1Q67A

Crystal structure of dcp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
146
Chain Sequence
b'LNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decapping protein involved in mRNA degradation-Dcp1p
publication title Crystal structure of Dcp1p and its functional implications in mRNA decapping
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 36
structure length 146
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1q67A01
2Y7BA 3FSSA 1WI1A 2DN6A 1MIZB 1UEFA 3M1IB 2CY5A 2OTXA 4IOYX 4DX8A 1EGXA 2CY4A 3VOQA 4IAPA 1M7EA 1MKEA 3V5WA 3ZDTA 3QBVB 4EJNA 3TCAA 1OMWA 2EMTA 3N7CA 3TFMA 4F7HA 1B55A 1V61A 3P7ZA 2DX5A 2X18A 1X86A 2BCJA 4GN1A 3GYPA 1FGYA 3X23A 5CLLB 2D11A 1FAOA 2DX1A 2W2XC 4WSFA 2Y8GA 5D3VA 4CHJA 5C5BA 1UNQA 1FHOA 2YSZA 5GOWB 5J3YA 2GJYA 4HDQA 2Z0OA 2CRFA 3A98B 1W1GA 1NTYA 4IFSA 5D27A 2P0HA 1DROA 4GMXB 5JLJB 1V88A 4HB3B 5HE1A 4Y94A 5C6RA 3IVFA 3U7DA 1QC6A 1XCGA 2MWNB 4HHVA 1XX0A 4HAYB 1UPQA 2MDXA 2LG1A 2XQNM 1V5PA 5LOPB 2ROVA 3SO6A 5J3QA 1K5GB 3F5RA 1Z87A 3LJUX 4L6EA 1Y19B 2HE7A 2N0YA 2LULA 2W2WA 4CYEA 2DHKA 2D9ZA 4KHAA 1BTKA 1TQZA 3VIAA 5LONB 2ELAA 2H7DA 3AU4A 2GS0A 4K81A 1PFJA 4KHOA 1GC6A 2I1KA 2I5CA 1FB8A 2R09A 3DXEA 2MKRA 2EC1A 3PVUA 1DDVA 1U27A 2QKLA 2UZSA 2DA0A 1OQNA 3D8FA 1WVHA 1I2HA 2RGNB 2V76A 3U8ZA 3KY9A 3PSCA 2D2QA 1X11A 3AJ4A 1LB1A 3TVVA 1TJ6A 5CLQB 2VRWB 2MFQA 5HE2A 3CIKA 3ML4A 4HAUB 4A6FA 5KCVA 4A6KA 1J0WA 4BBKA 1BWNA 1XD4A 1X05A 4P7IA 2E2XA 4KAXB 2LOXA 2RUKB 4H8SA 5DI9B 2W2XD 1SGHA 2YS1A 1N3HA 3KRWA 4TYZA 4HDOA 3D8DA 1Y5OA 2RVBB 1RRPB 2NZ8B 2CAYA 2I1JA 3HW2B 3KRXA 5DIFB 2D9WA 1V5UA 2KUPA 2KCJA 5DHAB 2DYNA 2P0FA 4HB2B 1WJ1A 3WYFB 4GXBA 4K17A 2K2UA 2DKPA 5FI1A 1XR0B 3F0WA 3OANA 1U2BA 1U5FA 4DBBA 4WVFB 2ADZA 2Z0QA 3DXDA 3ODOA 4F7UP 1RJ2A 2J59M 1KI1B 2RLOA 4MK0A 2IFSA 1EAZA 1ISNA 4YL8A 3HK0A 1E5WA 1I7AA 4HAVB 1J19A 3QWMA 1WGQA 5D3YA 1GG3A 4PQ0A 2YS3A 1PLSA 2DTCA 1MPHA 1DDWA 3AU5A 3A8PA 2K2JA 1XODA 5D3XA 1FHWA 5J3TA 2DHJA 3SUZA 3FM8C 2AEHA 3NSUA 4TKNA 1V89A 5DH9B 1UNRA 3FEHA 1FHXA 1MK7B 5JHHA 2COAA 4ZRJA 3SNHA 2COFA 2COCA 2DYQA 3RCPA 2J0KA 5L81A 4EMOA 1V5MA 2N23A 1BTNA 3ULCA 4NY0A 4DX90 3PEGA 5HE0A 1FOEA 2AL6A 2IYBA 5C16A 2P0DA 4EKUA 2UZRA 3A8QA 3PVLA 3KSYA 2EJ8A 2D4QA 4PNKA 5C5BB 4HAZB 4GMVA 2LOZA 1K5DB 1W1DA 4KVGB 2RSGA 5KQ1A 4GPTB 2R0DA 1MIXA 3O96A 5FI0A 2M38A 4HB4B 1SHCA 5D3WA 1UNPA 5KQ4A 2Y8FA 3SYXA 1TXDA 1IRSA 4HB0B 4HAWB 4ZRKA 1DYNA 2VKIA 1NTVA 4A5KA 2D10A 3P6AA 5HE3A 2FJLA 2GCJA 2OQBA 3WA0A 1LW3A 4B6HA 1W1HA 4A6HA 3ZVRA 2DHIA 1EVHA 2YF0A 2D9VA 2M14A 1Q67A 2YRYA 3ODWA 4Z2NA 3DXCA 1ZSQA 1MAIA 3G9WA 1QQGA 3ODXA 1ZVRA 5EFXA 4YONA 2EMSA 3D8EA 2ZPYA 1P6SA 2NMBA 2ELBA 1AWEA 4MT7A 1P3RA 2L1CA 3T06A 1KZGA 4K2PA 1PMSA 4F7GA 2RNRB 3BJIA 2Z0PA 4KHBB 1EF1A 1ZM0A 2VSZA 2J0MA 2ROZB 4XWXA 3KZ1A 1UPRA 2YS5A 2YT1A 2DKQA 3TO1A 1U5DA 1H4RA 2H7EA 4CHMA 3PVWA 4DXAB 1ZC4B 5JP4A 3ULBA 3MDBC 2D9YA 1WG7A 5C79A 1U29A 3PG7A 2I5FA 2HTHB 3SV1A 2P8VA 1WJMA 4A6FB 3BINA 2QKMA 2GCLA 4HATB 1M7RA 2YVCA 3PZDA 4GZUA 2DLWA 1P5TA 4HAXB 2CODA 4Z2MB 1KZ7A 4MY6A 2LKOA 3HQCA 1WGUA 2LYDA 3QIJA 1XKEA 1MK9B 4WJ7A 1X1GA 1DBHA 2L2IA 1H10A 2Q13A 2JP2A 2D9XA 3TW1A 2YT0A 3GYOA 4C0AA 1OY2A 2K00A 2PZ1A 4NSWA 1NI2A 1BAKA 3CXBB 3UZTA 1DDMA 5JHGA 1NU2A 2DFKA 4ZRIA 4D0NB 1GC7A 1X1FA 3MPXA 4K2OA 2G35A 3PP2A 1ZC3B 2UVMA 1U5EA 2KGXB 2J0JA 1U5GA 1FGZA 1AQCA 5DHFB
chains in the Genus database with same CATH superfamily
2Y7BA 3FSSA 1WI1A 2DN6A 1MIZB 1UEFA 3M1IB 2CY5A 2FJUB 2OTXA 4IOYX 4DX8A 1EGXA 2CY4A 3VOQA 4GOUA 4IAPA 1M7EA 1MKEA 3V5WA 3ZDTA 2Z59A 3QBVB 4EJNA 3TCAA 1OMWA 2EMTA 3N7CA 3TFMA 4F7HA 1B55A 2KIGA 1V61A 3P7ZA 2DX5A 3B77A 3HIEA 2X18A 1X86A 2BCJA 4GN1A 3GYPA 1FGYA 3X23A 5CLLB 2D11A 1FAOA 2DX1A 2W2XC 4WSFA 1ZYIA 2Y8GA 5D3VA 4CHJA 5C5BA 1UNQA 1FHOA 2YSZA 5GOWB 5J3YA 2GJYA 4HDQA 2Z0OA 2CRFA 3A98B 4D6WA 3DCXA 1W1GA 1NTYA 4IFSA 5D27A 4QXAB 2P0HA 1DROA 4GMXB 5JLJB 1V88A 4HB3B 4DIXA 5HE1A 4Y94A 5C6RA 3IVFA 3U7DA 1QC6A 1XCGA 2MWNB 4QJ5B 4HHVA 1XX0A 4HAYB 1UPQA 2MDXA 2LG1A 2XQNM 1V5PA 5LOPB 2ROVA 3SO6A 5J3QA 1K5GB 3F5RA 1Z87A 3LJUX 4L6EA 1Y19B 2HE7A 2N0YA 2LULA 2W2WA 4CYEA 2DHKA 2D9ZA 4KHAA 1BTKA 1TQZA 3VIAA 4KHBA 5LONB 2ELAA 2H7DA 3AU4A 2GS0A 4K81A 1PFJA 4KHOA 1GC6A 2I1KA 2I5CA 1FB8A 2R09A 3DXEA 2MKRA 2EC1A 3PVUA 1DDVA 1U27A 2QKLA 2K8EA 2UZSA 2DA0A 1OQNA 3D8FA 1WVHA 1I2HA 2RGNB 2V76A 3U8ZA 3KY9A 3PSCA 2D2QA 1X11A 3AJ4A 4OT1A 1LB1A 3TVVA 4QJ3B 4OSNA 1TJ6A 5CLQB 2VRWB 2MFQA 5HE2A 3CIKA 3ML4A 4HAUB 4A6FA 5KCVA 4A6KA 1J0WA 4BBKA 1BWNA 1XD4A 1X05A 4P7IA 2E2XA 4KAXB 2LOXA 2RUKB 4H8SA 5DI9B 2W2XD 1SGHA 2YS1A 1N3HA 3KRWA 4TYZA 4HDOA 3D8DA 1Y5OA 2RVBB 1RRPB 2NZ8B 2CAYA 2I1JA 3HW2B 1MI1A 3KRXA 5DIFB 2D9WA 1V5UA 2KUPA 2KCJA 5DHAB 2DYNA 2Z13A 2P0FA 4HB2B 1WJ1A 3WYFB 2Z14A 4GXBA 3NW8A 4K17A 2K2UA 2DKPA 5FI1A 1XR0B 3F0WA 3OANA 3NWDA 1U2BA 1U5FA 4DBBA 4WVFB 2ADZA 2Z0QA 3DXDA 2RRFA 3ODOA 4F7UP 1RJ2A 2J59M 1KI1B 2RLOA 4MK0A 2IFSA 1EAZA 1ISNA 4YL8A 3HK0A 1E5WA 1I7AA 4HAVB 1J19A 3QWMA 1WGQA 3U12A 5D3YA 1GG3A 4PQ0A 2YS3A 1PLSA 5M4YB 2DTCA 1MPHA 1DDWA 3AU5A 3A8PA 1T77A 2K2JA 2KR0A 1XODA 5D3XA 1FHWA 5J3TA 2DHJA 3SUZA 3FM8C 2AEHA 3NSUA 4TKNA 1V89A 5DH9B 1UNRA 3FEHA 1FHXA 1MK7B 5JHHA 2COAA 4ZRJA 3SNHA 2COFA 2COCA 5LG4B 2DYQA 3RCPA 2J0KA 5L81A 4EMOA 1V5MA 2N23A 1BTNA 3ULCA 4NY0A 4DX90 5IRSA 3PEGA 5HE0A 1FOEA 2AL6A 2IYBA 2GUMA 5C16A 4QJ4B 2P0DA 3OHMB 4EKUA 2UZRA 3A8QA 3FVCA 3NWFA 3PVLA 4CSQA 3KSYA 2EJ8A 2D4QA 4PNKA 5C5BB 4L1RA 4HAZB 4GMVA 2LOZA 1K5DB 1W1DA 4KVGB 2RSGA 5KQ1A 4GPTB 2R0DA 1MIXA 3O96A 5FI0A 5I2SA 2M38A 4HB4B 1SHCA 5D3WA 1UNPA 5KQ4A 2Y8FA 3SYXA 1TXDA 1IRSA 4HB0B 4HAWB 4ZRKA 1DYNA 2VKIA 1NTVA 4A5KA 2D10A 3P6AA 5HE3A 2FJLA 2GCJA 2OQBA 3WA0A 2KUQA 1LW3A 4B6HA 1W1HA 2KIEA 2NBVA 4A6HA 3ZVRA 2DHIA 1EVHA 2ZKMX 2YF0A 2D9VA 2M14A 1Q67A 2YRYA 3ODWA 4Z2NA 3DXCA 1ZSQA 1MAIA 3G9WA 2YT2A 1QQGA 3ODXA 1ZVRA 5EFXA 4YONA 2EMSA 3D8EA 2ZPYA 1P6SA 2NMBA 2ELBA 1AWEA 4MT7A 1P3RA 2L1CA 3T06A 1KZGA 4K2PA 1PMSA 4F7GA 2RNRB 3BJIA 2Z0PA 4KHBB 1EF1A 1ZM0A 2VSZA 2J0MA 2ROZB 3HSAA 2Z4DA 4XWXA 3KZ1A 1UPRA 2YS5A 2YT1A 2DKQA 3TO1A 1U5DA 1H4RA 2H7EA 4CHMA 3PVWA 4DXAB 1ZC4B 3A58A 5JP4A 3ULBA 3MDBC 4GNKB 2D9YA 1WG7A 5C79A 1U29A 3PG7A 2I5FA 2HTHB 3NWAA 3SV1A 2P8VA 1WJMA 4A6FB 2K49A 3BINA 2QKMA 2GCLA 4HATB 1M7RA 2YVCA 3PZDA 4GZUA 2DLWA 1P5TA 4HAXB 2CODA 4Z2MB 1KZ7A 4MY6A 2R2YA 3HQCA 2LKOA 1WGUA 2LYDA 3QIJA 1XKEA 1MK9B 4WJ7A 1X1GA 1DBHA 2L2IA 1H10A 2Q13A 2JP2A 2D9XA 3TW1A 5I2MA 2YT0A 3GYOA 4C0AA 1OY2A 2K00A 2PZ1A 4NSWA 1NI2A 1BAKA 3CXBB 3UZTA 1DDMA 5JHGA 1NU2A 2DFKA 4ZRIA 4D0NB 1GC7A 4HSIA 1X1FA 3MPXA 4K2OA 2G35A 3PP2A 1ZC3B 2UVMA 1U5EA 2KGXB 2J0JA 1U5GA 1FGZA 1AQCA 5DHFB
chains in the Genus database with same CATH topology
2Y7BA 3FSSA 1WI1A 2DN6A 1MIZB 1UEFA 3M1IB 2CY5A 2OTXA 4IOYX 4DX8A 1EGXA 2CY4A 3VOQA 4IAPA 1M7EA 1MKEA 3V5WA 3ZDTA 3QBVB 4EJNA 3TCAA 1OMWA 2EMTA 3N7CA 3TFMA 4F7HA 1B55A 1V61A 3P7ZA 2DX5A 2X18A 1X86A 2BCJA 4GN1A 3GYPA 1FGYA 3X23A 5CLLB 2D11A 1FAOA 2DX1A 2W2XC 4WSFA 2Y8GA 5D3VA 4CHJA 5C5BA 1UNQA 1FHOA 2YSZA 5GOWB 5J3YA 2GJYA 4HDQA 2Z0OA 2CRFA 3A98B 1W1GA 1NTYA 4IFSA 5D27A 2P0HA 1DROA 4GMXB 5JLJB 1V88A 4HB3B 5HE1A 4Y94A 5C6RA 3IVFA 3U7DA 1QC6A 1XCGA 2MWNB 4HHVA 1XX0A 4HAYB 1UPQA 2MDXA 2LG1A 2XQNM 1V5PA 5LOPB 2ROVA 3SO6A 5J3QA 1K5GB 3F5RA 1Z87A 3LJUX 4L6EA 1Y19B 2HE7A 2N0YA 2LULA 2W2WA 4CYEA 2DHKA 2D9ZA 4KHAA 1BTKA 1TQZA 3VIAA 5LONB 2ELAA 2H7DA 3AU4A 2GS0A 4K81A 1PFJA 4KHOA 1GC6A 2I1KA 2I5CA 1FB8A 2R09A 3DXEA 2MKRA 2EC1A 3PVUA 1DDVA 1U27A 2QKLA 2UZSA 2DA0A 1OQNA 3D8FA 1WVHA 1I2HA 2RGNB 2V76A 3U8ZA 3KY9A 3PSCA 2D2QA 1X11A 3AJ4A 1LB1A 3TVVA 1TJ6A 5CLQB 2VRWB 2MFQA 5HE2A 3CIKA 3ML4A 4HAUB 4A6FA 5KCVA 4A6KA 1J0WA 4BBKA 1BWNA 1XD4A 1X05A 4P7IA 2E2XA 4KAXB 2LOXA 2RUKB 4H8SA 5DI9B 2W2XD 1SGHA 2YS1A 1N3HA 3KRWA 4TYZA 4HDOA 3D8DA 1Y5OA 2RVBB 1RRPB 2NZ8B 2CAYA 2I1JA 3HW2B 3KRXA 5DIFB 2D9WA 1V5UA 2KUPA 2KCJA 5DHAB 2DYNA 2P0FA 4HB2B 1WJ1A 3WYFB 4GXBA 4K17A 2K2UA 2DKPA 5FI1A 1XR0B 3F0WA 3OANA 1U2BA 1U5FA 4DBBA 4WVFB 2ADZA 2Z0QA 3DXDA 3ODOA 4F7UP 1RJ2A 2J59M 1KI1B 2RLOA 4MK0A 2IFSA 1EAZA 1ISNA 4YL8A 3HK0A 1E5WA 1I7AA 4HAVB 1J19A 3QWMA 1WGQA 5D3YA 1GG3A 4PQ0A 2YS3A 1PLSA 2DTCA 1MPHA 1DDWA 3AU5A 3A8PA 2K2JA 1XODA 5D3XA 1FHWA 5J3TA 2DHJA 3SUZA 3FM8C 2AEHA 3NSUA 4TKNA 1V89A 5DH9B 1UNRA 3FEHA 1FHXA 1MK7B 5JHHA 2COAA 4ZRJA 3SNHA 2COFA 2COCA 2DYQA 3RCPA 2J0KA 5L81A 4EMOA 1V5MA 2N23A 1BTNA 3ULCA 4NY0A 4DX90 3PEGA 5HE0A 1FOEA 2AL6A 2IYBA 5C16A 2P0DA 4EKUA 2UZRA 3A8QA 3PVLA 3KSYA 2EJ8A 2D4QA 4PNKA 5C5BB 4HAZB 4GMVA 2LOZA 1K5DB 1W1DA 4KVGB 2RSGA 5KQ1A 4GPTB 2R0DA 1MIXA 3O96A 5FI0A 2M38A 4HB4B 1SHCA 5D3WA 1UNPA 5KQ4A 2Y8FA 3SYXA 1TXDA 1IRSA 4HB0B 4HAWB 4ZRKA 1DYNA 2VKIA 1NTVA 4A5KA 2D10A 3P6AA 5HE3A 2FJLA 2GCJA 2OQBA 3WA0A 1LW3A 4B6HA 1W1HA 4A6HA 3ZVRA 2DHIA 1EVHA 2YF0A 2D9VA 2M14A 1Q67A 2YRYA 3ODWA 4Z2NA 3DXCA 1ZSQA 1MAIA 3G9WA 1QQGA 3ODXA 1ZVRA 5EFXA 4YONA 2EMSA 3D8EA 2ZPYA 1P6SA 2NMBA 2ELBA 1AWEA 4MT7A 1P3RA 2L1CA 3T06A 1KZGA 4K2PA 1PMSA 4F7GA 2RNRB 3BJIA 2Z0PA 4KHBB 1EF1A 1ZM0A 2VSZA 2J0MA 2ROZB 4XWXA 3KZ1A 1UPRA 2YS5A 2YT1A 2DKQA 3TO1A 1U5DA 1H4RA 2H7EA 4CHMA 3PVWA 4DXAB 1ZC4B 5JP4A 3ULBA 3MDBC 2D9YA 1WG7A 5C79A 1U29A 3PG7A 2I5FA 2HTHB 3SV1A 2P8VA 1WJMA 4A6FB 3BINA 2QKMA 2GCLA 4HATB 1M7RA 2YVCA 3PZDA 4GZUA 2DLWA 1P5TA 4HAXB 2CODA 4Z2MB 1KZ7A 4MY6A 2LKOA 3HQCA 1WGUA 2LYDA 3QIJA 1XKEA 1MK9B 4WJ7A 1X1GA 1DBHA 2L2IA 1H10A 2Q13A 2JP2A 2D9XA 3TW1A 2YT0A 3GYOA 4C0AA 1OY2A 2K00A 2PZ1A 4NSWA 1NI2A 1BAKA 3CXBB 3UZTA 1DDMA 5JHGA 1NU2A 2DFKA 4ZRIA 4D0NB 1GC7A 1X1FA 3MPXA 4K2OA 2G35A 3PP2A 1ZC3B 2UVMA 1U5EA 2KGXB 2J0JA 1U5GA 1FGZA 1AQCA 5DHFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7B A;  3FSS A;  1WI1 A;  2DN6 A;  1MIZ B;  1UEF A;  3M1I B;  2CY5 A;  2OTX A;  4IOY X;  4DX8 A;  1EGX A;  2CY4 A;  3VOQ A;  4IAP A;  1M7E A;  1MKE A;  3V5W A;  3ZDT A;  3QBV B;  4EJN A;  3TCA A;  1OMW A;  2EMT A;  3N7C A;  3TFM A;  4F7H A;  1B55 A;  1V61 A;  3P7Z A;  2DX5 A;  2X18 A;  1X86 A;  2BCJ A;  4GN1 A;  3GYP A;  1FGY A;  3X23 A;  5CLL B;  2D11 A;  1FAO A;  2DX1 A;  2W2X C;  4WSF A;  2Y8G A;  5D3V A;  4CHJ A;  5C5B A;  1UNQ A;  1FHO A;  2YSZ A;  5GOW B;  5J3Y A;  2GJY A;  4HDQ A;  2Z0O A;  2CRF A;  3A98 B;  1W1G A;  1NTY A;  4IFS A;  5D27 A;  2P0H A;  1DRO A;  4GMX B;  5JLJ B;  1V88 A;  4HB3 B;  5HE1 A;  4Y94 A;  5C6R A;  3IVF A;  3U7D A;  1QC6 A;  1XCG A;  2MWN B;  4HHV A;  1XX0 A;  4HAY B;  1UPQ A;  2MDX A;  2LG1 A;  2XQN M;  1V5P A;  5LOP B;  2ROV A;  3SO6 A;  5J3Q A;  1K5G B;  3F5R A;  1Z87 A;  3LJU X;  4L6E A;  1Y19 B;  2HE7 A;  2N0Y A;  2LUL A;  2W2W A;  4CYE A;  2DHK A;  2D9Z A;  4KHA A;  1BTK A;  1TQZ A;  3VIA A;  5LON B;  2ELA A;  2H7D A;  3AU4 A;  2GS0 A;  4K81 A;  1PFJ A;  4KHO A;  1GC6 A;  2I1K A;  2I5C A;  1FB8 A;  2R09 A;  3DXE A;  2MKR A;  2EC1 A;  3PVU A;  1DDV A;  1U27 A;  2QKL A;  2UZS A;  2DA0 A;  1OQN A;  3D8F A;  1WVH A;  1I2H A;  2RGN B;  2V76 A;  3U8Z A;  3KY9 A;  3PSC A;  2D2Q A;  1X11 A;  3AJ4 A;  1LB1 A;  3TVV A;  1TJ6 A;  5CLQ B;  2VRW B;  2MFQ A;  5HE2 A;  3CIK A;  3ML4 A;  4HAU B;  4A6F A;  5KCV A;  4A6K A;  1J0W A;  4BBK A;  1BWN A;  1XD4 A;  1X05 A;  4P7I A;  2E2X A;  4KAX B;  2LOX A;  2RUK B;  4H8S A;  5DI9 B;  2W2X D;  1SGH A;  2YS1 A;  1N3H A;  3KRW A;  4TYZ A;  4HDO A;  3D8D A;  1Y5O A;  2RVB B;  1RRP B;  2NZ8 B;  2CAY A;  2I1J A;  3HW2 B;  3KRX A;  5DIF B;  2D9W A;  1V5U A;  2KUP A;  2KCJ A;  5DHA B;  2DYN A;  2P0F A;  4HB2 B;  1WJ1 A;  3WYF B;  4GXB A;  4K17 A;  2K2U A;  2DKP A;  5FI1 A;  1XR0 B;  3F0W A;  3OAN A;  1U2B A;  1U5F A;  4DBB A;  4WVF B;  2ADZ A;  2Z0Q A;  3DXD A;  3ODO A;  4F7U P;  1RJ2 A;  2J59 M;  1KI1 B;  2RLO A;  4MK0 A;  2IFS A;  1EAZ A;  1ISN A;  4YL8 A;  3HK0 A;  1E5W A;  1I7A A;  4HAV B;  1J19 A;  3QWM A;  1WGQ A;  5D3Y A;  1GG3 A;  4PQ0 A;  2YS3 A;  1PLS A;  2DTC A;  1MPH A;  1DDW A;  3AU5 A;  3A8P A;  2K2J A;  1XOD A;  5D3X A;  1FHW A;  5J3T A;  2DHJ A;  3SUZ A;  3FM8 C;  2AEH A;  3NSU A;  4TKN A;  1V89 A;  5DH9 B;  1UNR A;  3FEH A;  1FHX A;  1MK7 B;  5JHH A;  2COA A;  4ZRJ A;  3SNH A;  2COF A;  2COC A;  2DYQ A;  3RCP A;  2J0K A;  5L81 A;  4EMO A;  1V5M A;  2N23 A;  1BTN A;  3ULC A;  4NY0 A;  4DX9 0;  3PEG A;  5HE0 A;  1FOE A;  2AL6 A;  2IYB A;  5C16 A;  2P0D A;  4EKU A;  2UZR A;  3A8Q A;  3PVL A;  3KSY A;  2EJ8 A;  2D4Q A;  4PNK A;  5C5B B;  4HAZ B;  4GMV A;  2LOZ A;  1K5D B;  1W1D A;  4KVG B;  2RSG A;  5KQ1 A;  4GPT B;  2R0D A;  1MIX A;  3O96 A;  5FI0 A;  2M38 A;  4HB4 B;  1SHC A;  5D3W A;  1UNP A;  5KQ4 A;  2Y8F A;  3SYX A;  1TXD A;  1IRS A;  4HB0 B;  4HAW B;  4ZRK A;  1DYN A;  2VKI A;  1NTV A;  4A5K A;  2D10 A;  3P6A A;  5HE3 A;  2FJL A;  2GCJ A;  2OQB A;  3WA0 A;  1LW3 A;  4B6H A;  1W1H A;  4A6H A;  3ZVR A;  2DHI A;  1EVH A;  2YF0 A;  2D9V A;  2M14 A;  1Q67 A;  2YRY A;  3ODW A;  4Z2N A;  3DXC A;  1ZSQ A;  1MAI A;  3G9W A;  1QQG A;  3ODX A;  1ZVR A;  5EFX A;  4YON A;  2EMS A;  3D8E A;  2ZPY A;  1P6S A;  2NMB A;  2ELB A;  1AWE A;  4MT7 A;  1P3R A;  2L1C A;  3T06 A;  1KZG A;  4K2P A;  1PMS A;  4F7G A;  2RNR B;  3BJI A;  2Z0P A;  4KHB B;  1EF1 A;  1ZM0 A;  2VSZ A;  2J0M A;  2ROZ B;  4XWX A;  3KZ1 A;  1UPR A;  2YS5 A;  2YT1 A;  2DKQ A;  3TO1 A;  1U5D A;  1H4R A;  2H7E A;  4CHM A;  3PVW A;  4DXA B;  1ZC4 B;  5JP4 A;  3ULB A;  3MDB C;  2D9Y A;  1WG7 A;  5C79 A;  1U29 A;  3PG7 A;  2I5F A;  2HTH B;  3SV1 A;  2P8V A;  1WJM A;  4A6F B;  3BIN A;  2QKM A;  2GCL A;  4HAT B;  1M7R A;  2YVC A;  3PZD A;  4GZU A;  2DLW A;  1P5T A;  4HAX B;  2COD A;  4Z2M B;  1KZ7 A;  4MY6 A;  2LKO A;  3HQC A;  1WGU A;  2LYD A;  3QIJ A;  1XKE A;  1MK9 B;  4WJ7 A;  1X1G A;  1DBH A;  2L2I A;  1H10 A;  2Q13 A;  2JP2 A;  2D9X A;  3TW1 A;  2YT0 A;  3GYO A;  4C0A A;  1OY2 A;  2K00 A;  2PZ1 A;  4NSW A;  1NI2 A;  1BAK A;  3CXB B;  3UZT A;  1DDM A;  5JHG A;  1NU2 A;  2DFK A;  4ZRI A;  4D0N B;  1GC7 A;  1X1F A;  3MPX A;  4K2O A;  2G35 A;  3PP2 A;  1ZC3 B;  2UVM A;  1U5E A;  2KGX B;  2J0J A;  1U5G A;  1FGZ A;  1AQC A;  5DHF B; 
#chains in the Genus database with same CATH topology
 2Y7B A;  3FSS A;  1WI1 A;  2DN6 A;  1MIZ B;  1UEF A;  3M1I B;  2CY5 A;  2FJU B;  2OTX A;  4IOY X;  4DX8 A;  1EGX A;  2CY4 A;  3VOQ A;  4GOU A;  4IAP A;  1M7E A;  1MKE A;  3V5W A;  3ZDT A;  2Z59 A;  3QBV B;  4EJN A;  3TCA A;  1OMW A;  2EMT A;  3N7C A;  3TFM A;  4F7H A;  1B55 A;  2KIG A;  1V61 A;  3P7Z A;  2DX5 A;  3B77 A;  3HIE A;  2X18 A;  1X86 A;  2BCJ A;  4GN1 A;  3GYP A;  1FGY A;  3X23 A;  5CLL B;  2D11 A;  1FAO A;  2DX1 A;  2W2X C;  4WSF A;  1ZYI A;  2Y8G A;  5D3V A;  4CHJ A;  5C5B A;  1UNQ A;  1FHO A;  2YSZ A;  5GOW B;  5J3Y A;  2GJY A;  4HDQ A;  2Z0O A;  2CRF A;  3A98 B;  4D6W A;  3DCX A;  1W1G A;  1NTY A;  4IFS A;  5D27 A;  4QXA B;  2P0H A;  1DRO A;  4GMX B;  5JLJ B;  1V88 A;  4HB3 B;  4DIX A;  5HE1 A;  4Y94 A;  5C6R A;  3IVF A;  3U7D A;  1QC6 A;  1XCG A;  2MWN B;  4QJ5 B;  4HHV A;  1XX0 A;  4HAY B;  1UPQ A;  2MDX A;  2LG1 A;  2XQN M;  1V5P A;  5LOP B;  2ROV A;  3SO6 A;  5J3Q A;  1K5G B;  3F5R A;  1Z87 A;  3LJU X;  4L6E A;  1Y19 B;  2HE7 A;  2N0Y A;  2LUL A;  2W2W A;  4CYE A;  2DHK A;  2D9Z A;  4KHA A;  1BTK A;  1TQZ A;  3VIA A;  4KHB A;  5LON B;  2ELA A;  2H7D A;  3AU4 A;  2GS0 A;  4K81 A;  1PFJ A;  4KHO A;  1GC6 A;  2I1K A;  2I5C A;  1FB8 A;  2R09 A;  3DXE A;  2MKR A;  2EC1 A;  3PVU A;  1DDV A;  1U27 A;  2QKL A;  2K8E A;  2UZS A;  2DA0 A;  1OQN A;  3D8F A;  1WVH A;  1I2H A;  2RGN B;  2V76 A;  3U8Z A;  3KY9 A;  3PSC A;  2D2Q A;  1X11 A;  3AJ4 A;  4OT1 A;  1LB1 A;  3TVV A;  4QJ3 B;  4OSN A;  1TJ6 A;  5CLQ B;  2VRW B;  2MFQ A;  5HE2 A;  3CIK A;  3ML4 A;  4HAU B;  4A6F A;  5KCV A;  4A6K A;  1J0W A;  4BBK A;  1BWN A;  1XD4 A;  1X05 A;  4P7I A;  2E2X A;  4KAX B;  2LOX A;  2RUK B;  4H8S A;  5DI9 B;  2W2X D;  1SGH A;  2YS1 A;  1N3H A;  3KRW A;  4TYZ A;  4HDO A;  3D8D A;  1Y5O A;  2RVB B;  1RRP B;  2NZ8 B;  2CAY A;  2I1J A;  3HW2 B;  1MI1 A;  3KRX A;  5DIF B;  2D9W A;  1V5U A;  2KUP A;  2KCJ A;  5DHA B;  2DYN A;  2Z13 A;  2P0F A;  4HB2 B;  1WJ1 A;  3WYF B;  2Z14 A;  4GXB A;  3NW8 A;  4K17 A;  2K2U A;  2DKP A;  5FI1 A;  1XR0 B;  3F0W A;  3OAN A;  3NWD A;  1U2B A;  1U5F A;  4DBB A;  4WVF B;  2ADZ A;  2Z0Q A;  3DXD A;  2RRF A;  3ODO A;  4F7U P;  1RJ2 A;  2J59 M;  1KI1 B;  2RLO A;  4MK0 A;  2IFS A;  1EAZ A;  1ISN A;  4YL8 A;  3HK0 A;  1E5W A;  1I7A A;  4HAV B;  1J19 A;  3QWM A;  1WGQ A;  3U12 A;  5D3Y A;  1GG3 A;  4PQ0 A;  2YS3 A;  1PLS A;  5M4Y B;  2DTC A;  1MPH A;  1DDW A;  3AU5 A;  3A8P A;  1T77 A;  2K2J A;  2KR0 A;  1XOD A;  5D3X A;  1FHW A;  5J3T A;  2DHJ A;  3SUZ A;  3FM8 C;  2AEH A;  3NSU A;  4TKN A;  1V89 A;  5DH9 B;  1UNR A;  3FEH A;  1FHX A;  1MK7 B;  5JHH A;  2COA A;  4ZRJ A;  3SNH A;  2COF A;  2COC A;  5LG4 B;  2DYQ A;  3RCP A;  2J0K A;  5L81 A;  4EMO A;  1V5M A;  2N23 A;  1BTN A;  3ULC A;  4NY0 A;  4DX9 0;  5IRS A;  3PEG A;  5HE0 A;  1FOE A;  2AL6 A;  2IYB A;  2GUM A;  5C16 A;  4QJ4 B;  2P0D A;  3OHM B;  4EKU A;  2UZR A;  3A8Q A;  3FVC A;  3NWF A;  3PVL A;  4CSQ A;  3KSY A;  2EJ8 A;  2D4Q A;  4PNK A;  5C5B B;  4L1R A;  4HAZ B;  4GMV A;  2LOZ A;  1K5D B;  1W1D A;  4KVG B;  2RSG A;  5KQ1 A;  4GPT B;  2R0D A;  1MIX A;  3O96 A;  5FI0 A;  5I2S A;  2M38 A;  4HB4 B;  1SHC A;  5D3W A;  1UNP A;  5KQ4 A;  2Y8F A;  3SYX A;  1TXD A;  1IRS A;  4HB0 B;  4HAW B;  4ZRK A;  1DYN A;  2VKI A;  1NTV A;  4A5K A;  2D10 A;  3P6A A;  5HE3 A;  2FJL A;  2GCJ A;  2OQB A;  3WA0 A;  2KUQ A;  1LW3 A;  4B6H A;  1W1H A;  2KIE A;  2NBV A;  4A6H A;  3ZVR A;  2DHI A;  1EVH A;  2ZKM X;  2YF0 A;  2D9V A;  2M14 A;  1Q67 A;  2YRY A;  3ODW A;  4Z2N A;  3DXC A;  1ZSQ A;  1MAI A;  3G9W A;  2YT2 A;  1QQG A;  3ODX A;  1ZVR A;  5EFX A;  4YON A;  2EMS A;  3D8E A;  2ZPY A;  1P6S A;  2NMB A;  2ELB A;  1AWE A;  4MT7 A;  1P3R A;  2L1C A;  3T06 A;  1KZG A;  4K2P A;  1PMS A;  4F7G A;  2RNR B;  3BJI A;  2Z0P A;  4KHB B;  1EF1 A;  1ZM0 A;  2VSZ A;  2J0M A;  2ROZ B;  3HSA A;  2Z4D A;  4XWX A;  3KZ1 A;  1UPR A;  2YS5 A;  2YT1 A;  2DKQ A;  3TO1 A;  1U5D A;  1H4R A;  2H7E A;  4CHM A;  3PVW A;  4DXA B;  1ZC4 B;  3A58 A;  5JP4 A;  3ULB A;  3MDB C;  4GNK B;  2D9Y A;  1WG7 A;  5C79 A;  1U29 A;  3PG7 A;  2I5F A;  2HTH B;  3NWA A;  3SV1 A;  2P8V A;  1WJM A;  4A6F B;  2K49 A;  3BIN A;  2QKM A;  2GCL A;  4HAT B;  1M7R A;  2YVC A;  3PZD A;  4GZU A;  2DLW A;  1P5T A;  4HAX B;  2COD A;  4Z2M B;  1KZ7 A;  4MY6 A;  2R2Y A;  3HQC A;  2LKO A;  1WGU A;  2LYD A;  3QIJ A;  1XKE A;  1MK9 B;  4WJ7 A;  1X1G A;  1DBH A;  2L2I A;  1H10 A;  2Q13 A;  2JP2 A;  2D9X A;  3TW1 A;  5I2M A;  2YT0 A;  3GYO A;  4C0A A;  1OY2 A;  2K00 A;  2PZ1 A;  4NSW A;  1NI2 A;  1BAK A;  3CXB B;  3UZT A;  1DDM A;  5JHG A;  1NU2 A;  2DFK A;  4ZRI A;  4D0N B;  1GC7 A;  4HSI A;  1X1F A;  3MPX A;  4K2O A;  2G35 A;  3PP2 A;  1ZC3 B;  2UVM A;  1U5E A;  2KGX B;  2J0J A;  1U5G A;  1FGZ A;  1AQC A;  5DHF B; 
#chains in the Genus database with same CATH homology
 2Y7B A;  3FSS A;  1WI1 A;  2DN6 A;  1MIZ B;  1UEF A;  3M1I B;  2CY5 A;  2OTX A;  4IOY X;  4DX8 A;  1EGX A;  2CY4 A;  3VOQ A;  4IAP A;  1M7E A;  1MKE A;  3V5W A;  3ZDT A;  3QBV B;  4EJN A;  3TCA A;  1OMW A;  2EMT A;  3N7C A;  3TFM A;  4F7H A;  1B55 A;  1V61 A;  3P7Z A;  2DX5 A;  2X18 A;  1X86 A;  2BCJ A;  4GN1 A;  3GYP A;  1FGY A;  3X23 A;  5CLL B;  2D11 A;  1FAO A;  2DX1 A;  2W2X C;  4WSF A;  2Y8G A;  5D3V A;  4CHJ A;  5C5B A;  1UNQ A;  1FHO A;  2YSZ A;  5GOW B;  5J3Y A;  2GJY A;  4HDQ A;  2Z0O A;  2CRF A;  3A98 B;  1W1G A;  1NTY A;  4IFS A;  5D27 A;  2P0H A;  1DRO A;  4GMX B;  5JLJ B;  1V88 A;  4HB3 B;  5HE1 A;  4Y94 A;  5C6R A;  3IVF A;  3U7D A;  1QC6 A;  1XCG A;  2MWN B;  4HHV A;  1XX0 A;  4HAY B;  1UPQ A;  2MDX A;  2LG1 A;  2XQN M;  1V5P A;  5LOP B;  2ROV A;  3SO6 A;  5J3Q A;  1K5G B;  3F5R A;  1Z87 A;  3LJU X;  4L6E A;  1Y19 B;  2HE7 A;  2N0Y A;  2LUL A;  2W2W A;  4CYE A;  2DHK A;  2D9Z A;  4KHA A;  1BTK A;  1TQZ A;  3VIA A;  5LON B;  2ELA A;  2H7D A;  3AU4 A;  2GS0 A;  4K81 A;  1PFJ A;  4KHO A;  1GC6 A;  2I1K A;  2I5C A;  1FB8 A;  2R09 A;  3DXE A;  2MKR A;  2EC1 A;  3PVU A;  1DDV A;  1U27 A;  2QKL A;  2UZS A;  2DA0 A;  1OQN A;  3D8F A;  1WVH A;  1I2H A;  2RGN B;  2V76 A;  3U8Z A;  3KY9 A;  3PSC A;  2D2Q A;  1X11 A;  3AJ4 A;  1LB1 A;  3TVV A;  1TJ6 A;  5CLQ B;  2VRW B;  2MFQ A;  5HE2 A;  3CIK A;  3ML4 A;  4HAU B;  4A6F A;  5KCV A;  4A6K A;  1J0W A;  4BBK A;  1BWN A;  1XD4 A;  1X05 A;  4P7I A;  2E2X A;  4KAX B;  2LOX A;  2RUK B;  4H8S A;  5DI9 B;  2W2X D;  1SGH A;  2YS1 A;  1N3H A;  3KRW A;  4TYZ A;  4HDO A;  3D8D A;  1Y5O A;  2RVB B;  1RRP B;  2NZ8 B;  2CAY A;  2I1J A;  3HW2 B;  3KRX A;  5DIF B;  2D9W A;  1V5U A;  2KUP A;  2KCJ A;  5DHA B;  2DYN A;  2P0F A;  4HB2 B;  1WJ1 A;  3WYF B;  4GXB A;  4K17 A;  2K2U A;  2DKP A;  5FI1 A;  1XR0 B;  3F0W A;  3OAN A;  1U2B A;  1U5F A;  4DBB A;  4WVF B;  2ADZ A;  2Z0Q A;  3DXD A;  3ODO A;  4F7U P;  1RJ2 A;  2J59 M;  1KI1 B;  2RLO A;  4MK0 A;  2IFS A;  1EAZ A;  1ISN A;  4YL8 A;  3HK0 A;  1E5W A;  1I7A A;  4HAV B;  1J19 A;  3QWM A;  1WGQ A;  5D3Y A;  1GG3 A;  4PQ0 A;  2YS3 A;  1PLS A;  2DTC A;  1MPH A;  1DDW A;  3AU5 A;  3A8P A;  2K2J A;  1XOD A;  5D3X A;  1FHW A;  5J3T A;  2DHJ A;  3SUZ A;  3FM8 C;  2AEH A;  3NSU A;  4TKN A;  1V89 A;  5DH9 B;  1UNR A;  3FEH A;  1FHX A;  1MK7 B;  5JHH A;  2COA A;  4ZRJ A;  3SNH A;  2COF A;  2COC A;  2DYQ A;  3RCP A;  2J0K A;  5L81 A;  4EMO A;  1V5M A;  2N23 A;  1BTN A;  3ULC A;  4NY0 A;  4DX9 0;  3PEG A;  5HE0 A;  1FOE A;  2AL6 A;  2IYB A;  5C16 A;  2P0D A;  4EKU A;  2UZR A;  3A8Q A;  3PVL A;  3KSY A;  2EJ8 A;  2D4Q A;  4PNK A;  5C5B B;  4HAZ B;  4GMV A;  2LOZ A;  1K5D B;  1W1D A;  4KVG B;  2RSG A;  5KQ1 A;  4GPT B;  2R0D A;  1MIX A;  3O96 A;  5FI0 A;  2M38 A;  4HB4 B;  1SHC A;  5D3W A;  1UNP A;  5KQ4 A;  2Y8F A;  3SYX A;  1TXD A;  1IRS A;  4HB0 B;  4HAW B;  4ZRK A;  1DYN A;  2VKI A;  1NTV A;  4A5K A;  2D10 A;  3P6A A;  5HE3 A;  2FJL A;  2GCJ A;  2OQB A;  3WA0 A;  1LW3 A;  4B6H A;  1W1H A;  4A6H A;  3ZVR A;  2DHI A;  1EVH A;  2YF0 A;  2D9V A;  2M14 A;  1Q67 A;  2YRY A;  3ODW A;  4Z2N A;  3DXC A;  1ZSQ A;  1MAI A;  3G9W A;  1QQG A;  3ODX A;  1ZVR A;  5EFX A;  4YON A;  2EMS A;  3D8E A;  2ZPY A;  1P6S A;  2NMB A;  2ELB A;  1AWE A;  4MT7 A;  1P3R A;  2L1C A;  3T06 A;  1KZG A;  4K2P A;  1PMS A;  4F7G A;  2RNR B;  3BJI A;  2Z0P A;  4KHB B;  1EF1 A;  1ZM0 A;  2VSZ A;  2J0M A;  2ROZ B;  4XWX A;  3KZ1 A;  1UPR A;  2YS5 A;  2YT1 A;  2DKQ A;  3TO1 A;  1U5D A;  1H4R A;  2H7E A;  4CHM A;  3PVW A;  4DXA B;  1ZC4 B;  5JP4 A;  3ULB A;  3MDB C;  2D9Y A;  1WG7 A;  5C79 A;  1U29 A;  3PG7 A;  2I5F A;  2HTH B;  3SV1 A;  2P8V A;  1WJM A;  4A6F B;  3BIN A;  2QKM A;  2GCL A;  4HAT B;  1M7R A;  2YVC A;  3PZD A;  4GZU A;  2DLW A;  1P5T A;  4HAX B;  2COD A;  4Z2M B;  1KZ7 A;  4MY6 A;  2LKO A;  3HQC A;  1WGU A;  2LYD A;  3QIJ A;  1XKE A;  1MK9 B;  4WJ7 A;  1X1G A;  1DBH A;  2L2I A;  1H10 A;  2Q13 A;  2JP2 A;  2D9X A;  3TW1 A;  2YT0 A;  3GYO A;  4C0A A;  1OY2 A;  2K00 A;  2PZ1 A;  4NSW A;  1NI2 A;  1BAK A;  3CXB B;  3UZT A;  1DDM A;  5JHG A;  1NU2 A;  2DFK A;  4ZRI A;  4D0N B;  1GC7 A;  1X1F A;  3MPX A;  4K2O A;  2G35 A;  3PP2 A;  1ZC3 B;  2UVM A;  1U5E A;  2KGX B;  2J0J A;  1U5G A;  1FGZ A;  1AQC A;  5DHF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...