1Q67A

Crystal structure of dcp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
146
Chain Sequence
LNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decapping protein involved in mRNA degradation-Dcp1p
publication title Crystal structure of Dcp1p and its functional implications in mRNA decapping
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 36
structure length 146
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1q67A01
4HAYB 4F7HA 4EJNA 4IOYX 2I1KA 2YVCA 4HB0B 2AL6A 1EVHA 4HAVB 3PEGA 1BTNA 4Y94A 2I1JA 1SGHA 1OMWA 3TO1A 2UZRA 1OQNA 3KRXA 1WJ1A 2ADZA 2DHKA 4KHOA 1V89A 2Y8GA 3A8QA 2NZ8B 4MK0A 1H10A 2GCJA 4H8SA 1J0WA 2VKIA 3PZDA 4PNKA 2K2UA 4EKUA 1Y5OA 1XCGA 2R0DA 2D11A 3D8DA 2RNRB 5LONB 4NY0A 2LULA 2R09A 2W2WA 4CHJA 1UPRA 2GCLA 1GG3A 4PQ0A 4F7UP 5HE1A 1X1GA 1U5EA 2DX1A 2Y8FA 2D9XA 1DBHA 4KHAA 4YL8A 2YRYA 1PMSA 1TQZA 2CAYA 1U2BA 2EJ8A 2XQNM 2P0FA 4GMXB 4DXAB 3V5WA 2LKOA 1TXDA 1UNPA 3RCPA 5DHAB 4DX90 1DDWA 3TCAA 2D9YA 1ZC4B 3SUZA 2QKLA 1RJ2A 5GOWB 4GZUA 4HDQA 1UEFA 3DXCA 1X05A 3M1IB 1X11A 5LOPB 1V5UA 3KRWA 2I5CA 2K00A 1M7EA 3N7CA 1UPQA 1GC6A 2OQBA 2DX5A 1GC7A 2RLOA 2MFQA 3LJUX 4CYEA 2PZ1A 3SO6A 2YF0A 2D9ZA 2Z0QA 5D3XA 3X23A 1AWEA 1U5DA 5J3TA 1DDVA 1KZ7A 4TYZA 1XD4A 1Z87A 3WYFB 3ODWA 3CXBB 1WVHA 1UNRA 1P6SA 1ZM0A 2W2XC 3A98B 2LOZA 1W1DA 1WI1A 2ZPYA 4A6HA 1E5WA 3KZ1A 4KAXB 4XWXA 4HB2B 2Z0OA 3VOQA 5CLLB 2IFSA 3ULBA 3TW1A 2MKRA 4K17A 1NTVA 2N23A 1LW3A 2X18A 1U29A 4WVFB 2OTXA 1V88A 1MIZB 5DH9B 4BBKA 2D10A 3PP2A 5DHFB 5JHHA 3AJ4A 1XR0B 2J59M 4ZRKA 1H4RA 3SV1A 1EGXA 2RSGA 1W1HA 2H7DA 1V5MA 2RUKB 2HTHB 4IAPA 4L6EA 2EMSA 5D3WA 1EF1A 2EMTA 1XKEA 3CIKA 4HAUB 1OY2A 1MPHA 1MIXA 2LOXA 2P0HA 5C79A 2DYNA 2DN6A 1PFJA 1X1FA 2MWNB 3IVFA 1I7AA 4ZRIA 1NU2A 2ROZB 2GJYA 2VSZA 1FHOA 5JHGA 1EAZA 4IFSA 1SHCA 1B55A 3U7DA 1MK9B 5EFXA 2M14A 4KVGB 1WJMA 1U5FA 2DYQA 4A6FA 5D3YA 3OANA 3F5RA 1FOEA 3D8FA 3ZDTA 4HAXB 4HAWB 4HB3B 1FHWA 2DA0A 3GYPA 3ODOA 2DLWA 4HB4B 3FEHA 1WGQA 1DROA 1PLSA 2CRFA 2FJLA 2IYBA 5DIFB 1ZSQA 3MDBC 1NTYA 2NMBA 4HDOA 4F7GA 2EC1A 2CY5A 2E2XA 4K2PA 1DDMA 2K2JA 2YS5A 5D27A 1KI1B 2JP2A 4A6FB 2UZSA 1IRSA 2KGXB 2VRWB 3MPXA 3F0WA 3QBVB 4ZRJA 3PVLA 3PVUA 1QC6A 4DBBA 2AEHA 3PSCA 3U8ZA 4P7IA 3FM8C 3PG7A 1X86A 2G35A 5JLJB 2H7EA 2DKQA 4Z2MB 2LG1A 4A6KA 5JP4A 3ML4A 5L81A 2YT0A 3G9WA 2Q13A 4DX8A 3P7ZA 1N3HA 1U5GA 2DTCA 3HW2B 1P5TA 4GPTB 3ULCA 4GXBA 5J3QA 2V76A 3NSUA 3BJIA 1DYNA 1BTKA 4EMOA 3HK0A 2ROVA 2P8VA 1BAKA 3SNHA 3T06A 3DXDA 1V5PA 2Z0PA 4KHBB 2J0MA 2COCA 2Y7BA 2KCJA 4NSWA 2I5FA 3UZTA 5KCVA 4A5KA 2YS1A 2LYDA 3TFMA 3ZVRA 2DHIA 3SYXA 1U27A 2DHJA 2YS3A 1I2HA 5C16A 3QIJA 3A8PA 1UNQA 5C6RA 4MT7A 4Z2NA 2J0JA 5DI9B 2QKMA 1P3RA 5FI1A 3QWMA 4YONA 1AQCA 2L2IA 3P6AA 1LB1A 2CY4A 4WJ7A 4HAZB 1Y19B 3HQCA 3O96A 5C5BA 2BCJA 2KUPA 5KQ4A 3ODXA 1QQGA 3AU4A 5KQ1A 1XODA 4WSFA 3GYOA 1ZVRA 1K5GB 4CHMA 2GS0A 1TJ6A 2MDXA 2D9WA 4MY6A 3VIAA 1WGUA 1MKEA 3KY9A 1FHXA 2N0YA 5CLQB 2L1CA 2UVMA 3KSYA 5HE0A 2D4QA 3WA0A 1MK7B 4HHVA 4GMVA 1BWNA 3AU5A 2RGNB 2M38A 5C5BB 2YSZA 1W1GA 1FGZA 4GN1A 5HE3A 5HE2A 2YT1A 2P0DA 2ELAA 2RVBB 1K5DB 1FB8A 2D9VA 2COAA 3FSSA 2W2XD 5J3YA 4K2OA 2COFA 5D3VA 2ELBA 1M7RA 1MAIA 2HE7A 1ZC3B 4B6HA 1RRPB 4D0NB 1WG7A 1ISNA 3TVVA 2DKPA 1NI2A 2CODA 1Q67A 2DFKA 3PVWA 4HATB 2D2QA 1FGYA 4TKNA 3DXEA 4K81A 3D8EA 1FAOA 1KZGA 1XX0A 2J0KA 1V61A 3BINA 1J19A 5FI0A 4C0AA
chains in the Genus database with same CATH superfamily
4HAYB 4F7HA 4EJNA 4IOYX 2I1KA 2YVCA 4HB0B 2AL6A 1EVHA 4HAVB 2RRFA 3PEGA 1BTNA 4Y94A 2I1JA 1SGHA 1OMWA 2NBVA 3TO1A 2UZRA 1OQNA 3KRXA 1WJ1A 2ADZA 2DHKA 2Z14A 4KHOA 1V89A 2Y8GA 3A8QA 3NWAA 2NZ8B 4MK0A 5M4YB 1H10A 2GCJA 4H8SA 2ZKMX 1J0WA 2VKIA 3PZDA 4PNKA 2K2UA 4EKUA 1Y5OA 1XCGA 2K8EA 2R0DA 2D11A 3D8DA 2RNRB 2KIGA 5LONB 4NY0A 2LULA 2R09A 2W2WA 4CHJA 1UPRA 4L1RA 2GCLA 3NWDA 1GG3A 4PQ0A 1T77A 4F7UP 5HE1A 1X1GA 1U5EA 2DX1A 2Y8FA 2D9XA 1DBHA 4KHAA 4YL8A 2YRYA 1PMSA 1TQZA 2CAYA 1U2BA 2EJ8A 2XQNM 2P0FA 4GMXB 4DXAB 3V5WA 2LKOA 1TXDA 1UNPA 3RCPA 5DHAB 4DX90 1DDWA 3TCAA 2D9YA 1ZC4B 3A58A 3SUZA 2QKLA 1RJ2A 5GOWB 4GZUA 3FVCA 2Z13A 4HDQA 1UEFA 3DXCA 1X05A 3M1IB 1X11A 5LOPB 1V5UA 3KRWA 2I5CA 2K00A 4CSQA 1M7EA 3N7CA 1UPQA 1GC6A 2OQBA 2DX5A 1GC7A 2RLOA 2MFQA 3LJUX 1MI1A 4QJ4B 4CYEA 2PZ1A 3SO6A 2YF0A 2D9ZA 2Z0QA 5D3XA 3OHMB 3X23A 1AWEA 1U5DA 5J3TA 1DDVA 1KZ7A 4TYZA 1XD4A 1Z87A 3NWFA 3WYFB 3ODWA 3CXBB 1WVHA 1UNRA 1P6SA 1ZM0A 2W2XC 3A98B 2LOZA 1W1DA 1WI1A 2ZPYA 4A6HA 1E5WA 3KZ1A 4KAXB 4XWXA 4HB2B 2Z0OA 3VOQA 5CLLB 2IFSA 3ULBA 3TW1A 2MKRA 4K17A 4GOUA 1NTVA 2N23A 1LW3A 2X18A 1U29A 4WVFB 2OTXA 1V88A 1MIZB 5DH9B 4BBKA 2D10A 3PP2A 5DHFB 5JHHA 3AJ4A 1XR0B 2J59M 4ZRKA 1H4RA 2YT2A 3SV1A 1EGXA 2RSGA 1W1HA 2H7DA 1V5MA 2RUKB 2HTHB 4IAPA 4L6EA 2EMSA 5D3WA 1EF1A 3HSAA 2EMTA 1XKEA 3CIKA 4HAUB 1OY2A 1MPHA 1MIXA 2LOXA 2P0HA 5C79A 2DYNA 2DN6A 1PFJA 5IRSA 1X1FA 2MWNB 3IVFA 1I7AA 4ZRIA 4QJ3B 3U12A 1NU2A 2ROZB 2GJYA 2VSZA 4QJ5B 1FHOA 5JHGA 1EAZA 4IFSA 1SHCA 1B55A 3U7DA 1MK9B 3DCXA 5EFXA 2M14A 4KVGB 1WJMA 1U5FA 2KR0A 4DIXA 2DYQA 2KIEA 4A6FA 5D3YA 3OANA 3F5RA 1FOEA 3D8FA 3ZDTA 4HAXB 4HAWB 4HB3B 1FHWA 2DA0A 3GYPA 3ODOA 2DLWA 4HB4B 3FEHA 1WGQA 1DROA 1PLSA 2CRFA 2FJLA 2IYBA 5DIFB 1ZSQA 4QXAB 3MDBC 1NTYA 2NMBA 4HDOA 4F7GA 2EC1A 2CY5A 2E2XA 4K2PA 2KUQA 1DDMA 2K2JA 2YS5A 5D27A 1KI1B 2JP2A 4A6FB 2UZSA 4HSIA 1IRSA 2KGXB 2VRWB 3B77A 3MPXA 3F0WA 3QBVB 4ZRJA 3PVLA 3PVUA 1QC6A 4DBBA 2AEHA 3PSCA 3U8ZA 4D6WA 4P7IA 3FM8C 3PG7A 1X86A 2G35A 5JLJB 2H7EA 2DKQA 4Z2MB 2LG1A 4A6KA 5JP4A 3ML4A 5L81A 2YT0A 4OSNA 3G9WA 2Q13A 4DX8A 3P7ZA 1N3HA 1U5GA 2DTCA 3HW2B 1P5TA 4GPTB 3ULCA 1ZYIA 4GXBA 5J3QA 2V76A 3NSUA 3BJIA 1DYNA 1BTKA 4EMOA 3HK0A 2ROVA 2P8VA 1BAKA 3SNHA 3T06A 3DXDA 1V5PA 2Z0PA 4KHBB 2J0MA 2COCA 2Y7BA 4GNKB 2KCJA 4NSWA 2I5FA 3UZTA 5KCVA 4A5KA 2YS1A 4OT1A 2LYDA 5LG4B 3TFMA 3ZVRA 2DHIA 3SYXA 1U27A 3NW8A 2DHJA 2YS3A 1I2HA 5C16A 3QIJA 3A8PA 1UNQA 5C6RA 4MT7A 4Z2NA 2J0JA 5DI9B 2QKMA 1P3RA 5FI1A 3QWMA 4YONA 1AQCA 2L2IA 3P6AA 1LB1A 2CY4A 4WJ7A 4HAZB 1Y19B 3HQCA 3O96A 5C5BA 2BCJA 2KUPA 2GUMA 5KQ4A 3ODXA 1QQGA 3AU4A 2FJUB 5KQ1A 1XODA 4WSFA 3GYOA 1ZVRA 1K5GB 3HIEA 4CHMA 2GS0A 2Z4DA 1TJ6A 2MDXA 2D9WA 4MY6A 3VIAA 1WGUA 1MKEA 3KY9A 1FHXA 2N0YA 5CLQB 2L1CA 2UVMA 3KSYA 5HE0A 2D4QA 3WA0A 1MK7B 4HHVA 4GMVA 5I2SA 1BWNA 3AU5A 2RGNB 2M38A 5C5BB 2YSZA 1W1GA 1FGZA 4GN1A 5HE3A 5HE2A 2YT1A 2P0DA 2ELAA 2RVBB 1K5DB 1FB8A 2D9VA 2COAA 3FSSA 2W2XD 5J3YA 4K2OA 2COFA 5D3VA 2ELBA 1M7RA 4KHBA 1MAIA 2HE7A 1ZC3B 4B6HA 1RRPB 4D0NB 1WG7A 1ISNA 3TVVA 2DKPA 1NI2A 2CODA 1Q67A 2DFKA 3PVWA 4HATB 2D2QA 1FGYA 4TKNA 3DXEA 4K81A 2R2YA 1FAOA 3D8EA 1KZGA 1XX0A 2J0KA 1V61A 2K49A 3BINA 5I2MA 1J19A 5FI0A 4C0AA 2Z59A
chains in the Genus database with same CATH topology
4HAYB 4F7HA 4EJNA 4IOYX 2I1KA 2YVCA 4HB0B 2AL6A 1EVHA 4HAVB 3PEGA 1BTNA 4Y94A 2I1JA 1SGHA 1OMWA 3TO1A 2UZRA 1OQNA 3KRXA 1WJ1A 2ADZA 2DHKA 4KHOA 1V89A 2Y8GA 3A8QA 2NZ8B 4MK0A 1H10A 2GCJA 4H8SA 1J0WA 2VKIA 3PZDA 4PNKA 2K2UA 4EKUA 1Y5OA 1XCGA 2R0DA 2D11A 3D8DA 2RNRB 5LONB 4NY0A 2LULA 2R09A 2W2WA 4CHJA 1UPRA 2GCLA 1GG3A 4PQ0A 4F7UP 5HE1A 1X1GA 1U5EA 2DX1A 2Y8FA 2D9XA 1DBHA 4KHAA 4YL8A 2YRYA 1PMSA 1TQZA 2CAYA 1U2BA 2EJ8A 2XQNM 2P0FA 4GMXB 4DXAB 3V5WA 2LKOA 1TXDA 1UNPA 3RCPA 5DHAB 4DX90 1DDWA 3TCAA 2D9YA 1ZC4B 3SUZA 2QKLA 1RJ2A 5GOWB 4GZUA 4HDQA 1UEFA 3DXCA 1X05A 3M1IB 1X11A 5LOPB 1V5UA 3KRWA 2I5CA 2K00A 1M7EA 3N7CA 1UPQA 1GC6A 2OQBA 2DX5A 1GC7A 2RLOA 2MFQA 3LJUX 4CYEA 2PZ1A 3SO6A 2YF0A 2D9ZA 2Z0QA 5D3XA 3X23A 1AWEA 1U5DA 5J3TA 1DDVA 1KZ7A 4TYZA 1XD4A 1Z87A 3WYFB 3ODWA 3CXBB 1WVHA 1UNRA 1P6SA 1ZM0A 2W2XC 3A98B 2LOZA 1W1DA 1WI1A 2ZPYA 4A6HA 1E5WA 3KZ1A 4KAXB 4XWXA 4HB2B 2Z0OA 3VOQA 5CLLB 2IFSA 3ULBA 3TW1A 2MKRA 4K17A 1NTVA 2N23A 1LW3A 2X18A 1U29A 4WVFB 2OTXA 1V88A 1MIZB 5DH9B 4BBKA 2D10A 3PP2A 5DHFB 5JHHA 3AJ4A 1XR0B 2J59M 4ZRKA 1H4RA 3SV1A 1EGXA 2RSGA 1W1HA 2H7DA 1V5MA 2RUKB 2HTHB 4IAPA 4L6EA 2EMSA 5D3WA 1EF1A 2EMTA 1XKEA 3CIKA 4HAUB 1OY2A 1MPHA 1MIXA 2LOXA 2P0HA 5C79A 2DYNA 2DN6A 1PFJA 1X1FA 2MWNB 3IVFA 1I7AA 4ZRIA 1NU2A 2ROZB 2GJYA 2VSZA 1FHOA 5JHGA 1EAZA 4IFSA 1SHCA 1B55A 3U7DA 1MK9B 5EFXA 2M14A 4KVGB 1WJMA 1U5FA 2DYQA 4A6FA 5D3YA 3OANA 3F5RA 1FOEA 3D8FA 3ZDTA 4HAXB 4HAWB 4HB3B 1FHWA 2DA0A 3GYPA 3ODOA 2DLWA 4HB4B 3FEHA 1WGQA 1DROA 1PLSA 2CRFA 2FJLA 2IYBA 5DIFB 1ZSQA 3MDBC 1NTYA 2NMBA 4HDOA 4F7GA 2EC1A 2CY5A 2E2XA 4K2PA 1DDMA 2K2JA 2YS5A 5D27A 1KI1B 2JP2A 4A6FB 2UZSA 1IRSA 2KGXB 2VRWB 3MPXA 3F0WA 3QBVB 4ZRJA 3PVLA 3PVUA 1QC6A 4DBBA 2AEHA 3PSCA 3U8ZA 4P7IA 3FM8C 3PG7A 1X86A 2G35A 5JLJB 2H7EA 2DKQA 4Z2MB 2LG1A 4A6KA 5JP4A 3ML4A 5L81A 2YT0A 3G9WA 2Q13A 4DX8A 3P7ZA 1N3HA 1U5GA 2DTCA 3HW2B 1P5TA 4GPTB 3ULCA 4GXBA 5J3QA 2V76A 3NSUA 3BJIA 1DYNA 1BTKA 4EMOA 3HK0A 2ROVA 2P8VA 1BAKA 3SNHA 3T06A 3DXDA 1V5PA 2Z0PA 4KHBB 2J0MA 2COCA 2Y7BA 2KCJA 4NSWA 2I5FA 3UZTA 5KCVA 4A5KA 2YS1A 2LYDA 3TFMA 3ZVRA 2DHIA 3SYXA 1U27A 2DHJA 2YS3A 1I2HA 5C16A 3QIJA 3A8PA 1UNQA 5C6RA 4MT7A 4Z2NA 2J0JA 5DI9B 2QKMA 1P3RA 5FI1A 3QWMA 4YONA 1AQCA 2L2IA 3P6AA 1LB1A 2CY4A 4WJ7A 4HAZB 1Y19B 3HQCA 3O96A 5C5BA 2BCJA 2KUPA 5KQ4A 3ODXA 1QQGA 3AU4A 5KQ1A 1XODA 4WSFA 3GYOA 1ZVRA 1K5GB 4CHMA 2GS0A 1TJ6A 2MDXA 2D9WA 4MY6A 3VIAA 1WGUA 1MKEA 3KY9A 1FHXA 2N0YA 5CLQB 2L1CA 2UVMA 3KSYA 5HE0A 2D4QA 3WA0A 1MK7B 4HHVA 4GMVA 1BWNA 3AU5A 2RGNB 2M38A 5C5BB 2YSZA 1W1GA 1FGZA 4GN1A 5HE3A 5HE2A 2YT1A 2P0DA 2ELAA 2RVBB 1K5DB 1FB8A 2D9VA 2COAA 3FSSA 2W2XD 5J3YA 4K2OA 2COFA 5D3VA 2ELBA 1M7RA 1MAIA 2HE7A 1ZC3B 4B6HA 1RRPB 4D0NB 1WG7A 1ISNA 3TVVA 2DKPA 1NI2A 2CODA 1Q67A 2DFKA 3PVWA 4HATB 2D2QA 1FGYA 4TKNA 3DXEA 4K81A 3D8EA 1FAOA 1KZGA 1XX0A 2J0KA 1V61A 3BINA 1J19A 5FI0A 4C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  4F7H A;  4EJN A;  4IOY X;  2I1K A;  2YVC A;  4HB0 B;  2AL6 A;  1EVH A;  4HAV B;  3PEG A;  1BTN A;  4Y94 A;  2I1J A;  1SGH A;  1OMW A;  3TO1 A;  2UZR A;  1OQN A;  3KRX A;  1WJ1 A;  2ADZ A;  2DHK A;  4KHO A;  1V89 A;  2Y8G A;  3A8Q A;  2NZ8 B;  4MK0 A;  1H10 A;  2GCJ A;  4H8S A;  1J0W A;  2VKI A;  3PZD A;  4PNK A;  2K2U A;  4EKU A;  1Y5O A;  1XCG A;  2R0D A;  2D11 A;  3D8D A;  2RNR B;  5LON B;  4NY0 A;  2LUL A;  2R09 A;  2W2W A;  4CHJ A;  1UPR A;  2GCL A;  1GG3 A;  4PQ0 A;  4F7U P;  5HE1 A;  1X1G A;  1U5E A;  2DX1 A;  2Y8F A;  2D9X A;  1DBH A;  4KHA A;  4YL8 A;  2YRY A;  1PMS A;  1TQZ A;  2CAY A;  1U2B A;  2EJ8 A;  2XQN M;  2P0F A;  4GMX B;  4DXA B;  3V5W A;  2LKO A;  1TXD A;  1UNP A;  3RCP A;  5DHA B;  4DX9 0;  1DDW A;  3TCA A;  2D9Y A;  1ZC4 B;  3SUZ A;  2QKL A;  1RJ2 A;  5GOW B;  4GZU A;  4HDQ A;  1UEF A;  3DXC A;  1X05 A;  3M1I B;  1X11 A;  5LOP B;  1V5U A;  3KRW A;  2I5C A;  2K00 A;  1M7E A;  3N7C A;  1UPQ A;  1GC6 A;  2OQB A;  2DX5 A;  1GC7 A;  2RLO A;  2MFQ A;  3LJU X;  4CYE A;  2PZ1 A;  3SO6 A;  2YF0 A;  2D9Z A;  2Z0Q A;  5D3X A;  3X23 A;  1AWE A;  1U5D A;  5J3T A;  1DDV A;  1KZ7 A;  4TYZ A;  1XD4 A;  1Z87 A;  3WYF B;  3ODW A;  3CXB B;  1WVH A;  1UNR A;  1P6S A;  1ZM0 A;  2W2X C;  3A98 B;  2LOZ A;  1W1D A;  1WI1 A;  2ZPY A;  4A6H A;  1E5W A;  3KZ1 A;  4KAX B;  4XWX A;  4HB2 B;  2Z0O A;  3VOQ A;  5CLL B;  2IFS A;  3ULB A;  3TW1 A;  2MKR A;  4K17 A;  1NTV A;  2N23 A;  1LW3 A;  2X18 A;  1U29 A;  4WVF B;  2OTX A;  1V88 A;  1MIZ B;  5DH9 B;  4BBK A;  2D10 A;  3PP2 A;  5DHF B;  5JHH A;  3AJ4 A;  1XR0 B;  2J59 M;  4ZRK A;  1H4R A;  3SV1 A;  1EGX A;  2RSG A;  1W1H A;  2H7D A;  1V5M A;  2RUK B;  2HTH B;  4IAP A;  4L6E A;  2EMS A;  5D3W A;  1EF1 A;  2EMT A;  1XKE A;  3CIK A;  4HAU B;  1OY2 A;  1MPH A;  1MIX A;  2LOX A;  2P0H A;  5C79 A;  2DYN A;  2DN6 A;  1PFJ A;  1X1F A;  2MWN B;  3IVF A;  1I7A A;  4ZRI A;  1NU2 A;  2ROZ B;  2GJY A;  2VSZ A;  1FHO A;  5JHG A;  1EAZ A;  4IFS A;  1SHC A;  1B55 A;  3U7D A;  1MK9 B;  5EFX A;  2M14 A;  4KVG B;  1WJM A;  1U5F A;  2DYQ A;  4A6F A;  5D3Y A;  3OAN A;  3F5R A;  1FOE A;  3D8F A;  3ZDT A;  4HAX B;  4HAW B;  4HB3 B;  1FHW A;  2DA0 A;  3GYP A;  3ODO A;  2DLW A;  4HB4 B;  3FEH A;  1WGQ A;  1DRO A;  1PLS A;  2CRF A;  2FJL A;  2IYB A;  5DIF B;  1ZSQ A;  3MDB C;  1NTY A;  2NMB A;  4HDO A;  4F7G A;  2EC1 A;  2CY5 A;  2E2X A;  4K2P A;  1DDM A;  2K2J A;  2YS5 A;  5D27 A;  1KI1 B;  2JP2 A;  4A6F B;  2UZS A;  1IRS A;  2KGX B;  2VRW B;  3MPX A;  3F0W A;  3QBV B;  4ZRJ A;  3PVL A;  3PVU A;  1QC6 A;  4DBB A;  2AEH A;  3PSC A;  3U8Z A;  4P7I A;  3FM8 C;  3PG7 A;  1X86 A;  2G35 A;  5JLJ B;  2H7E A;  2DKQ A;  4Z2M B;  2LG1 A;  4A6K A;  5JP4 A;  3ML4 A;  5L81 A;  2YT0 A;  3G9W A;  2Q13 A;  4DX8 A;  3P7Z A;  1N3H A;  1U5G A;  2DTC A;  3HW2 B;  1P5T A;  4GPT B;  3ULC A;  4GXB A;  5J3Q A;  2V76 A;  3NSU A;  3BJI A;  1DYN A;  1BTK A;  4EMO A;  3HK0 A;  2ROV A;  2P8V A;  1BAK A;  3SNH A;  3T06 A;  3DXD A;  1V5P A;  2Z0P A;  4KHB B;  2J0M A;  2COC A;  2Y7B A;  2KCJ A;  4NSW A;  2I5F A;  3UZT A;  5KCV A;  4A5K A;  2YS1 A;  2LYD A;  3TFM A;  3ZVR A;  2DHI A;  3SYX A;  1U27 A;  2DHJ A;  2YS3 A;  1I2H A;  5C16 A;  3QIJ A;  3A8P A;  1UNQ A;  5C6R A;  4MT7 A;  4Z2N A;  2J0J A;  5DI9 B;  2QKM A;  1P3R A;  5FI1 A;  3QWM A;  4YON A;  1AQC A;  2L2I A;  3P6A A;  1LB1 A;  2CY4 A;  4WJ7 A;  4HAZ B;  1Y19 B;  3HQC A;  3O96 A;  5C5B A;  2BCJ A;  2KUP A;  5KQ4 A;  3ODX A;  1QQG A;  3AU4 A;  5KQ1 A;  1XOD A;  4WSF A;  3GYO A;  1ZVR A;  1K5G B;  4CHM A;  2GS0 A;  1TJ6 A;  2MDX A;  2D9W A;  4MY6 A;  3VIA A;  1WGU A;  1MKE A;  3KY9 A;  1FHX A;  2N0Y A;  5CLQ B;  2L1C A;  2UVM A;  3KSY A;  5HE0 A;  2D4Q A;  3WA0 A;  1MK7 B;  4HHV A;  4GMV A;  1BWN A;  3AU5 A;  2RGN B;  2M38 A;  5C5B B;  2YSZ A;  1W1G A;  1FGZ A;  4GN1 A;  5HE3 A;  5HE2 A;  2YT1 A;  2P0D A;  2ELA A;  2RVB B;  1K5D B;  1FB8 A;  2D9V A;  2COA A;  3FSS A;  2W2X D;  5J3Y A;  4K2O A;  2COF A;  5D3V A;  2ELB A;  1M7R A;  1MAI A;  2HE7 A;  1ZC3 B;  4B6H A;  1RRP B;  4D0N B;  1WG7 A;  1ISN A;  3TVV A;  2DKP A;  1NI2 A;  2COD A;  1Q67 A;  2DFK A;  3PVW A;  4HAT B;  2D2Q A;  1FGY A;  4TKN A;  3DXE A;  4K81 A;  3D8E A;  1FAO A;  1KZG A;  1XX0 A;  2J0K A;  1V61 A;  3BIN A;  1J19 A;  5FI0 A;  4C0A A; 
#chains in the Genus database with same CATH topology
 4HAY B;  4F7H A;  4EJN A;  4IOY X;  2I1K A;  2YVC A;  4HB0 B;  2AL6 A;  1EVH A;  4HAV B;  2RRF A;  3PEG A;  1BTN A;  4Y94 A;  2I1J A;  1SGH A;  1OMW A;  2NBV A;  3TO1 A;  2UZR A;  1OQN A;  3KRX A;  1WJ1 A;  2ADZ A;  2DHK A;  2Z14 A;  4KHO A;  1V89 A;  2Y8G A;  3A8Q A;  3NWA A;  2NZ8 B;  4MK0 A;  5M4Y B;  1H10 A;  2GCJ A;  4H8S A;  2ZKM X;  1J0W A;  2VKI A;  3PZD A;  4PNK A;  2K2U A;  4EKU A;  1Y5O A;  1XCG A;  2K8E A;  2R0D A;  2D11 A;  3D8D A;  2RNR B;  2KIG A;  5LON B;  4NY0 A;  2LUL A;  2R09 A;  2W2W A;  4CHJ A;  1UPR A;  4L1R A;  2GCL A;  3NWD A;  1GG3 A;  4PQ0 A;  1T77 A;  4F7U P;  5HE1 A;  1X1G A;  1U5E A;  2DX1 A;  2Y8F A;  2D9X A;  1DBH A;  4KHA A;  4YL8 A;  2YRY A;  1PMS A;  1TQZ A;  2CAY A;  1U2B A;  2EJ8 A;  2XQN M;  2P0F A;  4GMX B;  4DXA B;  3V5W A;  2LKO A;  1TXD A;  1UNP A;  3RCP A;  5DHA B;  4DX9 0;  1DDW A;  3TCA A;  2D9Y A;  1ZC4 B;  3A58 A;  3SUZ A;  2QKL A;  1RJ2 A;  5GOW B;  4GZU A;  3FVC A;  2Z13 A;  4HDQ A;  1UEF A;  3DXC A;  1X05 A;  3M1I B;  1X11 A;  5LOP B;  1V5U A;  3KRW A;  2I5C A;  2K00 A;  4CSQ A;  1M7E A;  3N7C A;  1UPQ A;  1GC6 A;  2OQB A;  2DX5 A;  1GC7 A;  2RLO A;  2MFQ A;  3LJU X;  1MI1 A;  4QJ4 B;  4CYE A;  2PZ1 A;  3SO6 A;  2YF0 A;  2D9Z A;  2Z0Q A;  5D3X A;  3OHM B;  3X23 A;  1AWE A;  1U5D A;  5J3T A;  1DDV A;  1KZ7 A;  4TYZ A;  1XD4 A;  1Z87 A;  3NWF A;  3WYF B;  3ODW A;  3CXB B;  1WVH A;  1UNR A;  1P6S A;  1ZM0 A;  2W2X C;  3A98 B;  2LOZ A;  1W1D A;  1WI1 A;  2ZPY A;  4A6H A;  1E5W A;  3KZ1 A;  4KAX B;  4XWX A;  4HB2 B;  2Z0O A;  3VOQ A;  5CLL B;  2IFS A;  3ULB A;  3TW1 A;  2MKR A;  4K17 A;  4GOU A;  1NTV A;  2N23 A;  1LW3 A;  2X18 A;  1U29 A;  4WVF B;  2OTX A;  1V88 A;  1MIZ B;  5DH9 B;  4BBK A;  2D10 A;  3PP2 A;  5DHF B;  5JHH A;  3AJ4 A;  1XR0 B;  2J59 M;  4ZRK A;  1H4R A;  2YT2 A;  3SV1 A;  1EGX A;  2RSG A;  1W1H A;  2H7D A;  1V5M A;  2RUK B;  2HTH B;  4IAP A;  4L6E A;  2EMS A;  5D3W A;  1EF1 A;  3HSA A;  2EMT A;  1XKE A;  3CIK A;  4HAU B;  1OY2 A;  1MPH A;  1MIX A;  2LOX A;  2P0H A;  5C79 A;  2DYN A;  2DN6 A;  1PFJ A;  5IRS A;  1X1F A;  2MWN B;  3IVF A;  1I7A A;  4ZRI A;  4QJ3 B;  3U12 A;  1NU2 A;  2ROZ B;  2GJY A;  2VSZ A;  4QJ5 B;  1FHO A;  5JHG A;  1EAZ A;  4IFS A;  1SHC A;  1B55 A;  3U7D A;  1MK9 B;  3DCX A;  5EFX A;  2M14 A;  4KVG B;  1WJM A;  1U5F A;  2KR0 A;  4DIX A;  2DYQ A;  2KIE A;  4A6F A;  5D3Y A;  3OAN A;  3F5R A;  1FOE A;  3D8F A;  3ZDT A;  4HAX B;  4HAW B;  4HB3 B;  1FHW A;  2DA0 A;  3GYP A;  3ODO A;  2DLW A;  4HB4 B;  3FEH A;  1WGQ A;  1DRO A;  1PLS A;  2CRF A;  2FJL A;  2IYB A;  5DIF B;  1ZSQ A;  4QXA B;  3MDB C;  1NTY A;  2NMB A;  4HDO A;  4F7G A;  2EC1 A;  2CY5 A;  2E2X A;  4K2P A;  2KUQ A;  1DDM A;  2K2J A;  2YS5 A;  5D27 A;  1KI1 B;  2JP2 A;  4A6F B;  2UZS A;  4HSI A;  1IRS A;  2KGX B;  2VRW B;  3B77 A;  3MPX A;  3F0W A;  3QBV B;  4ZRJ A;  3PVL A;  3PVU A;  1QC6 A;  4DBB A;  2AEH A;  3PSC A;  3U8Z A;  4D6W A;  4P7I A;  3FM8 C;  3PG7 A;  1X86 A;  2G35 A;  5JLJ B;  2H7E A;  2DKQ A;  4Z2M B;  2LG1 A;  4A6K A;  5JP4 A;  3ML4 A;  5L81 A;  2YT0 A;  4OSN A;  3G9W A;  2Q13 A;  4DX8 A;  3P7Z A;  1N3H A;  1U5G A;  2DTC A;  3HW2 B;  1P5T A;  4GPT B;  3ULC A;  1ZYI A;  4GXB A;  5J3Q A;  2V76 A;  3NSU A;  3BJI A;  1DYN A;  1BTK A;  4EMO A;  3HK0 A;  2ROV A;  2P8V A;  1BAK A;  3SNH A;  3T06 A;  3DXD A;  1V5P A;  2Z0P A;  4KHB B;  2J0M A;  2COC A;  2Y7B A;  4GNK B;  2KCJ A;  4NSW A;  2I5F A;  3UZT A;  5KCV A;  4A5K A;  2YS1 A;  4OT1 A;  2LYD A;  5LG4 B;  3TFM A;  3ZVR A;  2DHI A;  3SYX A;  1U27 A;  3NW8 A;  2DHJ A;  2YS3 A;  1I2H A;  5C16 A;  3QIJ A;  3A8P A;  1UNQ A;  5C6R A;  4MT7 A;  4Z2N A;  2J0J A;  5DI9 B;  2QKM A;  1P3R A;  5FI1 A;  3QWM A;  4YON A;  1AQC A;  2L2I A;  3P6A A;  1LB1 A;  2CY4 A;  4WJ7 A;  4HAZ B;  1Y19 B;  3HQC A;  3O96 A;  5C5B A;  2BCJ A;  2KUP A;  2GUM A;  5KQ4 A;  3ODX A;  1QQG A;  3AU4 A;  2FJU B;  5KQ1 A;  1XOD A;  4WSF A;  3GYO A;  1ZVR A;  1K5G B;  3HIE A;  4CHM A;  2GS0 A;  2Z4D A;  1TJ6 A;  2MDX A;  2D9W A;  4MY6 A;  3VIA A;  1WGU A;  1MKE A;  3KY9 A;  1FHX A;  2N0Y A;  5CLQ B;  2L1C A;  2UVM A;  3KSY A;  5HE0 A;  2D4Q A;  3WA0 A;  1MK7 B;  4HHV A;  4GMV A;  5I2S A;  1BWN A;  3AU5 A;  2RGN B;  2M38 A;  5C5B B;  2YSZ A;  1W1G A;  1FGZ A;  4GN1 A;  5HE3 A;  5HE2 A;  2YT1 A;  2P0D A;  2ELA A;  2RVB B;  1K5D B;  1FB8 A;  2D9V A;  2COA A;  3FSS A;  2W2X D;  5J3Y A;  4K2O A;  2COF A;  5D3V A;  2ELB A;  1M7R A;  4KHB A;  1MAI A;  2HE7 A;  1ZC3 B;  4B6H A;  1RRP B;  4D0N B;  1WG7 A;  1ISN A;  3TVV A;  2DKP A;  1NI2 A;  2COD A;  1Q67 A;  2DFK A;  3PVW A;  4HAT B;  2D2Q A;  1FGY A;  4TKN A;  3DXE A;  4K81 A;  2R2Y A;  1FAO A;  3D8E A;  1KZG A;  1XX0 A;  2J0K A;  1V61 A;  2K49 A;  3BIN A;  5I2M A;  1J19 A;  5FI0 A;  4C0A A;  2Z59 A; 
#chains in the Genus database with same CATH homology
 4HAY B;  4F7H A;  4EJN A;  4IOY X;  2I1K A;  2YVC A;  4HB0 B;  2AL6 A;  1EVH A;  4HAV B;  3PEG A;  1BTN A;  4Y94 A;  2I1J A;  1SGH A;  1OMW A;  3TO1 A;  2UZR A;  1OQN A;  3KRX A;  1WJ1 A;  2ADZ A;  2DHK A;  4KHO A;  1V89 A;  2Y8G A;  3A8Q A;  2NZ8 B;  4MK0 A;  1H10 A;  2GCJ A;  4H8S A;  1J0W A;  2VKI A;  3PZD A;  4PNK A;  2K2U A;  4EKU A;  1Y5O A;  1XCG A;  2R0D A;  2D11 A;  3D8D A;  2RNR B;  5LON B;  4NY0 A;  2LUL A;  2R09 A;  2W2W A;  4CHJ A;  1UPR A;  2GCL A;  1GG3 A;  4PQ0 A;  4F7U P;  5HE1 A;  1X1G A;  1U5E A;  2DX1 A;  2Y8F A;  2D9X A;  1DBH A;  4KHA A;  4YL8 A;  2YRY A;  1PMS A;  1TQZ A;  2CAY A;  1U2B A;  2EJ8 A;  2XQN M;  2P0F A;  4GMX B;  4DXA B;  3V5W A;  2LKO A;  1TXD A;  1UNP A;  3RCP A;  5DHA B;  4DX9 0;  1DDW A;  3TCA A;  2D9Y A;  1ZC4 B;  3SUZ A;  2QKL A;  1RJ2 A;  5GOW B;  4GZU A;  4HDQ A;  1UEF A;  3DXC A;  1X05 A;  3M1I B;  1X11 A;  5LOP B;  1V5U A;  3KRW A;  2I5C A;  2K00 A;  1M7E A;  3N7C A;  1UPQ A;  1GC6 A;  2OQB A;  2DX5 A;  1GC7 A;  2RLO A;  2MFQ A;  3LJU X;  4CYE A;  2PZ1 A;  3SO6 A;  2YF0 A;  2D9Z A;  2Z0Q A;  5D3X A;  3X23 A;  1AWE A;  1U5D A;  5J3T A;  1DDV A;  1KZ7 A;  4TYZ A;  1XD4 A;  1Z87 A;  3WYF B;  3ODW A;  3CXB B;  1WVH A;  1UNR A;  1P6S A;  1ZM0 A;  2W2X C;  3A98 B;  2LOZ A;  1W1D A;  1WI1 A;  2ZPY A;  4A6H A;  1E5W A;  3KZ1 A;  4KAX B;  4XWX A;  4HB2 B;  2Z0O A;  3VOQ A;  5CLL B;  2IFS A;  3ULB A;  3TW1 A;  2MKR A;  4K17 A;  1NTV A;  2N23 A;  1LW3 A;  2X18 A;  1U29 A;  4WVF B;  2OTX A;  1V88 A;  1MIZ B;  5DH9 B;  4BBK A;  2D10 A;  3PP2 A;  5DHF B;  5JHH A;  3AJ4 A;  1XR0 B;  2J59 M;  4ZRK A;  1H4R A;  3SV1 A;  1EGX A;  2RSG A;  1W1H A;  2H7D A;  1V5M A;  2RUK B;  2HTH B;  4IAP A;  4L6E A;  2EMS A;  5D3W A;  1EF1 A;  2EMT A;  1XKE A;  3CIK A;  4HAU B;  1OY2 A;  1MPH A;  1MIX A;  2LOX A;  2P0H A;  5C79 A;  2DYN A;  2DN6 A;  1PFJ A;  1X1F A;  2MWN B;  3IVF A;  1I7A A;  4ZRI A;  1NU2 A;  2ROZ B;  2GJY A;  2VSZ A;  1FHO A;  5JHG A;  1EAZ A;  4IFS A;  1SHC A;  1B55 A;  3U7D A;  1MK9 B;  5EFX A;  2M14 A;  4KVG B;  1WJM A;  1U5F A;  2DYQ A;  4A6F A;  5D3Y A;  3OAN A;  3F5R A;  1FOE A;  3D8F A;  3ZDT A;  4HAX B;  4HAW B;  4HB3 B;  1FHW A;  2DA0 A;  3GYP A;  3ODO A;  2DLW A;  4HB4 B;  3FEH A;  1WGQ A;  1DRO A;  1PLS A;  2CRF A;  2FJL A;  2IYB A;  5DIF B;  1ZSQ A;  3MDB C;  1NTY A;  2NMB A;  4HDO A;  4F7G A;  2EC1 A;  2CY5 A;  2E2X A;  4K2P A;  1DDM A;  2K2J A;  2YS5 A;  5D27 A;  1KI1 B;  2JP2 A;  4A6F B;  2UZS A;  1IRS A;  2KGX B;  2VRW B;  3MPX A;  3F0W A;  3QBV B;  4ZRJ A;  3PVL A;  3PVU A;  1QC6 A;  4DBB A;  2AEH A;  3PSC A;  3U8Z A;  4P7I A;  3FM8 C;  3PG7 A;  1X86 A;  2G35 A;  5JLJ B;  2H7E A;  2DKQ A;  4Z2M B;  2LG1 A;  4A6K A;  5JP4 A;  3ML4 A;  5L81 A;  2YT0 A;  3G9W A;  2Q13 A;  4DX8 A;  3P7Z A;  1N3H A;  1U5G A;  2DTC A;  3HW2 B;  1P5T A;  4GPT B;  3ULC A;  4GXB A;  5J3Q A;  2V76 A;  3NSU A;  3BJI A;  1DYN A;  1BTK A;  4EMO A;  3HK0 A;  2ROV A;  2P8V A;  1BAK A;  3SNH A;  3T06 A;  3DXD A;  1V5P A;  2Z0P A;  4KHB B;  2J0M A;  2COC A;  2Y7B A;  2KCJ A;  4NSW A;  2I5F A;  3UZT A;  5KCV A;  4A5K A;  2YS1 A;  2LYD A;  3TFM A;  3ZVR A;  2DHI A;  3SYX A;  1U27 A;  2DHJ A;  2YS3 A;  1I2H A;  5C16 A;  3QIJ A;  3A8P A;  1UNQ A;  5C6R A;  4MT7 A;  4Z2N A;  2J0J A;  5DI9 B;  2QKM A;  1P3R A;  5FI1 A;  3QWM A;  4YON A;  1AQC A;  2L2I A;  3P6A A;  1LB1 A;  2CY4 A;  4WJ7 A;  4HAZ B;  1Y19 B;  3HQC A;  3O96 A;  5C5B A;  2BCJ A;  2KUP A;  5KQ4 A;  3ODX A;  1QQG A;  3AU4 A;  5KQ1 A;  1XOD A;  4WSF A;  3GYO A;  1ZVR A;  1K5G B;  4CHM A;  2GS0 A;  1TJ6 A;  2MDX A;  2D9W A;  4MY6 A;  3VIA A;  1WGU A;  1MKE A;  3KY9 A;  1FHX A;  2N0Y A;  5CLQ B;  2L1C A;  2UVM A;  3KSY A;  5HE0 A;  2D4Q A;  3WA0 A;  1MK7 B;  4HHV A;  4GMV A;  1BWN A;  3AU5 A;  2RGN B;  2M38 A;  5C5B B;  2YSZ A;  1W1G A;  1FGZ A;  4GN1 A;  5HE3 A;  5HE2 A;  2YT1 A;  2P0D A;  2ELA A;  2RVB B;  1K5D B;  1FB8 A;  2D9V A;  2COA A;  3FSS A;  2W2X D;  5J3Y A;  4K2O A;  2COF A;  5D3V A;  2ELB A;  1M7R A;  1MAI A;  2HE7 A;  1ZC3 B;  4B6H A;  1RRP B;  4D0N B;  1WG7 A;  1ISN A;  3TVV A;  2DKP A;  1NI2 A;  2COD A;  1Q67 A;  2DFK A;  3PVW A;  4HAT B;  2D2Q A;  1FGY A;  4TKN A;  3DXE A;  4K81 A;  3D8E A;  1FAO A;  1KZG A;  1XX0 A;  2J0K A;  1V61 A;  3BIN A;  1J19 A;  5FI0 A;  4C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...