1Q67A

Crystal structure of dcp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
146
Chain Sequence
LNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Decapping protein involved in mRNA degradation-Dcp1p
publication title Crystal structure of Dcp1p and its functional implications in mRNA decapping
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 146
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1q67A01
1DDVA 2GCJA 4GMVA 4A6HA 2VSZA 3TW1A 4IAPA 4A6KA 1KI1B 1Q67A 4DXAB 1ZSQA 3G9WA 1QQGA 1DDWA 5C79A 3ULBA 1FOEA 3GYOA 5D3YA 1FHXA 3FEHA 4Y94A 1FAOA 1K5DB 2LKOA 3PVLA 2HE7A 2CY5A 5KQ1A 1V88A 2W2XD 1I2HA 2DKQA 3SYXA 2G35A 4HB4B 1ISNA 2ROZB 1SHCA 2VKIA 3OANA 1U2BA 1H10A 2Y7BA 3ULCA 4Z2MB 3N7CA 1OY2A 4CYEA 5JP4A 1BTKA 5CLLB 1TJ6A 2N0YA 5JHGA 2RGNB 1DYNA 2CRFA 3BJIA 1DDMA 4P7IA 2YS1A 3ODXA 4EMOA 3AU5A 1J0WA 2DX1A 3NSUA 2YVCA 5C5BA 5C5BB 2NZ8B 1Y5OA 4IFSA 3SO6A 2CAYA 3F5RA 1BTNA 3PG7A 4KHOA 4NSWA 2D10A 1XX0A 2DHJA 4K81A 2DKPA 2Y8GA 2ROVA 5LOPB 1OMWA 2RLOA 4HB0B 3A98B 2Z0OA 4HAZB 3RCPA 1NTYA 1U27A 2QKLA 2HTHB 4K2OA 1EGXA 4K2PA 2R0DA 4WVFB 1PFJA 1V5PA 1GC6A 3D8DA 3FM8C 2YSZA 2DFKA 2UVMA 2D9WA 2E2XA 3WYFB 2YS5A 2VRWB 2K00A 4TYZA 2W2XC 1UPRA 2IYBA 2YT1A 4HHVA 1EVHA 1OQNA 1EAZA 1XKEA 1KZ7A 2J0MA 4GXBA 2BCJA 2M38A 3KRWA 4MT7A 4EKUA 3DXDA 3P7ZA 4ZRIA 1X1GA 4BBKA 2RNRB 2KUPA 2P0HA 2D11A 2YS3A 2LOXA 4DX90 2CODA 5C6RA 3KY9A 3QIJA 3SV1A 3HW2B 3CIKA 2V76A 1PMSA 4Z2NA 4L6EA 2OTXA 1P5TA 1XODA 1WJMA 5DIFB 2D9VA 4NY0A 3AJ4A 1GG3A 2JP2A 3U8ZA 3ZDTA 3TCAA 3PEGA 3PVUA 2Z0QA 1UNQA 2R09A 5DHFB 1J19A 3U7DA 3D8EA 2J0JA 5JHHA 1U29A 4WSFA 4KVGB 4EJNA 5GOWB 3HQCA 2LYDA 2K2JA 1QC6A 1WG7A 3A8PA 1WJ1A 1MKEA 4KHBB 1FHWA 1UNRA 3X23A 4YL8A 4GPTB 5HE0A 1X05A 4HDOA 1UPQA 2MDXA 4A5KA 3VOQA 3TO1A 4WJ7A 1U5EA 1DBHA 3MPXA 2I5CA 3DXCA 5C16A 3KRXA 2EMTA 2YRYA 2KCJA 1WGQA 1DROA 1U5FA 1UNPA 3M1IB 1V89A 5D3XA 2N23A 5J3TA 1MAIA 5HE2A 1EF1A 1FHOA 4HAVB 1ZM0A 4F7HA 4B6HA 3PZDA 1N3HA 3QBVB 2DYQA 2YF0A 3AU4A 3QWMA 2FJLA 4IOYX 2DHIA 2ZPYA 4C0AA 2LG1A 2Z0PA 2L2IA 1FGYA 2ELBA 4GN1A 3LJUX 3BINA 4GMXB 4HAUB 1M7EA 1MK9B 2ADZA 1MIZB 3D8FA 3ZVRA 1W1DA 4HAWB 1ZC3B 1LB1A 3GYPA 2RSGA 1B55A 2COCA 1V5MA 2Q13A 4ZRKA 5KQ4A 2COFA 2H7DA 1E5WA 2MFQA 2AL6A 2J59M 1BWNA 4HAYB 1IRSA 1LW3A 3KSYA 2X18A 1I7AA 2EC1A 2P0FA 1AQCA 1W1GA 4XWXA 3TFMA 1MIXA 4H8SA 1RJ2A 1SGHA 2EJ8A 1PLSA 5DI9B 2UZSA 5L81A 4HDQA 4CHMA 1W1HA 1M7RA 1K5GB 2MKRA 3V5WA 3T06A 1U5DA 2RVBB 1H4RA 2I1JA 4D0NB 4F7UP 5FI1A 3IVFA 4HAXB 2H7EA 1FGZA 2P0DA 2D4QA 3ODWA 4MY6A 4HATB 3CXBB 5HE1A 2ELAA 1P6SA 3FSSA 2M14A 5FI0A 2DX5A 2CY4A 2PZ1A 5HE3A 1WVHA 4DX8A 3DXEA 2GS0A 3A8QA 2AEHA 2J0KA 2I1KA 4HB2B 3TVVA 5J3QA 1XR0B 4HB3B 3F0WA 1RRPB 2LOZA 1AWEA 2D9YA 1ZVRA 2D9ZA 1P3RA 2Y8FA 3MDBC 1XD4A 3SUZA 4PNKA 1Y19B 1NI2A 1NU2A 3ODOA 1Z87A 1MK7B 3UZTA 1KZGA 5CLQB 1TXDA 4F7GA 1UEFA 1WI1A 3KZ1A 1V61A 1FB8A 3SNHA 3PSCA 2GJYA 4GZUA 2I5FA 5D3WA 2XQNM 4PQ0A 2D2QA 3P6AA 2MWNB 1NTVA 1WGUA 2RUKB 4CHJA 5JLJB 4DBBA 5LONB 3WA0A 4TKNA 1U5GA 1X11A 2QKMA 4KAXB 2P8VA 4ZRJA 2KGXB 3PVWA 5EFXA 2OQBA 1XCGA 1X1FA 2DTCA 1MPHA 4KHAA 4YONA 4K17A 2IFSA 2LULA 2DHKA 5DH9B 2YT0A 5D27A 2UZRA 2NMBA 5KCVA 1X86A 2DA0A 3PP2A 2DLWA 3ML4A 2DYNA 4MK0A 3O96A 2GCLA 1GC7A 4A6FA 4A6FB 2W2WA 5DHAB 1TQZA 5D3VA 2L1CA 2K2UA 2DN6A 2D9XA 1ZC4B 2EMSA 5J3YA 2COAA 3VIAA 1BAKA 1V5UA 3HK0A
chains in the Genus database with same CATH superfamily
1DDVA 2GCJA 4GMVA 4A6HA 2VSZA 3TW1A 4IAPA 4A6KA 1KI1B 1Q67A 4DXAB 1ZSQA 3G9WA 1QQGA 1DDWA 5C79A 5IRSA 3ULBA 4CSQA 1FOEA 3GYOA 5D3YA 1FHXA 3FEHA 4Y94A 1FAOA 1K5DB 2Z59A 2LKOA 3PVLA 2HE7A 2CY5A 5KQ1A 1V88A 2W2XD 1I2HA 4GOUA 2DKQA 2R2YA 3SYXA 1T77A 2KUQA 2G35A 4HB4B 1ISNA 2ROZB 1SHCA 2VKIA 3OANA 3NW8A 1U2BA 1H10A 2Y7BA 3ULCA 2Z13A 5I2SA 4Z2MB 3N7CA 1OY2A 3HIEA 4CYEA 5JP4A 3NWFA 1BTKA 5CLLB 1TJ6A 2N0YA 3NWDA 5JHGA 2RGNB 4KHBA 1DYNA 2CRFA 4DIXA 3BJIA 1DDMA 4P7IA 2YS1A 3ODXA 4EMOA 3FVCA 3AU5A 1J0WA 2GUMA 2DX1A 2K49A 3NSUA 2ZKMX 2YVCA 5C5BA 5C5BB 2NZ8B 2KIGA 1Y5OA 4IFSA 3SO6A 2CAYA 1ZYIA 3F5RA 1BTNA 3PG7A 4KHOA 4NSWA 2D10A 1XX0A 2DHJA 4K81A 2DKPA 2Y8GA 2ROVA 5LOPB 1OMWA 2RLOA 4HB0B 3A98B 2Z0OA 4HAZB 2KIEA 3RCPA 2K8EA 1NTYA 1U27A 2QKLA 2HTHB 4K2OA 1EGXA 4K2PA 4QXAB 2R0DA 4WVFB 1PFJA 1V5PA 1GC6A 3D8DA 3FM8C 3NWAA 2YSZA 2DFKA 2UVMA 2D9WA 3DCXA 2E2XA 3WYFB 2YS5A 2VRWB 2K00A 4QJ3B 4TYZA 2W2XC 4OSNA 1UPRA 2IYBA 2YT1A 4HHVA 1EVHA 1OQNA 1EAZA 1XKEA 1KZ7A 2J0MA 4GXBA 2BCJA 2NBVA 2M38A 3KRWA 4MT7A 4EKUA 3DXDA 3P7ZA 4ZRIA 1X1GA 4BBKA 2RNRB 2KUPA 2P0HA 2D11A 2YS3A 2LOXA 4DX90 2CODA 5C6RA 3KY9A 3QIJA 3SV1A 3HW2B 3CIKA 2V76A 4HSIA 1PMSA 4Z2NA 4L6EA 5LG4B 2OTXA 1P5TA 1XODA 4GNKB 1WJMA 5DIFB 2D9VA 4NY0A 3AJ4A 1GG3A 2JP2A 3U8ZA 3ZDTA 3TCAA 3PEGA 3PVUA 2Z0QA 1UNQA 2R09A 2Z4DA 5DHFB 1J19A 3U7DA 3D8EA 2J0JA 5JHHA 1U29A 4WSFA 4KVGB 4EJNA 5GOWB 3HQCA 2LYDA 2K2JA 1QC6A 1WG7A 3A8PA 1WJ1A 1MKEA 4KHBB 1FHWA 1UNRA 3X23A 4YL8A 3OHMB 2RRFA 4GPTB 5HE0A 4D6WA 1X05A 4HDOA 1UPQA 2MDXA 4A5KA 3VOQA 3TO1A 4WJ7A 1U5EA 1DBHA 4QJ5B 3MPXA 2I5CA 3DXCA 5C16A 3KRXA 2EMTA 2YRYA 2KCJA 1WGQA 1DROA 1U5FA 1UNPA 3M1IB 1V89A 5D3XA 2N23A 5J3TA 1MAIA 5HE2A 1MI1A 1EF1A 1FHOA 4HAVB 1ZM0A 4F7HA 4B6HA 3PZDA 1N3HA 3QBVB 2DYQA 2YF0A 3AU4A 3QWMA 2FJLA 4IOYX 2DHIA 2ZPYA 4C0AA 2LG1A 2Z0PA 2L2IA 1FGYA 2ELBA 4GN1A 3LJUX 3BINA 4GMXB 4HAUB 1M7EA 1MK9B 2ADZA 1MIZB 3D8FA 3ZVRA 1W1DA 4HAWB 1ZC3B 1LB1A 2Z14A 2RSGA 1B55A 2YT2A 3GYPA 2COCA 5M4YB 1V5MA 2Q13A 3B77A 4ZRKA 5KQ4A 2COFA 2H7DA 1E5WA 2FJUB 2MFQA 2AL6A 2J59M 1BWNA 4HAYB 1IRSA 1LW3A 3KSYA 2X18A 1I7AA 2EC1A 3A58A 2P0FA 1AQCA 1W1GA 4XWXA 3TFMA 1MIXA 4H8SA 1RJ2A 1SGHA 2EJ8A 1PLSA 5DI9B 2UZSA 5L81A 4HDQA 4CHMA 1W1HA 1M7RA 1K5GB 2MKRA 3V5WA 3T06A 1U5DA 2RVBB 1H4RA 2I1JA 4D0NB 4F7UP 5FI1A 3IVFA 4HAXB 2H7EA 1FGZA 2P0DA 2D4QA 3ODWA 4MY6A 4HATB 3CXBB 5HE1A 2ELAA 1P6SA 4OT1A 3FSSA 2M14A 5FI0A 2DX5A 2CY4A 2PZ1A 5HE3A 1WVHA 4DX8A 3HSAA 3DXEA 2GS0A 3A8QA 2AEHA 2J0KA 2I1KA 4HB2B 3TVVA 5J3QA 1XR0B 4HB3B 3F0WA 1RRPB 2LOZA 1AWEA 2D9YA 1ZVRA 5I2MA 2D9ZA 1P3RA 2Y8FA 3MDBC 1XD4A 4L1RA 3SUZA 4PNKA 1Y19B 1NI2A 1NU2A 3ODOA 1Z87A 2KR0A 3U12A 1MK7B 3UZTA 1KZGA 5CLQB 1TXDA 4F7GA 1UEFA 1WI1A 3KZ1A 1V61A 1FB8A 3SNHA 3PSCA 2GJYA 4GZUA 2I5FA 5D3WA 2XQNM 4PQ0A 2D2QA 3P6AA 2MWNB 1NTVA 1WGUA 2RUKB 4CHJA 5JLJB 4DBBA 5LONB 3WA0A 4TKNA 1U5GA 1X11A 2QKMA 4KAXB 2P8VA 4ZRJA 2KGXB 3PVWA 5EFXA 2OQBA 1XCGA 1X1FA 2DTCA 1MPHA 4KHAA 4YONA 4K17A 2IFSA 2LULA 2DHKA 5DH9B 2YT0A 5D27A 2UZRA 2NMBA 5KCVA 1X86A 2DA0A 3PP2A 2DLWA 3ML4A 2DYNA 4MK0A 3O96A 2GCLA 1GC7A 4A6FA 4A6FB 2W2WA 4QJ4B 5DHAB 1TQZA 5D3VA 2L1CA 2K2UA 2DN6A 2D9XA 1ZC4B 2EMSA 5J3YA 2COAA 3VIAA 1BAKA 1V5UA 3HK0A
chains in the Genus database with same CATH topology
1DDVA 2GCJA 4GMVA 4A6HA 2VSZA 3TW1A 4IAPA 4A6KA 1KI1B 1Q67A 4DXAB 1ZSQA 3G9WA 1QQGA 1DDWA 5C79A 3ULBA 1FOEA 3GYOA 5D3YA 1FHXA 3FEHA 4Y94A 1FAOA 1K5DB 2LKOA 3PVLA 2HE7A 2CY5A 5KQ1A 1V88A 2W2XD 1I2HA 2DKQA 3SYXA 2G35A 4HB4B 1ISNA 2ROZB 1SHCA 2VKIA 3OANA 1U2BA 1H10A 2Y7BA 3ULCA 4Z2MB 3N7CA 1OY2A 4CYEA 5JP4A 1BTKA 5CLLB 1TJ6A 2N0YA 5JHGA 2RGNB 1DYNA 2CRFA 3BJIA 1DDMA 4P7IA 2YS1A 3ODXA 4EMOA 3AU5A 1J0WA 2DX1A 3NSUA 2YVCA 5C5BA 5C5BB 2NZ8B 1Y5OA 4IFSA 3SO6A 2CAYA 3F5RA 1BTNA 3PG7A 4KHOA 4NSWA 2D10A 1XX0A 2DHJA 4K81A 2DKPA 2Y8GA 2ROVA 5LOPB 1OMWA 2RLOA 4HB0B 3A98B 2Z0OA 4HAZB 3RCPA 1NTYA 1U27A 2QKLA 2HTHB 4K2OA 1EGXA 4K2PA 2R0DA 4WVFB 1PFJA 1V5PA 1GC6A 3D8DA 3FM8C 2YSZA 2DFKA 2UVMA 2D9WA 2E2XA 3WYFB 2YS5A 2VRWB 2K00A 4TYZA 2W2XC 1UPRA 2IYBA 2YT1A 4HHVA 1EVHA 1OQNA 1EAZA 1XKEA 1KZ7A 2J0MA 4GXBA 2BCJA 2M38A 3KRWA 4MT7A 4EKUA 3DXDA 3P7ZA 4ZRIA 1X1GA 4BBKA 2RNRB 2KUPA 2P0HA 2D11A 2YS3A 2LOXA 4DX90 2CODA 5C6RA 3KY9A 3QIJA 3SV1A 3HW2B 3CIKA 2V76A 1PMSA 4Z2NA 4L6EA 2OTXA 1P5TA 1XODA 1WJMA 5DIFB 2D9VA 4NY0A 3AJ4A 1GG3A 2JP2A 3U8ZA 3ZDTA 3TCAA 3PEGA 3PVUA 2Z0QA 1UNQA 2R09A 5DHFB 1J19A 3U7DA 3D8EA 2J0JA 5JHHA 1U29A 4WSFA 4KVGB 4EJNA 5GOWB 3HQCA 2LYDA 2K2JA 1QC6A 1WG7A 3A8PA 1WJ1A 1MKEA 4KHBB 1FHWA 1UNRA 3X23A 4YL8A 4GPTB 5HE0A 1X05A 4HDOA 1UPQA 2MDXA 4A5KA 3VOQA 3TO1A 4WJ7A 1U5EA 1DBHA 3MPXA 2I5CA 3DXCA 5C16A 3KRXA 2EMTA 2YRYA 2KCJA 1WGQA 1DROA 1U5FA 1UNPA 3M1IB 1V89A 5D3XA 2N23A 5J3TA 1MAIA 5HE2A 1EF1A 1FHOA 4HAVB 1ZM0A 4F7HA 4B6HA 3PZDA 1N3HA 3QBVB 2DYQA 2YF0A 3AU4A 3QWMA 2FJLA 4IOYX 2DHIA 2ZPYA 4C0AA 2LG1A 2Z0PA 2L2IA 1FGYA 2ELBA 4GN1A 3LJUX 3BINA 4GMXB 4HAUB 1M7EA 1MK9B 2ADZA 1MIZB 3D8FA 3ZVRA 1W1DA 4HAWB 1ZC3B 1LB1A 3GYPA 2RSGA 1B55A 2COCA 1V5MA 2Q13A 4ZRKA 5KQ4A 2COFA 2H7DA 1E5WA 2MFQA 2AL6A 2J59M 1BWNA 4HAYB 1IRSA 1LW3A 3KSYA 2X18A 1I7AA 2EC1A 2P0FA 1AQCA 1W1GA 4XWXA 3TFMA 1MIXA 4H8SA 1RJ2A 1SGHA 2EJ8A 1PLSA 5DI9B 2UZSA 5L81A 4HDQA 4CHMA 1W1HA 1M7RA 1K5GB 2MKRA 3V5WA 3T06A 1U5DA 2RVBB 1H4RA 2I1JA 4D0NB 4F7UP 5FI1A 3IVFA 4HAXB 2H7EA 1FGZA 2P0DA 2D4QA 3ODWA 4MY6A 4HATB 3CXBB 5HE1A 2ELAA 1P6SA 3FSSA 2M14A 5FI0A 2DX5A 2CY4A 2PZ1A 5HE3A 1WVHA 4DX8A 3DXEA 2GS0A 3A8QA 2AEHA 2J0KA 2I1KA 4HB2B 3TVVA 5J3QA 1XR0B 4HB3B 3F0WA 1RRPB 2LOZA 1AWEA 2D9YA 1ZVRA 2D9ZA 1P3RA 2Y8FA 3MDBC 1XD4A 3SUZA 4PNKA 1Y19B 1NI2A 1NU2A 3ODOA 1Z87A 1MK7B 3UZTA 1KZGA 5CLQB 1TXDA 4F7GA 1UEFA 1WI1A 3KZ1A 1V61A 1FB8A 3SNHA 3PSCA 2GJYA 4GZUA 2I5FA 5D3WA 2XQNM 4PQ0A 2D2QA 3P6AA 2MWNB 1NTVA 1WGUA 2RUKB 4CHJA 5JLJB 4DBBA 5LONB 3WA0A 4TKNA 1U5GA 1X11A 2QKMA 4KAXB 2P8VA 4ZRJA 2KGXB 3PVWA 5EFXA 2OQBA 1XCGA 1X1FA 2DTCA 1MPHA 4KHAA 4YONA 4K17A 2IFSA 2LULA 2DHKA 5DH9B 2YT0A 5D27A 2UZRA 2NMBA 5KCVA 1X86A 2DA0A 3PP2A 2DLWA 3ML4A 2DYNA 4MK0A 3O96A 2GCLA 1GC7A 4A6FA 4A6FB 2W2WA 5DHAB 1TQZA 5D3VA 2L1CA 2K2UA 2DN6A 2D9XA 1ZC4B 2EMSA 5J3YA 2COAA 3VIAA 1BAKA 1V5UA 3HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDV A;  2GCJ A;  4GMV A;  4A6H A;  2VSZ A;  3TW1 A;  4IAP A;  4A6K A;  1KI1 B;  1Q67 A;  4DXA B;  1ZSQ A;  3G9W A;  1QQG A;  1DDW A;  5C79 A;  3ULB A;  1FOE A;  3GYO A;  5D3Y A;  1FHX A;  3FEH A;  4Y94 A;  1FAO A;  1K5D B;  2LKO A;  3PVL A;  2HE7 A;  2CY5 A;  5KQ1 A;  1V88 A;  2W2X D;  1I2H A;  2DKQ A;  3SYX A;  2G35 A;  4HB4 B;  1ISN A;  2ROZ B;  1SHC A;  2VKI A;  3OAN A;  1U2B A;  1H10 A;  2Y7B A;  3ULC A;  4Z2M B;  3N7C A;  1OY2 A;  4CYE A;  5JP4 A;  1BTK A;  5CLL B;  1TJ6 A;  2N0Y A;  5JHG A;  2RGN B;  1DYN A;  2CRF A;  3BJI A;  1DDM A;  4P7I A;  2YS1 A;  3ODX A;  4EMO A;  3AU5 A;  1J0W A;  2DX1 A;  3NSU A;  2YVC A;  5C5B A;  5C5B B;  2NZ8 B;  1Y5O A;  4IFS A;  3SO6 A;  2CAY A;  3F5R A;  1BTN A;  3PG7 A;  4KHO A;  4NSW A;  2D10 A;  1XX0 A;  2DHJ A;  4K81 A;  2DKP A;  2Y8G A;  2ROV A;  5LOP B;  1OMW A;  2RLO A;  4HB0 B;  3A98 B;  2Z0O A;  4HAZ B;  3RCP A;  1NTY A;  1U27 A;  2QKL A;  2HTH B;  4K2O A;  1EGX A;  4K2P A;  2R0D A;  4WVF B;  1PFJ A;  1V5P A;  1GC6 A;  3D8D A;  3FM8 C;  2YSZ A;  2DFK A;  2UVM A;  2D9W A;  2E2X A;  3WYF B;  2YS5 A;  2VRW B;  2K00 A;  4TYZ A;  2W2X C;  1UPR A;  2IYB A;  2YT1 A;  4HHV A;  1EVH A;  1OQN A;  1EAZ A;  1XKE A;  1KZ7 A;  2J0M A;  4GXB A;  2BCJ A;  2M38 A;  3KRW A;  4MT7 A;  4EKU A;  3DXD A;  3P7Z A;  4ZRI A;  1X1G A;  4BBK A;  2RNR B;  2KUP A;  2P0H A;  2D11 A;  2YS3 A;  2LOX A;  4DX9 0;  2COD A;  5C6R A;  3KY9 A;  3QIJ A;  3SV1 A;  3HW2 B;  3CIK A;  2V76 A;  1PMS A;  4Z2N A;  4L6E A;  2OTX A;  1P5T A;  1XOD A;  1WJM A;  5DIF B;  2D9V A;  4NY0 A;  3AJ4 A;  1GG3 A;  2JP2 A;  3U8Z A;  3ZDT A;  3TCA A;  3PEG A;  3PVU A;  2Z0Q A;  1UNQ A;  2R09 A;  5DHF B;  1J19 A;  3U7D A;  3D8E A;  2J0J A;  5JHH A;  1U29 A;  4WSF A;  4KVG B;  4EJN A;  5GOW B;  3HQC A;  2LYD A;  2K2J A;  1QC6 A;  1WG7 A;  3A8P A;  1WJ1 A;  1MKE A;  4KHB B;  1FHW A;  1UNR A;  3X23 A;  4YL8 A;  4GPT B;  5HE0 A;  1X05 A;  4HDO A;  1UPQ A;  2MDX A;  4A5K A;  3VOQ A;  3TO1 A;  4WJ7 A;  1U5E A;  1DBH A;  3MPX A;  2I5C A;  3DXC A;  5C16 A;  3KRX A;  2EMT A;  2YRY A;  2KCJ A;  1WGQ A;  1DRO A;  1U5F A;  1UNP A;  3M1I B;  1V89 A;  5D3X A;  2N23 A;  5J3T A;  1MAI A;  5HE2 A;  1EF1 A;  1FHO A;  4HAV B;  1ZM0 A;  4F7H A;  4B6H A;  3PZD A;  1N3H A;  3QBV B;  2DYQ A;  2YF0 A;  3AU4 A;  3QWM A;  2FJL A;  4IOY X;  2DHI A;  2ZPY A;  4C0A A;  2LG1 A;  2Z0P A;  2L2I A;  1FGY A;  2ELB A;  4GN1 A;  3LJU X;  3BIN A;  4GMX B;  4HAU B;  1M7E A;  1MK9 B;  2ADZ A;  1MIZ B;  3D8F A;  3ZVR A;  1W1D A;  4HAW B;  1ZC3 B;  1LB1 A;  3GYP A;  2RSG A;  1B55 A;  2COC A;  1V5M A;  2Q13 A;  4ZRK A;  5KQ4 A;  2COF A;  2H7D A;  1E5W A;  2MFQ A;  2AL6 A;  2J59 M;  1BWN A;  4HAY B;  1IRS A;  1LW3 A;  3KSY A;  2X18 A;  1I7A A;  2EC1 A;  2P0F A;  1AQC A;  1W1G A;  4XWX A;  3TFM A;  1MIX A;  4H8S A;  1RJ2 A;  1SGH A;  2EJ8 A;  1PLS A;  5DI9 B;  2UZS A;  5L81 A;  4HDQ A;  4CHM A;  1W1H A;  1M7R A;  1K5G B;  2MKR A;  3V5W A;  3T06 A;  1U5D A;  2RVB B;  1H4R A;  2I1J A;  4D0N B;  4F7U P;  5FI1 A;  3IVF A;  4HAX B;  2H7E A;  1FGZ A;  2P0D A;  2D4Q A;  3ODW A;  4MY6 A;  4HAT B;  3CXB B;  5HE1 A;  2ELA A;  1P6S A;  3FSS A;  2M14 A;  5FI0 A;  2DX5 A;  2CY4 A;  2PZ1 A;  5HE3 A;  1WVH A;  4DX8 A;  3DXE A;  2GS0 A;  3A8Q A;  2AEH A;  2J0K A;  2I1K A;  4HB2 B;  3TVV A;  5J3Q A;  1XR0 B;  4HB3 B;  3F0W A;  1RRP B;  2LOZ A;  1AWE A;  2D9Y A;  1ZVR A;  2D9Z A;  1P3R A;  2Y8F A;  3MDB C;  1XD4 A;  3SUZ A;  4PNK A;  1Y19 B;  1NI2 A;  1NU2 A;  3ODO A;  1Z87 A;  1MK7 B;  3UZT A;  1KZG A;  5CLQ B;  1TXD A;  4F7G A;  1UEF A;  1WI1 A;  3KZ1 A;  1V61 A;  1FB8 A;  3SNH A;  3PSC A;  2GJY A;  4GZU A;  2I5F A;  5D3W A;  2XQN M;  4PQ0 A;  2D2Q A;  3P6A A;  2MWN B;  1NTV A;  1WGU A;  2RUK B;  4CHJ A;  5JLJ B;  4DBB A;  5LON B;  3WA0 A;  4TKN A;  1U5G A;  1X11 A;  2QKM A;  4KAX B;  2P8V A;  4ZRJ A;  2KGX B;  3PVW A;  5EFX A;  2OQB A;  1XCG A;  1X1F A;  2DTC A;  1MPH A;  4KHA A;  4YON A;  4K17 A;  2IFS A;  2LUL A;  2DHK A;  5DH9 B;  2YT0 A;  5D27 A;  2UZR A;  2NMB A;  5KCV A;  1X86 A;  2DA0 A;  3PP2 A;  2DLW A;  3ML4 A;  2DYN A;  4MK0 A;  3O96 A;  2GCL A;  1GC7 A;  4A6F A;  4A6F B;  2W2W A;  5DHA B;  1TQZ A;  5D3V A;  2L1C A;  2K2U A;  2DN6 A;  2D9X A;  1ZC4 B;  2EMS A;  5J3Y A;  2COA A;  3VIA A;  1BAK A;  1V5U A;  3HK0 A; 
#chains in the Genus database with same CATH topology
 1DDV A;  2GCJ A;  4GMV A;  4A6H A;  2VSZ A;  3TW1 A;  4IAP A;  4A6K A;  1KI1 B;  1Q67 A;  4DXA B;  1ZSQ A;  3G9W A;  1QQG A;  1DDW A;  5C79 A;  5IRS A;  3ULB A;  4CSQ A;  1FOE A;  3GYO A;  5D3Y A;  1FHX A;  3FEH A;  4Y94 A;  1FAO A;  1K5D B;  2Z59 A;  2LKO A;  3PVL A;  2HE7 A;  2CY5 A;  5KQ1 A;  1V88 A;  2W2X D;  1I2H A;  4GOU A;  2DKQ A;  2R2Y A;  3SYX A;  1T77 A;  2KUQ A;  2G35 A;  4HB4 B;  1ISN A;  2ROZ B;  1SHC A;  2VKI A;  3OAN A;  3NW8 A;  1U2B A;  1H10 A;  2Y7B A;  3ULC A;  2Z13 A;  5I2S A;  4Z2M B;  3N7C A;  1OY2 A;  3HIE A;  4CYE A;  5JP4 A;  3NWF A;  1BTK A;  5CLL B;  1TJ6 A;  2N0Y A;  3NWD A;  5JHG A;  2RGN B;  4KHB A;  1DYN A;  2CRF A;  4DIX A;  3BJI A;  1DDM A;  4P7I A;  2YS1 A;  3ODX A;  4EMO A;  3FVC A;  3AU5 A;  1J0W A;  2GUM A;  2DX1 A;  2K49 A;  3NSU A;  2ZKM X;  2YVC A;  5C5B A;  5C5B B;  2NZ8 B;  2KIG A;  1Y5O A;  4IFS A;  3SO6 A;  2CAY A;  1ZYI A;  3F5R A;  1BTN A;  3PG7 A;  4KHO A;  4NSW A;  2D10 A;  1XX0 A;  2DHJ A;  4K81 A;  2DKP A;  2Y8G A;  2ROV A;  5LOP B;  1OMW A;  2RLO A;  4HB0 B;  3A98 B;  2Z0O A;  4HAZ B;  2KIE A;  3RCP A;  2K8E A;  1NTY A;  1U27 A;  2QKL A;  2HTH B;  4K2O A;  1EGX A;  4K2P A;  4QXA B;  2R0D A;  4WVF B;  1PFJ A;  1V5P A;  1GC6 A;  3D8D A;  3FM8 C;  3NWA A;  2YSZ A;  2DFK A;  2UVM A;  2D9W A;  3DCX A;  2E2X A;  3WYF B;  2YS5 A;  2VRW B;  2K00 A;  4QJ3 B;  4TYZ A;  2W2X C;  4OSN A;  1UPR A;  2IYB A;  2YT1 A;  4HHV A;  1EVH A;  1OQN A;  1EAZ A;  1XKE A;  1KZ7 A;  2J0M A;  4GXB A;  2BCJ A;  2NBV A;  2M38 A;  3KRW A;  4MT7 A;  4EKU A;  3DXD A;  3P7Z A;  4ZRI A;  1X1G A;  4BBK A;  2RNR B;  2KUP A;  2P0H A;  2D11 A;  2YS3 A;  2LOX A;  4DX9 0;  2COD A;  5C6R A;  3KY9 A;  3QIJ A;  3SV1 A;  3HW2 B;  3CIK A;  2V76 A;  4HSI A;  1PMS A;  4Z2N A;  4L6E A;  5LG4 B;  2OTX A;  1P5T A;  1XOD A;  4GNK B;  1WJM A;  5DIF B;  2D9V A;  4NY0 A;  3AJ4 A;  1GG3 A;  2JP2 A;  3U8Z A;  3ZDT A;  3TCA A;  3PEG A;  3PVU A;  2Z0Q A;  1UNQ A;  2R09 A;  2Z4D A;  5DHF B;  1J19 A;  3U7D A;  3D8E A;  2J0J A;  5JHH A;  1U29 A;  4WSF A;  4KVG B;  4EJN A;  5GOW B;  3HQC A;  2LYD A;  2K2J A;  1QC6 A;  1WG7 A;  3A8P A;  1WJ1 A;  1MKE A;  4KHB B;  1FHW A;  1UNR A;  3X23 A;  4YL8 A;  3OHM B;  2RRF A;  4GPT B;  5HE0 A;  4D6W A;  1X05 A;  4HDO A;  1UPQ A;  2MDX A;  4A5K A;  3VOQ A;  3TO1 A;  4WJ7 A;  1U5E A;  1DBH A;  4QJ5 B;  3MPX A;  2I5C A;  3DXC A;  5C16 A;  3KRX A;  2EMT A;  2YRY A;  2KCJ A;  1WGQ A;  1DRO A;  1U5F A;  1UNP A;  3M1I B;  1V89 A;  5D3X A;  2N23 A;  5J3T A;  1MAI A;  5HE2 A;  1MI1 A;  1EF1 A;  1FHO A;  4HAV B;  1ZM0 A;  4F7H A;  4B6H A;  3PZD A;  1N3H A;  3QBV B;  2DYQ A;  2YF0 A;  3AU4 A;  3QWM A;  2FJL A;  4IOY X;  2DHI A;  2ZPY A;  4C0A A;  2LG1 A;  2Z0P A;  2L2I A;  1FGY A;  2ELB A;  4GN1 A;  3LJU X;  3BIN A;  4GMX B;  4HAU B;  1M7E A;  1MK9 B;  2ADZ A;  1MIZ B;  3D8F A;  3ZVR A;  1W1D A;  4HAW B;  1ZC3 B;  1LB1 A;  2Z14 A;  2RSG A;  1B55 A;  2YT2 A;  3GYP A;  2COC A;  5M4Y B;  1V5M A;  2Q13 A;  3B77 A;  4ZRK A;  5KQ4 A;  2COF A;  2H7D A;  1E5W A;  2FJU B;  2MFQ A;  2AL6 A;  2J59 M;  1BWN A;  4HAY B;  1IRS A;  1LW3 A;  3KSY A;  2X18 A;  1I7A A;  2EC1 A;  3A58 A;  2P0F A;  1AQC A;  1W1G A;  4XWX A;  3TFM A;  1MIX A;  4H8S A;  1RJ2 A;  1SGH A;  2EJ8 A;  1PLS A;  5DI9 B;  2UZS A;  5L81 A;  4HDQ A;  4CHM A;  1W1H A;  1M7R A;  1K5G B;  2MKR A;  3V5W A;  3T06 A;  1U5D A;  2RVB B;  1H4R A;  2I1J A;  4D0N B;  4F7U P;  5FI1 A;  3IVF A;  4HAX B;  2H7E A;  1FGZ A;  2P0D A;  2D4Q A;  3ODW A;  4MY6 A;  4HAT B;  3CXB B;  5HE1 A;  2ELA A;  1P6S A;  4OT1 A;  3FSS A;  2M14 A;  5FI0 A;  2DX5 A;  2CY4 A;  2PZ1 A;  5HE3 A;  1WVH A;  4DX8 A;  3HSA A;  3DXE A;  2GS0 A;  3A8Q A;  2AEH A;  2J0K A;  2I1K A;  4HB2 B;  3TVV A;  5J3Q A;  1XR0 B;  4HB3 B;  3F0W A;  1RRP B;  2LOZ A;  1AWE A;  2D9Y A;  1ZVR A;  5I2M A;  2D9Z A;  1P3R A;  2Y8F A;  3MDB C;  1XD4 A;  4L1R A;  3SUZ A;  4PNK A;  1Y19 B;  1NI2 A;  1NU2 A;  3ODO A;  1Z87 A;  2KR0 A;  3U12 A;  1MK7 B;  3UZT A;  1KZG A;  5CLQ B;  1TXD A;  4F7G A;  1UEF A;  1WI1 A;  3KZ1 A;  1V61 A;  1FB8 A;  3SNH A;  3PSC A;  2GJY A;  4GZU A;  2I5F A;  5D3W A;  2XQN M;  4PQ0 A;  2D2Q A;  3P6A A;  2MWN B;  1NTV A;  1WGU A;  2RUK B;  4CHJ A;  5JLJ B;  4DBB A;  5LON B;  3WA0 A;  4TKN A;  1U5G A;  1X11 A;  2QKM A;  4KAX B;  2P8V A;  4ZRJ A;  2KGX B;  3PVW A;  5EFX A;  2OQB A;  1XCG A;  1X1F A;  2DTC A;  1MPH A;  4KHA A;  4YON A;  4K17 A;  2IFS A;  2LUL A;  2DHK A;  5DH9 B;  2YT0 A;  5D27 A;  2UZR A;  2NMB A;  5KCV A;  1X86 A;  2DA0 A;  3PP2 A;  2DLW A;  3ML4 A;  2DYN A;  4MK0 A;  3O96 A;  2GCL A;  1GC7 A;  4A6F A;  4A6F B;  2W2W A;  4QJ4 B;  5DHA B;  1TQZ A;  5D3V A;  2L1C A;  2K2U A;  2DN6 A;  2D9X A;  1ZC4 B;  2EMS A;  5J3Y A;  2COA A;  3VIA A;  1BAK A;  1V5U A;  3HK0 A; 
#chains in the Genus database with same CATH homology
 1DDV A;  2GCJ A;  4GMV A;  4A6H A;  2VSZ A;  3TW1 A;  4IAP A;  4A6K A;  1KI1 B;  1Q67 A;  4DXA B;  1ZSQ A;  3G9W A;  1QQG A;  1DDW A;  5C79 A;  3ULB A;  1FOE A;  3GYO A;  5D3Y A;  1FHX A;  3FEH A;  4Y94 A;  1FAO A;  1K5D B;  2LKO A;  3PVL A;  2HE7 A;  2CY5 A;  5KQ1 A;  1V88 A;  2W2X D;  1I2H A;  2DKQ A;  3SYX A;  2G35 A;  4HB4 B;  1ISN A;  2ROZ B;  1SHC A;  2VKI A;  3OAN A;  1U2B A;  1H10 A;  2Y7B A;  3ULC A;  4Z2M B;  3N7C A;  1OY2 A;  4CYE A;  5JP4 A;  1BTK A;  5CLL B;  1TJ6 A;  2N0Y A;  5JHG A;  2RGN B;  1DYN A;  2CRF A;  3BJI A;  1DDM A;  4P7I A;  2YS1 A;  3ODX A;  4EMO A;  3AU5 A;  1J0W A;  2DX1 A;  3NSU A;  2YVC A;  5C5B A;  5C5B B;  2NZ8 B;  1Y5O A;  4IFS A;  3SO6 A;  2CAY A;  3F5R A;  1BTN A;  3PG7 A;  4KHO A;  4NSW A;  2D10 A;  1XX0 A;  2DHJ A;  4K81 A;  2DKP A;  2Y8G A;  2ROV A;  5LOP B;  1OMW A;  2RLO A;  4HB0 B;  3A98 B;  2Z0O A;  4HAZ B;  3RCP A;  1NTY A;  1U27 A;  2QKL A;  2HTH B;  4K2O A;  1EGX A;  4K2P A;  2R0D A;  4WVF B;  1PFJ A;  1V5P A;  1GC6 A;  3D8D A;  3FM8 C;  2YSZ A;  2DFK A;  2UVM A;  2D9W A;  2E2X A;  3WYF B;  2YS5 A;  2VRW B;  2K00 A;  4TYZ A;  2W2X C;  1UPR A;  2IYB A;  2YT1 A;  4HHV A;  1EVH A;  1OQN A;  1EAZ A;  1XKE A;  1KZ7 A;  2J0M A;  4GXB A;  2BCJ A;  2M38 A;  3KRW A;  4MT7 A;  4EKU A;  3DXD A;  3P7Z A;  4ZRI A;  1X1G A;  4BBK A;  2RNR B;  2KUP A;  2P0H A;  2D11 A;  2YS3 A;  2LOX A;  4DX9 0;  2COD A;  5C6R A;  3KY9 A;  3QIJ A;  3SV1 A;  3HW2 B;  3CIK A;  2V76 A;  1PMS A;  4Z2N A;  4L6E A;  2OTX A;  1P5T A;  1XOD A;  1WJM A;  5DIF B;  2D9V A;  4NY0 A;  3AJ4 A;  1GG3 A;  2JP2 A;  3U8Z A;  3ZDT A;  3TCA A;  3PEG A;  3PVU A;  2Z0Q A;  1UNQ A;  2R09 A;  5DHF B;  1J19 A;  3U7D A;  3D8E A;  2J0J A;  5JHH A;  1U29 A;  4WSF A;  4KVG B;  4EJN A;  5GOW B;  3HQC A;  2LYD A;  2K2J A;  1QC6 A;  1WG7 A;  3A8P A;  1WJ1 A;  1MKE A;  4KHB B;  1FHW A;  1UNR A;  3X23 A;  4YL8 A;  4GPT B;  5HE0 A;  1X05 A;  4HDO A;  1UPQ A;  2MDX A;  4A5K A;  3VOQ A;  3TO1 A;  4WJ7 A;  1U5E A;  1DBH A;  3MPX A;  2I5C A;  3DXC A;  5C16 A;  3KRX A;  2EMT A;  2YRY A;  2KCJ A;  1WGQ A;  1DRO A;  1U5F A;  1UNP A;  3M1I B;  1V89 A;  5D3X A;  2N23 A;  5J3T A;  1MAI A;  5HE2 A;  1EF1 A;  1FHO A;  4HAV B;  1ZM0 A;  4F7H A;  4B6H A;  3PZD A;  1N3H A;  3QBV B;  2DYQ A;  2YF0 A;  3AU4 A;  3QWM A;  2FJL A;  4IOY X;  2DHI A;  2ZPY A;  4C0A A;  2LG1 A;  2Z0P A;  2L2I A;  1FGY A;  2ELB A;  4GN1 A;  3LJU X;  3BIN A;  4GMX B;  4HAU B;  1M7E A;  1MK9 B;  2ADZ A;  1MIZ B;  3D8F A;  3ZVR A;  1W1D A;  4HAW B;  1ZC3 B;  1LB1 A;  3GYP A;  2RSG A;  1B55 A;  2COC A;  1V5M A;  2Q13 A;  4ZRK A;  5KQ4 A;  2COF A;  2H7D A;  1E5W A;  2MFQ A;  2AL6 A;  2J59 M;  1BWN A;  4HAY B;  1IRS A;  1LW3 A;  3KSY A;  2X18 A;  1I7A A;  2EC1 A;  2P0F A;  1AQC A;  1W1G A;  4XWX A;  3TFM A;  1MIX A;  4H8S A;  1RJ2 A;  1SGH A;  2EJ8 A;  1PLS A;  5DI9 B;  2UZS A;  5L81 A;  4HDQ A;  4CHM A;  1W1H A;  1M7R A;  1K5G B;  2MKR A;  3V5W A;  3T06 A;  1U5D A;  2RVB B;  1H4R A;  2I1J A;  4D0N B;  4F7U P;  5FI1 A;  3IVF A;  4HAX B;  2H7E A;  1FGZ A;  2P0D A;  2D4Q A;  3ODW A;  4MY6 A;  4HAT B;  3CXB B;  5HE1 A;  2ELA A;  1P6S A;  3FSS A;  2M14 A;  5FI0 A;  2DX5 A;  2CY4 A;  2PZ1 A;  5HE3 A;  1WVH A;  4DX8 A;  3DXE A;  2GS0 A;  3A8Q A;  2AEH A;  2J0K A;  2I1K A;  4HB2 B;  3TVV A;  5J3Q A;  1XR0 B;  4HB3 B;  3F0W A;  1RRP B;  2LOZ A;  1AWE A;  2D9Y A;  1ZVR A;  2D9Z A;  1P3R A;  2Y8F A;  3MDB C;  1XD4 A;  3SUZ A;  4PNK A;  1Y19 B;  1NI2 A;  1NU2 A;  3ODO A;  1Z87 A;  1MK7 B;  3UZT A;  1KZG A;  5CLQ B;  1TXD A;  4F7G A;  1UEF A;  1WI1 A;  3KZ1 A;  1V61 A;  1FB8 A;  3SNH A;  3PSC A;  2GJY A;  4GZU A;  2I5F A;  5D3W A;  2XQN M;  4PQ0 A;  2D2Q A;  3P6A A;  2MWN B;  1NTV A;  1WGU A;  2RUK B;  4CHJ A;  5JLJ B;  4DBB A;  5LON B;  3WA0 A;  4TKN A;  1U5G A;  1X11 A;  2QKM A;  4KAX B;  2P8V A;  4ZRJ A;  2KGX B;  3PVW A;  5EFX A;  2OQB A;  1XCG A;  1X1F A;  2DTC A;  1MPH A;  4KHA A;  4YON A;  4K17 A;  2IFS A;  2LUL A;  2DHK A;  5DH9 B;  2YT0 A;  5D27 A;  2UZR A;  2NMB A;  5KCV A;  1X86 A;  2DA0 A;  3PP2 A;  2DLW A;  3ML4 A;  2DYN A;  4MK0 A;  3O96 A;  2GCL A;  1GC7 A;  4A6F A;  4A6F B;  2W2W A;  5DHA B;  1TQZ A;  5D3V A;  2L1C A;  2K2U A;  2DN6 A;  2D9X A;  1ZC4 B;  2EMS A;  5J3Y A;  2COA A;  3VIA A;  1BAK A;  1V5U A;  3HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...