3FSSA

Structure of the tandem ph domains of rtt106
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 57
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2009-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3fssA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3fssA01
3PVWA 5C6RA 2LKOA 4IOYX 1FB8A 2DHIA 1DDVA 1EAZA 2N23A 4MK0A 4YONA 2R0DA 2CRFA 2DLWA 5C5BA 3DXCA 4BBKA 5HE1A 2D11A 1KZ7A 2ADZA 5D3VA 2D9ZA 1BWNA 4GN1A 3X23A 5D3XA 1V5MA 4ZRJA 2H7DA 3KSYA 4C0AA 2COAA 3KY9A 1ZVRA 1LW3A 1WGUA 2EJ8A 2DYNA 3A98B 4F7UP 2DKQA 2D9WA 4IAPA 3PVLA 2YS1A 3D8EA 1H10A 4DX90 1X1GA 2YF0A 4A6HA 1LB1A 4A6FA 1X1FA 2D4QA 1UNQA 4MT7A 1FGZA 3T06A 2MKRA 1FAOA 4EJNA 3BJIA 5JHGA 4XWXA 2W2WA 5CLLB 3ULBA 3SO6A 2EC1A 1GC7A 4WSFA 3M1IB 3N7CA 1EVHA 1DBHA 3U8ZA 5C5BB 4K2OA 4CYEA 4F7HA 4HDOA 4MY6A 3KRXA 3ODWA 2HTHB 1EF1A 3SUZA 3HQCA 2ELAA 1FHWA 2LULA 3CIKA 2DTCA 2YS3A 2M14A 2RVBB 5JHHA 2IYBA 4IFSA 1XKEA 1P3RA 3A8PA 2G35A 3PG7A 1E5WA 3P6AA 2YT1A 2I1KA 3G9WA 1UEFA 3DXEA 4A6FB 4WVFB 2DX1A 3QWMA 2DHJA 4L6EA 3QIJA 2YT0A 2KUPA 3SNHA 1ISNA 4EKUA 1QQGA 1NTVA 3RCPA 2PZ1A 3WYFB 3O96A 3ZDTA 2N0YA 2BCJA 2EMSA 3SYXA 3FSSA 3SV1A 1K5DB 1U5EA 2AEHA 1GG3A 1MKEA 2VSZA 2Z0PA 3U7DA 3TCAA 1U2BA 3PSCA 1Y5OA 1V88A 2GCLA 2LYDA 2AL6A 4ZRIA 5DI9B 2RSGA 2MWNB 4HAXB 1BTKA 1V5UA 4HAWB 1V5PA 3MDBC 1SGHA 2Z0QA 2RUKB 1ZM0A 1XODA 2J59M 2MFQA 2NMBA 4P7IA 3F0WA 2VRWB 1IRSA 5EFXA 2P0DA 5DHFB 2I1JA 1V61A 2J0MA 2QKLA 1MAIA 1U29A 1X11A 5KQ1A 3LJUX 1B55A 5GOWB 3DXDA 3AJ4A 1NI2A 5C16A 2Y8GA 5L81A 2LOZA 5JLJB 4HAUB 2Z0OA 1MIZB 5D27A 1Z87A 1AWEA 3PZDA 1FHOA 4GZUA 1WGQA 4EMOA 2UVMA 1ZC3B 1WVHA 2D9YA 1RRPB 1XX0A 2ELBA 4H8SA 4HB2B 4HB3B 5KQ4A 2R09A 1GC6A 1TXDA 2KCJA 1FGYA 4DX8A 2XQNM 5DHAB 4KHBB 1J0WA 4CHMA 2W2XC 5DIFB 3HK0A 2LG1A 2ROVA 2UZSA 1DDWA 1UPQA 2CY4A 2CODA 4HB0B 3ODOA 1X86A 1XR0B 2D9VA 2RGNB 1X05A 1I2HA 4HAYB 1UNPA 3FM8C 5J3QA 1OMWA 3ML4A 4DBBA 2ZPYA 2H7EA 2D10A 3V5WA 1U5DA 1FHXA 1ZSQA 2YVCA 1BTNA 4HDQA 4D0NB 3TW1A 2COFA 3PEGA 1H4RA 2DX5A 3P7ZA 2VKIA 2YS5A 1KI1B 2M38A 3TFMA 4PQ0A 5HE3A 2I5CA 2YRYA 3BINA 1DDMA 2K00A 2EMTA 3CXBB 5DH9B 2P0HA 1W1DA 5J3YA 1P5TA 2QKMA 4KAXB 1PMSA 2DA0A 2DHKA 2HE7A 1M7RA 4GXBA 3D8FA 3TO1A 3AU5A 2I5FA 4KHOA 4F7GA 5LONB 1UPRA 1TJ6A 1W1HA 1SHCA 2JP2A 2GJYA 4GPTB 5FI0A 4A5KA 2GS0A 2KGXB 2D2QA 5D3YA 4B6HA 2E2XA 1NTYA 1XCGA 2CY5A 1K5GB 3PVUA 5LOPB 1RJ2A 3F5RA 3IVFA 2MDXA 1U27A 3GYPA 1WI1A 2X18A 4NY0A 3A8QA 2L2IA 3D8DA 2IFSA 3KRWA 4ZRKA 5D3WA 3NSUA 1FOEA 2K2JA 1DYNA 1N3HA 1Q67A 4GMVA 4Z2NA 3VIAA 2P0FA 4HB4B 5C79A 2Y7BA 1OQNA 1P6SA 2DYQA 2YSZA 1U5GA 5FI1A 1MIXA 4TKNA 4CHJA 1PLSA 3QBVB 1MK7B 4NSWA 2Q13A 2K2UA 2P8VA 3MPXA 2GCJA 4K2PA 4HATB 5KCVA 2OQBA 1U5FA 1WG7A 4HAZB 4Z2MB 3TVVA 2CAYA 1WJMA 1AQCA 5CLQB 2DKPA 2L1CA 4PNKA 1OY2A 1XD4A 2FJLA 1BAKA 4YL8A 4GMXB 3KZ1A 3WA0A 1Y19B 5J3TA 2UZRA 3ULCA 2COCA 3PP2A 2V76A 2J0KA 2LOXA 2Y8FA 4Y94A 2J0JA 1MPHA 1TQZA 2OTXA 2D9XA 5HE2A 2W2XD 2DN6A 3ODXA 4DXAB 3AU4A 4KVGB 1UNRA 3FEHA 1W1GA 3HW2B 1WJ1A 1V89A 1MK9B 1EGXA 2DFKA 1ZC4B 3VOQA 1I7AA 4A6KA 5JP4A 4KHAA 3ZVRA 1NU2A 3GYOA 4HAVB 2RLOA 4WJ7A 2ROZB 5HE0A 3OANA 1J19A 1PFJA 4HHVA 4K17A 1QC6A 1KZGA 3UZTA 1DROA 2RNRB 4TYZA 4K81A 1M7EA 2NZ8B
chains in the Genus database with same CATH superfamily
3PVWA 5C6RA 2LKOA 4IOYX 1FB8A 2DHIA 2GUMA 1DDVA 1EAZA 2N23A 4MK0A 4YONA 2R0DA 2CRFA 2DLWA 5C5BA 3DXCA 4BBKA 3FVCA 5HE1A 2D11A 1KZ7A 2ADZA 5D3VA 2D9ZA 1BWNA 4GN1A 3X23A 5D3XA 1V5MA 4ZRJA 2H7DA 3KSYA 4C0AA 2COAA 3KY9A 1ZVRA 1LW3A 1WGUA 2EJ8A 2DYNA 3A98B 4F7UP 2DKQA 2D9WA 2Z4DA 4IAPA 3PVLA 2YS1A 3D8EA 1H10A 4DX90 1X1GA 2YF0A 4A6HA 1LB1A 4A6FA 1X1FA 2KIEA 2D4QA 1UNQA 4MT7A 1FGZA 3DCXA 3T06A 2MKRA 5I2SA 1FAOA 4EJNA 3BJIA 5JHGA 4XWXA 2W2WA 5CLLB 3ULBA 3SO6A 2EC1A 4GOUA 1GC7A 4WSFA 3M1IB 3N7CA 1EVHA 1DBHA 3U8ZA 5C5BB 2ZKMX 4K2OA 4CYEA 4F7HA 4HDOA 4DIXA 4MY6A 3KRXA 3ODWA 2HTHB 1EF1A 3SUZA 3HQCA 2ELAA 1FHWA 2LULA 3CIKA 2DTCA 2YS3A 2M14A 2RVBB 5JHHA 2IYBA 4IFSA 1XKEA 2FJUB 1P3RA 3A8PA 3HSAA 2G35A 3PG7A 1E5WA 3P6AA 2YT1A 2I1KA 3G9WA 1UEFA 3DXEA 4GNKB 4A6FB 4WVFB 2Z59A 2DX1A 2Z13A 2DHJA 3QWMA 4L6EA 4QJ5B 3QIJA 2YT0A 2KUPA 4HSIA 3SNHA 1ISNA 4EKUA 1QQGA 1NTVA 3RCPA 2PZ1A 3WYFB 2YT2A 3O96A 3ZDTA 2N0YA 2BCJA 3HIEA 2EMSA 3SYXA 3FSSA 3OHMB 3SV1A 1K5DB 1U5EA 2AEHA 1GG3A 4QJ4B 1MKEA 2VSZA 2Z0PA 3U7DA 3TCAA 1U2BA 3PSCA 1Y5OA 1V88A 2GCLA 2LYDA 2AL6A 4ZRIA 5DI9B 2RSGA 2MWNB 4HAXB 4KHBA 1BTKA 1V5UA 4HAWB 1V5PA 3MDBC 1SGHA 2Z0QA 5I2MA 2RUKB 1ZM0A 1XODA 2J59M 2MFQA 2NMBA 4P7IA 3F0WA 2VRWB 1IRSA 5EFXA 2P0DA 5DHFB 2I1JA 1V61A 2J0MA 2KUQA 2QKLA 1MAIA 1U29A 1X11A 5KQ1A 2Z14A 4D6WA 3LJUX 1B55A 5GOWB 3DXDA 3AJ4A 1NI2A 5C16A 2Y8GA 5L81A 2LOZA 5JLJB 2NBVA 4HAUB 2Z0OA 1MIZB 5D27A 1Z87A 1AWEA 3PZDA 1FHOA 4GZUA 1WGQA 4EMOA 2UVMA 1ZC3B 1WVHA 3NWFA 2D9YA 1RRPB 1XX0A 2ELBA 4H8SA 4HB2B 4HB3B 5KQ4A 2R09A 1GC6A 2R2YA 1TXDA 2KCJA 1FGYA 4DX8A 2XQNM 5DHAB 4KHBB 1J0WA 4CHMA 2W2XC 5DIFB 3HK0A 2LG1A 2ROVA 2UZSA 1DDWA 1UPQA 2CY4A 2CODA 4HB0B 3ODOA 1X86A 1XR0B 2D9VA 2RGNB 1X05A 1I2HA 4HAYB 5M4YB 1UNPA 3FM8C 5J3QA 1OMWA 3NW8A 4OT1A 3ML4A 4OSNA 4DBBA 2ZPYA 2H7EA 2D10A 3V5WA 1U5DA 1FHXA 1ZSQA 2YVCA 1BTNA 4HDQA 4D0NB 3TW1A 2COFA 3PEGA 1H4RA 2KIGA 2DX5A 3P7ZA 2VKIA 2YS5A 1KI1B 2M38A 3TFMA 4PQ0A 5HE3A 2I5CA 2YRYA 3BINA 1DDMA 4QJ3B 3NWDA 4CSQA 2K00A 2EMTA 3CXBB 5DH9B 2P0HA 1W1DA 3B77A 1P5TA 5J3YA 2QKMA 4KAXB 1PMSA 2DA0A 2DHKA 2HE7A 1M7RA 4GXBA 3D8FA 3TO1A 3U12A 3AU5A 2I5FA 4KHOA 4F7GA 5LONB 1UPRA 2KR0A 5IRSA 1TJ6A 1W1HA 1SHCA 2JP2A 2GJYA 4GPTB 5FI0A 4A5KA 2GS0A 2KGXB 2D2QA 5D3YA 4B6HA 2E2XA 1NTYA 3NWAA 1XCGA 2CY5A 1K5GB 3PVUA 5LOPB 1RJ2A 3F5RA 3IVFA 2MDXA 1U27A 3GYPA 1WI1A 2X18A 4QXAB 1ZYIA 4NY0A 3A8QA 2L2IA 3D8DA 2IFSA 3KRWA 4ZRKA 5D3WA 3NSUA 1FOEA 2K2JA 1DYNA 1N3HA 1Q67A 4GMVA 4Z2NA 2RRFA 2P0FA 3VIAA 4HB4B 5C79A 2Y7BA 1OQNA 1P6SA 2DYQA 2YSZA 1U5GA 5FI1A 1MIXA 4L1RA 4TKNA 4CHJA 1PLSA 3QBVB 1MK7B 4NSWA 2Q13A 2K2UA 2P8VA 3MPXA 2GCJA 4K2PA 4HATB 5KCVA 2OQBA 1U5FA 1WG7A 4HAZB 4Z2MB 3TVVA 2CAYA 1WJMA 1AQCA 5CLQB 2DKPA 2L1CA 4PNKA 1OY2A 1XD4A 2FJLA 1BAKA 4YL8A 4GMXB 3KZ1A 3WA0A 1Y19B 5J3TA 2UZRA 3ULCA 2COCA 3PP2A 2V76A 2J0KA 2LOXA 2Y8FA 4Y94A 2J0JA 1MPHA 1TQZA 2OTXA 2D9XA 5HE2A 2W2XD 2DN6A 3ODXA 4DXAB 2K8EA 3AU4A 1UNRA 4KVGB 3FEHA 1W1GA 3HW2B 1WJ1A 1V89A 1MK9B 1EGXA 5LG4B 2DFKA 1ZC4B 3VOQA 1I7AA 2K49A 1MI1A 4A6KA 5JP4A 4KHAA 3ZVRA 1NU2A 3GYOA 4HAVB 2RLOA 4WJ7A 2ROZB 5HE0A 3OANA 1J19A 1PFJA 4HHVA 4K17A 1QC6A 1T77A 1KZGA 3UZTA 1DROA 2RNRB 4TYZA 4K81A 1M7EA 2NZ8B 3A58A
chains in the Genus database with same CATH topology
3PVWA 5C6RA 2LKOA 4IOYX 1FB8A 2DHIA 2GUMA 1DDVA 1EAZA 2N23A 4MK0A 4YONA 2R0DA 2CRFA 2DLWA 5C5BA 3DXCA 4BBKA 5HE1A 3FVCA 2D11A 1KZ7A 2ADZA 5D3VA 2D9ZA 1BWNA 4GN1A 3X23A 5D3XA 1V5MA 4ZRJA 2H7DA 3KSYA 4C0AA 2COAA 3KY9A 1ZVRA 1LW3A 1WGUA 2EJ8A 2DYNA 3A98B 4F7UP 2DKQA 2D9WA 4IAPA 2Z4DA 3PVLA 2YS1A 3D8EA 1H10A 4DX90 1X1GA 2YF0A 4A6HA 1LB1A 4A6FA 1X1FA 2KIEA 2D4QA 1UNQA 4MT7A 1FGZA 3T06A 2MKRA 5I2SA 1FAOA 4EJNA 3BJIA 5JHGA 4XWXA 2W2WA 5CLLB 3ULBA 3SO6A 2EC1A 4GOUA 1GC7A 4WSFA 3M1IB 3N7CA 1EVHA 1DBHA 3U8ZA 5C5BB 2ZKMX 4K2OA 4CYEA 4F7HA 4HDOA 4DIXA 4MY6A 3KRXA 3ODWA 2HTHB 1EF1A 3SUZA 3HQCA 2ELAA 1FHWA 2LULA 3CIKA 2DTCA 2YS3A 2M14A 2RVBB 5JHHA 2IYBA 4IFSA 1XKEA 2FJUB 1P3RA 3A8PA 2G35A 3PG7A 1E5WA 3P6AA 2YT1A 2I1KA 3G9WA 1UEFA 3DXEA 4GNKB 4A6FB 4WVFB 2Z59A 2DX1A 3QWMA 2DHJA 4L6EA 2Z13A 4QJ5B 3QIJA 2YT0A 2KUPA 4HSIA 3SNHA 1ISNA 4EKUA 1QQGA 1NTVA 3RCPA 2PZ1A 3WYFB 2YT2A 3O96A 3ZDTA 2N0YA 2BCJA 3HIEA 2EMSA 3SYXA 3FSSA 3OHMB 3SV1A 1K5DB 1U5EA 2AEHA 1GG3A 4QJ4B 1MKEA 2VSZA 2Z0PA 3U7DA 3TCAA 1U2BA 3PSCA 1Y5OA 1V88A 2GCLA 2LYDA 2AL6A 4ZRIA 5DI9B 2RSGA 2MWNB 4HAXB 4KHBA 1BTKA 1V5UA 4HAWB 1V5PA 3MDBC 1SGHA 2Z0QA 5I2MA 2RUKB 1ZM0A 1XODA 2J59M 2MFQA 2NMBA 4P7IA 3F0WA 2VRWB 1IRSA 5EFXA 2P0DA 5DHFB 2I1JA 1V61A 2J0MA 2KUQA 2QKLA 1MAIA 1U29A 1X11A 5KQ1A 2Z14A 4D6WA 3LJUX 1B55A 5GOWB 3DXDA 3AJ4A 1NI2A 5C16A 2Y8GA 5L81A 2LOZA 5JLJB 2NBVA 4HAUB 2Z0OA 1MIZB 5D27A 1Z87A 1AWEA 3PZDA 1FHOA 4GZUA 1WGQA 4EMOA 2UVMA 1ZC3B 1WVHA 3NWFA 2D9YA 1RRPB 1XX0A 2ELBA 4H8SA 4HB2B 4HB3B 5KQ4A 2R09A 1GC6A 2R2YA 1TXDA 2KCJA 1FGYA 4DX8A 2XQNM 5DHAB 4KHBB 1J0WA 4CHMA 2W2XC 5DIFB 3HK0A 2LG1A 2ROVA 2UZSA 1DDWA 1UPQA 2CY4A 2CODA 4HB0B 3ODOA 1X86A 1XR0B 2D9VA 2RGNB 1X05A 1I2HA 4HAYB 5M4YB 1UNPA 3FM8C 5J3QA 1OMWA 3NW8A 4OT1A 3ML4A 4OSNA 4DBBA 2ZPYA 2H7EA 2D10A 3V5WA 1U5DA 1FHXA 1ZSQA 2YVCA 1BTNA 4HDQA 4D0NB 3TW1A 2COFA 3PEGA 1H4RA 2KIGA 2DX5A 3P7ZA 2VKIA 2YS5A 1KI1B 2M38A 3TFMA 4PQ0A 5HE3A 2I5CA 2YRYA 3BINA 1DDMA 4QJ3B 3NWDA 4CSQA 2K00A 2EMTA 3CXBB 5DH9B 2P0HA 1W1DA 5J3YA 1P5TA 2QKMA 4KAXB 1PMSA 2DA0A 2DHKA 2HE7A 1M7RA 4GXBA 3D8FA 3TO1A 3U12A 3AU5A 2I5FA 4KHOA 4F7GA 5LONB 1UPRA 2KR0A 5IRSA 1TJ6A 1W1HA 1SHCA 2JP2A 2GJYA 4GPTB 5FI0A 4A5KA 2GS0A 2KGXB 2D2QA 5D3YA 4B6HA 2E2XA 1NTYA 3NWAA 1XCGA 2CY5A 1K5GB 3PVUA 5LOPB 1RJ2A 3F5RA 3IVFA 2MDXA 1U27A 3GYPA 1WI1A 2X18A 4QXAB 1ZYIA 4NY0A 3A8QA 2L2IA 3D8DA 2IFSA 3KRWA 4ZRKA 5D3WA 3NSUA 1FOEA 2K2JA 1DYNA 1N3HA 1Q67A 4GMVA 4Z2NA 3VIAA 2P0FA 2RRFA 4HB4B 5C79A 2Y7BA 1OQNA 1P6SA 2DYQA 2YSZA 1U5GA 5FI1A 1MIXA 4TKNA 4CHJA 4L1RA 1PLSA 3QBVB 1MK7B 4NSWA 2Q13A 2K2UA 2P8VA 3MPXA 2GCJA 4K2PA 4HATB 5KCVA 2OQBA 1U5FA 1WG7A 4HAZB 4Z2MB 3TVVA 2CAYA 1WJMA 1AQCA 5CLQB 2DKPA 2L1CA 4PNKA 1OY2A 1XD4A 2FJLA 1BAKA 4YL8A 4GMXB 3KZ1A 3WA0A 1Y19B 5J3TA 2UZRA 3ULCA 2COCA 3PP2A 2V76A 2J0KA 2LOXA 2Y8FA 4Y94A 2J0JA 1MPHA 1TQZA 2OTXA 2D9XA 5HE2A 2W2XD 2DN6A 3ODXA 4DXAB 3AU4A 4KVGB 1UNRA 2K8EA 3FEHA 1W1GA 3HW2B 1WJ1A 1V89A 1MK9B 1EGXA 5LG4B 2DFKA 1ZC4B 3VOQA 1I7AA 2K49A 4A6KA 5JP4A 4KHAA 3ZVRA 1NU2A 3GYOA 4HAVB 2RLOA 4WJ7A 2ROZB 5HE0A 3OANA 1J19A 1PFJA 4HHVA 4K17A 1QC6A 1KZGA 3UZTA 1DROA 2RNRB 4TYZA 4K81A 1M7EA 2NZ8B 3A58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVW A;  5C6R A;  2LKO A;  4IOY X;  1FB8 A;  2DHI A;  1DDV A;  1EAZ A;  2N23 A;  4MK0 A;  4YON A;  2R0D A;  2CRF A;  2DLW A;  5C5B A;  3DXC A;  4BBK A;  5HE1 A;  2D11 A;  1KZ7 A;  2ADZ A;  5D3V A;  2D9Z A;  1BWN A;  4GN1 A;  3X23 A;  5D3X A;  1V5M A;  4ZRJ A;  2H7D A;  3KSY A;  4C0A A;  2COA A;  3KY9 A;  1ZVR A;  1LW3 A;  1WGU A;  2EJ8 A;  2DYN A;  3A98 B;  4F7U P;  2DKQ A;  2D9W A;  4IAP A;  3PVL A;  2YS1 A;  3D8E A;  1H10 A;  4DX9 0;  1X1G A;  2YF0 A;  4A6H A;  1LB1 A;  4A6F A;  1X1F A;  2D4Q A;  1UNQ A;  4MT7 A;  1FGZ A;  3T06 A;  2MKR A;  1FAO A;  4EJN A;  3BJI A;  5JHG A;  4XWX A;  2W2W A;  5CLL B;  3ULB A;  3SO6 A;  2EC1 A;  1GC7 A;  4WSF A;  3M1I B;  3N7C A;  1EVH A;  1DBH A;  3U8Z A;  5C5B B;  4K2O A;  4CYE A;  4F7H A;  4HDO A;  4MY6 A;  3KRX A;  3ODW A;  2HTH B;  1EF1 A;  3SUZ A;  3HQC A;  2ELA A;  1FHW A;  2LUL A;  3CIK A;  2DTC A;  2YS3 A;  2M14 A;  2RVB B;  5JHH A;  2IYB A;  4IFS A;  1XKE A;  1P3R A;  3A8P A;  2G35 A;  3PG7 A;  1E5W A;  3P6A A;  2YT1 A;  2I1K A;  3G9W A;  1UEF A;  3DXE A;  4A6F B;  4WVF B;  2DX1 A;  3QWM A;  2DHJ A;  4L6E A;  3QIJ A;  2YT0 A;  2KUP A;  3SNH A;  1ISN A;  4EKU A;  1QQG A;  1NTV A;  3RCP A;  2PZ1 A;  3WYF B;  3O96 A;  3ZDT A;  2N0Y A;  2BCJ A;  2EMS A;  3SYX A;  3FSS A;  3SV1 A;  1K5D B;  1U5E A;  2AEH A;  1GG3 A;  1MKE A;  2VSZ A;  2Z0P A;  3U7D A;  3TCA A;  1U2B A;  3PSC A;  1Y5O A;  1V88 A;  2GCL A;  2LYD A;  2AL6 A;  4ZRI A;  5DI9 B;  2RSG A;  2MWN B;  4HAX B;  1BTK A;  1V5U A;  4HAW B;  1V5P A;  3MDB C;  1SGH A;  2Z0Q A;  2RUK B;  1ZM0 A;  1XOD A;  2J59 M;  2MFQ A;  2NMB A;  4P7I A;  3F0W A;  2VRW B;  1IRS A;  5EFX A;  2P0D A;  5DHF B;  2I1J A;  1V61 A;  2J0M A;  2QKL A;  1MAI A;  1U29 A;  1X11 A;  5KQ1 A;  3LJU X;  1B55 A;  5GOW B;  3DXD A;  3AJ4 A;  1NI2 A;  5C16 A;  2Y8G A;  5L81 A;  2LOZ A;  5JLJ B;  4HAU B;  2Z0O A;  1MIZ B;  5D27 A;  1Z87 A;  1AWE A;  3PZD A;  1FHO A;  4GZU A;  1WGQ A;  4EMO A;  2UVM A;  1ZC3 B;  1WVH A;  2D9Y A;  1RRP B;  1XX0 A;  2ELB A;  4H8S A;  4HB2 B;  4HB3 B;  5KQ4 A;  2R09 A;  1GC6 A;  1TXD A;  2KCJ A;  1FGY A;  4DX8 A;  2XQN M;  5DHA B;  4KHB B;  1J0W A;  4CHM A;  2W2X C;  5DIF B;  3HK0 A;  2LG1 A;  2ROV A;  2UZS A;  1DDW A;  1UPQ A;  2CY4 A;  2COD A;  4HB0 B;  3ODO A;  1X86 A;  1XR0 B;  2D9V A;  2RGN B;  1X05 A;  1I2H A;  4HAY B;  1UNP A;  3FM8 C;  5J3Q A;  1OMW A;  3ML4 A;  4DBB A;  2ZPY A;  2H7E A;  2D10 A;  3V5W A;  1U5D A;  1FHX A;  1ZSQ A;  2YVC A;  1BTN A;  4HDQ A;  4D0N B;  3TW1 A;  2COF A;  3PEG A;  1H4R A;  2DX5 A;  3P7Z A;  2VKI A;  2YS5 A;  1KI1 B;  2M38 A;  3TFM A;  4PQ0 A;  5HE3 A;  2I5C A;  2YRY A;  3BIN A;  1DDM A;  2K00 A;  2EMT A;  3CXB B;  5DH9 B;  2P0H A;  1W1D A;  5J3Y A;  1P5T A;  2QKM A;  4KAX B;  1PMS A;  2DA0 A;  2DHK A;  2HE7 A;  1M7R A;  4GXB A;  3D8F A;  3TO1 A;  3AU5 A;  2I5F A;  4KHO A;  4F7G A;  5LON B;  1UPR A;  1TJ6 A;  1W1H A;  1SHC A;  2JP2 A;  2GJY A;  4GPT B;  5FI0 A;  4A5K A;  2GS0 A;  2KGX B;  2D2Q A;  5D3Y A;  4B6H A;  2E2X A;  1NTY A;  1XCG A;  2CY5 A;  1K5G B;  3PVU A;  5LOP B;  1RJ2 A;  3F5R A;  3IVF A;  2MDX A;  1U27 A;  3GYP A;  1WI1 A;  2X18 A;  4NY0 A;  3A8Q A;  2L2I A;  3D8D A;  2IFS A;  3KRW A;  4ZRK A;  5D3W A;  3NSU A;  1FOE A;  2K2J A;  1DYN A;  1N3H A;  1Q67 A;  4GMV A;  4Z2N A;  3VIA A;  2P0F A;  4HB4 B;  5C79 A;  2Y7B A;  1OQN A;  1P6S A;  2DYQ A;  2YSZ A;  1U5G A;  5FI1 A;  1MIX A;  4TKN A;  4CHJ A;  1PLS A;  3QBV B;  1MK7 B;  4NSW A;  2Q13 A;  2K2U A;  2P8V A;  3MPX A;  2GCJ A;  4K2P A;  4HAT B;  5KCV A;  2OQB A;  1U5F A;  1WG7 A;  4HAZ B;  4Z2M B;  3TVV A;  2CAY A;  1WJM A;  1AQC A;  5CLQ B;  2DKP A;  2L1C A;  4PNK A;  1OY2 A;  1XD4 A;  2FJL A;  1BAK A;  4YL8 A;  4GMX B;  3KZ1 A;  3WA0 A;  1Y19 B;  5J3T A;  2UZR A;  3ULC A;  2COC A;  3PP2 A;  2V76 A;  2J0K A;  2LOX A;  2Y8F A;  4Y94 A;  2J0J A;  1MPH A;  1TQZ A;  2OTX A;  2D9X A;  5HE2 A;  2W2X D;  2DN6 A;  3ODX A;  4DXA B;  3AU4 A;  4KVG B;  1UNR A;  3FEH A;  1W1G A;  3HW2 B;  1WJ1 A;  1V89 A;  1MK9 B;  1EGX A;  2DFK A;  1ZC4 B;  3VOQ A;  1I7A A;  4A6K A;  5JP4 A;  4KHA A;  3ZVR A;  1NU2 A;  3GYO A;  4HAV B;  2RLO A;  4WJ7 A;  2ROZ B;  5HE0 A;  3OAN A;  1J19 A;  1PFJ A;  4HHV A;  4K17 A;  1QC6 A;  1KZG A;  3UZT A;  1DRO A;  2RNR B;  4TYZ A;  4K81 A;  1M7E A;  2NZ8 B; 
#chains in the Genus database with same CATH topology
 3PVW A;  5C6R A;  2LKO A;  4IOY X;  1FB8 A;  2DHI A;  2GUM A;  1DDV A;  1EAZ A;  2N23 A;  4MK0 A;  4YON A;  2R0D A;  2CRF A;  2DLW A;  5C5B A;  3DXC A;  4BBK A;  3FVC A;  5HE1 A;  2D11 A;  1KZ7 A;  2ADZ A;  5D3V A;  2D9Z A;  1BWN A;  4GN1 A;  3X23 A;  5D3X A;  1V5M A;  4ZRJ A;  2H7D A;  3KSY A;  4C0A A;  2COA A;  3KY9 A;  1ZVR A;  1LW3 A;  1WGU A;  2EJ8 A;  2DYN A;  3A98 B;  4F7U P;  2DKQ A;  2D9W A;  2Z4D A;  4IAP A;  3PVL A;  2YS1 A;  3D8E A;  1H10 A;  4DX9 0;  1X1G A;  2YF0 A;  4A6H A;  1LB1 A;  4A6F A;  1X1F A;  2KIE A;  2D4Q A;  1UNQ A;  4MT7 A;  1FGZ A;  3DCX A;  3T06 A;  2MKR A;  5I2S A;  1FAO A;  4EJN A;  3BJI A;  5JHG A;  4XWX A;  2W2W A;  5CLL B;  3ULB A;  3SO6 A;  2EC1 A;  4GOU A;  1GC7 A;  4WSF A;  3M1I B;  3N7C A;  1EVH A;  1DBH A;  3U8Z A;  5C5B B;  2ZKM X;  4K2O A;  4CYE A;  4F7H A;  4HDO A;  4DIX A;  4MY6 A;  3KRX A;  3ODW A;  2HTH B;  1EF1 A;  3SUZ A;  3HQC A;  2ELA A;  1FHW A;  2LUL A;  3CIK A;  2DTC A;  2YS3 A;  2M14 A;  2RVB B;  5JHH A;  2IYB A;  4IFS A;  1XKE A;  2FJU B;  1P3R A;  3A8P A;  3HSA A;  2G35 A;  3PG7 A;  1E5W A;  3P6A A;  2YT1 A;  2I1K A;  3G9W A;  1UEF A;  3DXE A;  4GNK B;  4A6F B;  4WVF B;  2Z59 A;  2DX1 A;  2Z13 A;  2DHJ A;  3QWM A;  4L6E A;  4QJ5 B;  3QIJ A;  2YT0 A;  2KUP A;  4HSI A;  3SNH A;  1ISN A;  4EKU A;  1QQG A;  1NTV A;  3RCP A;  2PZ1 A;  3WYF B;  2YT2 A;  3O96 A;  3ZDT A;  2N0Y A;  2BCJ A;  3HIE A;  2EMS A;  3SYX A;  3FSS A;  3OHM B;  3SV1 A;  1K5D B;  1U5E A;  2AEH A;  1GG3 A;  4QJ4 B;  1MKE A;  2VSZ A;  2Z0P A;  3U7D A;  3TCA A;  1U2B A;  3PSC A;  1Y5O A;  1V88 A;  2GCL A;  2LYD A;  2AL6 A;  4ZRI A;  5DI9 B;  2RSG A;  2MWN B;  4HAX B;  4KHB A;  1BTK A;  1V5U A;  4HAW B;  1V5P A;  3MDB C;  1SGH A;  2Z0Q A;  5I2M A;  2RUK B;  1ZM0 A;  1XOD A;  2J59 M;  2MFQ A;  2NMB A;  4P7I A;  3F0W A;  2VRW B;  1IRS A;  5EFX A;  2P0D A;  5DHF B;  2I1J A;  1V61 A;  2J0M A;  2KUQ A;  2QKL A;  1MAI A;  1U29 A;  1X11 A;  5KQ1 A;  2Z14 A;  4D6W A;  3LJU X;  1B55 A;  5GOW B;  3DXD A;  3AJ4 A;  1NI2 A;  5C16 A;  2Y8G A;  5L81 A;  2LOZ A;  5JLJ B;  2NBV A;  4HAU B;  2Z0O A;  1MIZ B;  5D27 A;  1Z87 A;  1AWE A;  3PZD A;  1FHO A;  4GZU A;  1WGQ A;  4EMO A;  2UVM A;  1ZC3 B;  1WVH A;  3NWF A;  2D9Y A;  1RRP B;  1XX0 A;  2ELB A;  4H8S A;  4HB2 B;  4HB3 B;  5KQ4 A;  2R09 A;  1GC6 A;  2R2Y A;  1TXD A;  2KCJ A;  1FGY A;  4DX8 A;  2XQN M;  5DHA B;  4KHB B;  1J0W A;  4CHM A;  2W2X C;  5DIF B;  3HK0 A;  2LG1 A;  2ROV A;  2UZS A;  1DDW A;  1UPQ A;  2CY4 A;  2COD A;  4HB0 B;  3ODO A;  1X86 A;  1XR0 B;  2D9V A;  2RGN B;  1X05 A;  1I2H A;  4HAY B;  5M4Y B;  1UNP A;  3FM8 C;  5J3Q A;  1OMW A;  3NW8 A;  4OT1 A;  3ML4 A;  4OSN A;  4DBB A;  2ZPY A;  2H7E A;  2D10 A;  3V5W A;  1U5D A;  1FHX A;  1ZSQ A;  2YVC A;  1BTN A;  4HDQ A;  4D0N B;  3TW1 A;  2COF A;  3PEG A;  1H4R A;  2KIG A;  2DX5 A;  3P7Z A;  2VKI A;  2YS5 A;  1KI1 B;  2M38 A;  3TFM A;  4PQ0 A;  5HE3 A;  2I5C A;  2YRY A;  3BIN A;  1DDM A;  4QJ3 B;  3NWD A;  4CSQ A;  2K00 A;  2EMT A;  3CXB B;  5DH9 B;  2P0H A;  1W1D A;  3B77 A;  1P5T A;  5J3Y A;  2QKM A;  4KAX B;  1PMS A;  2DA0 A;  2DHK A;  2HE7 A;  1M7R A;  4GXB A;  3D8F A;  3TO1 A;  3U12 A;  3AU5 A;  2I5F A;  4KHO A;  4F7G A;  5LON B;  1UPR A;  2KR0 A;  5IRS A;  1TJ6 A;  1W1H A;  1SHC A;  2JP2 A;  2GJY A;  4GPT B;  5FI0 A;  4A5K A;  2GS0 A;  2KGX B;  2D2Q A;  5D3Y A;  4B6H A;  2E2X A;  1NTY A;  3NWA A;  1XCG A;  2CY5 A;  1K5G B;  3PVU A;  5LOP B;  1RJ2 A;  3F5R A;  3IVF A;  2MDX A;  1U27 A;  3GYP A;  1WI1 A;  2X18 A;  4QXA B;  1ZYI A;  4NY0 A;  3A8Q A;  2L2I A;  3D8D A;  2IFS A;  3KRW A;  4ZRK A;  5D3W A;  3NSU A;  1FOE A;  2K2J A;  1DYN A;  1N3H A;  1Q67 A;  4GMV A;  4Z2N A;  2RRF A;  2P0F A;  3VIA A;  4HB4 B;  5C79 A;  2Y7B A;  1OQN A;  1P6S A;  2DYQ A;  2YSZ A;  1U5G A;  5FI1 A;  1MIX A;  4L1R A;  4TKN A;  4CHJ A;  1PLS A;  3QBV B;  1MK7 B;  4NSW A;  2Q13 A;  2K2U A;  2P8V A;  3MPX A;  2GCJ A;  4K2P A;  4HAT B;  5KCV A;  2OQB A;  1U5F A;  1WG7 A;  4HAZ B;  4Z2M B;  3TVV A;  2CAY A;  1WJM A;  1AQC A;  5CLQ B;  2DKP A;  2L1C A;  4PNK A;  1OY2 A;  1XD4 A;  2FJL A;  1BAK A;  4YL8 A;  4GMX B;  3KZ1 A;  3WA0 A;  1Y19 B;  5J3T A;  2UZR A;  3ULC A;  2COC A;  3PP2 A;  2V76 A;  2J0K A;  2LOX A;  2Y8F A;  4Y94 A;  2J0J A;  1MPH A;  1TQZ A;  2OTX A;  2D9X A;  5HE2 A;  2W2X D;  2DN6 A;  3ODX A;  4DXA B;  2K8E A;  3AU4 A;  1UNR A;  4KVG B;  3FEH A;  1W1G A;  3HW2 B;  1WJ1 A;  1V89 A;  1MK9 B;  1EGX A;  5LG4 B;  2DFK A;  1ZC4 B;  3VOQ A;  1I7A A;  2K49 A;  1MI1 A;  4A6K A;  5JP4 A;  4KHA A;  3ZVR A;  1NU2 A;  3GYO A;  4HAV B;  2RLO A;  4WJ7 A;  2ROZ B;  5HE0 A;  3OAN A;  1J19 A;  1PFJ A;  4HHV A;  4K17 A;  1QC6 A;  1T77 A;  1KZG A;  3UZT A;  1DRO A;  2RNR B;  4TYZ A;  4K81 A;  1M7E A;  2NZ8 B;  3A58 A; 
#chains in the Genus database with same CATH homology
 3PVW A;  5C6R A;  2LKO A;  4IOY X;  1FB8 A;  2DHI A;  2GUM A;  1DDV A;  1EAZ A;  2N23 A;  4MK0 A;  4YON A;  2R0D A;  2CRF A;  2DLW A;  5C5B A;  3DXC A;  4BBK A;  5HE1 A;  3FVC A;  2D11 A;  1KZ7 A;  2ADZ A;  5D3V A;  2D9Z A;  1BWN A;  4GN1 A;  3X23 A;  5D3X A;  1V5M A;  4ZRJ A;  2H7D A;  3KSY A;  4C0A A;  2COA A;  3KY9 A;  1ZVR A;  1LW3 A;  1WGU A;  2EJ8 A;  2DYN A;  3A98 B;  4F7U P;  2DKQ A;  2D9W A;  4IAP A;  2Z4D A;  3PVL A;  2YS1 A;  3D8E A;  1H10 A;  4DX9 0;  1X1G A;  2YF0 A;  4A6H A;  1LB1 A;  4A6F A;  1X1F A;  2KIE A;  2D4Q A;  1UNQ A;  4MT7 A;  1FGZ A;  3T06 A;  2MKR A;  5I2S A;  1FAO A;  4EJN A;  3BJI A;  5JHG A;  4XWX A;  2W2W A;  5CLL B;  3ULB A;  3SO6 A;  2EC1 A;  4GOU A;  1GC7 A;  4WSF A;  3M1I B;  3N7C A;  1EVH A;  1DBH A;  3U8Z A;  5C5B B;  2ZKM X;  4K2O A;  4CYE A;  4F7H A;  4HDO A;  4DIX A;  4MY6 A;  3KRX A;  3ODW A;  2HTH B;  1EF1 A;  3SUZ A;  3HQC A;  2ELA A;  1FHW A;  2LUL A;  3CIK A;  2DTC A;  2YS3 A;  2M14 A;  2RVB B;  5JHH A;  2IYB A;  4IFS A;  1XKE A;  2FJU B;  1P3R A;  3A8P A;  2G35 A;  3PG7 A;  1E5W A;  3P6A A;  2YT1 A;  2I1K A;  3G9W A;  1UEF A;  3DXE A;  4GNK B;  4A6F B;  4WVF B;  2Z59 A;  2DX1 A;  3QWM A;  2DHJ A;  4L6E A;  2Z13 A;  4QJ5 B;  3QIJ A;  2YT0 A;  2KUP A;  4HSI A;  3SNH A;  1ISN A;  4EKU A;  1QQG A;  1NTV A;  3RCP A;  2PZ1 A;  3WYF B;  2YT2 A;  3O96 A;  3ZDT A;  2N0Y A;  2BCJ A;  3HIE A;  2EMS A;  3SYX A;  3FSS A;  3OHM B;  3SV1 A;  1K5D B;  1U5E A;  2AEH A;  1GG3 A;  4QJ4 B;  1MKE A;  2VSZ A;  2Z0P A;  3U7D A;  3TCA A;  1U2B A;  3PSC A;  1Y5O A;  1V88 A;  2GCL A;  2LYD A;  2AL6 A;  4ZRI A;  5DI9 B;  2RSG A;  2MWN B;  4HAX B;  4KHB A;  1BTK A;  1V5U A;  4HAW B;  1V5P A;  3MDB C;  1SGH A;  2Z0Q A;  5I2M A;  2RUK B;  1ZM0 A;  1XOD A;  2J59 M;  2MFQ A;  2NMB A;  4P7I A;  3F0W A;  2VRW B;  1IRS A;  5EFX A;  2P0D A;  5DHF B;  2I1J A;  1V61 A;  2J0M A;  2KUQ A;  2QKL A;  1MAI A;  1U29 A;  1X11 A;  5KQ1 A;  2Z14 A;  4D6W A;  3LJU X;  1B55 A;  5GOW B;  3DXD A;  3AJ4 A;  1NI2 A;  5C16 A;  2Y8G A;  5L81 A;  2LOZ A;  5JLJ B;  2NBV A;  4HAU B;  2Z0O A;  1MIZ B;  5D27 A;  1Z87 A;  1AWE A;  3PZD A;  1FHO A;  4GZU A;  1WGQ A;  4EMO A;  2UVM A;  1ZC3 B;  1WVH A;  3NWF A;  2D9Y A;  1RRP B;  1XX0 A;  2ELB A;  4H8S A;  4HB2 B;  4HB3 B;  5KQ4 A;  2R09 A;  1GC6 A;  2R2Y A;  1TXD A;  2KCJ A;  1FGY A;  4DX8 A;  2XQN M;  5DHA B;  4KHB B;  1J0W A;  4CHM A;  2W2X C;  5DIF B;  3HK0 A;  2LG1 A;  2ROV A;  2UZS A;  1DDW A;  1UPQ A;  2CY4 A;  2COD A;  4HB0 B;  3ODO A;  1X86 A;  1XR0 B;  2D9V A;  2RGN B;  1X05 A;  1I2H A;  4HAY B;  5M4Y B;  1UNP A;  3FM8 C;  5J3Q A;  1OMW A;  3NW8 A;  4OT1 A;  3ML4 A;  4OSN A;  4DBB A;  2ZPY A;  2H7E A;  2D10 A;  3V5W A;  1U5D A;  1FHX A;  1ZSQ A;  2YVC A;  1BTN A;  4HDQ A;  4D0N B;  3TW1 A;  2COF A;  3PEG A;  1H4R A;  2KIG A;  2DX5 A;  3P7Z A;  2VKI A;  2YS5 A;  1KI1 B;  2M38 A;  3TFM A;  4PQ0 A;  5HE3 A;  2I5C A;  2YRY A;  3BIN A;  1DDM A;  4QJ3 B;  3NWD A;  4CSQ A;  2K00 A;  2EMT A;  3CXB B;  5DH9 B;  2P0H A;  1W1D A;  5J3Y A;  1P5T A;  2QKM A;  4KAX B;  1PMS A;  2DA0 A;  2DHK A;  2HE7 A;  1M7R A;  4GXB A;  3D8F A;  3TO1 A;  3U12 A;  3AU5 A;  2I5F A;  4KHO A;  4F7G A;  5LON B;  1UPR A;  2KR0 A;  5IRS A;  1TJ6 A;  1W1H A;  1SHC A;  2JP2 A;  2GJY A;  4GPT B;  5FI0 A;  4A5K A;  2GS0 A;  2KGX B;  2D2Q A;  5D3Y A;  4B6H A;  2E2X A;  1NTY A;  3NWA A;  1XCG A;  2CY5 A;  1K5G B;  3PVU A;  5LOP B;  1RJ2 A;  3F5R A;  3IVF A;  2MDX A;  1U27 A;  3GYP A;  1WI1 A;  2X18 A;  4QXA B;  1ZYI A;  4NY0 A;  3A8Q A;  2L2I A;  3D8D A;  2IFS A;  3KRW A;  4ZRK A;  5D3W A;  3NSU A;  1FOE A;  2K2J A;  1DYN A;  1N3H A;  1Q67 A;  4GMV A;  4Z2N A;  3VIA A;  2P0F A;  2RRF A;  4HB4 B;  5C79 A;  2Y7B A;  1OQN A;  1P6S A;  2DYQ A;  2YSZ A;  1U5G A;  5FI1 A;  1MIX A;  4TKN A;  4CHJ A;  4L1R A;  1PLS A;  3QBV B;  1MK7 B;  4NSW A;  2Q13 A;  2K2U A;  2P8V A;  3MPX A;  2GCJ A;  4K2P A;  4HAT B;  5KCV A;  2OQB A;  1U5F A;  1WG7 A;  4HAZ B;  4Z2M B;  3TVV A;  2CAY A;  1WJM A;  1AQC A;  5CLQ B;  2DKP A;  2L1C A;  4PNK A;  1OY2 A;  1XD4 A;  2FJL A;  1BAK A;  4YL8 A;  4GMX B;  3KZ1 A;  3WA0 A;  1Y19 B;  5J3T A;  2UZR A;  3ULC A;  2COC A;  3PP2 A;  2V76 A;  2J0K A;  2LOX A;  2Y8F A;  4Y94 A;  2J0J A;  1MPH A;  1TQZ A;  2OTX A;  2D9X A;  5HE2 A;  2W2X D;  2DN6 A;  3ODX A;  4DXA B;  3AU4 A;  4KVG B;  1UNR A;  2K8E A;  3FEH A;  1W1G A;  3HW2 B;  1WJ1 A;  1V89 A;  1MK9 B;  1EGX A;  5LG4 B;  2DFK A;  1ZC4 B;  3VOQ A;  1I7A A;  2K49 A;  4A6K A;  5JP4 A;  4KHA A;  3ZVR A;  1NU2 A;  3GYO A;  4HAV B;  2RLO A;  4WJ7 A;  2ROZ B;  5HE0 A;  3OAN A;  1J19 A;  1PFJ A;  4HHV A;  4K17 A;  1QC6 A;  1KZG A;  3UZT A;  1DRO A;  2RNR B;  4TYZ A;  4K81 A;  1M7E A;  2NZ8 B;  3A58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...