1Q67A

Crystal structure of dcp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
146
Chain Sequence
LNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decapping protein involved in mRNA degradation-Dcp1p
publication title Crystal structure of Dcp1p and its functional implications in mRNA decapping
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 36
structure length 146
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1q67A01
1XX0A 1SHCA 5C16A 1NTYA 2CAYA 3FM8C 2ZPYA 3ODOA 2YS1A 2LOXA 1PLSA 3SV1A 1X86A 3QBVB 2DX5A 4K2OA 5HE2A 1XR0B 2UZRA 1NU2A 5DHAB 4YL8A 3UZTA 3G9WA 1I7AA 2DN6A 1GG3A 2I1KA 2COCA 3KRXA 4BBKA 2P0FA 5JLJB 4EJNA 3D8DA 2MDXA 2Q13A 3CIKA 2I1JA 1EGXA 1OY2A 1DBHA 2KCJA 4IAPA 2ELBA 1V61A 3SNHA 4GMVA 2ROVA 2MFQA 3CXBB 1EAZA 2OQBA 1FAOA 4MK0A 2DFKA 1TJ6A 3V5WA 1WI1A 2R09A 3TO1A 2J0KA 4EKUA 2Y8GA 3FSSA 1XCGA 2DHIA 1E5WA 2W2XC 2CY5A 3F0WA 2YF0A 5C6RA 5FI1A 1SGHA 1UPRA 4A6KA 3MPXA 5D27A 1P3RA 1U5DA 1QC6A 2DHKA 3A98B 4GXBA 2LOZA 2DTCA 1WJMA 3QIJA 5LOPB 3M1IB 2R0DA 4KAXB 4WVFB 1IRSA 1M7RA 2CODA 3PG7A 5CLLB 5HE0A 1MK7B 1FHXA 3F5RA 2X18A 4CYEA 2CRFA 1DYNA 4HB2B 4Y94A 4B6HA 2H7EA 2L1CA 5CLQB 2DKPA 2J0MA 4XWXA 2EC1A 3AJ4A 2N23A 4KVGB 2COFA 2D9XA 3A8QA 1DDWA 1K5GB 2D9YA 3KRWA 1X05A 2GS0A 3TVVA 1N3HA 5D3VA 5FI0A 4ZRJA 1J0WA 4A6HA 2DYNA 1BTNA 4IFSA 3WYFB 3GYPA 1V5PA 3FEHA 4C0AA 2GCJA 4NSWA 3PSCA 2RGNB 1OQNA 2K00A 2YSZA 3D8FA 4IOYX 2LG1A 3TW1A 5DHFB 1U27A 4F7UP 2VKIA 2NZ8B 1BWNA 1K5DB 1TQZA 1WVHA 1UEFA 1U5FA 2K2UA 1Y5OA 1NTVA 3N7CA 4CHMA 3GYOA 4HAUB 3AU4A 2EJ8A 5DIFB 1MIZB 1XD4A 2COAA 3ZDTA 5D3WA 2EMTA 3DXCA 1Q67A 5J3QA 4NY0A 5J3YA 2YRYA 2UVMA 4A5KA 4HATB 3KY9A 4GZUA 1BTKA 3TFMA 1KZ7A 4H8SA 4WSFA 4DXAB 1DDVA 2J59M 1AQCA 1LB1A 1WJ1A 3U7DA 2D11A 4HAZB 4DX90 3SO6A 4HAVB 1W1HA 1WGQA 4F7HA 1XKEA 3VOQA 1PMSA 2JP2A 5C79A 3P7ZA 3ODXA 2HE7A 4HAYB 2CY4A 2Z0QA 4PQ0A 2BCJA 4KHOA 1WGUA 3IVFA 1DDMA 1NI2A 2MWNB 2Z0PA 1P5TA 1MK9B 1U29A 1WG7A 2RLOA 2YVCA 5D3YA 2YS3A 1P6SA 2GCLA 3U8ZA 2LYDA 2P0HA 5D3XA 1MAIA 2IYBA 2AEHA 5DI9B 4KHBB 3AU5A 4Z2MB 3PVWA 4A6FA 1B55A 3NSUA 1ZC4B 1KZGA 1X1FA 1I2HA 4HDQA 3ULCA 1ZSQA 3PVLA 4PNKA 1OMWA 2YS5A 2D4QA 2KUPA 1BAKA 2P8VA 2Y7BA 3KZ1A 5GOWB 5DH9B 2DYQA 5C5BA 4A6FB 1ZC3B 1V5MA 2EMSA 3SYXA 4ZRKA 1UPQA 3HW2B 1GC6A 1X11A 2MKRA 3ZVRA 5KQ1A 2M38A 1X1GA 4HB3B 2D9WA 5HE1A 2W2XD 4DX8A 2PZ1A 2ADZA 5LONB 4HHVA 3ODWA 3MDBC 3RCPA 3O96A 4CHJA 4D0NB 2VRWB 4HB0B 3P6AA 4MT7A 4HAXB 2LKOA 1UNPA 2RUKB 3SUZA 2IFSA 3PVUA 2ELAA 2QKMA 3D8EA 3ULBA 1FHWA 2G35A 4TYZA 1GC7A 1FGZA 1U2BA 3PZDA 4Z2NA 2FJLA 2RNRB 4WJ7A 2YT0A 3ML4A 2Y8FA 2J0JA 1UNRA 2I5FA 1PFJA 1KI1B 5KCVA 2KGXB 2I5CA 2DLWA 3KSYA 4KHAA 2D9ZA 3T06A 1DROA 2AL6A 2QKLA 2XQNM 3A8PA 4L6EA 3QWMA 2V76A 1U5GA 2OTXA 3BJIA 1LW3A 2ROZB 1MIXA 1FGYA 1FHOA 4EMOA 1EF1A 5JHGA 4YONA 1XODA 1V88A 2DHJA 4HB4B 4K2PA 2NMBA 5J3TA 5HE3A 4GMXB 1H4RA 3DXEA 2D10A 1RJ2A 1U5EA 1Y19B 1ZVRA 1FOEA 4ZRIA 1W1GA 1FB8A 3OANA 5KQ4A 2RVBB 1W1DA 5L81A 2DKQA 1V5UA 2N0YA 2Z0OA 2E2XA 2RSGA 1ZM0A 3PP2A 4F7GA 4HDOA 2VSZA 3VIAA 3X23A 1TXDA 3BINA 3HK0A 5JHHA 1UNQA 2L2IA 2DA0A 3WA0A 4TKNA 3DXDA 2D9VA 2UZSA 2YT1A 3TCAA 2D2QA 2GJYA 4P7IA 2W2WA 1M7EA 1J19A 1EVHA 5JP4A 1MKEA 4HAWB 2H7DA 2K2JA 1RRPB 2LULA 4GPTB 4K17A 1V89A 1H10A 4MY6A 3HQCA 4K81A 5C5BB 4GN1A 5EFXA 1QQGA 2HTHB 1Z87A 1ISNA 3PEGA 2DX1A 4DBBA 2M14A 2P0DA 1MPHA 3LJUX 1AWEA
chains in the Genus database with same CATH superfamily
1XX0A 1SHCA 5C16A 1NTYA 2CAYA 3FM8C 2ZPYA 3ODOA 2YS1A 2LOXA 1PLSA 3SV1A 1X86A 3QBVB 2DX5A 4K2OA 5HE2A 1XR0B 2UZRA 1NU2A 5DHAB 4YL8A 3UZTA 4GNKB 3FVCA 3G9WA 1I7AA 2DN6A 1GG3A 2I1KA 2COCA 3KRXA 4BBKA 2P0FA 5JLJB 4EJNA 3D8DA 2MDXA 2Q13A 3CIKA 2I1JA 1EGXA 1OY2A 1DBHA 2KCJA 4DIXA 4IAPA 2ELBA 1V61A 3SNHA 4GMVA 2ROVA 4CSQA 2MFQA 3CXBB 1EAZA 2OQBA 1FAOA 4MK0A 2DFKA 1TJ6A 3V5WA 1WI1A 2R09A 3TO1A 2J0KA 4EKUA 2Y8GA 3FSSA 1XCGA 2DHIA 1E5WA 2W2XC 2CY5A 3F0WA 2YF0A 5C6RA 3B77A 5FI1A 1SGHA 1UPRA 4A6KA 3MPXA 5D27A 1P3RA 1U5DA 2KIEA 1QC6A 2DHKA 3A98B 4GXBA 2LOZA 2DTCA 1WJMA 3QIJA 5LOPB 3M1IB 2R0DA 4KHBA 4QJ3B 4KAXB 4WVFB 1IRSA 1M7RA 2CODA 3PG7A 5CLLB 5HE0A 1MK7B 1FHXA 3F5RA 2X18A 4CYEA 2CRFA 1DYNA 4HB2B 4Y94A 4B6HA 2H7EA 2L1CA 5CLQB 2DKPA 2J0MA 4XWXA 2EC1A 3AJ4A 2N23A 4KVGB 3A58A 2COFA 2D9XA 3A8QA 1DDWA 4QXAB 1K5GB 2D9YA 3KRWA 1X05A 2GS0A 3TVVA 1N3HA 5D3VA 5FI0A 3NW8A 4ZRJA 1J0WA 4A6HA 2DYNA 1BTNA 4IFSA 3WYFB 4OT1A 3GYPA 1V5PA 3FEHA 4C0AA 2GCJA 4NSWA 3PSCA 2NBVA 2RGNB 1OQNA 2K00A 2YSZA 3U12A 3D8FA 4IOYX 2LG1A 3TW1A 5DHFB 1U27A 4D6WA 4F7UP 2VKIA 2NZ8B 1BWNA 1K5DB 1TQZA 1WVHA 1UEFA 1U5FA 2K2UA 1Y5OA 1NTVA 3N7CA 3NWDA 4CHMA 3GYOA 4HAUB 3AU4A 2EJ8A 2FJUB 5DIFB 1MIZB 2R2YA 1XD4A 2COAA 3ZDTA 5D3WA 2EMTA 5LG4B 3DXCA 1Q67A 5J3QA 4NY0A 5J3YA 2YRYA 2K8EA 2UVMA 4A5KA 4HATB 3KY9A 4GZUA 1BTKA 3TFMA 1KZ7A 4H8SA 4WSFA 4DXAB 1DDVA 2J59M 1AQCA 1LB1A 1WJ1A 2YT2A 3U7DA 2D11A 4HAZB 1ZYIA 4DX90 4L1RA 3SO6A 4HAVB 1W1HA 1WGQA 4F7HA 1XKEA 3VOQA 1PMSA 2JP2A 2ZKMX 5C79A 3P7ZA 3ODXA 2HE7A 4HAYB 2CY4A 2Z0QA 4PQ0A 2BCJA 4KHOA 1WGUA 3IVFA 1DDMA 1NI2A 2MWNB 2Z0PA 1P5TA 1MK9B 1U29A 1WG7A 2RLOA 2YVCA 5D3YA 2YS3A 1P6SA 2RRFA 2GCLA 2Z4DA 3U8ZA 2LYDA 2P0HA 5D3XA 1MAIA 3NWFA 2IYBA 2AEHA 2Z13A 5DI9B 4KHBB 3AU5A 4Z2MB 3PVWA 4A6FA 5I2SA 3HSAA 1B55A 3NSUA 1ZC4B 1KZGA 1X1FA 1I2HA 4HDQA 3ULCA 1ZSQA 3PVLA 4PNKA 1OMWA 2YS5A 2D4QA 2KUPA 1BAKA 2P8VA 2Y7BA 3OHMB 3KZ1A 5GOWB 5DH9B 2DYQA 5C5BA 4A6FB 1ZC3B 1V5MA 2EMSA 3SYXA 4ZRKA 1UPQA 3HW2B 1GC6A 1X11A 2MKRA 3ZVRA 5KQ1A 2M38A 1X1GA 4HB3B 2D9WA 5HE1A 2W2XD 4DX8A 2PZ1A 2ADZA 5LONB 4HHVA 5I2MA 3ODWA 3MDBC 3RCPA 3O96A 4CHJA 4D0NB 2VRWB 4HB0B 3P6AA 4MT7A 4HAXB 2LKOA 1UNPA 2RUKB 3SUZA 2KR0A 2IFSA 3PVUA 2KUQA 2ELAA 2QKMA 4GOUA 3D8EA 3ULBA 1FHWA 2G35A 4TYZA 1GC7A 1FGZA 1U2BA 3PZDA 4Z2NA 2FJLA 2RNRB 4WJ7A 2YT0A 3ML4A 2Y8FA 2J0JA 1UNRA 2I5FA 1PFJA 1KI1B 5KCVA 2KGXB 2I5CA 2DLWA 3KSYA 4KHAA 2D9ZA 3T06A 3HIEA 1DROA 2AL6A 2QKLA 2XQNM 3A8PA 4L6EA 1MI1A 3QWMA 5IRSA 2V76A 1U5GA 2OTXA 3BJIA 1LW3A 3NWAA 2ROZB 1MIXA 4QJ5B 1FGYA 1FHOA 4EMOA 1EF1A 4OSNA 5JHGA 4YONA 1XODA 1V88A 2DHJA 4HB4B 4K2PA 2NMBA 5J3TA 5HE3A 4GMXB 1H4RA 2KIGA 3DXEA 2D10A 1RJ2A 1U5EA 1Y19B 1ZVRA 1FOEA 4ZRIA 1W1GA 1FB8A 3OANA 5KQ4A 2RVBB 4QJ4B 1W1DA 5L81A 4HSIA 2DKQA 1V5UA 2N0YA 2Z0OA 2E2XA 2RSGA 1ZM0A 3PP2A 4F7GA 4HDOA 2VSZA 3VIAA 2K49A 3X23A 1TXDA 3BINA 3HK0A 5JHHA 1UNQA 2L2IA 2Z14A 2DA0A 3WA0A 4TKNA 3DXDA 2D9VA 2GUMA 2UZSA 2YT1A 2Z59A 2D2QA 2GJYA 3TCAA 4P7IA 2W2WA 1M7EA 1J19A 1EVHA 5JP4A 1MKEA 4HAWB 2H7DA 2K2JA 1RRPB 2LULA 4GPTB 4K17A 3DCXA 1V89A 1H10A 4MY6A 3HQCA 5M4YB 4K81A 5C5BB 4GN1A 5EFXA 1QQGA 2HTHB 1Z87A 1ISNA 3PEGA 2DX1A 4DBBA 2M14A 2P0DA 1MPHA 1T77A 3LJUX 1AWEA
chains in the Genus database with same CATH topology
1XX0A 1SHCA 5C16A 1NTYA 2CAYA 3FM8C 2ZPYA 3ODOA 2YS1A 2LOXA 1PLSA 3SV1A 1X86A 3QBVB 2DX5A 4K2OA 5HE2A 1XR0B 2UZRA 1NU2A 5DHAB 4YL8A 3UZTA 3G9WA 1I7AA 2DN6A 1GG3A 2I1KA 2COCA 3KRXA 4BBKA 2P0FA 5JLJB 4EJNA 3D8DA 2MDXA 2Q13A 3CIKA 2I1JA 1EGXA 1OY2A 1DBHA 2KCJA 4IAPA 2ELBA 1V61A 3SNHA 4GMVA 2ROVA 2MFQA 3CXBB 1EAZA 2OQBA 1FAOA 4MK0A 2DFKA 1TJ6A 3V5WA 1WI1A 2R09A 3TO1A 2J0KA 4EKUA 2Y8GA 3FSSA 1XCGA 2DHIA 1E5WA 2W2XC 2CY5A 3F0WA 2YF0A 5C6RA 5FI1A 1SGHA 1UPRA 4A6KA 3MPXA 5D27A 1P3RA 1U5DA 1QC6A 2DHKA 3A98B 4GXBA 2LOZA 2DTCA 1WJMA 3QIJA 5LOPB 3M1IB 2R0DA 4KAXB 4WVFB 1IRSA 1M7RA 2CODA 3PG7A 5CLLB 5HE0A 1MK7B 1FHXA 3F5RA 2X18A 4CYEA 2CRFA 1DYNA 4HB2B 4Y94A 4B6HA 2H7EA 2L1CA 5CLQB 2DKPA 2J0MA 4XWXA 2EC1A 3AJ4A 2N23A 4KVGB 2COFA 2D9XA 3A8QA 1DDWA 1K5GB 2D9YA 3KRWA 1X05A 2GS0A 3TVVA 1N3HA 5D3VA 5FI0A 4ZRJA 1J0WA 4A6HA 2DYNA 1BTNA 4IFSA 3WYFB 3GYPA 1V5PA 3FEHA 4C0AA 2GCJA 4NSWA 3PSCA 2RGNB 1OQNA 2K00A 2YSZA 3D8FA 4IOYX 2LG1A 3TW1A 5DHFB 1U27A 4F7UP 2VKIA 2NZ8B 1BWNA 1K5DB 1TQZA 1WVHA 1UEFA 1U5FA 2K2UA 1Y5OA 1NTVA 3N7CA 4CHMA 3GYOA 4HAUB 3AU4A 2EJ8A 5DIFB 1MIZB 1XD4A 2COAA 3ZDTA 5D3WA 2EMTA 3DXCA 1Q67A 5J3QA 4NY0A 5J3YA 2YRYA 2UVMA 4A5KA 4HATB 3KY9A 4GZUA 1BTKA 3TFMA 1KZ7A 4H8SA 4WSFA 4DXAB 1DDVA 2J59M 1AQCA 1LB1A 1WJ1A 3U7DA 2D11A 4HAZB 4DX90 3SO6A 4HAVB 1W1HA 1WGQA 4F7HA 1XKEA 3VOQA 1PMSA 2JP2A 5C79A 3P7ZA 3ODXA 2HE7A 4HAYB 2CY4A 2Z0QA 4PQ0A 2BCJA 4KHOA 1WGUA 3IVFA 1DDMA 1NI2A 2MWNB 2Z0PA 1P5TA 1MK9B 1U29A 1WG7A 2RLOA 2YVCA 5D3YA 2YS3A 1P6SA 2GCLA 3U8ZA 2LYDA 2P0HA 5D3XA 1MAIA 2IYBA 2AEHA 5DI9B 4KHBB 3AU5A 4Z2MB 3PVWA 4A6FA 1B55A 3NSUA 1ZC4B 1KZGA 1X1FA 1I2HA 4HDQA 3ULCA 1ZSQA 3PVLA 4PNKA 1OMWA 2YS5A 2D4QA 2KUPA 1BAKA 2P8VA 2Y7BA 3KZ1A 5GOWB 5DH9B 2DYQA 5C5BA 4A6FB 1ZC3B 1V5MA 2EMSA 3SYXA 4ZRKA 1UPQA 3HW2B 1GC6A 1X11A 2MKRA 3ZVRA 5KQ1A 2M38A 1X1GA 4HB3B 2D9WA 5HE1A 2W2XD 4DX8A 2PZ1A 2ADZA 5LONB 4HHVA 3ODWA 3MDBC 3RCPA 3O96A 4CHJA 4D0NB 2VRWB 4HB0B 3P6AA 4MT7A 4HAXB 2LKOA 1UNPA 2RUKB 3SUZA 2IFSA 3PVUA 2ELAA 2QKMA 3D8EA 3ULBA 1FHWA 2G35A 4TYZA 1GC7A 1FGZA 1U2BA 3PZDA 4Z2NA 2FJLA 2RNRB 4WJ7A 2YT0A 3ML4A 2Y8FA 2J0JA 1UNRA 2I5FA 1PFJA 1KI1B 5KCVA 2KGXB 2I5CA 2DLWA 3KSYA 4KHAA 2D9ZA 3T06A 1DROA 2AL6A 2QKLA 2XQNM 3A8PA 4L6EA 3QWMA 2V76A 1U5GA 2OTXA 3BJIA 1LW3A 2ROZB 1MIXA 1FGYA 1FHOA 4EMOA 1EF1A 5JHGA 4YONA 1XODA 1V88A 2DHJA 4HB4B 4K2PA 2NMBA 5J3TA 5HE3A 4GMXB 1H4RA 3DXEA 2D10A 1RJ2A 1U5EA 1Y19B 1ZVRA 1FOEA 4ZRIA 1W1GA 1FB8A 3OANA 5KQ4A 2RVBB 1W1DA 5L81A 2DKQA 1V5UA 2N0YA 2Z0OA 2E2XA 2RSGA 1ZM0A 3PP2A 4F7GA 4HDOA 2VSZA 3VIAA 3X23A 1TXDA 3BINA 3HK0A 5JHHA 1UNQA 2L2IA 2DA0A 3WA0A 4TKNA 3DXDA 2D9VA 2UZSA 2YT1A 3TCAA 2D2QA 2GJYA 4P7IA 2W2WA 1M7EA 1J19A 1EVHA 5JP4A 1MKEA 4HAWB 2H7DA 2K2JA 1RRPB 2LULA 4GPTB 4K17A 1V89A 1H10A 4MY6A 3HQCA 4K81A 5C5BB 4GN1A 5EFXA 1QQGA 2HTHB 1Z87A 1ISNA 3PEGA 2DX1A 4DBBA 2M14A 2P0DA 1MPHA 3LJUX 1AWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX0 A;  1SHC A;  5C16 A;  1NTY A;  2CAY A;  3FM8 C;  2ZPY A;  3ODO A;  2YS1 A;  2LOX A;  1PLS A;  3SV1 A;  1X86 A;  3QBV B;  2DX5 A;  4K2O A;  5HE2 A;  1XR0 B;  2UZR A;  1NU2 A;  5DHA B;  4YL8 A;  3UZT A;  3G9W A;  1I7A A;  2DN6 A;  1GG3 A;  2I1K A;  2COC A;  3KRX A;  4BBK A;  2P0F A;  5JLJ B;  4EJN A;  3D8D A;  2MDX A;  2Q13 A;  3CIK A;  2I1J A;  1EGX A;  1OY2 A;  1DBH A;  2KCJ A;  4IAP A;  2ELB A;  1V61 A;  3SNH A;  4GMV A;  2ROV A;  2MFQ A;  3CXB B;  1EAZ A;  2OQB A;  1FAO A;  4MK0 A;  2DFK A;  1TJ6 A;  3V5W A;  1WI1 A;  2R09 A;  3TO1 A;  2J0K A;  4EKU A;  2Y8G A;  3FSS A;  1XCG A;  2DHI A;  1E5W A;  2W2X C;  2CY5 A;  3F0W A;  2YF0 A;  5C6R A;  5FI1 A;  1SGH A;  1UPR A;  4A6K A;  3MPX A;  5D27 A;  1P3R A;  1U5D A;  1QC6 A;  2DHK A;  3A98 B;  4GXB A;  2LOZ A;  2DTC A;  1WJM A;  3QIJ A;  5LOP B;  3M1I B;  2R0D A;  4KAX B;  4WVF B;  1IRS A;  1M7R A;  2COD A;  3PG7 A;  5CLL B;  5HE0 A;  1MK7 B;  1FHX A;  3F5R A;  2X18 A;  4CYE A;  2CRF A;  1DYN A;  4HB2 B;  4Y94 A;  4B6H A;  2H7E A;  2L1C A;  5CLQ B;  2DKP A;  2J0M A;  4XWX A;  2EC1 A;  3AJ4 A;  2N23 A;  4KVG B;  2COF A;  2D9X A;  3A8Q A;  1DDW A;  1K5G B;  2D9Y A;  3KRW A;  1X05 A;  2GS0 A;  3TVV A;  1N3H A;  5D3V A;  5FI0 A;  4ZRJ A;  1J0W A;  4A6H A;  2DYN A;  1BTN A;  4IFS A;  3WYF B;  3GYP A;  1V5P A;  3FEH A;  4C0A A;  2GCJ A;  4NSW A;  3PSC A;  2RGN B;  1OQN A;  2K00 A;  2YSZ A;  3D8F A;  4IOY X;  2LG1 A;  3TW1 A;  5DHF B;  1U27 A;  4F7U P;  2VKI A;  2NZ8 B;  1BWN A;  1K5D B;  1TQZ A;  1WVH A;  1UEF A;  1U5F A;  2K2U A;  1Y5O A;  1NTV A;  3N7C A;  4CHM A;  3GYO A;  4HAU B;  3AU4 A;  2EJ8 A;  5DIF B;  1MIZ B;  1XD4 A;  2COA A;  3ZDT A;  5D3W A;  2EMT A;  3DXC A;  1Q67 A;  5J3Q A;  4NY0 A;  5J3Y A;  2YRY A;  2UVM A;  4A5K A;  4HAT B;  3KY9 A;  4GZU A;  1BTK A;  3TFM A;  1KZ7 A;  4H8S A;  4WSF A;  4DXA B;  1DDV A;  2J59 M;  1AQC A;  1LB1 A;  1WJ1 A;  3U7D A;  2D11 A;  4HAZ B;  4DX9 0;  3SO6 A;  4HAV B;  1W1H A;  1WGQ A;  4F7H A;  1XKE A;  3VOQ A;  1PMS A;  2JP2 A;  5C79 A;  3P7Z A;  3ODX A;  2HE7 A;  4HAY B;  2CY4 A;  2Z0Q A;  4PQ0 A;  2BCJ A;  4KHO A;  1WGU A;  3IVF A;  1DDM A;  1NI2 A;  2MWN B;  2Z0P A;  1P5T A;  1MK9 B;  1U29 A;  1WG7 A;  2RLO A;  2YVC A;  5D3Y A;  2YS3 A;  1P6S A;  2GCL A;  3U8Z A;  2LYD A;  2P0H A;  5D3X A;  1MAI A;  2IYB A;  2AEH A;  5DI9 B;  4KHB B;  3AU5 A;  4Z2M B;  3PVW A;  4A6F A;  1B55 A;  3NSU A;  1ZC4 B;  1KZG A;  1X1F A;  1I2H A;  4HDQ A;  3ULC A;  1ZSQ A;  3PVL A;  4PNK A;  1OMW A;  2YS5 A;  2D4Q A;  2KUP A;  1BAK A;  2P8V A;  2Y7B A;  3KZ1 A;  5GOW B;  5DH9 B;  2DYQ A;  5C5B A;  4A6F B;  1ZC3 B;  1V5M A;  2EMS A;  3SYX A;  4ZRK A;  1UPQ A;  3HW2 B;  1GC6 A;  1X11 A;  2MKR A;  3ZVR A;  5KQ1 A;  2M38 A;  1X1G A;  4HB3 B;  2D9W A;  5HE1 A;  2W2X D;  4DX8 A;  2PZ1 A;  2ADZ A;  5LON B;  4HHV A;  3ODW A;  3MDB C;  3RCP A;  3O96 A;  4CHJ A;  4D0N B;  2VRW B;  4HB0 B;  3P6A A;  4MT7 A;  4HAX B;  2LKO A;  1UNP A;  2RUK B;  3SUZ A;  2IFS A;  3PVU A;  2ELA A;  2QKM A;  3D8E A;  3ULB A;  1FHW A;  2G35 A;  4TYZ A;  1GC7 A;  1FGZ A;  1U2B A;  3PZD A;  4Z2N A;  2FJL A;  2RNR B;  4WJ7 A;  2YT0 A;  3ML4 A;  2Y8F A;  2J0J A;  1UNR A;  2I5F A;  1PFJ A;  1KI1 B;  5KCV A;  2KGX B;  2I5C A;  2DLW A;  3KSY A;  4KHA A;  2D9Z A;  3T06 A;  1DRO A;  2AL6 A;  2QKL A;  2XQN M;  3A8P A;  4L6E A;  3QWM A;  2V76 A;  1U5G A;  2OTX A;  3BJI A;  1LW3 A;  2ROZ B;  1MIX A;  1FGY A;  1FHO A;  4EMO A;  1EF1 A;  5JHG A;  4YON A;  1XOD A;  1V88 A;  2DHJ A;  4HB4 B;  4K2P A;  2NMB A;  5J3T A;  5HE3 A;  4GMX B;  1H4R A;  3DXE A;  2D10 A;  1RJ2 A;  1U5E A;  1Y19 B;  1ZVR A;  1FOE A;  4ZRI A;  1W1G A;  1FB8 A;  3OAN A;  5KQ4 A;  2RVB B;  1W1D A;  5L81 A;  2DKQ A;  1V5U A;  2N0Y A;  2Z0O A;  2E2X A;  2RSG A;  1ZM0 A;  3PP2 A;  4F7G A;  4HDO A;  2VSZ A;  3VIA A;  3X23 A;  1TXD A;  3BIN A;  3HK0 A;  5JHH A;  1UNQ A;  2L2I A;  2DA0 A;  3WA0 A;  4TKN A;  3DXD A;  2D9V A;  2UZS A;  2YT1 A;  3TCA A;  2D2Q A;  2GJY A;  4P7I A;  2W2W A;  1M7E A;  1J19 A;  1EVH A;  5JP4 A;  1MKE A;  4HAW B;  2H7D A;  2K2J A;  1RRP B;  2LUL A;  4GPT B;  4K17 A;  1V89 A;  1H10 A;  4MY6 A;  3HQC A;  4K81 A;  5C5B B;  4GN1 A;  5EFX A;  1QQG A;  2HTH B;  1Z87 A;  1ISN A;  3PEG A;  2DX1 A;  4DBB A;  2M14 A;  2P0D A;  1MPH A;  3LJU X;  1AWE A; 
#chains in the Genus database with same CATH topology
 1XX0 A;  1SHC A;  5C16 A;  1NTY A;  2CAY A;  3FM8 C;  2ZPY A;  3ODO A;  2YS1 A;  2LOX A;  1PLS A;  3SV1 A;  1X86 A;  3QBV B;  2DX5 A;  4K2O A;  5HE2 A;  1XR0 B;  2UZR A;  1NU2 A;  5DHA B;  4YL8 A;  3UZT A;  4GNK B;  3FVC A;  3G9W A;  1I7A A;  2DN6 A;  1GG3 A;  2I1K A;  2COC A;  3KRX A;  4BBK A;  2P0F A;  5JLJ B;  4EJN A;  3D8D A;  2MDX A;  2Q13 A;  3CIK A;  2I1J A;  1EGX A;  1OY2 A;  1DBH A;  2KCJ A;  4DIX A;  4IAP A;  2ELB A;  1V61 A;  3SNH A;  4GMV A;  2ROV A;  4CSQ A;  2MFQ A;  3CXB B;  1EAZ A;  2OQB A;  1FAO A;  4MK0 A;  2DFK A;  1TJ6 A;  3V5W A;  1WI1 A;  2R09 A;  3TO1 A;  2J0K A;  4EKU A;  2Y8G A;  3FSS A;  1XCG A;  2DHI A;  1E5W A;  2W2X C;  2CY5 A;  3F0W A;  2YF0 A;  5C6R A;  3B77 A;  5FI1 A;  1SGH A;  1UPR A;  4A6K A;  3MPX A;  5D27 A;  1P3R A;  1U5D A;  2KIE A;  1QC6 A;  2DHK A;  3A98 B;  4GXB A;  2LOZ A;  2DTC A;  1WJM A;  3QIJ A;  5LOP B;  3M1I B;  2R0D A;  4KHB A;  4QJ3 B;  4KAX B;  4WVF B;  1IRS A;  1M7R A;  2COD A;  3PG7 A;  5CLL B;  5HE0 A;  1MK7 B;  1FHX A;  3F5R A;  2X18 A;  4CYE A;  2CRF A;  1DYN A;  4HB2 B;  4Y94 A;  4B6H A;  2H7E A;  2L1C A;  5CLQ B;  2DKP A;  2J0M A;  4XWX A;  2EC1 A;  3AJ4 A;  2N23 A;  4KVG B;  3A58 A;  2COF A;  2D9X A;  3A8Q A;  1DDW A;  4QXA B;  1K5G B;  2D9Y A;  3KRW A;  1X05 A;  2GS0 A;  3TVV A;  1N3H A;  5D3V A;  5FI0 A;  3NW8 A;  4ZRJ A;  1J0W A;  4A6H A;  2DYN A;  1BTN A;  4IFS A;  3WYF B;  4OT1 A;  3GYP A;  1V5P A;  3FEH A;  4C0A A;  2GCJ A;  4NSW A;  3PSC A;  2NBV A;  2RGN B;  1OQN A;  2K00 A;  2YSZ A;  3U12 A;  3D8F A;  4IOY X;  2LG1 A;  3TW1 A;  5DHF B;  1U27 A;  4D6W A;  4F7U P;  2VKI A;  2NZ8 B;  1BWN A;  1K5D B;  1TQZ A;  1WVH A;  1UEF A;  1U5F A;  2K2U A;  1Y5O A;  1NTV A;  3N7C A;  3NWD A;  4CHM A;  3GYO A;  4HAU B;  3AU4 A;  2EJ8 A;  2FJU B;  5DIF B;  1MIZ B;  2R2Y A;  1XD4 A;  2COA A;  3ZDT A;  5D3W A;  2EMT A;  5LG4 B;  3DXC A;  1Q67 A;  5J3Q A;  4NY0 A;  5J3Y A;  2YRY A;  2K8E A;  2UVM A;  4A5K A;  4HAT B;  3KY9 A;  4GZU A;  1BTK A;  3TFM A;  1KZ7 A;  4H8S A;  4WSF A;  4DXA B;  1DDV A;  2J59 M;  1AQC A;  1LB1 A;  1WJ1 A;  2YT2 A;  3U7D A;  2D11 A;  4HAZ B;  1ZYI A;  4DX9 0;  4L1R A;  3SO6 A;  4HAV B;  1W1H A;  1WGQ A;  4F7H A;  1XKE A;  3VOQ A;  1PMS A;  2JP2 A;  2ZKM X;  5C79 A;  3P7Z A;  3ODX A;  2HE7 A;  4HAY B;  2CY4 A;  2Z0Q A;  4PQ0 A;  2BCJ A;  4KHO A;  1WGU A;  3IVF A;  1DDM A;  1NI2 A;  2MWN B;  2Z0P A;  1P5T A;  1MK9 B;  1U29 A;  1WG7 A;  2RLO A;  2YVC A;  5D3Y A;  2YS3 A;  1P6S A;  2RRF A;  2GCL A;  2Z4D A;  3U8Z A;  2LYD A;  2P0H A;  5D3X A;  1MAI A;  3NWF A;  2IYB A;  2AEH A;  2Z13 A;  5DI9 B;  4KHB B;  3AU5 A;  4Z2M B;  3PVW A;  4A6F A;  5I2S A;  3HSA A;  1B55 A;  3NSU A;  1ZC4 B;  1KZG A;  1X1F A;  1I2H A;  4HDQ A;  3ULC A;  1ZSQ A;  3PVL A;  4PNK A;  1OMW A;  2YS5 A;  2D4Q A;  2KUP A;  1BAK A;  2P8V A;  2Y7B A;  3OHM B;  3KZ1 A;  5GOW B;  5DH9 B;  2DYQ A;  5C5B A;  4A6F B;  1ZC3 B;  1V5M A;  2EMS A;  3SYX A;  4ZRK A;  1UPQ A;  3HW2 B;  1GC6 A;  1X11 A;  2MKR A;  3ZVR A;  5KQ1 A;  2M38 A;  1X1G A;  4HB3 B;  2D9W A;  5HE1 A;  2W2X D;  4DX8 A;  2PZ1 A;  2ADZ A;  5LON B;  4HHV A;  5I2M A;  3ODW A;  3MDB C;  3RCP A;  3O96 A;  4CHJ A;  4D0N B;  2VRW B;  4HB0 B;  3P6A A;  4MT7 A;  4HAX B;  2LKO A;  1UNP A;  2RUK B;  3SUZ A;  2KR0 A;  2IFS A;  3PVU A;  2KUQ A;  2ELA A;  2QKM A;  4GOU A;  3D8E A;  3ULB A;  1FHW A;  2G35 A;  4TYZ A;  1GC7 A;  1FGZ A;  1U2B A;  3PZD A;  4Z2N A;  2FJL A;  2RNR B;  4WJ7 A;  2YT0 A;  3ML4 A;  2Y8F A;  2J0J A;  1UNR A;  2I5F A;  1PFJ A;  1KI1 B;  5KCV A;  2KGX B;  2I5C A;  2DLW A;  3KSY A;  4KHA A;  2D9Z A;  3T06 A;  3HIE A;  1DRO A;  2AL6 A;  2QKL A;  2XQN M;  3A8P A;  4L6E A;  1MI1 A;  3QWM A;  5IRS A;  2V76 A;  1U5G A;  2OTX A;  3BJI A;  1LW3 A;  3NWA A;  2ROZ B;  1MIX A;  4QJ5 B;  1FGY A;  1FHO A;  4EMO A;  1EF1 A;  4OSN A;  5JHG A;  4YON A;  1XOD A;  1V88 A;  2DHJ A;  4HB4 B;  4K2P A;  2NMB A;  5J3T A;  5HE3 A;  4GMX B;  1H4R A;  2KIG A;  3DXE A;  2D10 A;  1RJ2 A;  1U5E A;  1Y19 B;  1ZVR A;  1FOE A;  4ZRI A;  1W1G A;  1FB8 A;  3OAN A;  5KQ4 A;  2RVB B;  4QJ4 B;  1W1D A;  5L81 A;  4HSI A;  2DKQ A;  1V5U A;  2N0Y A;  2Z0O A;  2E2X A;  2RSG A;  1ZM0 A;  3PP2 A;  4F7G A;  4HDO A;  2VSZ A;  3VIA A;  2K49 A;  3X23 A;  1TXD A;  3BIN A;  3HK0 A;  5JHH A;  1UNQ A;  2L2I A;  2Z14 A;  2DA0 A;  3WA0 A;  4TKN A;  3DXD A;  2D9V A;  2GUM A;  2UZS A;  2YT1 A;  2Z59 A;  2D2Q A;  2GJY A;  3TCA A;  4P7I A;  2W2W A;  1M7E A;  1J19 A;  1EVH A;  5JP4 A;  1MKE A;  4HAW B;  2H7D A;  2K2J A;  1RRP B;  2LUL A;  4GPT B;  4K17 A;  3DCX A;  1V89 A;  1H10 A;  4MY6 A;  3HQC A;  5M4Y B;  4K81 A;  5C5B B;  4GN1 A;  5EFX A;  1QQG A;  2HTH B;  1Z87 A;  1ISN A;  3PEG A;  2DX1 A;  4DBB A;  2M14 A;  2P0D A;  1MPH A;  1T77 A;  3LJU X;  1AWE A; 
#chains in the Genus database with same CATH homology
 1XX0 A;  1SHC A;  5C16 A;  1NTY A;  2CAY A;  3FM8 C;  2ZPY A;  3ODO A;  2YS1 A;  2LOX A;  1PLS A;  3SV1 A;  1X86 A;  3QBV B;  2DX5 A;  4K2O A;  5HE2 A;  1XR0 B;  2UZR A;  1NU2 A;  5DHA B;  4YL8 A;  3UZT A;  3G9W A;  1I7A A;  2DN6 A;  1GG3 A;  2I1K A;  2COC A;  3KRX A;  4BBK A;  2P0F A;  5JLJ B;  4EJN A;  3D8D A;  2MDX A;  2Q13 A;  3CIK A;  2I1J A;  1EGX A;  1OY2 A;  1DBH A;  2KCJ A;  4IAP A;  2ELB A;  1V61 A;  3SNH A;  4GMV A;  2ROV A;  2MFQ A;  3CXB B;  1EAZ A;  2OQB A;  1FAO A;  4MK0 A;  2DFK A;  1TJ6 A;  3V5W A;  1WI1 A;  2R09 A;  3TO1 A;  2J0K A;  4EKU A;  2Y8G A;  3FSS A;  1XCG A;  2DHI A;  1E5W A;  2W2X C;  2CY5 A;  3F0W A;  2YF0 A;  5C6R A;  5FI1 A;  1SGH A;  1UPR A;  4A6K A;  3MPX A;  5D27 A;  1P3R A;  1U5D A;  1QC6 A;  2DHK A;  3A98 B;  4GXB A;  2LOZ A;  2DTC A;  1WJM A;  3QIJ A;  5LOP B;  3M1I B;  2R0D A;  4KAX B;  4WVF B;  1IRS A;  1M7R A;  2COD A;  3PG7 A;  5CLL B;  5HE0 A;  1MK7 B;  1FHX A;  3F5R A;  2X18 A;  4CYE A;  2CRF A;  1DYN A;  4HB2 B;  4Y94 A;  4B6H A;  2H7E A;  2L1C A;  5CLQ B;  2DKP A;  2J0M A;  4XWX A;  2EC1 A;  3AJ4 A;  2N23 A;  4KVG B;  2COF A;  2D9X A;  3A8Q A;  1DDW A;  1K5G B;  2D9Y A;  3KRW A;  1X05 A;  2GS0 A;  3TVV A;  1N3H A;  5D3V A;  5FI0 A;  4ZRJ A;  1J0W A;  4A6H A;  2DYN A;  1BTN A;  4IFS A;  3WYF B;  3GYP A;  1V5P A;  3FEH A;  4C0A A;  2GCJ A;  4NSW A;  3PSC A;  2RGN B;  1OQN A;  2K00 A;  2YSZ A;  3D8F A;  4IOY X;  2LG1 A;  3TW1 A;  5DHF B;  1U27 A;  4F7U P;  2VKI A;  2NZ8 B;  1BWN A;  1K5D B;  1TQZ A;  1WVH A;  1UEF A;  1U5F A;  2K2U A;  1Y5O A;  1NTV A;  3N7C A;  4CHM A;  3GYO A;  4HAU B;  3AU4 A;  2EJ8 A;  5DIF B;  1MIZ B;  1XD4 A;  2COA A;  3ZDT A;  5D3W A;  2EMT A;  3DXC A;  1Q67 A;  5J3Q A;  4NY0 A;  5J3Y A;  2YRY A;  2UVM A;  4A5K A;  4HAT B;  3KY9 A;  4GZU A;  1BTK A;  3TFM A;  1KZ7 A;  4H8S A;  4WSF A;  4DXA B;  1DDV A;  2J59 M;  1AQC A;  1LB1 A;  1WJ1 A;  3U7D A;  2D11 A;  4HAZ B;  4DX9 0;  3SO6 A;  4HAV B;  1W1H A;  1WGQ A;  4F7H A;  1XKE A;  3VOQ A;  1PMS A;  2JP2 A;  5C79 A;  3P7Z A;  3ODX A;  2HE7 A;  4HAY B;  2CY4 A;  2Z0Q A;  4PQ0 A;  2BCJ A;  4KHO A;  1WGU A;  3IVF A;  1DDM A;  1NI2 A;  2MWN B;  2Z0P A;  1P5T A;  1MK9 B;  1U29 A;  1WG7 A;  2RLO A;  2YVC A;  5D3Y A;  2YS3 A;  1P6S A;  2GCL A;  3U8Z A;  2LYD A;  2P0H A;  5D3X A;  1MAI A;  2IYB A;  2AEH A;  5DI9 B;  4KHB B;  3AU5 A;  4Z2M B;  3PVW A;  4A6F A;  1B55 A;  3NSU A;  1ZC4 B;  1KZG A;  1X1F A;  1I2H A;  4HDQ A;  3ULC A;  1ZSQ A;  3PVL A;  4PNK A;  1OMW A;  2YS5 A;  2D4Q A;  2KUP A;  1BAK A;  2P8V A;  2Y7B A;  3KZ1 A;  5GOW B;  5DH9 B;  2DYQ A;  5C5B A;  4A6F B;  1ZC3 B;  1V5M A;  2EMS A;  3SYX A;  4ZRK A;  1UPQ A;  3HW2 B;  1GC6 A;  1X11 A;  2MKR A;  3ZVR A;  5KQ1 A;  2M38 A;  1X1G A;  4HB3 B;  2D9W A;  5HE1 A;  2W2X D;  4DX8 A;  2PZ1 A;  2ADZ A;  5LON B;  4HHV A;  3ODW A;  3MDB C;  3RCP A;  3O96 A;  4CHJ A;  4D0N B;  2VRW B;  4HB0 B;  3P6A A;  4MT7 A;  4HAX B;  2LKO A;  1UNP A;  2RUK B;  3SUZ A;  2IFS A;  3PVU A;  2ELA A;  2QKM A;  3D8E A;  3ULB A;  1FHW A;  2G35 A;  4TYZ A;  1GC7 A;  1FGZ A;  1U2B A;  3PZD A;  4Z2N A;  2FJL A;  2RNR B;  4WJ7 A;  2YT0 A;  3ML4 A;  2Y8F A;  2J0J A;  1UNR A;  2I5F A;  1PFJ A;  1KI1 B;  5KCV A;  2KGX B;  2I5C A;  2DLW A;  3KSY A;  4KHA A;  2D9Z A;  3T06 A;  1DRO A;  2AL6 A;  2QKL A;  2XQN M;  3A8P A;  4L6E A;  3QWM A;  2V76 A;  1U5G A;  2OTX A;  3BJI A;  1LW3 A;  2ROZ B;  1MIX A;  1FGY A;  1FHO A;  4EMO A;  1EF1 A;  5JHG A;  4YON A;  1XOD A;  1V88 A;  2DHJ A;  4HB4 B;  4K2P A;  2NMB A;  5J3T A;  5HE3 A;  4GMX B;  1H4R A;  3DXE A;  2D10 A;  1RJ2 A;  1U5E A;  1Y19 B;  1ZVR A;  1FOE A;  4ZRI A;  1W1G A;  1FB8 A;  3OAN A;  5KQ4 A;  2RVB B;  1W1D A;  5L81 A;  2DKQ A;  1V5U A;  2N0Y A;  2Z0O A;  2E2X A;  2RSG A;  1ZM0 A;  3PP2 A;  4F7G A;  4HDO A;  2VSZ A;  3VIA A;  3X23 A;  1TXD A;  3BIN A;  3HK0 A;  5JHH A;  1UNQ A;  2L2I A;  2DA0 A;  3WA0 A;  4TKN A;  3DXD A;  2D9V A;  2UZS A;  2YT1 A;  3TCA A;  2D2Q A;  2GJY A;  4P7I A;  2W2W A;  1M7E A;  1J19 A;  1EVH A;  5JP4 A;  1MKE A;  4HAW B;  2H7D A;  2K2J A;  1RRP B;  2LUL A;  4GPT B;  4K17 A;  1V89 A;  1H10 A;  4MY6 A;  3HQC A;  4K81 A;  5C5B B;  4GN1 A;  5EFX A;  1QQG A;  2HTH B;  1Z87 A;  1ISN A;  3PEG A;  2DX1 A;  4DBB A;  2M14 A;  2P0D A;  1MPH A;  3LJU X;  1AWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...