3TO1A

Two surfaces on rtt106 mediate histone binding and chaperone activity
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
230
structure length
212
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
publication title Two surfaces on the histone chaperone Rtt106 mediate histone binding, replication, and silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 212
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3to1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3to1A01
4TKNA 2HE7A 1V5PA 1U5DA 3ZDTA 1U29A 3SV1A 2YRYA 2RSGA 1U5GA 2VSZA 3A98B 5D3VA 4A6FB 5DHFB 2N0YA 2W2XD 4B6HA 1DDWA 3GYPA 2X18A 1OY2A 2E2XA 2Z0OA 3AU5A 1XKEA 3AU4A 2DTCA 4A5KA 4KAXB 4KHOA 2J0MA 5FI1A 1J0WA 5L81A 4GZUA 4A6KA 5DI9B 4MK0A 3AJ4A 2I5CA 3DXDA 2P0FA 2UVMA 4PQ0A 2N23A 2GS0A 5JP4A 1E5WA 2AL6A 2G35A 2LYDA 2ADZA 4K81A 2COFA 1X86A 2BCJA 1WVHA 1LW3A 1KZ7A 1FGZA 1XCGA 3DXCA 2D9YA 1XODA 2IFSA 1W1DA 2DHKA 4KHAA 4C0AA 1M7RA 2ROZB 4IAPA 3TO1A 4A6HA 1DDVA 3BJIA 1WI1A 3VOQA 2D11A 5DH9B 4PNKA 2DFKA 3D8DA 2OTXA 4HAXB 4F7UP 2DKPA 3HW2B 2MDXA 1V89A 3WYFB 4HAYB 1GG3A 2QKMA 2NMBA 4CYEA 3DXEA 2COCA 2RVBB 3KRXA 1PMSA 4TYZA 4H8SA 1XX0A 1AQCA 3FEHA 2DHIA 1KI1B 1BTKA 3KSYA 2DX1A 3PSCA 4K2PA 3CIKA 2EMTA 3X23A 5FI0A 1FAOA 3TW1A 1MIXA 1V5UA 3A8QA 1Q67A 1SGHA 1DDMA 3KZ1A 2DHJA 4ZRJA 5C79A 2RUKB 2K2JA 4HAZB 5D3WA 2PZ1A 2W2WA 1ISNA 5J3TA 1Y5OA 1XR0B 4HATB 1RRPB 2ELBA 1UNRA 4XWXA 1M7EA 1Y19B 1NU2A 3SO6A 1ZSQA 3A8PA 2EJ8A 1X05A 1X1GA 5JLJB 2DA0A 2K00A 2YSZA 2YS5A 2GJYA 3PG7A 2FJLA 4L6EA 1DBHA 1J19A 3V5WA 2M38A 4F7HA 1MIZB 2XQNM 4MY6A 1I7AA 1MAIA 2D9WA 3FM8C 3ODOA 1GC7A 3PVUA 2D9VA 2P8VA 1ZM0A 3MPXA 1UPRA 1UEFA 2Z0QA 4K2OA 4D0NB 2RLOA 2UZRA 4KVGB 3U7DA 5C6RA 1UPQA 2DYQA 1SHCA 2CY5A 1XD4A 4GMVA 2W2XC 4GN1A 1EGXA 2Z0PA 2J0JA 1ZC4B 2YS3A 1TJ6A 3VIAA 2H7EA 3IVFA 4P7IA 3PVLA 1NI2A 4WSFA 2D4QA 1MPHA 1KZGA 2EMSA 2V76A 3HQCA 3WA0A 1FOEA 1V5MA 4WJ7A 2YVCA 3ML4A 4HHVA 4HAWB 4MT7A 3ZVRA 5LOPB 2MFQA 2I1JA 1WJMA 1IRSA 3SUZA 2RGNB 1B55A 5C5BA 3ODWA 3PZDA 4CHMA 2QKLA 1X1FA 1PLSA 2L2IA 3HK0A 1NTVA 1FGYA 5CLQB 2L1CA 4Z2MB 3QWMA 1WGQA 4YL8A 4WVFB 2YT1A 1V88A 2IYBA 1DROA 5GOWB 3SNHA 4HB2B 2EC1A 4A6FA 5LONB 3GYOA 3QBVB 4IOYX 3ULBA 2VKIA 3D8EA 2D9XA 5HE3A 4HAVB 2CY4A 4DXAB 1P5TA 1GC6A 5J3QA 4F7GA 2CODA 1TXDA 4HDQA 1FHWA 4DX8A 4Z2NA 3BINA 2I1KA 4CHJA 4GXBA 5HE0A 1N3HA 1V61A 1OQNA 1WG7A 5DHAB 4EJNA 3FSSA 3M1IB 4K17A 2Y7BA 2K2UA 5KCVA 3NSUA 2DLWA 4HB0B 1U5EA 1U5FA 5D27A 1I2HA 1DYNA 2JP2A 1K5DB 2HTHB 5J3YA 4ZRIA 2RNRB 2D9ZA 2D2QA 3MDBC 1QC6A 4HB4B 1BWNA 4EKUA 3UZTA 2ELAA 4ZRKA 2M14A 2D10A 3T06A 2Q13A 3KY9A 3F5RA 2KCJA 2GCLA 1U2BA 2DKQA 1UNPA 2DX5A 3O96A 2UZSA 4NY0A 4HAUB 2MKRA 3TFMA 2DN6A 1EVHA 4GPTB 1AWEA 2MWNB 4GMXB 3ODXA 5D3YA 1WJ1A 3PP2A 2CAYA 4DBBA 1OMWA 5EFXA 3CXBB 3RCPA 1X11A 2P0DA 3D8FA 4BBKA 1PFJA 2LOXA 2KUPA 4EMOA 4DX90 4HDOA 2R0DA 3TCAA 5DIFB 2DYNA 3TVVA 2CRFA 2J0KA 1TQZA 2LKOA 3SYXA 3KRWA 1FHXA 2ZPYA 1QQGA 3P6AA 3PVWA 1H4RA 1UNQA 1WGUA 5JHHA 1H10A 1NTYA 1RJ2A 2R09A 1MKEA 2LULA 5JHGA 2I5FA 1BTNA 1EF1A 1FB8A 3G9WA 3PEGA 2H7DA 2AEHA 4NSWA 2NZ8B 1K5GB 2KGXB 5KQ4A 4IFSA 2J59M 1EAZA 2OQBA 1W1HA 5HE2A 2LG1A 2P0HA 5C16A 2COAA 4HB3B 2LOZA 2YS1A 1MK7B 2ROVA 2YT0A 3P7ZA 1ZVRA 4KHBB 1ZC3B 2GCJA 1BAKA 1FHOA 1MK9B 5CLLB 3U8ZA 1LB1A 3OANA 1P6SA 3F0WA 1U27A 5D3XA 2Y8FA 5HE1A 3N7CA 1Z87A 4Y94A 3LJUX 2VRWB 2YF0A 1P3RA 2Y8GA 5C5BB 4YONA 3ULCA 5KQ1A 3QIJA 1W1GA
chains in the Genus database with same CATH superfamily
4TKNA 2HE7A 1V5PA 1U5DA 3ZDTA 1U29A 3SV1A 2YRYA 2RSGA 2K8EA 1U5GA 2VSZA 3A98B 5D3VA 4A6FB 5DHFB 2N0YA 2W2XD 4B6HA 1DDWA 3GYPA 2X18A 1OY2A 2E2XA 2Z0OA 3AU5A 1XKEA 3AU4A 2DTCA 4A5KA 4KAXB 4KHOA 2J0MA 5FI1A 1J0WA 5L81A 4GZUA 4A6KA 5DI9B 4MK0A 3AJ4A 3DCXA 2I5CA 2Z59A 3DXDA 2P0FA 2UVMA 4PQ0A 2N23A 2GS0A 5JP4A 1E5WA 2AL6A 2G35A 2LYDA 2ADZA 4K81A 2COFA 1X86A 2BCJA 1WVHA 1LW3A 1KZ7A 2FJUB 1FGZA 5I2SA 1XCGA 3DXCA 2D9YA 1XODA 2IFSA 1W1DA 2DHKA 4KHAA 5M4YB 4C0AA 1M7RA 2ROZB 4IAPA 3NWFA 3TO1A 4A6HA 1DDVA 3BJIA 1WI1A 3VOQA 2D11A 5DH9B 4PNKA 2DFKA 3D8DA 2OTXA 1T77A 4HAXB 4F7UP 2DKPA 3HW2B 2MDXA 1V89A 2RRFA 3WYFB 4HAYB 1GG3A 2QKMA 2NMBA 4CYEA 3DXEA 2COCA 2RVBB 3KRXA 1PMSA 4TYZA 4H8SA 1XX0A 1AQCA 3FEHA 2DHIA 1KI1B 1BTKA 3KSYA 2DX1A 3PSCA 4K2PA 3CIKA 2EMTA 3X23A 5FI0A 1FAOA 4GOUA 3TW1A 1MIXA 1V5UA 3A8QA 1Q67A 1SGHA 1DDMA 3KZ1A 2DHJA 4ZRJA 5C79A 2RUKB 2K2JA 4HAZB 5D3WA 2PZ1A 2ZKMX 2W2WA 1ISNA 5J3TA 1Y5OA 1XR0B 3NWDA 4HATB 3HSAA 1RRPB 2KR0A 2ELBA 1UNRA 4XWXA 1M7EA 1Y19B 1NU2A 3SO6A 1ZSQA 3A8PA 2EJ8A 1X05A 1X1GA 5JLJB 2DA0A 2K00A 2YSZA 2YS5A 2GJYA 3PG7A 2FJLA 3OHMB 4L6EA 1DBHA 1J19A 3V5WA 2M38A 4F7HA 1MIZB 2XQNM 4MY6A 1I7AA 1MAIA 2D9WA 3FM8C 3ODOA 1GC7A 3PVUA 2D9VA 2P8VA 1ZM0A 3FVCA 3MPXA 1UPRA 1UEFA 2Z0QA 4K2OA 4D0NB 2RLOA 2UZRA 4KVGB 4QJ3B 3U7DA 5C6RA 1UPQA 2DYQA 3A58A 1SHCA 2CY5A 1XD4A 4GMVA 2W2XC 4GN1A 1EGXA 2Z0PA 2J0JA 1ZC4B 2YS3A 1TJ6A 3VIAA 2H7EA 3IVFA 3B77A 4P7IA 3PVLA 1NI2A 4WSFA 2D4QA 1MPHA 1KZGA 2EMSA 2V76A 3HQCA 4KHBA 3WA0A 1ZYIA 1FOEA 1V5MA 4L1RA 4WJ7A 2YVCA 3ML4A 4HHVA 4HAWB 4MT7A 3ZVRA 2NBVA 5LOPB 2MFQA 2I1JA 1WJMA 1IRSA 3SUZA 2RGNB 1B55A 5C5BA 3ODWA 3PZDA 4CHMA 2QKLA 1X1FA 1PLSA 2L2IA 3HK0A 1NTVA 1FGYA 5CLQB 2L1CA 4Z2MB 3QWMA 3U12A 1WGQA 4OT1A 4YL8A 1MI1A 4WVFB 2YT1A 1V88A 2IYBA 1DROA 5GOWB 3SNHA 2Z13A 4HB2B 2EC1A 4A6FA 5LONB 3GYOA 3QBVB 4IOYX 3ULBA 2VKIA 3D8EA 2D9XA 5HE3A 4HAVB 2CY4A 4DXAB 1P5TA 1GC6A 5J3QA 4F7GA 2CODA 2GUMA 1TXDA 2KUQA 4HDQA 1FHWA 4DX8A 4Z2NA 3BINA 2I1KA 4CHJA 4GXBA 4GNKB 5HE0A 1N3HA 1V61A 1OQNA 1WG7A 5DHAB 4OSNA 4EJNA 3FSSA 3M1IB 2K49A 2Y7BA 4K17A 2K2UA 5KCVA 3NSUA 2DLWA 4HB0B 1U5EA 4D6WA 1U5FA 5D27A 1I2HA 1DYNA 2JP2A 1K5DB 2HTHB 5J3YA 4ZRIA 4QJ4B 2RNRB 2D9ZA 2D2QA 3MDBC 1QC6A 4HB4B 2Z14A 1BWNA 4EKUA 3UZTA 2ELAA 4ZRKA 4CSQA 2M14A 2D10A 3T06A 2Q13A 3KY9A 3F5RA 5IRSA 2KCJA 2GCLA 1U2BA 2DKQA 1UNPA 5LG4B 2DX5A 2KIGA 3O96A 2UZSA 4NY0A 5I2MA 4HAUB 2MKRA 3TFMA 2DN6A 1EVHA 4GPTB 1AWEA 2MWNB 4GMXB 4HSIA 3ODXA 5D3YA 1WJ1A 3PP2A 2CAYA 4DBBA 1OMWA 3NW8A 5EFXA 3CXBB 2R2YA 3RCPA 1X11A 2P0DA 3D8FA 4BBKA 1PFJA 2LOXA 2KUPA 4EMOA 4DX90 4HDOA 2R0DA 2Z4DA 3TCAA 5DIFB 2DYNA 3TVVA 2CRFA 2J0KA 1TQZA 2LKOA 3SYXA 3KRWA 1FHXA 2ZPYA 1QQGA 2KIEA 3P6AA 3PVWA 1H4RA 1UNQA 1WGUA 5JHHA 1H10A 1NTYA 1RJ2A 2R09A 1MKEA 2LULA 5JHGA 2I5FA 1BTNA 1EF1A 1FB8A 3G9WA 3PEGA 2H7DA 2AEHA 4NSWA 3NWAA 2NZ8B 1K5GB 2KGXB 5KQ4A 4IFSA 2J59M 1EAZA 2OQBA 1W1HA 5HE2A 2LG1A 4QJ5B 2P0HA 4DIXA 5C16A 2COAA 4HB3B 2LOZA 2YS1A 1MK7B 2ROVA 2YT0A 3P7ZA 4QXAB 1ZVRA 4KHBB 1ZC3B 2YT2A 2GCJA 1BAKA 1FHOA 1MK9B 5CLLB 3U8ZA 1LB1A 3OANA 1P6SA 3F0WA 1U27A 5D3XA 2Y8FA 5HE1A 3N7CA 1Z87A 4Y94A 3LJUX 2VRWB 2YF0A 1P3RA 2Y8GA 5C5BB 4YONA 3HIEA 3ULCA 5KQ1A 3QIJA 1W1GA
chains in the Genus database with same CATH topology
4TKNA 2HE7A 1V5PA 1U5DA 3ZDTA 1U29A 3SV1A 2YRYA 2RSGA 2K8EA 1U5GA 2VSZA 3A98B 5D3VA 4A6FB 5DHFB 2N0YA 2W2XD 4B6HA 1DDWA 3GYPA 2X18A 1OY2A 2E2XA 2Z0OA 3AU5A 1XKEA 3AU4A 2DTCA 4A5KA 4KAXB 4KHOA 2J0MA 5FI1A 1J0WA 5L81A 4GZUA 4A6KA 5DI9B 4MK0A 3AJ4A 2I5CA 2Z59A 3DXDA 2P0FA 2UVMA 4PQ0A 2N23A 2GS0A 5JP4A 1E5WA 2AL6A 2G35A 2LYDA 2ADZA 4K81A 2COFA 1X86A 2BCJA 1WVHA 1LW3A 1KZ7A 2FJUB 1FGZA 5I2SA 1XCGA 3DXCA 2D9YA 1XODA 2IFSA 1W1DA 2DHKA 4KHAA 5M4YB 4C0AA 1M7RA 2ROZB 4IAPA 3NWFA 3TO1A 4A6HA 1DDVA 3BJIA 1WI1A 3VOQA 2D11A 5DH9B 4PNKA 2DFKA 3D8DA 2OTXA 4HAXB 4F7UP 2DKPA 3HW2B 2MDXA 1V89A 2RRFA 3WYFB 4HAYB 1GG3A 2QKMA 2NMBA 4CYEA 3DXEA 2COCA 2RVBB 3KRXA 1PMSA 4TYZA 4H8SA 1XX0A 1AQCA 3FEHA 2DHIA 1KI1B 1BTKA 3KSYA 2DX1A 3PSCA 4K2PA 3CIKA 2EMTA 3X23A 5FI0A 1FAOA 4GOUA 3TW1A 1MIXA 1V5UA 3A8QA 1Q67A 1SGHA 1DDMA 3KZ1A 2DHJA 4ZRJA 5C79A 2RUKB 2K2JA 4HAZB 5D3WA 2PZ1A 2ZKMX 2W2WA 1ISNA 5J3TA 1Y5OA 1XR0B 3NWDA 4HATB 1RRPB 2KR0A 2ELBA 1UNRA 4XWXA 1M7EA 1Y19B 1NU2A 3SO6A 1ZSQA 3A8PA 2EJ8A 1X05A 1X1GA 5JLJB 2DA0A 2K00A 2YSZA 2YS5A 2GJYA 3PG7A 2FJLA 4L6EA 3OHMB 1DBHA 1J19A 3V5WA 2M38A 4F7HA 1MIZB 2XQNM 4MY6A 1I7AA 1MAIA 2D9WA 3FM8C 3ODOA 1GC7A 3PVUA 2D9VA 2P8VA 1ZM0A 3MPXA 3FVCA 1UPRA 1UEFA 2Z0QA 4K2OA 4D0NB 2RLOA 2UZRA 4KVGB 3U7DA 5C6RA 4QJ3B 1UPQA 2DYQA 3A58A 1SHCA 2CY5A 1XD4A 4GMVA 2W2XC 4GN1A 1EGXA 2Z0PA 2J0JA 1ZC4B 2YS3A 1TJ6A 3VIAA 2H7EA 3IVFA 4P7IA 3PVLA 1NI2A 4WSFA 2D4QA 1MPHA 1KZGA 2EMSA 2V76A 3HQCA 4KHBA 3WA0A 1ZYIA 1FOEA 1V5MA 4WJ7A 4L1RA 2YVCA 3ML4A 4HHVA 4HAWB 4MT7A 3ZVRA 2NBVA 5LOPB 2MFQA 2I1JA 1WJMA 1IRSA 3SUZA 2RGNB 1B55A 5C5BA 3ODWA 3PZDA 4CHMA 2QKLA 1X1FA 1PLSA 2L2IA 3HK0A 1NTVA 1FGYA 5CLQB 2L1CA 4Z2MB 3QWMA 3U12A 1WGQA 4OT1A 4YL8A 4WVFB 2YT1A 1V88A 2IYBA 1DROA 5GOWB 3SNHA 2Z13A 4HB2B 2EC1A 4A6FA 5LONB 3GYOA 3QBVB 4IOYX 3ULBA 2VKIA 3D8EA 2D9XA 5HE3A 4HAVB 2CY4A 4DXAB 1P5TA 1GC6A 5J3QA 4F7GA 2CODA 2GUMA 1TXDA 2KUQA 4HDQA 1FHWA 4DX8A 4Z2NA 3BINA 2I1KA 4CHJA 4GXBA 4GNKB 5HE0A 1N3HA 1V61A 1OQNA 1WG7A 5DHAB 4OSNA 4EJNA 3FSSA 3M1IB 4K17A 2Y7BA 2K49A 2K2UA 5KCVA 3NSUA 2DLWA 4HB0B 1U5EA 4D6WA 1U5FA 5D27A 1I2HA 1DYNA 2JP2A 1K5DB 2HTHB 5J3YA 4ZRIA 4QJ4B 2RNRB 2D9ZA 2D2QA 3MDBC 1QC6A 4HB4B 2Z14A 1BWNA 4EKUA 3UZTA 2ELAA 4ZRKA 4CSQA 2M14A 2D10A 3T06A 2Q13A 3KY9A 3F5RA 5IRSA 2KCJA 2GCLA 1U2BA 2DKQA 1UNPA 5LG4B 2DX5A 2KIGA 3O96A 2UZSA 4NY0A 5I2MA 4HAUB 2MKRA 3TFMA 2DN6A 1EVHA 4GPTB 1AWEA 2MWNB 4GMXB 4HSIA 3ODXA 5D3YA 1WJ1A 3PP2A 2CAYA 4DBBA 1OMWA 3NW8A 5EFXA 3CXBB 2R2YA 3RCPA 1X11A 2P0DA 3D8FA 4BBKA 1PFJA 2LOXA 2KUPA 4EMOA 4DX90 4HDOA 2R0DA 2Z4DA 3TCAA 5DIFB 2DYNA 3TVVA 2CRFA 2J0KA 1TQZA 2LKOA 3SYXA 3KRWA 1FHXA 2ZPYA 1QQGA 2KIEA 3P6AA 3PVWA 1H4RA 1UNQA 1WGUA 5JHHA 1H10A 1NTYA 1RJ2A 2R09A 1MKEA 2LULA 5JHGA 2I5FA 1BTNA 1EF1A 1FB8A 3G9WA 3PEGA 2H7DA 2AEHA 4NSWA 3NWAA 2NZ8B 1K5GB 2KGXB 5KQ4A 4IFSA 2J59M 1EAZA 2OQBA 1W1HA 5HE2A 2LG1A 4QJ5B 2P0HA 4DIXA 5C16A 2COAA 4HB3B 2LOZA 2YS1A 1MK7B 2ROVA 2YT0A 3P7ZA 4QXAB 1ZVRA 4KHBB 1ZC3B 2YT2A 2GCJA 1BAKA 1FHOA 1MK9B 5CLLB 3U8ZA 1LB1A 3OANA 1P6SA 3F0WA 1U27A 5D3XA 2Y8FA 5HE1A 3N7CA 1Z87A 4Y94A 3LJUX 2VRWB 2YF0A 1P3RA 2Y8GA 5C5BB 4YONA 3HIEA 3ULCA 5KQ1A 3QIJA 1W1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  2HE7 A;  1V5P A;  1U5D A;  3ZDT A;  1U29 A;  3SV1 A;  2YRY A;  2RSG A;  1U5G A;  2VSZ A;  3A98 B;  5D3V A;  4A6F B;  5DHF B;  2N0Y A;  2W2X D;  4B6H A;  1DDW A;  3GYP A;  2X18 A;  1OY2 A;  2E2X A;  2Z0O A;  3AU5 A;  1XKE A;  3AU4 A;  2DTC A;  4A5K A;  4KAX B;  4KHO A;  2J0M A;  5FI1 A;  1J0W A;  5L81 A;  4GZU A;  4A6K A;  5DI9 B;  4MK0 A;  3AJ4 A;  2I5C A;  3DXD A;  2P0F A;  2UVM A;  4PQ0 A;  2N23 A;  2GS0 A;  5JP4 A;  1E5W A;  2AL6 A;  2G35 A;  2LYD A;  2ADZ A;  4K81 A;  2COF A;  1X86 A;  2BCJ A;  1WVH A;  1LW3 A;  1KZ7 A;  1FGZ A;  1XCG A;  3DXC A;  2D9Y A;  1XOD A;  2IFS A;  1W1D A;  2DHK A;  4KHA A;  4C0A A;  1M7R A;  2ROZ B;  4IAP A;  3TO1 A;  4A6H A;  1DDV A;  3BJI A;  1WI1 A;  3VOQ A;  2D11 A;  5DH9 B;  4PNK A;  2DFK A;  3D8D A;  2OTX A;  4HAX B;  4F7U P;  2DKP A;  3HW2 B;  2MDX A;  1V89 A;  3WYF B;  4HAY B;  1GG3 A;  2QKM A;  2NMB A;  4CYE A;  3DXE A;  2COC A;  2RVB B;  3KRX A;  1PMS A;  4TYZ A;  4H8S A;  1XX0 A;  1AQC A;  3FEH A;  2DHI A;  1KI1 B;  1BTK A;  3KSY A;  2DX1 A;  3PSC A;  4K2P A;  3CIK A;  2EMT A;  3X23 A;  5FI0 A;  1FAO A;  3TW1 A;  1MIX A;  1V5U A;  3A8Q A;  1Q67 A;  1SGH A;  1DDM A;  3KZ1 A;  2DHJ A;  4ZRJ A;  5C79 A;  2RUK B;  2K2J A;  4HAZ B;  5D3W A;  2PZ1 A;  2W2W A;  1ISN A;  5J3T A;  1Y5O A;  1XR0 B;  4HAT B;  1RRP B;  2ELB A;  1UNR A;  4XWX A;  1M7E A;  1Y19 B;  1NU2 A;  3SO6 A;  1ZSQ A;  3A8P A;  2EJ8 A;  1X05 A;  1X1G A;  5JLJ B;  2DA0 A;  2K00 A;  2YSZ A;  2YS5 A;  2GJY A;  3PG7 A;  2FJL A;  4L6E A;  1DBH A;  1J19 A;  3V5W A;  2M38 A;  4F7H A;  1MIZ B;  2XQN M;  4MY6 A;  1I7A A;  1MAI A;  2D9W A;  3FM8 C;  3ODO A;  1GC7 A;  3PVU A;  2D9V A;  2P8V A;  1ZM0 A;  3MPX A;  1UPR A;  1UEF A;  2Z0Q A;  4K2O A;  4D0N B;  2RLO A;  2UZR A;  4KVG B;  3U7D A;  5C6R A;  1UPQ A;  2DYQ A;  1SHC A;  2CY5 A;  1XD4 A;  4GMV A;  2W2X C;  4GN1 A;  1EGX A;  2Z0P A;  2J0J A;  1ZC4 B;  2YS3 A;  1TJ6 A;  3VIA A;  2H7E A;  3IVF A;  4P7I A;  3PVL A;  1NI2 A;  4WSF A;  2D4Q A;  1MPH A;  1KZG A;  2EMS A;  2V76 A;  3HQC A;  3WA0 A;  1FOE A;  1V5M A;  4WJ7 A;  2YVC A;  3ML4 A;  4HHV A;  4HAW B;  4MT7 A;  3ZVR A;  5LOP B;  2MFQ A;  2I1J A;  1WJM A;  1IRS A;  3SUZ A;  2RGN B;  1B55 A;  5C5B A;  3ODW A;  3PZD A;  4CHM A;  2QKL A;  1X1F A;  1PLS A;  2L2I A;  3HK0 A;  1NTV A;  1FGY A;  5CLQ B;  2L1C A;  4Z2M B;  3QWM A;  1WGQ A;  4YL8 A;  4WVF B;  2YT1 A;  1V88 A;  2IYB A;  1DRO A;  5GOW B;  3SNH A;  4HB2 B;  2EC1 A;  4A6F A;  5LON B;  3GYO A;  3QBV B;  4IOY X;  3ULB A;  2VKI A;  3D8E A;  2D9X A;  5HE3 A;  4HAV B;  2CY4 A;  4DXA B;  1P5T A;  1GC6 A;  5J3Q A;  4F7G A;  2COD A;  1TXD A;  4HDQ A;  1FHW A;  4DX8 A;  4Z2N A;  3BIN A;  2I1K A;  4CHJ A;  4GXB A;  5HE0 A;  1N3H A;  1V61 A;  1OQN A;  1WG7 A;  5DHA B;  4EJN A;  3FSS A;  3M1I B;  4K17 A;  2Y7B A;  2K2U A;  5KCV A;  3NSU A;  2DLW A;  4HB0 B;  1U5E A;  1U5F A;  5D27 A;  1I2H A;  1DYN A;  2JP2 A;  1K5D B;  2HTH B;  5J3Y A;  4ZRI A;  2RNR B;  2D9Z A;  2D2Q A;  3MDB C;  1QC6 A;  4HB4 B;  1BWN A;  4EKU A;  3UZT A;  2ELA A;  4ZRK A;  2M14 A;  2D10 A;  3T06 A;  2Q13 A;  3KY9 A;  3F5R A;  2KCJ A;  2GCL A;  1U2B A;  2DKQ A;  1UNP A;  2DX5 A;  3O96 A;  2UZS A;  4NY0 A;  4HAU B;  2MKR A;  3TFM A;  2DN6 A;  1EVH A;  4GPT B;  1AWE A;  2MWN B;  4GMX B;  3ODX A;  5D3Y A;  1WJ1 A;  3PP2 A;  2CAY A;  4DBB A;  1OMW A;  5EFX A;  3CXB B;  3RCP A;  1X11 A;  2P0D A;  3D8F A;  4BBK A;  1PFJ A;  2LOX A;  2KUP A;  4EMO A;  4DX9 0;  4HDO A;  2R0D A;  3TCA A;  5DIF B;  2DYN A;  3TVV A;  2CRF A;  2J0K A;  1TQZ A;  2LKO A;  3SYX A;  3KRW A;  1FHX A;  2ZPY A;  1QQG A;  3P6A A;  3PVW A;  1H4R A;  1UNQ A;  1WGU A;  5JHH A;  1H10 A;  1NTY A;  1RJ2 A;  2R09 A;  1MKE A;  2LUL A;  5JHG A;  2I5F A;  1BTN A;  1EF1 A;  1FB8 A;  3G9W A;  3PEG A;  2H7D A;  2AEH A;  4NSW A;  2NZ8 B;  1K5G B;  2KGX B;  5KQ4 A;  4IFS A;  2J59 M;  1EAZ A;  2OQB A;  1W1H A;  5HE2 A;  2LG1 A;  2P0H A;  5C16 A;  2COA A;  4HB3 B;  2LOZ A;  2YS1 A;  1MK7 B;  2ROV A;  2YT0 A;  3P7Z A;  1ZVR A;  4KHB B;  1ZC3 B;  2GCJ A;  1BAK A;  1FHO A;  1MK9 B;  5CLL B;  3U8Z A;  1LB1 A;  3OAN A;  1P6S A;  3F0W A;  1U27 A;  5D3X A;  2Y8F A;  5HE1 A;  3N7C A;  1Z87 A;  4Y94 A;  3LJU X;  2VRW B;  2YF0 A;  1P3R A;  2Y8G A;  5C5B B;  4YON A;  3ULC A;  5KQ1 A;  3QIJ A;  1W1G A; 
#chains in the Genus database with same CATH topology
 4TKN A;  2HE7 A;  1V5P A;  1U5D A;  3ZDT A;  1U29 A;  3SV1 A;  2YRY A;  2RSG A;  2K8E A;  1U5G A;  2VSZ A;  3A98 B;  5D3V A;  4A6F B;  5DHF B;  2N0Y A;  2W2X D;  4B6H A;  1DDW A;  3GYP A;  2X18 A;  1OY2 A;  2E2X A;  2Z0O A;  3AU5 A;  1XKE A;  3AU4 A;  2DTC A;  4A5K A;  4KAX B;  4KHO A;  2J0M A;  5FI1 A;  1J0W A;  5L81 A;  4GZU A;  4A6K A;  5DI9 B;  4MK0 A;  3AJ4 A;  3DCX A;  2I5C A;  2Z59 A;  3DXD A;  2P0F A;  2UVM A;  4PQ0 A;  2N23 A;  2GS0 A;  5JP4 A;  1E5W A;  2AL6 A;  2G35 A;  2LYD A;  2ADZ A;  4K81 A;  2COF A;  1X86 A;  2BCJ A;  1WVH A;  1LW3 A;  1KZ7 A;  2FJU B;  1FGZ A;  5I2S A;  1XCG A;  3DXC A;  2D9Y A;  1XOD A;  2IFS A;  1W1D A;  2DHK A;  4KHA A;  5M4Y B;  4C0A A;  1M7R A;  2ROZ B;  4IAP A;  3NWF A;  3TO1 A;  4A6H A;  1DDV A;  3BJI A;  1WI1 A;  3VOQ A;  2D11 A;  5DH9 B;  4PNK A;  2DFK A;  3D8D A;  2OTX A;  1T77 A;  4HAX B;  4F7U P;  2DKP A;  3HW2 B;  2MDX A;  1V89 A;  2RRF A;  3WYF B;  4HAY B;  1GG3 A;  2QKM A;  2NMB A;  4CYE A;  3DXE A;  2COC A;  2RVB B;  3KRX A;  1PMS A;  4TYZ A;  4H8S A;  1XX0 A;  1AQC A;  3FEH A;  2DHI A;  1KI1 B;  1BTK A;  3KSY A;  2DX1 A;  3PSC A;  4K2P A;  3CIK A;  2EMT A;  3X23 A;  5FI0 A;  1FAO A;  4GOU A;  3TW1 A;  1MIX A;  1V5U A;  3A8Q A;  1Q67 A;  1SGH A;  1DDM A;  3KZ1 A;  2DHJ A;  4ZRJ A;  5C79 A;  2RUK B;  2K2J A;  4HAZ B;  5D3W A;  2PZ1 A;  2ZKM X;  2W2W A;  1ISN A;  5J3T A;  1Y5O A;  1XR0 B;  3NWD A;  4HAT B;  3HSA A;  1RRP B;  2KR0 A;  2ELB A;  1UNR A;  4XWX A;  1M7E A;  1Y19 B;  1NU2 A;  3SO6 A;  1ZSQ A;  3A8P A;  2EJ8 A;  1X05 A;  1X1G A;  5JLJ B;  2DA0 A;  2K00 A;  2YSZ A;  2YS5 A;  2GJY A;  3PG7 A;  2FJL A;  3OHM B;  4L6E A;  1DBH A;  1J19 A;  3V5W A;  2M38 A;  4F7H A;  1MIZ B;  2XQN M;  4MY6 A;  1I7A A;  1MAI A;  2D9W A;  3FM8 C;  3ODO A;  1GC7 A;  3PVU A;  2D9V A;  2P8V A;  1ZM0 A;  3FVC A;  3MPX A;  1UPR A;  1UEF A;  2Z0Q A;  4K2O A;  4D0N B;  2RLO A;  2UZR A;  4KVG B;  4QJ3 B;  3U7D A;  5C6R A;  1UPQ A;  2DYQ A;  3A58 A;  1SHC A;  2CY5 A;  1XD4 A;  4GMV A;  2W2X C;  4GN1 A;  1EGX A;  2Z0P A;  2J0J A;  1ZC4 B;  2YS3 A;  1TJ6 A;  3VIA A;  2H7E A;  3IVF A;  3B77 A;  4P7I A;  3PVL A;  1NI2 A;  4WSF A;  2D4Q A;  1MPH A;  1KZG A;  2EMS A;  2V76 A;  3HQC A;  4KHB A;  3WA0 A;  1ZYI A;  1FOE A;  1V5M A;  4L1R A;  4WJ7 A;  2YVC A;  3ML4 A;  4HHV A;  4HAW B;  4MT7 A;  3ZVR A;  2NBV A;  5LOP B;  2MFQ A;  2I1J A;  1WJM A;  1IRS A;  3SUZ A;  2RGN B;  1B55 A;  5C5B A;  3ODW A;  3PZD A;  4CHM A;  2QKL A;  1X1F A;  1PLS A;  2L2I A;  3HK0 A;  1NTV A;  1FGY A;  5CLQ B;  2L1C A;  4Z2M B;  3QWM A;  3U12 A;  1WGQ A;  4OT1 A;  4YL8 A;  1MI1 A;  4WVF B;  2YT1 A;  1V88 A;  2IYB A;  1DRO A;  5GOW B;  3SNH A;  2Z13 A;  4HB2 B;  2EC1 A;  4A6F A;  5LON B;  3GYO A;  3QBV B;  4IOY X;  3ULB A;  2VKI A;  3D8E A;  2D9X A;  5HE3 A;  4HAV B;  2CY4 A;  4DXA B;  1P5T A;  1GC6 A;  5J3Q A;  4F7G A;  2COD A;  2GUM A;  1TXD A;  2KUQ A;  4HDQ A;  1FHW A;  4DX8 A;  4Z2N A;  3BIN A;  2I1K A;  4CHJ A;  4GXB A;  4GNK B;  5HE0 A;  1N3H A;  1V61 A;  1OQN A;  1WG7 A;  5DHA B;  4OSN A;  4EJN A;  3FSS A;  3M1I B;  2K49 A;  2Y7B A;  4K17 A;  2K2U A;  5KCV A;  3NSU A;  2DLW A;  4HB0 B;  1U5E A;  4D6W A;  1U5F A;  5D27 A;  1I2H A;  1DYN A;  2JP2 A;  1K5D B;  2HTH B;  5J3Y A;  4ZRI A;  4QJ4 B;  2RNR B;  2D9Z A;  2D2Q A;  3MDB C;  1QC6 A;  4HB4 B;  2Z14 A;  1BWN A;  4EKU A;  3UZT A;  2ELA A;  4ZRK A;  4CSQ A;  2M14 A;  2D10 A;  3T06 A;  2Q13 A;  3KY9 A;  3F5R A;  5IRS A;  2KCJ A;  2GCL A;  1U2B A;  2DKQ A;  1UNP A;  5LG4 B;  2DX5 A;  2KIG A;  3O96 A;  2UZS A;  4NY0 A;  5I2M A;  4HAU B;  2MKR A;  3TFM A;  2DN6 A;  1EVH A;  4GPT B;  1AWE A;  2MWN B;  4GMX B;  4HSI A;  3ODX A;  5D3Y A;  1WJ1 A;  3PP2 A;  2CAY A;  4DBB A;  1OMW A;  3NW8 A;  5EFX A;  3CXB B;  2R2Y A;  3RCP A;  1X11 A;  2P0D A;  3D8F A;  4BBK A;  1PFJ A;  2LOX A;  2KUP A;  4EMO A;  4DX9 0;  4HDO A;  2R0D A;  2Z4D A;  3TCA A;  5DIF B;  2DYN A;  3TVV A;  2CRF A;  2J0K A;  1TQZ A;  2LKO A;  3SYX A;  3KRW A;  1FHX A;  2ZPY A;  1QQG A;  2KIE A;  3P6A A;  3PVW A;  1H4R A;  1UNQ A;  1WGU A;  5JHH A;  1H10 A;  1NTY A;  1RJ2 A;  2R09 A;  1MKE A;  2LUL A;  5JHG A;  2I5F A;  1BTN A;  1EF1 A;  1FB8 A;  3G9W A;  3PEG A;  2H7D A;  2AEH A;  4NSW A;  3NWA A;  2NZ8 B;  1K5G B;  2KGX B;  5KQ4 A;  4IFS A;  2J59 M;  1EAZ A;  2OQB A;  1W1H A;  5HE2 A;  2LG1 A;  4QJ5 B;  2P0H A;  4DIX A;  5C16 A;  2COA A;  4HB3 B;  2LOZ A;  2YS1 A;  1MK7 B;  2ROV A;  2YT0 A;  3P7Z A;  4QXA B;  1ZVR A;  4KHB B;  1ZC3 B;  2YT2 A;  2GCJ A;  1BAK A;  1FHO A;  1MK9 B;  5CLL B;  3U8Z A;  1LB1 A;  3OAN A;  1P6S A;  3F0W A;  1U27 A;  5D3X A;  2Y8F A;  5HE1 A;  3N7C A;  1Z87 A;  4Y94 A;  3LJU X;  2VRW B;  2YF0 A;  1P3R A;  2Y8G A;  5C5B B;  4YON A;  3HIE A;  3ULC A;  5KQ1 A;  3QIJ A;  1W1G A; 
#chains in the Genus database with same CATH homology
 4TKN A;  2HE7 A;  1V5P A;  1U5D A;  3ZDT A;  1U29 A;  3SV1 A;  2YRY A;  2RSG A;  2K8E A;  1U5G A;  2VSZ A;  3A98 B;  5D3V A;  4A6F B;  5DHF B;  2N0Y A;  2W2X D;  4B6H A;  1DDW A;  3GYP A;  2X18 A;  1OY2 A;  2E2X A;  2Z0O A;  3AU5 A;  1XKE A;  3AU4 A;  2DTC A;  4A5K A;  4KAX B;  4KHO A;  2J0M A;  5FI1 A;  1J0W A;  5L81 A;  4GZU A;  4A6K A;  5DI9 B;  4MK0 A;  3AJ4 A;  2I5C A;  2Z59 A;  3DXD A;  2P0F A;  2UVM A;  4PQ0 A;  2N23 A;  2GS0 A;  5JP4 A;  1E5W A;  2AL6 A;  2G35 A;  2LYD A;  2ADZ A;  4K81 A;  2COF A;  1X86 A;  2BCJ A;  1WVH A;  1LW3 A;  1KZ7 A;  2FJU B;  1FGZ A;  5I2S A;  1XCG A;  3DXC A;  2D9Y A;  1XOD A;  2IFS A;  1W1D A;  2DHK A;  4KHA A;  5M4Y B;  4C0A A;  1M7R A;  2ROZ B;  4IAP A;  3NWF A;  3TO1 A;  4A6H A;  1DDV A;  3BJI A;  1WI1 A;  3VOQ A;  2D11 A;  5DH9 B;  4PNK A;  2DFK A;  3D8D A;  2OTX A;  4HAX B;  4F7U P;  2DKP A;  3HW2 B;  2MDX A;  1V89 A;  2RRF A;  3WYF B;  4HAY B;  1GG3 A;  2QKM A;  2NMB A;  4CYE A;  3DXE A;  2COC A;  2RVB B;  3KRX A;  1PMS A;  4TYZ A;  4H8S A;  1XX0 A;  1AQC A;  3FEH A;  2DHI A;  1KI1 B;  1BTK A;  3KSY A;  2DX1 A;  3PSC A;  4K2P A;  3CIK A;  2EMT A;  3X23 A;  5FI0 A;  1FAO A;  4GOU A;  3TW1 A;  1MIX A;  1V5U A;  3A8Q A;  1Q67 A;  1SGH A;  1DDM A;  3KZ1 A;  2DHJ A;  4ZRJ A;  5C79 A;  2RUK B;  2K2J A;  4HAZ B;  5D3W A;  2PZ1 A;  2ZKM X;  2W2W A;  1ISN A;  5J3T A;  1Y5O A;  1XR0 B;  3NWD A;  4HAT B;  1RRP B;  2KR0 A;  2ELB A;  1UNR A;  4XWX A;  1M7E A;  1Y19 B;  1NU2 A;  3SO6 A;  1ZSQ A;  3A8P A;  2EJ8 A;  1X05 A;  1X1G A;  5JLJ B;  2DA0 A;  2K00 A;  2YSZ A;  2YS5 A;  2GJY A;  3PG7 A;  2FJL A;  4L6E A;  3OHM B;  1DBH A;  1J19 A;  3V5W A;  2M38 A;  4F7H A;  1MIZ B;  2XQN M;  4MY6 A;  1I7A A;  1MAI A;  2D9W A;  3FM8 C;  3ODO A;  1GC7 A;  3PVU A;  2D9V A;  2P8V A;  1ZM0 A;  3MPX A;  3FVC A;  1UPR A;  1UEF A;  2Z0Q A;  4K2O A;  4D0N B;  2RLO A;  2UZR A;  4KVG B;  3U7D A;  5C6R A;  4QJ3 B;  1UPQ A;  2DYQ A;  3A58 A;  1SHC A;  2CY5 A;  1XD4 A;  4GMV A;  2W2X C;  4GN1 A;  1EGX A;  2Z0P A;  2J0J A;  1ZC4 B;  2YS3 A;  1TJ6 A;  3VIA A;  2H7E A;  3IVF A;  4P7I A;  3PVL A;  1NI2 A;  4WSF A;  2D4Q A;  1MPH A;  1KZG A;  2EMS A;  2V76 A;  3HQC A;  4KHB A;  3WA0 A;  1ZYI A;  1FOE A;  1V5M A;  4WJ7 A;  4L1R A;  2YVC A;  3ML4 A;  4HHV A;  4HAW B;  4MT7 A;  3ZVR A;  2NBV A;  5LOP B;  2MFQ A;  2I1J A;  1WJM A;  1IRS A;  3SUZ A;  2RGN B;  1B55 A;  5C5B A;  3ODW A;  3PZD A;  4CHM A;  2QKL A;  1X1F A;  1PLS A;  2L2I A;  3HK0 A;  1NTV A;  1FGY A;  5CLQ B;  2L1C A;  4Z2M B;  3QWM A;  3U12 A;  1WGQ A;  4OT1 A;  4YL8 A;  4WVF B;  2YT1 A;  1V88 A;  2IYB A;  1DRO A;  5GOW B;  3SNH A;  2Z13 A;  4HB2 B;  2EC1 A;  4A6F A;  5LON B;  3GYO A;  3QBV B;  4IOY X;  3ULB A;  2VKI A;  3D8E A;  2D9X A;  5HE3 A;  4HAV B;  2CY4 A;  4DXA B;  1P5T A;  1GC6 A;  5J3Q A;  4F7G A;  2COD A;  2GUM A;  1TXD A;  2KUQ A;  4HDQ A;  1FHW A;  4DX8 A;  4Z2N A;  3BIN A;  2I1K A;  4CHJ A;  4GXB A;  4GNK B;  5HE0 A;  1N3H A;  1V61 A;  1OQN A;  1WG7 A;  5DHA B;  4OSN A;  4EJN A;  3FSS A;  3M1I B;  4K17 A;  2Y7B A;  2K49 A;  2K2U A;  5KCV A;  3NSU A;  2DLW A;  4HB0 B;  1U5E A;  4D6W A;  1U5F A;  5D27 A;  1I2H A;  1DYN A;  2JP2 A;  1K5D B;  2HTH B;  5J3Y A;  4ZRI A;  4QJ4 B;  2RNR B;  2D9Z A;  2D2Q A;  3MDB C;  1QC6 A;  4HB4 B;  2Z14 A;  1BWN A;  4EKU A;  3UZT A;  2ELA A;  4ZRK A;  4CSQ A;  2M14 A;  2D10 A;  3T06 A;  2Q13 A;  3KY9 A;  3F5R A;  5IRS A;  2KCJ A;  2GCL A;  1U2B A;  2DKQ A;  1UNP A;  5LG4 B;  2DX5 A;  2KIG A;  3O96 A;  2UZS A;  4NY0 A;  5I2M A;  4HAU B;  2MKR A;  3TFM A;  2DN6 A;  1EVH A;  4GPT B;  1AWE A;  2MWN B;  4GMX B;  4HSI A;  3ODX A;  5D3Y A;  1WJ1 A;  3PP2 A;  2CAY A;  4DBB A;  1OMW A;  3NW8 A;  5EFX A;  3CXB B;  2R2Y A;  3RCP A;  1X11 A;  2P0D A;  3D8F A;  4BBK A;  1PFJ A;  2LOX A;  2KUP A;  4EMO A;  4DX9 0;  4HDO A;  2R0D A;  2Z4D A;  3TCA A;  5DIF B;  2DYN A;  3TVV A;  2CRF A;  2J0K A;  1TQZ A;  2LKO A;  3SYX A;  3KRW A;  1FHX A;  2ZPY A;  1QQG A;  2KIE A;  3P6A A;  3PVW A;  1H4R A;  1UNQ A;  1WGU A;  5JHH A;  1H10 A;  1NTY A;  1RJ2 A;  2R09 A;  1MKE A;  2LUL A;  5JHG A;  2I5F A;  1BTN A;  1EF1 A;  1FB8 A;  3G9W A;  3PEG A;  2H7D A;  2AEH A;  4NSW A;  3NWA A;  2NZ8 B;  1K5G B;  2KGX B;  5KQ4 A;  4IFS A;  2J59 M;  1EAZ A;  2OQB A;  1W1H A;  5HE2 A;  2LG1 A;  4QJ5 B;  2P0H A;  4DIX A;  5C16 A;  2COA A;  4HB3 B;  2LOZ A;  2YS1 A;  1MK7 B;  2ROV A;  2YT0 A;  3P7Z A;  4QXA B;  1ZVR A;  4KHB B;  1ZC3 B;  2YT2 A;  2GCJ A;  1BAK A;  1FHO A;  1MK9 B;  5CLL B;  3U8Z A;  1LB1 A;  3OAN A;  1P6S A;  3F0W A;  1U27 A;  5D3X A;  2Y8F A;  5HE1 A;  3N7C A;  1Z87 A;  4Y94 A;  3LJU X;  2VRW B;  2YF0 A;  1P3R A;  2Y8G A;  5C5B B;  4YON A;  3HIE A;  3ULC A;  5KQ1 A;  3QIJ A;  1W1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...