3TO1A

Two surfaces on rtt106 mediate histone binding and chaperone activity
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
230
structure length
212
Chain Sequence
b'TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 54
structure length 212
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3to1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3to1A01
1V5MA 3SNHA 4A5KA 2COFA 3U8ZA 1V89A 3O96A 2YS5A 3N7CA 5J3QA 2DFKA 3FM8C 2DHIA 4KVGB 3MDBC 4Z2MB 4TYZA 3RCPA 1U5EA 4F7UP 1GC7A 2I1KA 2K00A 2V76A 3TO1A 1UNPA 2P8VA 2LOZA 4B6HA 1AQCA 1FGZA 5C79A 1U5GA 2P0HA 3D8EA 1ZM0A 4CYEA 5D3YA 5DHFB 2H7DA 3QWMA 1MK7B 1OQNA 5EFXA 1QQGA 4KHOA 2UVMA 5J3YA 1K5GB 2GS0A 3ZVRA 2YS3A 3DXDA 2YT1A 4HHVA 2GCLA 2D9XA 2J0KA 1LB1A 4NSWA 3IVFA 2NMBA 4Y94A 3F5RA 1P3RA 1ZC4B 1MPHA 2CODA 1V61A 4P7IA 1U5DA 1IRSA 4F7HA 1U2BA 1X1GA 3ODWA 1EF1A 1X05A 3NSUA 1DROA 2MWNB 2Y7BA 4HATB 1RJ2A 2D9ZA 3BJIA 1XKEA 2DX1A 1Y5OA 1Z87A 1U29A 4IAPA 5L81A 2EMTA 4KHAA 2ADZA 1AWEA 3V5WA 1EAZA 4HB3B 3TW1A 3HK0A 4C0AA 2XQNM 2OQBA 4XWXA 3TCAA 3KSYA 3SV1A 4EKUA 3AJ4A 4CHMA 2D4QA 3M1IB 3U7DA 1ISNA 1WJMA 1DDVA 4ZRKA 1ZC3B 3P6AA 1MK9B 2D9YA 2LG1A 4GN1A 2RLOA 4A6FA 5HE0A 4D0NB 3OANA 2IYBA 4MK0A 2R0DA 4GPTB 4PNKA 1N3HA 1Q67A 1EVHA 5HE2A 1BAKA 1FGYA 3ML4A 5KQ4A 2VSZA 2P0DA 2L1CA 2R09A 3T06A 1WGUA 2MFQA 2J0MA 1I2HA 4KHBB 1W1DA 3QIJA 2RVBB 1P6SA 2PZ1A 2RSGA 1UNRA 3DXEA 1OY2A 4HAYB 3TVVA 2YRYA 4EMOA 1H4RA 1MIXA 4K2OA 1OMWA 4MT7A 2NZ8B 5KCVA 2CRFA 1M7RA 5DHAB 4HAUB 2COCA 1ZSQA 1WVHA 3VOQA 4A6FB 4ZRIA 1X11A 2DKQA 2QKMA 3GYOA 2LULA 1UNQA 1TQZA 4K2PA 4WJ7A 1QC6A 2KGXB 3ULBA 3PVLA 3HW2B 1KZGA 1WG7A 5JP4A 4PQ0A 3QBVB 2RUKB 3UZTA 1X1FA 2VKIA 2EMSA 1H10A 1TJ6A 1DBHA 1DDMA 2HTHB 3ULCA 4K81A 2Y8GA 2DHKA 4GXBA 4Z2NA 1DYNA 2ELAA 3DXCA 4DXAB 1J19A 5C6RA 1XD4A 3BINA 2HE7A 5FI0A 2ZPYA 1XR0B 1ZVRA 5JHHA 2LYDA 3MPXA 5DIFB 2GJYA 4HAZB 1UPQA 2MDXA 2D11A 2L2IA 1SGHA 2H7EA 5HE1A 2JP2A 2AL6A 1MKEA 1W1HA 1GC6A 2YSZA 3A8PA 3PSCA 4HAWB 1Y19B 2Z0PA 2FJLA 2DYQA 2OTXA 1NU2A 2W2WA 1U27A 2EJ8A 4GMVA 2DX5A 2QKLA 2N0YA 3AU5A 3G9WA 1V5PA 5CLLB 3KZ1A 4HDOA 1WJ1A 2D10A 3SYXA 3GYPA 1FHOA 5D3XA 5D3VA 2YF0A 3PZDA 1WGQA 1P5TA 2DA0A 1BWNA 2YS1A 4HB2B 1TXDA 3KRWA 3TFMA 1DDWA 2DYNA 3AU4A 5CLQB 2W2XC 5D27A 3PEGA 1RRPB 1KZ7A 2P0FA 1FOEA 4MY6A 3X23A 2M14A 4H8SA 4GZUA 1GG3A 3ZDTA 4EJNA 2N23A 4A6KA 2Q13A 3SUZA 3A98B 1X86A 2W2XD 2EC1A 3ODXA 4DX90 3KRXA 2Z0OA 1B55A 5JHGA 4L6EA 1BTNA 2IFSA 1FHWA 2K2JA 2RNRB 1LW3A 3F0WA 1SHCA 3FEHA 4DBBA 1NI2A 5HE3A 4F7GA 5C5BA 3CIKA 4IFSA 4KAXB 2E2XA 5DH9B 1E5WA 1EGXA 1PLSA 1U5FA 3FSSA 2D2QA 2Z0QA 2Y8FA 2DKPA 1XCGA 2I5CA 4CHJA 2I1JA 2BCJA 5D3WA 2YVCA 2CAYA 2G35A 2KCJA 2ROVA 2MKRA 1UPRA 2CY5A 2I5FA 2ROZB 5JLJB 1NTYA 1KI1B 4HAVB 4NY0A 1WI1A 4YL8A 3WYFB 3VIAA 5C16A 5GOWB 3PVUA 2CY4A 3LJUX 3PG7A 4DX8A 3ODOA 5FI1A 5C5BB 5KQ1A 5LOPB 1I7AA 2K2UA 2UZSA 3P7ZA 1UEFA 2D9VA 2DTCA 4HAXB 4HDQA 2KUPA 1V88A 4ZRJA 1K5DB 3SO6A 3PP2A 1XX0A 1MIZB 2COAA 2LKOA 4GMXB 1PFJA 4TKNA 2RGNB 2X18A 1PMSA 3D8FA 4K17A 3A8QA 4HB0B 4IOYX 2J0JA 3CXBB 1FAOA 2M38A 2VRWB 2LOXA 1NTVA 4WVFB 2J59M 1FB8A 1M7EA 5DI9B 3D8DA 2GCJA 2DN6A 2AEHA 1FHXA 3WA0A 2D9WA 3HQCA 3PVWA 2UZRA 2DHJA 5J3TA 4A6HA 1MAIA 1BTKA 1XODA 2YT0A 1V5UA 1J0WA 1W1GA 5LONB 3KY9A 4BBKA 4HB4B 2DLWA 4YONA 2ELBA 4WSFA
chains in the Genus database with same CATH superfamily
1V5MA 3HIEA 3SNHA 4A5KA 2COFA 3U8ZA 2Z4DA 1V89A 3O96A 2Z14A 2YS5A 3N7CA 4L1RA 5J3QA 2DFKA 4QJ4B 3FM8C 2DHIA 4KVGB 3MDBC 4Z2MB 4TYZA 3RCPA 1U5EA 4F7UP 1GC7A 2I1KA 2K00A 2V76A 3TO1A 1UNPA 2P8VA 2Z13A 2LOZA 4B6HA 1AQCA 1FGZA 5C79A 1U5GA 2P0HA 3D8EA 1ZM0A 4CYEA 5D3YA 5DHFB 2H7DA 3QWMA 1MK7B 1OQNA 5EFXA 1QQGA 4KHOA 2UVMA 5J3YA 1K5GB 2GS0A 3ZVRA 2YS3A 3DXDA 2YT1A 4HHVA 4OSNA 2GCLA 2D9XA 2J0KA 1LB1A 4NSWA 3IVFA 2NMBA 4Y94A 3F5RA 1P3RA 1ZC4B 1MPHA 2CODA 1V61A 4P7IA 1IRSA 1U5DA 4F7HA 1U2BA 1X1GA 3ODWA 1EF1A 2RRFA 1X05A 3NSUA 1DROA 2MWNB 2Y7BA 4HATB 1RJ2A 2D9ZA 3BJIA 1XKEA 2DX1A 2KIGA 1Y5OA 1Z87A 1U29A 4IAPA 5L81A 2EMTA 4KHAA 2ADZA 1AWEA 3V5WA 1EAZA 4HB3B 3TW1A 2ZKMX 3HK0A 4C0AA 3U12A 2XQNM 2OQBA 4XWXA 3TCAA 3KSYA 3SV1A 4EKUA 3AJ4A 2KR0A 4CHMA 2D4QA 3M1IB 3U7DA 1ISNA 1WJMA 1DDVA 4ZRKA 1ZC3B 3P6AA 1MK9B 2D9YA 2LG1A 4GN1A 2RLOA 4A6FA 5HE0A 4D0NB 2K8EA 3OANA 1ZYIA 2IYBA 2YT2A 4MK0A 4HSIA 2R0DA 2K49A 2R2YA 4GPTB 4PNKA 1N3HA 1Q67A 1EVHA 5HE2A 1BAKA 1FGYA 3ML4A 5KQ4A 2VSZA 2P0DA 2L1CA 2R09A 3T06A 1WGUA 2MFQA 2J0MA 1I2HA 4KHBB 1W1DA 3QIJA 2RVBB 1P6SA 2PZ1A 2RSGA 1UNRA 3DXEA 1OY2A 4HAYB 3TVVA 2YRYA 4EMOA 1H4RA 1MIXA 4K2OA 1OMWA 4MT7A 2NZ8B 5KCVA 2CRFA 1M7RA 5DHAB 4HAUB 2COCA 5M4YB 1ZSQA 1WVHA 3VOQA 4A6FB 4ZRIA 5LG4B 1X11A 2DKQA 2QKMA 3GYOA 2LULA 1UNQA 1TQZA 4K2PA 4WJ7A 1QC6A 2KGXB 2GUMA 3ULBA 3PVLA 5I2SA 3HW2B 1KZGA 1WG7A 5JP4A 4PQ0A 3QBVB 2RUKB 4OT1A 3UZTA 1X1FA 2VKIA 3NW8A 2EMSA 1H10A 1TJ6A 1DBHA 1DDMA 2HTHB 3ULCA 4K81A 2Y8GA 2DHKA 4GXBA 4Z2NA 1DYNA 2ELAA 2KIEA 3DXCA 4DXAB 1J19A 5C6RA 1XD4A 3BINA 2HE7A 5FI0A 2ZPYA 1XR0B 1ZVRA 5JHHA 3DCXA 2LYDA 3MPXA 5DIFB 2GJYA 4HAZB 1UPQA 2MDXA 2D11A 2L2IA 1SGHA 2H7EA 5HE1A 1MI1A 2JP2A 2AL6A 1MKEA 1W1HA 1GC6A 2YSZA 3A8PA 3PSCA 4HAWB 1Y19B 2Z0PA 2FJLA 2DYQA 2OTXA 1NU2A 2W2WA 1U27A 2EJ8A 4GMVA 2DX5A 2QKLA 2N0YA 3AU5A 3G9WA 1V5PA 5CLLB 3KZ1A 4HDOA 1WJ1A 2D10A 3SYXA 3GYPA 4GOUA 1FHOA 5D3XA 5D3VA 2YF0A 3PZDA 1WGQA 1P5TA 2DA0A 1BWNA 2YS1A 4HB2B 1TXDA 3KRWA 3TFMA 1DDWA 2DYNA 3AU4A 3OHMB 5CLQB 2W2XC 5D27A 3PEGA 1RRPB 1KZ7A 2P0FA 1FOEA 4MY6A 3X23A 2M14A 4H8SA 4GZUA 4QJ3B 1GG3A 3ZDTA 4EJNA 2N23A 4A6KA 2Q13A 3SUZA 3A98B 1X86A 2W2XD 2EC1A 3ODXA 4DX90 3KRXA 2Z0OA 1B55A 3A58A 5JHGA 4L6EA 1BTNA 2IFSA 1FHWA 2K2JA 2RNRB 1LW3A 3F0WA 1SHCA 3FEHA 4DBBA 1NI2A 5HE3A 4F7GA 5C5BA 3CIKA 4IFSA 4KAXB 2E2XA 5DH9B 1E5WA 1EGXA 1PLSA 2KUQA 1U5FA 3FSSA 2D2QA 2Z0QA 2Y8FA 4DIXA 2DKPA 1XCGA 2I5CA 4CHJA 2I1JA 2BCJA 3NWFA 5D3WA 2YVCA 2CAYA 2G35A 4GNKB 2KCJA 2ROVA 3NWDA 2MKRA 1UPRA 2CY5A 2I5FA 2ROZB 5JLJB 1NTYA 1KI1B 4HAVB 4NY0A 1WI1A 4CSQA 4YL8A 3WYFB 5IRSA 3VIAA 5C16A 5GOWB 3PVUA 2CY4A 3LJUX 4QXAB 3PG7A 4DX8A 3ODOA 5FI1A 5I2MA 1T77A 5C5BB 5KQ1A 5LOPB 1I7AA 3HSAA 2K2UA 2UZSA 3P7ZA 1UEFA 2D9VA 2DTCA 2Z59A 2NBVA 4HAXB 4HDQA 4KHBA 2KUPA 1V88A 4ZRJA 1K5DB 3SO6A 3PP2A 1XX0A 1MIZB 2COAA 2LKOA 4GMXB 1PFJA 4TKNA 2RGNB 2X18A 1PMSA 3D8FA 4K17A 3A8QA 3B77A 4HB0B 4IOYX 2J0JA 3CXBB 1FAOA 2M38A 2VRWB 2LOXA 1NTVA 4WVFB 2J59M 1FB8A 1M7EA 5DI9B 3D8DA 4QJ5B 4D6WA 2GCJA 2DN6A 2AEHA 1FHXA 3WA0A 2D9WA 2FJUB 3HQCA 3PVWA 2UZRA 2DHJA 5J3TA 4A6HA 1MAIA 1BTKA 3NWAA 1XODA 2YT0A 1V5UA 1J0WA 1W1GA 5LONB 3KY9A 4BBKA 4HB4B 2DLWA 4YONA 3FVCA 2ELBA 4WSFA
chains in the Genus database with same CATH topology
1V5MA 3HIEA 3SNHA 4A5KA 2COFA 3U8ZA 2Z4DA 1V89A 3O96A 2Z14A 2YS5A 3N7CA 4L1RA 5J3QA 2DFKA 4QJ4B 3FM8C 2DHIA 4KVGB 3MDBC 4Z2MB 4TYZA 3RCPA 1U5EA 4F7UP 1GC7A 2I1KA 2K00A 2V76A 3TO1A 1UNPA 2P8VA 2Z13A 2LOZA 4B6HA 1AQCA 1FGZA 5C79A 1U5GA 2P0HA 3D8EA 1ZM0A 4CYEA 5D3YA 5DHFB 2H7DA 3QWMA 1MK7B 1OQNA 5EFXA 1QQGA 4KHOA 2UVMA 5J3YA 1K5GB 2GS0A 3ZVRA 2YS3A 3DXDA 2YT1A 4HHVA 4OSNA 2GCLA 2D9XA 2J0KA 1LB1A 4NSWA 3IVFA 2NMBA 4Y94A 3F5RA 1P3RA 1ZC4B 1MPHA 2CODA 1V61A 4P7IA 1U5DA 1IRSA 4F7HA 1U2BA 1X1GA 3ODWA 1EF1A 2RRFA 1X05A 3NSUA 1DROA 2MWNB 2Y7BA 4HATB 1RJ2A 2D9ZA 3BJIA 1XKEA 2DX1A 2KIGA 1Y5OA 1Z87A 1U29A 4IAPA 5L81A 2EMTA 4KHAA 2ADZA 1AWEA 3V5WA 1EAZA 4HB3B 3TW1A 3HK0A 2ZKMX 4C0AA 3U12A 2XQNM 2OQBA 4XWXA 3TCAA 3KSYA 3SV1A 4EKUA 3AJ4A 4CHMA 2KR0A 2D4QA 3M1IB 3U7DA 1ISNA 1WJMA 1DDVA 4ZRKA 1ZC3B 3P6AA 1MK9B 2D9YA 2LG1A 4GN1A 2RLOA 4A6FA 5HE0A 4D0NB 2K8EA 3OANA 1ZYIA 2IYBA 2YT2A 4MK0A 4HSIA 2R0DA 2K49A 2R2YA 4GPTB 4PNKA 1N3HA 1Q67A 1EVHA 5HE2A 1BAKA 1FGYA 3ML4A 5KQ4A 2VSZA 2P0DA 2L1CA 2R09A 3T06A 1WGUA 2MFQA 2J0MA 1I2HA 4KHBB 1W1DA 3QIJA 2RVBB 1P6SA 2PZ1A 2RSGA 1UNRA 3DXEA 1OY2A 4HAYB 3TVVA 2YRYA 4EMOA 1H4RA 1MIXA 4K2OA 1OMWA 4MT7A 2NZ8B 5KCVA 2CRFA 1M7RA 5DHAB 4HAUB 2COCA 5M4YB 1ZSQA 1WVHA 3VOQA 4A6FB 4ZRIA 5LG4B 1X11A 2DKQA 2QKMA 3GYOA 2LULA 1UNQA 1TQZA 4K2PA 4WJ7A 1QC6A 2KGXB 2GUMA 3ULBA 3PVLA 5I2SA 3HW2B 1KZGA 1WG7A 5JP4A 4PQ0A 3QBVB 2RUKB 3UZTA 4OT1A 1X1FA 2VKIA 3NW8A 2EMSA 1H10A 1TJ6A 1DBHA 1DDMA 2HTHB 3ULCA 4K81A 2Y8GA 2DHKA 4GXBA 4Z2NA 1DYNA 2ELAA 2KIEA 3DXCA 4DXAB 1J19A 5C6RA 1XD4A 3BINA 2HE7A 5FI0A 2ZPYA 1XR0B 1ZVRA 5JHHA 2LYDA 3MPXA 5DIFB 2GJYA 4HAZB 1UPQA 2MDXA 2D11A 2L2IA 1SGHA 2H7EA 5HE1A 2JP2A 2AL6A 1MKEA 1W1HA 1GC6A 2YSZA 3A8PA 3PSCA 4HAWB 1Y19B 2Z0PA 2FJLA 2DYQA 2OTXA 1NU2A 2W2WA 1U27A 2EJ8A 4GMVA 2DX5A 2QKLA 2N0YA 3AU5A 3G9WA 1V5PA 5CLLB 3KZ1A 4HDOA 1WJ1A 2D10A 3SYXA 3GYPA 4GOUA 1FHOA 5D3XA 5D3VA 2YF0A 3PZDA 1WGQA 1P5TA 2DA0A 1BWNA 2YS1A 4HB2B 1TXDA 3KRWA 3TFMA 1DDWA 2DYNA 3AU4A 3OHMB 5CLQB 2W2XC 5D27A 3PEGA 1RRPB 1KZ7A 2P0FA 1FOEA 4MY6A 3X23A 2M14A 4H8SA 4GZUA 4QJ3B 1GG3A 3ZDTA 4EJNA 2N23A 4A6KA 2Q13A 3SUZA 3A98B 1X86A 2W2XD 2EC1A 3ODXA 4DX90 3KRXA 2Z0OA 1B55A 5JHGA 3A58A 4L6EA 1BTNA 2IFSA 1FHWA 2K2JA 2RNRB 1LW3A 3F0WA 1SHCA 3FEHA 4DBBA 1NI2A 5HE3A 4F7GA 5C5BA 3CIKA 4IFSA 4KAXB 2E2XA 5DH9B 1E5WA 1EGXA 1PLSA 2KUQA 1U5FA 3FSSA 2D2QA 2Z0QA 2Y8FA 4DIXA 2DKPA 1XCGA 2I5CA 4CHJA 2I1JA 2BCJA 3NWFA 5D3WA 2YVCA 2CAYA 2G35A 4GNKB 2KCJA 2ROVA 3NWDA 2MKRA 1UPRA 2CY5A 2I5FA 2ROZB 5JLJB 1NTYA 1KI1B 4HAVB 4NY0A 1WI1A 4CSQA 4YL8A 3WYFB 5IRSA 3VIAA 5C16A 5GOWB 3PVUA 2CY4A 3LJUX 4QXAB 3PG7A 4DX8A 3ODOA 5FI1A 5I2MA 5C5BB 5KQ1A 5LOPB 1I7AA 2K2UA 2UZSA 3P7ZA 1UEFA 2D9VA 2DTCA 2Z59A 2NBVA 4HAXB 4HDQA 4KHBA 2KUPA 1V88A 4ZRJA 1K5DB 3SO6A 3PP2A 1XX0A 1MIZB 2COAA 2LKOA 4GMXB 1PFJA 4TKNA 2RGNB 2X18A 1PMSA 3D8FA 4K17A 3A8QA 4HB0B 4IOYX 2J0JA 3CXBB 1FAOA 2M38A 2VRWB 2LOXA 1NTVA 4WVFB 2J59M 1FB8A 1M7EA 5DI9B 3D8DA 4QJ5B 4D6WA 2GCJA 2DN6A 2AEHA 1FHXA 3WA0A 2D9WA 2FJUB 3HQCA 3PVWA 2UZRA 2DHJA 5J3TA 4A6HA 1MAIA 1BTKA 3NWAA 1XODA 2YT0A 1V5UA 1J0WA 1W1GA 5LONB 3KY9A 4BBKA 4HB4B 2DLWA 4YONA 3FVCA 2ELBA 4WSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5M A;  3SNH A;  4A5K A;  2COF A;  3U8Z A;  1V89 A;  3O96 A;  2YS5 A;  3N7C A;  5J3Q A;  2DFK A;  3FM8 C;  2DHI A;  4KVG B;  3MDB C;  4Z2M B;  4TYZ A;  3RCP A;  1U5E A;  4F7U P;  1GC7 A;  2I1K A;  2K00 A;  2V76 A;  3TO1 A;  1UNP A;  2P8V A;  2LOZ A;  4B6H A;  1AQC A;  1FGZ A;  5C79 A;  1U5G A;  2P0H A;  3D8E A;  1ZM0 A;  4CYE A;  5D3Y A;  5DHF B;  2H7D A;  3QWM A;  1MK7 B;  1OQN A;  5EFX A;  1QQG A;  4KHO A;  2UVM A;  5J3Y A;  1K5G B;  2GS0 A;  3ZVR A;  2YS3 A;  3DXD A;  2YT1 A;  4HHV A;  2GCL A;  2D9X A;  2J0K A;  1LB1 A;  4NSW A;  3IVF A;  2NMB A;  4Y94 A;  3F5R A;  1P3R A;  1ZC4 B;  1MPH A;  2COD A;  1V61 A;  4P7I A;  1U5D A;  1IRS A;  4F7H A;  1U2B A;  1X1G A;  3ODW A;  1EF1 A;  1X05 A;  3NSU A;  1DRO A;  2MWN B;  2Y7B A;  4HAT B;  1RJ2 A;  2D9Z A;  3BJI A;  1XKE A;  2DX1 A;  1Y5O A;  1Z87 A;  1U29 A;  4IAP A;  5L81 A;  2EMT A;  4KHA A;  2ADZ A;  1AWE A;  3V5W A;  1EAZ A;  4HB3 B;  3TW1 A;  3HK0 A;  4C0A A;  2XQN M;  2OQB A;  4XWX A;  3TCA A;  3KSY A;  3SV1 A;  4EKU A;  3AJ4 A;  4CHM A;  2D4Q A;  3M1I B;  3U7D A;  1ISN A;  1WJM A;  1DDV A;  4ZRK A;  1ZC3 B;  3P6A A;  1MK9 B;  2D9Y A;  2LG1 A;  4GN1 A;  2RLO A;  4A6F A;  5HE0 A;  4D0N B;  3OAN A;  2IYB A;  4MK0 A;  2R0D A;  4GPT B;  4PNK A;  1N3H A;  1Q67 A;  1EVH A;  5HE2 A;  1BAK A;  1FGY A;  3ML4 A;  5KQ4 A;  2VSZ A;  2P0D A;  2L1C A;  2R09 A;  3T06 A;  1WGU A;  2MFQ A;  2J0M A;  1I2H A;  4KHB B;  1W1D A;  3QIJ A;  2RVB B;  1P6S A;  2PZ1 A;  2RSG A;  1UNR A;  3DXE A;  1OY2 A;  4HAY B;  3TVV A;  2YRY A;  4EMO A;  1H4R A;  1MIX A;  4K2O A;  1OMW A;  4MT7 A;  2NZ8 B;  5KCV A;  2CRF A;  1M7R A;  5DHA B;  4HAU B;  2COC A;  1ZSQ A;  1WVH A;  3VOQ A;  4A6F B;  4ZRI A;  1X11 A;  2DKQ A;  2QKM A;  3GYO A;  2LUL A;  1UNQ A;  1TQZ A;  4K2P A;  4WJ7 A;  1QC6 A;  2KGX B;  3ULB A;  3PVL A;  3HW2 B;  1KZG A;  1WG7 A;  5JP4 A;  4PQ0 A;  3QBV B;  2RUK B;  3UZT A;  1X1F A;  2VKI A;  2EMS A;  1H10 A;  1TJ6 A;  1DBH A;  1DDM A;  2HTH B;  3ULC A;  4K81 A;  2Y8G A;  2DHK A;  4GXB A;  4Z2N A;  1DYN A;  2ELA A;  3DXC A;  4DXA B;  1J19 A;  5C6R A;  1XD4 A;  3BIN A;  2HE7 A;  5FI0 A;  2ZPY A;  1XR0 B;  1ZVR A;  5JHH A;  2LYD A;  3MPX A;  5DIF B;  2GJY A;  4HAZ B;  1UPQ A;  2MDX A;  2D11 A;  2L2I A;  1SGH A;  2H7E A;  5HE1 A;  2JP2 A;  2AL6 A;  1MKE A;  1W1H A;  1GC6 A;  2YSZ A;  3A8P A;  3PSC A;  4HAW B;  1Y19 B;  2Z0P A;  2FJL A;  2DYQ A;  2OTX A;  1NU2 A;  2W2W A;  1U27 A;  2EJ8 A;  4GMV A;  2DX5 A;  2QKL A;  2N0Y A;  3AU5 A;  3G9W A;  1V5P A;  5CLL B;  3KZ1 A;  4HDO A;  1WJ1 A;  2D10 A;  3SYX A;  3GYP A;  1FHO A;  5D3X A;  5D3V A;  2YF0 A;  3PZD A;  1WGQ A;  1P5T A;  2DA0 A;  1BWN A;  2YS1 A;  4HB2 B;  1TXD A;  3KRW A;  3TFM A;  1DDW A;  2DYN A;  3AU4 A;  5CLQ B;  2W2X C;  5D27 A;  3PEG A;  1RRP B;  1KZ7 A;  2P0F A;  1FOE A;  4MY6 A;  3X23 A;  2M14 A;  4H8S A;  4GZU A;  1GG3 A;  3ZDT A;  4EJN A;  2N23 A;  4A6K A;  2Q13 A;  3SUZ A;  3A98 B;  1X86 A;  2W2X D;  2EC1 A;  3ODX A;  4DX9 0;  3KRX A;  2Z0O A;  1B55 A;  5JHG A;  4L6E A;  1BTN A;  2IFS A;  1FHW A;  2K2J A;  2RNR B;  1LW3 A;  3F0W A;  1SHC A;  3FEH A;  4DBB A;  1NI2 A;  5HE3 A;  4F7G A;  5C5B A;  3CIK A;  4IFS A;  4KAX B;  2E2X A;  5DH9 B;  1E5W A;  1EGX A;  1PLS A;  1U5F A;  3FSS A;  2D2Q A;  2Z0Q A;  2Y8F A;  2DKP A;  1XCG A;  2I5C A;  4CHJ A;  2I1J A;  2BCJ A;  5D3W A;  2YVC A;  2CAY A;  2G35 A;  2KCJ A;  2ROV A;  2MKR A;  1UPR A;  2CY5 A;  2I5F A;  2ROZ B;  5JLJ B;  1NTY A;  1KI1 B;  4HAV B;  4NY0 A;  1WI1 A;  4YL8 A;  3WYF B;  3VIA A;  5C16 A;  5GOW B;  3PVU A;  2CY4 A;  3LJU X;  3PG7 A;  4DX8 A;  3ODO A;  5FI1 A;  5C5B B;  5KQ1 A;  5LOP B;  1I7A A;  2K2U A;  2UZS A;  3P7Z A;  1UEF A;  2D9V A;  2DTC A;  4HAX B;  4HDQ A;  2KUP A;  1V88 A;  4ZRJ A;  1K5D B;  3SO6 A;  3PP2 A;  1XX0 A;  1MIZ B;  2COA A;  2LKO A;  4GMX B;  1PFJ A;  4TKN A;  2RGN B;  2X18 A;  1PMS A;  3D8F A;  4K17 A;  3A8Q A;  4HB0 B;  4IOY X;  2J0J A;  3CXB B;  1FAO A;  2M38 A;  2VRW B;  2LOX A;  1NTV A;  4WVF B;  2J59 M;  1FB8 A;  1M7E A;  5DI9 B;  3D8D A;  2GCJ A;  2DN6 A;  2AEH A;  1FHX A;  3WA0 A;  2D9W A;  3HQC A;  3PVW A;  2UZR A;  2DHJ A;  5J3T A;  4A6H A;  1MAI A;  1BTK A;  1XOD A;  2YT0 A;  1V5U A;  1J0W A;  1W1G A;  5LON B;  3KY9 A;  4BBK A;  4HB4 B;  2DLW A;  4YON A;  2ELB A;  4WSF A; 
#chains in the Genus database with same CATH topology
 1V5M A;  3HIE A;  3SNH A;  4A5K A;  2COF A;  3U8Z A;  2Z4D A;  1V89 A;  3O96 A;  2Z14 A;  2YS5 A;  3N7C A;  4L1R A;  5J3Q A;  2DFK A;  4QJ4 B;  3FM8 C;  2DHI A;  4KVG B;  3MDB C;  4Z2M B;  4TYZ A;  3RCP A;  1U5E A;  4F7U P;  1GC7 A;  2I1K A;  2K00 A;  2V76 A;  3TO1 A;  1UNP A;  2P8V A;  2Z13 A;  2LOZ A;  4B6H A;  1AQC A;  1FGZ A;  5C79 A;  1U5G A;  2P0H A;  3D8E A;  1ZM0 A;  4CYE A;  5D3Y A;  5DHF B;  2H7D A;  3QWM A;  1MK7 B;  1OQN A;  5EFX A;  1QQG A;  4KHO A;  2UVM A;  5J3Y A;  1K5G B;  2GS0 A;  3ZVR A;  2YS3 A;  3DXD A;  2YT1 A;  4HHV A;  4OSN A;  2GCL A;  2D9X A;  2J0K A;  1LB1 A;  4NSW A;  3IVF A;  2NMB A;  4Y94 A;  3F5R A;  1P3R A;  1ZC4 B;  1MPH A;  2COD A;  1V61 A;  4P7I A;  1IRS A;  1U5D A;  4F7H A;  1U2B A;  1X1G A;  3ODW A;  1EF1 A;  2RRF A;  1X05 A;  3NSU A;  1DRO A;  2MWN B;  2Y7B A;  4HAT B;  1RJ2 A;  2D9Z A;  3BJI A;  1XKE A;  2DX1 A;  2KIG A;  1Y5O A;  1Z87 A;  1U29 A;  4IAP A;  5L81 A;  2EMT A;  4KHA A;  2ADZ A;  1AWE A;  3V5W A;  1EAZ A;  4HB3 B;  3TW1 A;  2ZKM X;  3HK0 A;  4C0A A;  3U12 A;  2XQN M;  2OQB A;  4XWX A;  3TCA A;  3KSY A;  3SV1 A;  4EKU A;  3AJ4 A;  2KR0 A;  4CHM A;  2D4Q A;  3M1I B;  3U7D A;  1ISN A;  1WJM A;  1DDV A;  4ZRK A;  1ZC3 B;  3P6A A;  1MK9 B;  2D9Y A;  2LG1 A;  4GN1 A;  2RLO A;  4A6F A;  5HE0 A;  4D0N B;  2K8E A;  3OAN A;  1ZYI A;  2IYB A;  2YT2 A;  4MK0 A;  4HSI A;  2R0D A;  2K49 A;  2R2Y A;  4GPT B;  4PNK A;  1N3H A;  1Q67 A;  1EVH A;  5HE2 A;  1BAK A;  1FGY A;  3ML4 A;  5KQ4 A;  2VSZ A;  2P0D A;  2L1C A;  2R09 A;  3T06 A;  1WGU A;  2MFQ A;  2J0M A;  1I2H A;  4KHB B;  1W1D A;  3QIJ A;  2RVB B;  1P6S A;  2PZ1 A;  2RSG A;  1UNR A;  3DXE A;  1OY2 A;  4HAY B;  3TVV A;  2YRY A;  4EMO A;  1H4R A;  1MIX A;  4K2O A;  1OMW A;  4MT7 A;  2NZ8 B;  5KCV A;  2CRF A;  1M7R A;  5DHA B;  4HAU B;  2COC A;  5M4Y B;  1ZSQ A;  1WVH A;  3VOQ A;  4A6F B;  4ZRI A;  5LG4 B;  1X11 A;  2DKQ A;  2QKM A;  3GYO A;  2LUL A;  1UNQ A;  1TQZ A;  4K2P A;  4WJ7 A;  1QC6 A;  2KGX B;  2GUM A;  3ULB A;  3PVL A;  5I2S A;  3HW2 B;  1KZG A;  1WG7 A;  5JP4 A;  4PQ0 A;  3QBV B;  2RUK B;  4OT1 A;  3UZT A;  1X1F A;  2VKI A;  3NW8 A;  2EMS A;  1H10 A;  1TJ6 A;  1DBH A;  1DDM A;  2HTH B;  3ULC A;  4K81 A;  2Y8G A;  2DHK A;  4GXB A;  4Z2N A;  1DYN A;  2ELA A;  2KIE A;  3DXC A;  4DXA B;  1J19 A;  5C6R A;  1XD4 A;  3BIN A;  2HE7 A;  5FI0 A;  2ZPY A;  1XR0 B;  1ZVR A;  5JHH A;  3DCX A;  2LYD A;  3MPX A;  5DIF B;  2GJY A;  4HAZ B;  1UPQ A;  2MDX A;  2D11 A;  2L2I A;  1SGH A;  2H7E A;  5HE1 A;  1MI1 A;  2JP2 A;  2AL6 A;  1MKE A;  1W1H A;  1GC6 A;  2YSZ A;  3A8P A;  3PSC A;  4HAW B;  1Y19 B;  2Z0P A;  2FJL A;  2DYQ A;  2OTX A;  1NU2 A;  2W2W A;  1U27 A;  2EJ8 A;  4GMV A;  2DX5 A;  2QKL A;  2N0Y A;  3AU5 A;  3G9W A;  1V5P A;  5CLL B;  3KZ1 A;  4HDO A;  1WJ1 A;  2D10 A;  3SYX A;  3GYP A;  4GOU A;  1FHO A;  5D3X A;  5D3V A;  2YF0 A;  3PZD A;  1WGQ A;  1P5T A;  2DA0 A;  1BWN A;  2YS1 A;  4HB2 B;  1TXD A;  3KRW A;  3TFM A;  1DDW A;  2DYN A;  3AU4 A;  3OHM B;  5CLQ B;  2W2X C;  5D27 A;  3PEG A;  1RRP B;  1KZ7 A;  2P0F A;  1FOE A;  4MY6 A;  3X23 A;  2M14 A;  4H8S A;  4GZU A;  4QJ3 B;  1GG3 A;  3ZDT A;  4EJN A;  2N23 A;  4A6K A;  2Q13 A;  3SUZ A;  3A98 B;  1X86 A;  2W2X D;  2EC1 A;  3ODX A;  4DX9 0;  3KRX A;  2Z0O A;  1B55 A;  3A58 A;  5JHG A;  4L6E A;  1BTN A;  2IFS A;  1FHW A;  2K2J A;  2RNR B;  1LW3 A;  3F0W A;  1SHC A;  3FEH A;  4DBB A;  1NI2 A;  5HE3 A;  4F7G A;  5C5B A;  3CIK A;  4IFS A;  4KAX B;  2E2X A;  5DH9 B;  1E5W A;  1EGX A;  1PLS A;  2KUQ A;  1U5F A;  3FSS A;  2D2Q A;  2Z0Q A;  2Y8F A;  4DIX A;  2DKP A;  1XCG A;  2I5C A;  4CHJ A;  2I1J A;  2BCJ A;  3NWF A;  5D3W A;  2YVC A;  2CAY A;  2G35 A;  4GNK B;  2KCJ A;  2ROV A;  3NWD A;  2MKR A;  1UPR A;  2CY5 A;  2I5F A;  2ROZ B;  5JLJ B;  1NTY A;  1KI1 B;  4HAV B;  4NY0 A;  1WI1 A;  4CSQ A;  4YL8 A;  3WYF B;  5IRS A;  3VIA A;  5C16 A;  5GOW B;  3PVU A;  2CY4 A;  3LJU X;  4QXA B;  3PG7 A;  4DX8 A;  3ODO A;  5FI1 A;  5I2M A;  1T77 A;  5C5B B;  5KQ1 A;  5LOP B;  1I7A A;  3HSA A;  2K2U A;  2UZS A;  3P7Z A;  1UEF A;  2D9V A;  2DTC A;  2Z59 A;  2NBV A;  4HAX B;  4HDQ A;  4KHB A;  2KUP A;  1V88 A;  4ZRJ A;  1K5D B;  3SO6 A;  3PP2 A;  1XX0 A;  1MIZ B;  2COA A;  2LKO A;  4GMX B;  1PFJ A;  4TKN A;  2RGN B;  2X18 A;  1PMS A;  3D8F A;  4K17 A;  3A8Q A;  3B77 A;  4HB0 B;  4IOY X;  2J0J A;  3CXB B;  1FAO A;  2M38 A;  2VRW B;  2LOX A;  1NTV A;  4WVF B;  2J59 M;  1FB8 A;  1M7E A;  5DI9 B;  3D8D A;  4QJ5 B;  4D6W A;  2GCJ A;  2DN6 A;  2AEH A;  1FHX A;  3WA0 A;  2D9W A;  2FJU B;  3HQC A;  3PVW A;  2UZR A;  2DHJ A;  5J3T A;  4A6H A;  1MAI A;  1BTK A;  3NWA A;  1XOD A;  2YT0 A;  1V5U A;  1J0W A;  1W1G A;  5LON B;  3KY9 A;  4BBK A;  4HB4 B;  2DLW A;  4YON A;  3FVC A;  2ELB A;  4WSF A; 
#chains in the Genus database with same CATH homology
 1V5M A;  3HIE A;  3SNH A;  4A5K A;  2COF A;  3U8Z A;  2Z4D A;  1V89 A;  3O96 A;  2Z14 A;  2YS5 A;  3N7C A;  4L1R A;  5J3Q A;  2DFK A;  4QJ4 B;  3FM8 C;  2DHI A;  4KVG B;  3MDB C;  4Z2M B;  4TYZ A;  3RCP A;  1U5E A;  4F7U P;  1GC7 A;  2I1K A;  2K00 A;  2V76 A;  3TO1 A;  1UNP A;  2P8V A;  2Z13 A;  2LOZ A;  4B6H A;  1AQC A;  1FGZ A;  5C79 A;  1U5G A;  2P0H A;  3D8E A;  1ZM0 A;  4CYE A;  5D3Y A;  5DHF B;  2H7D A;  3QWM A;  1MK7 B;  1OQN A;  5EFX A;  1QQG A;  4KHO A;  2UVM A;  5J3Y A;  1K5G B;  2GS0 A;  3ZVR A;  2YS3 A;  3DXD A;  2YT1 A;  4HHV A;  4OSN A;  2GCL A;  2D9X A;  2J0K A;  1LB1 A;  4NSW A;  3IVF A;  2NMB A;  4Y94 A;  3F5R A;  1P3R A;  1ZC4 B;  1MPH A;  2COD A;  1V61 A;  4P7I A;  1U5D A;  1IRS A;  4F7H A;  1U2B A;  1X1G A;  3ODW A;  1EF1 A;  2RRF A;  1X05 A;  3NSU A;  1DRO A;  2MWN B;  2Y7B A;  4HAT B;  1RJ2 A;  2D9Z A;  3BJI A;  1XKE A;  2DX1 A;  2KIG A;  1Y5O A;  1Z87 A;  1U29 A;  4IAP A;  5L81 A;  2EMT A;  4KHA A;  2ADZ A;  1AWE A;  3V5W A;  1EAZ A;  4HB3 B;  3TW1 A;  3HK0 A;  2ZKM X;  4C0A A;  3U12 A;  2XQN M;  2OQB A;  4XWX A;  3TCA A;  3KSY A;  3SV1 A;  4EKU A;  3AJ4 A;  4CHM A;  2KR0 A;  2D4Q A;  3M1I B;  3U7D A;  1ISN A;  1WJM A;  1DDV A;  4ZRK A;  1ZC3 B;  3P6A A;  1MK9 B;  2D9Y A;  2LG1 A;  4GN1 A;  2RLO A;  4A6F A;  5HE0 A;  4D0N B;  2K8E A;  3OAN A;  1ZYI A;  2IYB A;  2YT2 A;  4MK0 A;  4HSI A;  2R0D A;  2K49 A;  2R2Y A;  4GPT B;  4PNK A;  1N3H A;  1Q67 A;  1EVH A;  5HE2 A;  1BAK A;  1FGY A;  3ML4 A;  5KQ4 A;  2VSZ A;  2P0D A;  2L1C A;  2R09 A;  3T06 A;  1WGU A;  2MFQ A;  2J0M A;  1I2H A;  4KHB B;  1W1D A;  3QIJ A;  2RVB B;  1P6S A;  2PZ1 A;  2RSG A;  1UNR A;  3DXE A;  1OY2 A;  4HAY B;  3TVV A;  2YRY A;  4EMO A;  1H4R A;  1MIX A;  4K2O A;  1OMW A;  4MT7 A;  2NZ8 B;  5KCV A;  2CRF A;  1M7R A;  5DHA B;  4HAU B;  2COC A;  5M4Y B;  1ZSQ A;  1WVH A;  3VOQ A;  4A6F B;  4ZRI A;  5LG4 B;  1X11 A;  2DKQ A;  2QKM A;  3GYO A;  2LUL A;  1UNQ A;  1TQZ A;  4K2P A;  4WJ7 A;  1QC6 A;  2KGX B;  2GUM A;  3ULB A;  3PVL A;  5I2S A;  3HW2 B;  1KZG A;  1WG7 A;  5JP4 A;  4PQ0 A;  3QBV B;  2RUK B;  3UZT A;  4OT1 A;  1X1F A;  2VKI A;  3NW8 A;  2EMS A;  1H10 A;  1TJ6 A;  1DBH A;  1DDM A;  2HTH B;  3ULC A;  4K81 A;  2Y8G A;  2DHK A;  4GXB A;  4Z2N A;  1DYN A;  2ELA A;  2KIE A;  3DXC A;  4DXA B;  1J19 A;  5C6R A;  1XD4 A;  3BIN A;  2HE7 A;  5FI0 A;  2ZPY A;  1XR0 B;  1ZVR A;  5JHH A;  2LYD A;  3MPX A;  5DIF B;  2GJY A;  4HAZ B;  1UPQ A;  2MDX A;  2D11 A;  2L2I A;  1SGH A;  2H7E A;  5HE1 A;  2JP2 A;  2AL6 A;  1MKE A;  1W1H A;  1GC6 A;  2YSZ A;  3A8P A;  3PSC A;  4HAW B;  1Y19 B;  2Z0P A;  2FJL A;  2DYQ A;  2OTX A;  1NU2 A;  2W2W A;  1U27 A;  2EJ8 A;  4GMV A;  2DX5 A;  2QKL A;  2N0Y A;  3AU5 A;  3G9W A;  1V5P A;  5CLL B;  3KZ1 A;  4HDO A;  1WJ1 A;  2D10 A;  3SYX A;  3GYP A;  4GOU A;  1FHO A;  5D3X A;  5D3V A;  2YF0 A;  3PZD A;  1WGQ A;  1P5T A;  2DA0 A;  1BWN A;  2YS1 A;  4HB2 B;  1TXD A;  3KRW A;  3TFM A;  1DDW A;  2DYN A;  3AU4 A;  3OHM B;  5CLQ B;  2W2X C;  5D27 A;  3PEG A;  1RRP B;  1KZ7 A;  2P0F A;  1FOE A;  4MY6 A;  3X23 A;  2M14 A;  4H8S A;  4GZU A;  4QJ3 B;  1GG3 A;  3ZDT A;  4EJN A;  2N23 A;  4A6K A;  2Q13 A;  3SUZ A;  3A98 B;  1X86 A;  2W2X D;  2EC1 A;  3ODX A;  4DX9 0;  3KRX A;  2Z0O A;  1B55 A;  5JHG A;  3A58 A;  4L6E A;  1BTN A;  2IFS A;  1FHW A;  2K2J A;  2RNR B;  1LW3 A;  3F0W A;  1SHC A;  3FEH A;  4DBB A;  1NI2 A;  5HE3 A;  4F7G A;  5C5B A;  3CIK A;  4IFS A;  4KAX B;  2E2X A;  5DH9 B;  1E5W A;  1EGX A;  1PLS A;  2KUQ A;  1U5F A;  3FSS A;  2D2Q A;  2Z0Q A;  2Y8F A;  4DIX A;  2DKP A;  1XCG A;  2I5C A;  4CHJ A;  2I1J A;  2BCJ A;  3NWF A;  5D3W A;  2YVC A;  2CAY A;  2G35 A;  4GNK B;  2KCJ A;  2ROV A;  3NWD A;  2MKR A;  1UPR A;  2CY5 A;  2I5F A;  2ROZ B;  5JLJ B;  1NTY A;  1KI1 B;  4HAV B;  4NY0 A;  1WI1 A;  4CSQ A;  4YL8 A;  3WYF B;  5IRS A;  3VIA A;  5C16 A;  5GOW B;  3PVU A;  2CY4 A;  3LJU X;  4QXA B;  3PG7 A;  4DX8 A;  3ODO A;  5FI1 A;  5I2M A;  5C5B B;  5KQ1 A;  5LOP B;  1I7A A;  2K2U A;  2UZS A;  3P7Z A;  1UEF A;  2D9V A;  2DTC A;  2Z59 A;  2NBV A;  4HAX B;  4HDQ A;  4KHB A;  2KUP A;  1V88 A;  4ZRJ A;  1K5D B;  3SO6 A;  3PP2 A;  1XX0 A;  1MIZ B;  2COA A;  2LKO A;  4GMX B;  1PFJ A;  4TKN A;  2RGN B;  2X18 A;  1PMS A;  3D8F A;  4K17 A;  3A8Q A;  4HB0 B;  4IOY X;  2J0J A;  3CXB B;  1FAO A;  2M38 A;  2VRW B;  2LOX A;  1NTV A;  4WVF B;  2J59 M;  1FB8 A;  1M7E A;  5DI9 B;  3D8D A;  4QJ5 B;  4D6W A;  2GCJ A;  2DN6 A;  2AEH A;  1FHX A;  3WA0 A;  2D9W A;  2FJU B;  3HQC A;  3PVW A;  2UZR A;  2DHJ A;  5J3T A;  4A6H A;  1MAI A;  1BTK A;  3NWA A;  1XOD A;  2YT0 A;  1V5U A;  1J0W A;  1W1G A;  5LON B;  3KY9 A;  4BBK A;  4HB4 B;  2DLW A;  4YON A;  3FVC A;  2ELB A;  4WSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...