3FSSA

Structure of the tandem ph domains of rtt106
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2009-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3fssA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3fssA01
2YF0A 4YONA 5HE0A 2RGNB 2YS5A 1RJ2A 4K2PA 1WJ1A 1U2BA 5HE3A 4IFSA 1E5WA 2EJ8A 1EAZA 1KZ7A 2COFA 4HB4B 3VIAA 4HB3B 1WG7A 5J3TA 4B6HA 1X86A 1U5FA 5DHFB 2CRFA 1LB1A 3F5RA 1Q67A 4DBBA 1M7RA 4C0AA 3SO6A 2UVMA 1NU2A 2RNRB 4CYEA 2Z0PA 1B55A 4PQ0A 3ODOA 2YS3A 4WJ7A 3KRXA 2OTXA 2J0JA 1KI1B 1PLSA 2KUPA 4IOYX 4A5KA 3PVUA 2P0DA 3FEHA 1OQNA 2M38A 1SGHA 5LONB 5D3YA 2YSZA 4HB2B 1P3RA 3M1IB 3QWMA 5J3QA 5HE1A 3PVLA 1P5TA 2D9ZA 1KZGA 1RRPB 4XWXA 3TO1A 4NSWA 2DKPA 3VOQA 4Y94A 4ZRKA 3GYPA 4A6HA 2LKOA 3G9WA 3ZVRA 1LW3A 3SNHA 1FGZA 3PSCA 2D9VA 2D2QA 2R09A 2EMSA 2ROZB 4BBKA 1AWEA 1V61A 4DX8A 3F0WA 1MPHA 1BTNA 5LOPB 3U8ZA 3QIJA 1MKEA 1WGQA 1UNQA 3DXEA 5KQ1A 1BTKA 1MK9B 2HE7A 5JP4A 3O96A 2N23A 2PZ1A 2CY5A 3AJ4A 1M7EA 3SYXA 3TFMA 1Y19B 2D9WA 5L81A 2ELBA 2LG1A 1OMWA 4CHMA 1Y5OA 1FB8A 2CY4A 2YT0A 2COCA 3KSYA 3ULCA 5JHGA 2ADZA 4H8SA 3ML4A 4P7IA 4HAUB 3SUZA 2COAA 2J0MA 3D8DA 5D27A 3CXBB 2ELAA 2IFSA 4GPTB 2J0KA 2VKIA 1GG3A 3KZ1A 3RCPA 4WSFA 4K81A 1I7AA 2RSGA 1W1HA 3GYOA 2AL6A 1WGUA 2K2UA 1XX0A 1J19A 2DHIA 5C6RA 2N0YA 3AU5A 2AEHA 3HK0A 3CIKA 2DLWA 3WYFB 1OY2A 5DI9B 2P8VA 4ZRIA 1EVHA 2DX5A 2L2IA 2IYBA 2YVCA 2RUKB 2Y8FA 3TW1A 2I5FA 2GS0A 1XODA 1W1DA 4MT7A 3N7CA 2E2XA 2KGXB 2EC1A 1N3HA 3ODXA 2DA0A 2DHJA 2K2JA 4HDOA 3P6AA 3DXDA 3U7DA 4HAWB 2RLOA 3PP2A 5D3WA 2Y8GA 3NSUA 4F7GA 3TCAA 2D9YA 1MIZB 5HE2A 2MWNB 4KHOA 1FAOA 2P0HA 1XD4A 4ZRJA 4Z2MB 1J0WA 1U29A 5FI0A 5DIFB 1DBHA 1DDVA 1BWNA 2DX1A 3AU4A 2Z0OA 3QBVB 5DHAB 3BINA 2LULA 2LYDA 1I2HA 3KY9A 2UZRA 4PNKA 3A8QA 1PMSA 1DDWA 1WJMA 3D8EA 3BJIA 5D3VA 4A6FA 4L6EA 1EF1A 1TJ6A 2CAYA 2KCJA 2FJLA 1XKEA 1ZC3B 2MDXA 5FI1A 2Q13A 2DN6A 4HAVB 1U5GA 4WVFB 2I1KA 2H7EA 4TYZA 4F7HA 3PG7A 3X23A 2V76A 4HAYB 2LOXA 3V5WA 5GOWB 1QC6A 4KVGB 2W2WA 2JP2A 1PFJA 2ZPYA 5CLQB 3MDBC 2NMBA 2GCLA 3SV1A 4HDQA 2M14A 2DTCA 3PEGA 3UZTA 4Z2NA 1U27A 1DROA 2D9XA 2DKQA 2J59M 4D0NB 5C5BA 4A6FB 4HATB 3WA0A 1K5GB 3TVVA 1V88A 2QKMA 1TXDA 1H10A 1IRSA 1X1FA 2OQBA 4GXBA 2L1CA 3MPXA 1X1GA 2I5CA 2K00A 1NI2A 4IAPA 1EGXA 1AQCA 1K5DB 3FSSA 1FOEA 1WVHA 3PVWA 2DYQA 4K17A 4KHAA 4GMVA 5J3YA 1UNRA 2GJYA 2RVBB 1DDMA 2H7DA 1SHCA 2G35A 1V5MA 1GC6A 5KCVA 1TQZA 5KQ4A 3HW2B 4HAZB 2UZSA 5CLLB 1V89A 1FHWA 3T06A 1WI1A 2W2XC 1UNPA 5C5BB 2VSZA 3A98B 4KAXB 4GN1A 1FGYA 2LOZA 3ODWA 1QQGA 1UPQA 2DYNA 3A8PA 1V5PA 2D10A 4EJNA 1NTVA 3D8FA 1BAKA 2W2XD 2D4QA 1V5UA 2Y7BA 2Z0QA 4GZUA 1UEFA 5JHHA 2I1JA 2MKRA 3HQCA 4CHJA 2DHKA 2QKLA 3ULBA 5D3XA 1GC7A 1DYNA 1MIXA 3DXCA 4HAXB 1P6SA 4YL8A 3IVFA 2ROVA 2DFKA 2EMTA 2BCJA 4KHBB 5C16A 1UPRA 2MFQA 1NTYA 2X18A 1U5DA 3KRWA 2GCJA 2VRWB 2HTHB 4MY6A 4DX90 1X05A 4HHVA 3FM8C 1W1GA 1H4RA 2R0DA 1MAIA 4MK0A 2D11A 3OANA 1MK7B 1ZSQA 2YRYA 3ZDTA 2NZ8B 1XR0B 4F7UP 1U5EA 2YS1A 4K2OA 5C79A 1Z87A 1ZM0A 2CODA 1X11A 4NY0A 4A6KA 4HB0B 4GMXB 5DH9B 1ZVRA 2YT1A 3PZDA 1ISNA 5EFXA 1FHOA 2XQNM 4EKUA 2P0FA 4TKNA 1FHXA 4EMOA 3LJUX 5JLJB 1XCGA 3P7ZA 1ZC4B 4DXAB
chains in the Genus database with same CATH superfamily
2YF0A 4YONA 5HE0A 2RGNB 2YS5A 1RJ2A 4K2PA 1WJ1A 1U2BA 5HE3A 5I2SA 4IFSA 1E5WA 2EJ8A 1EAZA 1KZ7A 2COFA 4HB4B 3VIAA 4HB3B 1WG7A 5J3TA 4B6HA 1X86A 1U5FA 5DHFB 2CRFA 1LB1A 3F5RA 1Q67A 4DBBA 1M7RA 4C0AA 3SO6A 2UVMA 4HSIA 1NU2A 2RNRB 4CYEA 2Z0PA 1B55A 4PQ0A 3ODOA 2YS3A 4WJ7A 3KRXA 2OTXA 2J0JA 1KI1B 1PLSA 2KUPA 4IOYX 4A5KA 3PVUA 2P0DA 3FEHA 1OQNA 2M38A 1SGHA 5LONB 5D3YA 2YSZA 4HB2B 1P3RA 3M1IB 3QWMA 5J3QA 5HE1A 3PVLA 1P5TA 2D9ZA 2FJUB 4QJ5B 1KZGA 1RRPB 4XWXA 3TO1A 4NSWA 2DKPA 3VOQA 4Y94A 4ZRKA 3GYPA 4A6HA 2LKOA 3A58A 3G9WA 3ZVRA 1LW3A 3SNHA 1FGZA 1T77A 3PSCA 2D9VA 2D2QA 2R09A 2EMSA 2ROZB 4GOUA 4BBKA 1AWEA 1V61A 4DX8A 3F0WA 1MPHA 5M4YB 1BTNA 5LOPB 4QJ3B 3U8ZA 3QIJA 1MKEA 1WGQA 1UNQA 3DXEA 5KQ1A 1BTKA 1MK9B 2HE7A 5JP4A 3O96A 2N23A 2PZ1A 2CY5A 1ZYIA 3AJ4A 1M7EA 3SYXA 3U12A 3TFMA 1Y19B 2D9WA 3NW8A 5L81A 4DIXA 2ELBA 2LG1A 1OMWA 4CHMA 2NBVA 3NWDA 1Y5OA 1FB8A 2CY4A 2YT0A 2COCA 3KSYA 4OSNA 3ULCA 2ADZA 5JHGA 4H8SA 3ML4A 4P7IA 4QXAB 4HAUB 3SUZA 2COAA 2J0MA 3D8DA 5D27A 3CXBB 2ELAA 2IFSA 4GPTB 2J0KA 2VKIA 1GG3A 3KZ1A 3RCPA 4WSFA 4K81A 1I7AA 2RSGA 1W1HA 3GYOA 2AL6A 1WGUA 2K2UA 1XX0A 3NWAA 1J19A 2DHIA 5C6RA 4D6WA 2N0YA 2R2YA 3AU5A 4QJ4B 2AEHA 3HK0A 3CIKA 2DLWA 3WYFB 2Z59A 1OY2A 5DI9B 2P8VA 4ZRIA 1EVHA 2DX5A 2L2IA 3HSAA 3OHMB 2IYBA 2YVCA 2RUKB 2Y8FA 3TW1A 2I5FA 2GS0A 4CSQA 1XODA 1W1DA 4MT7A 3N7CA 2E2XA 2KGXB 2EC1A 1N3HA 3ODXA 2DA0A 2DHJA 2K2JA 4HDOA 3P6AA 3DXDA 3U7DA 4HAWB 2RLOA 3PP2A 5D3WA 2Y8GA 3NSUA 4F7GA 3TCAA 2D9YA 1MIZB 5HE2A 2MWNB 4KHOA 1FAOA 2RRFA 2P0HA 1XD4A 4ZRJA 4Z2MB 1J0WA 1U29A 5FI0A 5DIFB 1DBHA 1DDVA 2KUQA 1BWNA 2DX1A 3AU4A 2Z0OA 3QBVB 5DHAB 3BINA 1MI1A 2LULA 2LYDA 1I2HA 3KY9A 2UZRA 4PNKA 3A8QA 1PMSA 1DDWA 1WJMA 3D8EA 3BJIA 5D3VA 4A6FA 4L6EA 1EF1A 1TJ6A 2CAYA 2KCJA 2FJLA 1XKEA 1ZC3B 2MDXA 5FI1A 2Q13A 2DN6A 4HAVB 1U5GA 4WVFB 2I1KA 2H7EA 4TYZA 4F7HA 3PG7A 3X23A 2V76A 4HAYB 2LOXA 3V5WA 5GOWB 1QC6A 4KVGB 2W2WA 2JP2A 4L1RA 1PFJA 2ZPYA 2GUMA 5CLQB 3NWFA 2KIGA 3MDBC 2NMBA 2GCLA 3SV1A 4HDQA 2M14A 2DTCA 3PEGA 3UZTA 4Z2NA 1U27A 1DROA 2D9XA 2Z4DA 2DKQA 2J59M 4D0NB 5C5BA 4A6FB 4HATB 3WA0A 1K5GB 2YT2A 3TVVA 1V88A 2QKMA 1TXDA 1H10A 1IRSA 3FVCA 1X1FA 2OQBA 4GXBA 2L1CA 3MPXA 1X1GA 2I5CA 4OT1A 2K00A 1NI2A 4IAPA 1EGXA 1AQCA 1K5DB 3FSSA 2KIEA 1FOEA 1WVHA 3PVWA 2DYQA 4K17A 3DCXA 4GMVA 4KHAA 5J3YA 1UNRA 2GJYA 2Z14A 2RVBB 1DDMA 2H7DA 1SHCA 2G35A 4GNKB 1V5MA 1GC6A 5KCVA 1TQZA 5KQ4A 4KHBA 3HW2B 4HAZB 2UZSA 5CLLB 1V89A 1FHWA 2Z13A 3T06A 1WI1A 2W2XC 1UNPA 5C5BB 2VSZA 3A98B 4KAXB 4GN1A 1FGYA 2LOZA 3ODWA 1QQGA 1UPQA 2DYNA 3A8PA 1V5PA 2D10A 4EJNA 1NTVA 3D8FA 1BAKA 2W2XD 2D4QA 1V5UA 2Y7BA 2Z0QA 4GZUA 1UEFA 5JHHA 2I1JA 2MKRA 3HQCA 4CHJA 2DHKA 5I2MA 5IRSA 2QKLA 3ULBA 5D3XA 1GC7A 1DYNA 1MIXA 3DXCA 4HAXB 1P6SA 4YL8A 3IVFA 2ROVA 2DFKA 2EMTA 2BCJA 4KHBB 5C16A 2K49A 1UPRA 2MFQA 1NTYA 2X18A 1U5DA 3KRWA 2GCJA 2VRWB 2HTHB 4MY6A 4DX90 1X05A 4HHVA 3FM8C 1W1GA 1H4RA 2R0DA 1MAIA 2K8EA 4MK0A 2D11A 3OANA 1MK7B 1ZSQA 2YRYA 3HIEA 3ZDTA 2NZ8B 1XR0B 4F7UP 1U5EA 2YS1A 4K2OA 5C79A 1Z87A 1ZM0A 3B77A 2CODA 1X11A 2KR0A 4NY0A 4A6KA 4HB0B 4GMXB 5DH9B 1ZVRA 2YT1A 3PZDA 1ISNA 2ZKMX 5EFXA 1FHOA 2XQNM 4EKUA 2P0FA 4TKNA 1FHXA 4EMOA 3LJUX 5JLJB 1XCGA 5LG4B 3P7ZA 1ZC4B 4DXAB
chains in the Genus database with same CATH topology
2YF0A 4YONA 5HE0A 2RGNB 2YS5A 1RJ2A 4K2PA 1WJ1A 1U2BA 5HE3A 5I2SA 4IFSA 1E5WA 2EJ8A 1EAZA 1KZ7A 2COFA 4HB4B 3VIAA 4HB3B 1WG7A 5J3TA 4B6HA 1X86A 1U5FA 5DHFB 2CRFA 1LB1A 3F5RA 1Q67A 4DBBA 1M7RA 4C0AA 3SO6A 2UVMA 4HSIA 1NU2A 2RNRB 4CYEA 2Z0PA 1B55A 4PQ0A 3ODOA 2YS3A 4WJ7A 3KRXA 2OTXA 2J0JA 1KI1B 1PLSA 2KUPA 4IOYX 4A5KA 3PVUA 2P0DA 3FEHA 1OQNA 2M38A 1SGHA 5LONB 5D3YA 2YSZA 4HB2B 1P3RA 3M1IB 3QWMA 5J3QA 5HE1A 3PVLA 1P5TA 2D9ZA 2FJUB 4QJ5B 1KZGA 1RRPB 4XWXA 3TO1A 4NSWA 2DKPA 3VOQA 4Y94A 4ZRKA 3GYPA 4A6HA 2LKOA 3A58A 3G9WA 3ZVRA 1LW3A 3SNHA 1FGZA 3PSCA 2D9VA 2D2QA 2R09A 2EMSA 2ROZB 4BBKA 4GOUA 1AWEA 1V61A 4DX8A 3F0WA 1MPHA 5M4YB 1BTNA 5LOPB 4QJ3B 3U8ZA 3QIJA 1MKEA 1WGQA 1UNQA 3DXEA 5KQ1A 1BTKA 1MK9B 2HE7A 5JP4A 3O96A 2N23A 2PZ1A 2CY5A 1ZYIA 3AJ4A 1M7EA 3SYXA 3U12A 3TFMA 1Y19B 2D9WA 3NW8A 5L81A 4DIXA 2ELBA 2LG1A 1OMWA 4CHMA 2NBVA 3NWDA 1Y5OA 1FB8A 2CY4A 2YT0A 2COCA 3KSYA 3ULCA 5JHGA 2ADZA 4OSNA 4H8SA 3ML4A 4P7IA 4QXAB 4HAUB 3SUZA 2COAA 2J0MA 3D8DA 5D27A 3CXBB 2ELAA 2IFSA 4GPTB 2J0KA 2VKIA 1GG3A 3KZ1A 3RCPA 4WSFA 4K81A 1I7AA 2RSGA 1W1HA 3GYOA 2AL6A 1WGUA 2K2UA 1XX0A 3NWAA 1J19A 2DHIA 5C6RA 4D6WA 2N0YA 2R2YA 3AU5A 4QJ4B 2AEHA 3HK0A 3CIKA 2DLWA 3WYFB 2Z59A 1OY2A 5DI9B 2P8VA 4ZRIA 1EVHA 2DX5A 2L2IA 3OHMB 2IYBA 2YVCA 2RUKB 2Y8FA 3TW1A 2I5FA 2GS0A 4CSQA 1XODA 1W1DA 4MT7A 3N7CA 2E2XA 2KGXB 2EC1A 1N3HA 3ODXA 2DA0A 2DHJA 2K2JA 4HDOA 3P6AA 3DXDA 3U7DA 4HAWB 2RLOA 3PP2A 5D3WA 2Y8GA 3NSUA 4F7GA 3TCAA 2D9YA 1MIZB 5HE2A 2MWNB 4KHOA 1FAOA 2RRFA 2P0HA 1XD4A 4ZRJA 4Z2MB 1J0WA 1U29A 5FI0A 5DIFB 1DBHA 1DDVA 2KUQA 1BWNA 2DX1A 3AU4A 2Z0OA 3QBVB 5DHAB 3BINA 2LULA 2LYDA 1I2HA 3KY9A 2UZRA 4PNKA 3A8QA 1PMSA 1DDWA 1WJMA 3D8EA 3BJIA 5D3VA 4A6FA 4L6EA 1EF1A 1TJ6A 2CAYA 2KCJA 2FJLA 1XKEA 1ZC3B 2MDXA 5FI1A 2Q13A 2DN6A 4HAVB 1U5GA 4WVFB 2I1KA 2H7EA 4TYZA 4F7HA 3PG7A 3X23A 2V76A 4HAYB 2LOXA 3V5WA 5GOWB 1QC6A 4KVGB 2W2WA 2JP2A 4L1RA 1PFJA 2ZPYA 2GUMA 5CLQB 3NWFA 3MDBC 2KIGA 2NMBA 2GCLA 3SV1A 4HDQA 2M14A 2DTCA 3PEGA 3UZTA 4Z2NA 1U27A 1DROA 2D9XA 2Z4DA 2DKQA 2J59M 4D0NB 5C5BA 4A6FB 4HATB 3WA0A 1K5GB 2YT2A 3TVVA 1V88A 2QKMA 1TXDA 1H10A 1IRSA 3FVCA 1X1FA 2OQBA 4GXBA 2L1CA 3MPXA 1X1GA 2I5CA 4OT1A 2K00A 1NI2A 4IAPA 1EGXA 1AQCA 1K5DB 3FSSA 2KIEA 1FOEA 1WVHA 3PVWA 2DYQA 4K17A 4KHAA 4GMVA 5J3YA 1UNRA 2GJYA 2Z14A 2RVBB 1DDMA 2H7DA 1SHCA 2G35A 4GNKB 1V5MA 1GC6A 5KCVA 1TQZA 5KQ4A 4KHBA 3HW2B 4HAZB 2UZSA 5CLLB 1V89A 1FHWA 2Z13A 3T06A 1WI1A 2W2XC 1UNPA 5C5BB 2VSZA 3A98B 4KAXB 4GN1A 1FGYA 2LOZA 3ODWA 1QQGA 1UPQA 2DYNA 3A8PA 1V5PA 2D10A 4EJNA 1NTVA 3D8FA 1BAKA 2W2XD 2D4QA 1V5UA 2Y7BA 2Z0QA 4GZUA 1UEFA 5JHHA 2I1JA 2MKRA 3HQCA 4CHJA 2DHKA 5I2MA 5IRSA 2QKLA 3ULBA 5D3XA 1GC7A 1DYNA 1MIXA 3DXCA 4HAXB 1P6SA 4YL8A 3IVFA 2ROVA 2DFKA 2EMTA 2BCJA 4KHBB 5C16A 2K49A 1UPRA 2MFQA 1NTYA 2X18A 1U5DA 3KRWA 2GCJA 2VRWB 2HTHB 4MY6A 4DX90 1X05A 4HHVA 3FM8C 1W1GA 1H4RA 2R0DA 1MAIA 2K8EA 4MK0A 2D11A 3OANA 1MK7B 1ZSQA 2YRYA 3HIEA 3ZDTA 2NZ8B 1XR0B 4F7UP 1U5EA 2YS1A 4K2OA 5C79A 1Z87A 1ZM0A 2CODA 1X11A 2KR0A 4NY0A 4A6KA 4HB0B 4GMXB 5DH9B 1ZVRA 2YT1A 3PZDA 1ISNA 2ZKMX 5EFXA 1FHOA 2XQNM 4EKUA 2P0FA 4TKNA 1FHXA 4EMOA 3LJUX 5JLJB 1XCGA 5LG4B 3P7ZA 1ZC4B 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YF0 A;  4YON A;  5HE0 A;  2RGN B;  2YS5 A;  1RJ2 A;  4K2P A;  1WJ1 A;  1U2B A;  5HE3 A;  4IFS A;  1E5W A;  2EJ8 A;  1EAZ A;  1KZ7 A;  2COF A;  4HB4 B;  3VIA A;  4HB3 B;  1WG7 A;  5J3T A;  4B6H A;  1X86 A;  1U5F A;  5DHF B;  2CRF A;  1LB1 A;  3F5R A;  1Q67 A;  4DBB A;  1M7R A;  4C0A A;  3SO6 A;  2UVM A;  1NU2 A;  2RNR B;  4CYE A;  2Z0P A;  1B55 A;  4PQ0 A;  3ODO A;  2YS3 A;  4WJ7 A;  3KRX A;  2OTX A;  2J0J A;  1KI1 B;  1PLS A;  2KUP A;  4IOY X;  4A5K A;  3PVU A;  2P0D A;  3FEH A;  1OQN A;  2M38 A;  1SGH A;  5LON B;  5D3Y A;  2YSZ A;  4HB2 B;  1P3R A;  3M1I B;  3QWM A;  5J3Q A;  5HE1 A;  3PVL A;  1P5T A;  2D9Z A;  1KZG A;  1RRP B;  4XWX A;  3TO1 A;  4NSW A;  2DKP A;  3VOQ A;  4Y94 A;  4ZRK A;  3GYP A;  4A6H A;  2LKO A;  3G9W A;  3ZVR A;  1LW3 A;  3SNH A;  1FGZ A;  3PSC A;  2D9V A;  2D2Q A;  2R09 A;  2EMS A;  2ROZ B;  4BBK A;  1AWE A;  1V61 A;  4DX8 A;  3F0W A;  1MPH A;  1BTN A;  5LOP B;  3U8Z A;  3QIJ A;  1MKE A;  1WGQ A;  1UNQ A;  3DXE A;  5KQ1 A;  1BTK A;  1MK9 B;  2HE7 A;  5JP4 A;  3O96 A;  2N23 A;  2PZ1 A;  2CY5 A;  3AJ4 A;  1M7E A;  3SYX A;  3TFM A;  1Y19 B;  2D9W A;  5L81 A;  2ELB A;  2LG1 A;  1OMW A;  4CHM A;  1Y5O A;  1FB8 A;  2CY4 A;  2YT0 A;  2COC A;  3KSY A;  3ULC A;  5JHG A;  2ADZ A;  4H8S A;  3ML4 A;  4P7I A;  4HAU B;  3SUZ A;  2COA A;  2J0M A;  3D8D A;  5D27 A;  3CXB B;  2ELA A;  2IFS A;  4GPT B;  2J0K A;  2VKI A;  1GG3 A;  3KZ1 A;  3RCP A;  4WSF A;  4K81 A;  1I7A A;  2RSG A;  1W1H A;  3GYO A;  2AL6 A;  1WGU A;  2K2U A;  1XX0 A;  1J19 A;  2DHI A;  5C6R A;  2N0Y A;  3AU5 A;  2AEH A;  3HK0 A;  3CIK A;  2DLW A;  3WYF B;  1OY2 A;  5DI9 B;  2P8V A;  4ZRI A;  1EVH A;  2DX5 A;  2L2I A;  2IYB A;  2YVC A;  2RUK B;  2Y8F A;  3TW1 A;  2I5F A;  2GS0 A;  1XOD A;  1W1D A;  4MT7 A;  3N7C A;  2E2X A;  2KGX B;  2EC1 A;  1N3H A;  3ODX A;  2DA0 A;  2DHJ A;  2K2J A;  4HDO A;  3P6A A;  3DXD A;  3U7D A;  4HAW B;  2RLO A;  3PP2 A;  5D3W A;  2Y8G A;  3NSU A;  4F7G A;  3TCA A;  2D9Y A;  1MIZ B;  5HE2 A;  2MWN B;  4KHO A;  1FAO A;  2P0H A;  1XD4 A;  4ZRJ A;  4Z2M B;  1J0W A;  1U29 A;  5FI0 A;  5DIF B;  1DBH A;  1DDV A;  1BWN A;  2DX1 A;  3AU4 A;  2Z0O A;  3QBV B;  5DHA B;  3BIN A;  2LUL A;  2LYD A;  1I2H A;  3KY9 A;  2UZR A;  4PNK A;  3A8Q A;  1PMS A;  1DDW A;  1WJM A;  3D8E A;  3BJI A;  5D3V A;  4A6F A;  4L6E A;  1EF1 A;  1TJ6 A;  2CAY A;  2KCJ A;  2FJL A;  1XKE A;  1ZC3 B;  2MDX A;  5FI1 A;  2Q13 A;  2DN6 A;  4HAV B;  1U5G A;  4WVF B;  2I1K A;  2H7E A;  4TYZ A;  4F7H A;  3PG7 A;  3X23 A;  2V76 A;  4HAY B;  2LOX A;  3V5W A;  5GOW B;  1QC6 A;  4KVG B;  2W2W A;  2JP2 A;  1PFJ A;  2ZPY A;  5CLQ B;  3MDB C;  2NMB A;  2GCL A;  3SV1 A;  4HDQ A;  2M14 A;  2DTC A;  3PEG A;  3UZT A;  4Z2N A;  1U27 A;  1DRO A;  2D9X A;  2DKQ A;  2J59 M;  4D0N B;  5C5B A;  4A6F B;  4HAT B;  3WA0 A;  1K5G B;  3TVV A;  1V88 A;  2QKM A;  1TXD A;  1H10 A;  1IRS A;  1X1F A;  2OQB A;  4GXB A;  2L1C A;  3MPX A;  1X1G A;  2I5C A;  2K00 A;  1NI2 A;  4IAP A;  1EGX A;  1AQC A;  1K5D B;  3FSS A;  1FOE A;  1WVH A;  3PVW A;  2DYQ A;  4K17 A;  4KHA A;  4GMV A;  5J3Y A;  1UNR A;  2GJY A;  2RVB B;  1DDM A;  2H7D A;  1SHC A;  2G35 A;  1V5M A;  1GC6 A;  5KCV A;  1TQZ A;  5KQ4 A;  3HW2 B;  4HAZ B;  2UZS A;  5CLL B;  1V89 A;  1FHW A;  3T06 A;  1WI1 A;  2W2X C;  1UNP A;  5C5B B;  2VSZ A;  3A98 B;  4KAX B;  4GN1 A;  1FGY A;  2LOZ A;  3ODW A;  1QQG A;  1UPQ A;  2DYN A;  3A8P A;  1V5P A;  2D10 A;  4EJN A;  1NTV A;  3D8F A;  1BAK A;  2W2X D;  2D4Q A;  1V5U A;  2Y7B A;  2Z0Q A;  4GZU A;  1UEF A;  5JHH A;  2I1J A;  2MKR A;  3HQC A;  4CHJ A;  2DHK A;  2QKL A;  3ULB A;  5D3X A;  1GC7 A;  1DYN A;  1MIX A;  3DXC A;  4HAX B;  1P6S A;  4YL8 A;  3IVF A;  2ROV A;  2DFK A;  2EMT A;  2BCJ A;  4KHB B;  5C16 A;  1UPR A;  2MFQ A;  1NTY A;  2X18 A;  1U5D A;  3KRW A;  2GCJ A;  2VRW B;  2HTH B;  4MY6 A;  4DX9 0;  1X05 A;  4HHV A;  3FM8 C;  1W1G A;  1H4R A;  2R0D A;  1MAI A;  4MK0 A;  2D11 A;  3OAN A;  1MK7 B;  1ZSQ A;  2YRY A;  3ZDT A;  2NZ8 B;  1XR0 B;  4F7U P;  1U5E A;  2YS1 A;  4K2O A;  5C79 A;  1Z87 A;  1ZM0 A;  2COD A;  1X11 A;  4NY0 A;  4A6K A;  4HB0 B;  4GMX B;  5DH9 B;  1ZVR A;  2YT1 A;  3PZD A;  1ISN A;  5EFX A;  1FHO A;  2XQN M;  4EKU A;  2P0F A;  4TKN A;  1FHX A;  4EMO A;  3LJU X;  5JLJ B;  1XCG A;  3P7Z A;  1ZC4 B;  4DXA B; 
#chains in the Genus database with same CATH topology
 2YF0 A;  4YON A;  5HE0 A;  2RGN B;  2YS5 A;  1RJ2 A;  4K2P A;  1WJ1 A;  1U2B A;  5HE3 A;  5I2S A;  4IFS A;  1E5W A;  2EJ8 A;  1EAZ A;  1KZ7 A;  2COF A;  4HB4 B;  3VIA A;  4HB3 B;  1WG7 A;  5J3T A;  4B6H A;  1X86 A;  1U5F A;  5DHF B;  2CRF A;  1LB1 A;  3F5R A;  1Q67 A;  4DBB A;  1M7R A;  4C0A A;  3SO6 A;  2UVM A;  4HSI A;  1NU2 A;  2RNR B;  4CYE A;  2Z0P A;  1B55 A;  4PQ0 A;  3ODO A;  2YS3 A;  4WJ7 A;  3KRX A;  2OTX A;  2J0J A;  1KI1 B;  1PLS A;  2KUP A;  4IOY X;  4A5K A;  3PVU A;  2P0D A;  3FEH A;  1OQN A;  2M38 A;  1SGH A;  5LON B;  5D3Y A;  2YSZ A;  4HB2 B;  1P3R A;  3M1I B;  3QWM A;  5J3Q A;  5HE1 A;  3PVL A;  1P5T A;  2D9Z A;  2FJU B;  4QJ5 B;  1KZG A;  1RRP B;  4XWX A;  3TO1 A;  4NSW A;  2DKP A;  3VOQ A;  4Y94 A;  4ZRK A;  3GYP A;  4A6H A;  2LKO A;  3A58 A;  3G9W A;  3ZVR A;  1LW3 A;  3SNH A;  1FGZ A;  1T77 A;  3PSC A;  2D9V A;  2D2Q A;  2R09 A;  2EMS A;  2ROZ B;  4GOU A;  4BBK A;  1AWE A;  1V61 A;  4DX8 A;  3F0W A;  1MPH A;  5M4Y B;  1BTN A;  5LOP B;  4QJ3 B;  3U8Z A;  3QIJ A;  1MKE A;  1WGQ A;  1UNQ A;  3DXE A;  5KQ1 A;  1BTK A;  1MK9 B;  2HE7 A;  5JP4 A;  3O96 A;  2N23 A;  2PZ1 A;  2CY5 A;  1ZYI A;  3AJ4 A;  1M7E A;  3SYX A;  3U12 A;  3TFM A;  1Y19 B;  2D9W A;  3NW8 A;  5L81 A;  4DIX A;  2ELB A;  2LG1 A;  1OMW A;  4CHM A;  2NBV A;  3NWD A;  1Y5O A;  1FB8 A;  2CY4 A;  2YT0 A;  2COC A;  3KSY A;  4OSN A;  3ULC A;  2ADZ A;  5JHG A;  4H8S A;  3ML4 A;  4P7I A;  4QXA B;  4HAU B;  3SUZ A;  2COA A;  2J0M A;  3D8D A;  5D27 A;  3CXB B;  2ELA A;  2IFS A;  4GPT B;  2J0K A;  2VKI A;  1GG3 A;  3KZ1 A;  3RCP A;  4WSF A;  4K81 A;  1I7A A;  2RSG A;  1W1H A;  3GYO A;  2AL6 A;  1WGU A;  2K2U A;  1XX0 A;  3NWA A;  1J19 A;  2DHI A;  5C6R A;  4D6W A;  2N0Y A;  2R2Y A;  3AU5 A;  4QJ4 B;  2AEH A;  3HK0 A;  3CIK A;  2DLW A;  3WYF B;  2Z59 A;  1OY2 A;  5DI9 B;  2P8V A;  4ZRI A;  1EVH A;  2DX5 A;  2L2I A;  3HSA A;  3OHM B;  2IYB A;  2YVC A;  2RUK B;  2Y8F A;  3TW1 A;  2I5F A;  2GS0 A;  4CSQ A;  1XOD A;  1W1D A;  4MT7 A;  3N7C A;  2E2X A;  2KGX B;  2EC1 A;  1N3H A;  3ODX A;  2DA0 A;  2DHJ A;  2K2J A;  4HDO A;  3P6A A;  3DXD A;  3U7D A;  4HAW B;  2RLO A;  3PP2 A;  5D3W A;  2Y8G A;  3NSU A;  4F7G A;  3TCA A;  2D9Y A;  1MIZ B;  5HE2 A;  2MWN B;  4KHO A;  1FAO A;  2RRF A;  2P0H A;  1XD4 A;  4ZRJ A;  4Z2M B;  1J0W A;  1U29 A;  5FI0 A;  5DIF B;  1DBH A;  1DDV A;  2KUQ A;  1BWN A;  2DX1 A;  3AU4 A;  2Z0O A;  3QBV B;  5DHA B;  3BIN A;  1MI1 A;  2LUL A;  2LYD A;  1I2H A;  3KY9 A;  2UZR A;  4PNK A;  3A8Q A;  1PMS A;  1DDW A;  1WJM A;  3D8E A;  3BJI A;  5D3V A;  4A6F A;  4L6E A;  1EF1 A;  1TJ6 A;  2CAY A;  2KCJ A;  2FJL A;  1XKE A;  1ZC3 B;  2MDX A;  5FI1 A;  2Q13 A;  2DN6 A;  4HAV B;  1U5G A;  4WVF B;  2I1K A;  2H7E A;  4TYZ A;  4F7H A;  3PG7 A;  3X23 A;  2V76 A;  4HAY B;  2LOX A;  3V5W A;  5GOW B;  1QC6 A;  4KVG B;  2W2W A;  2JP2 A;  4L1R A;  1PFJ A;  2ZPY A;  2GUM A;  5CLQ B;  3NWF A;  2KIG A;  3MDB C;  2NMB A;  2GCL A;  3SV1 A;  4HDQ A;  2M14 A;  2DTC A;  3PEG A;  3UZT A;  4Z2N A;  1U27 A;  1DRO A;  2D9X A;  2Z4D A;  2DKQ A;  2J59 M;  4D0N B;  5C5B A;  4A6F B;  4HAT B;  3WA0 A;  1K5G B;  2YT2 A;  3TVV A;  1V88 A;  2QKM A;  1TXD A;  1H10 A;  1IRS A;  3FVC A;  1X1F A;  2OQB A;  4GXB A;  2L1C A;  3MPX A;  1X1G A;  2I5C A;  4OT1 A;  2K00 A;  1NI2 A;  4IAP A;  1EGX A;  1AQC A;  1K5D B;  3FSS A;  2KIE A;  1FOE A;  1WVH A;  3PVW A;  2DYQ A;  4K17 A;  3DCX A;  4GMV A;  4KHA A;  5J3Y A;  1UNR A;  2GJY A;  2Z14 A;  2RVB B;  1DDM A;  2H7D A;  1SHC A;  2G35 A;  4GNK B;  1V5M A;  1GC6 A;  5KCV A;  1TQZ A;  5KQ4 A;  4KHB A;  3HW2 B;  4HAZ B;  2UZS A;  5CLL B;  1V89 A;  1FHW A;  2Z13 A;  3T06 A;  1WI1 A;  2W2X C;  1UNP A;  5C5B B;  2VSZ A;  3A98 B;  4KAX B;  4GN1 A;  1FGY A;  2LOZ A;  3ODW A;  1QQG A;  1UPQ A;  2DYN A;  3A8P A;  1V5P A;  2D10 A;  4EJN A;  1NTV A;  3D8F A;  1BAK A;  2W2X D;  2D4Q A;  1V5U A;  2Y7B A;  2Z0Q A;  4GZU A;  1UEF A;  5JHH A;  2I1J A;  2MKR A;  3HQC A;  4CHJ A;  2DHK A;  5I2M A;  5IRS A;  2QKL A;  3ULB A;  5D3X A;  1GC7 A;  1DYN A;  1MIX A;  3DXC A;  4HAX B;  1P6S A;  4YL8 A;  3IVF A;  2ROV A;  2DFK A;  2EMT A;  2BCJ A;  4KHB B;  5C16 A;  2K49 A;  1UPR A;  2MFQ A;  1NTY A;  2X18 A;  1U5D A;  3KRW A;  2GCJ A;  2VRW B;  2HTH B;  4MY6 A;  4DX9 0;  1X05 A;  4HHV A;  3FM8 C;  1W1G A;  1H4R A;  2R0D A;  1MAI A;  2K8E A;  4MK0 A;  2D11 A;  3OAN A;  1MK7 B;  1ZSQ A;  2YRY A;  3HIE A;  3ZDT A;  2NZ8 B;  1XR0 B;  4F7U P;  1U5E A;  2YS1 A;  4K2O A;  5C79 A;  1Z87 A;  1ZM0 A;  3B77 A;  2COD A;  1X11 A;  2KR0 A;  4NY0 A;  4A6K A;  4HB0 B;  4GMX B;  5DH9 B;  1ZVR A;  2YT1 A;  3PZD A;  1ISN A;  2ZKM X;  5EFX A;  1FHO A;  2XQN M;  4EKU A;  2P0F A;  4TKN A;  1FHX A;  4EMO A;  3LJU X;  5JLJ B;  1XCG A;  5LG4 B;  3P7Z A;  1ZC4 B;  4DXA B; 
#chains in the Genus database with same CATH homology
 2YF0 A;  4YON A;  5HE0 A;  2RGN B;  2YS5 A;  1RJ2 A;  4K2P A;  1WJ1 A;  1U2B A;  5HE3 A;  5I2S A;  4IFS A;  1E5W A;  2EJ8 A;  1EAZ A;  1KZ7 A;  2COF A;  4HB4 B;  3VIA A;  4HB3 B;  1WG7 A;  5J3T A;  4B6H A;  1X86 A;  1U5F A;  5DHF B;  2CRF A;  1LB1 A;  3F5R A;  1Q67 A;  4DBB A;  1M7R A;  4C0A A;  3SO6 A;  2UVM A;  4HSI A;  1NU2 A;  2RNR B;  4CYE A;  2Z0P A;  1B55 A;  4PQ0 A;  3ODO A;  2YS3 A;  4WJ7 A;  3KRX A;  2OTX A;  2J0J A;  1KI1 B;  1PLS A;  2KUP A;  4IOY X;  4A5K A;  3PVU A;  2P0D A;  3FEH A;  1OQN A;  2M38 A;  1SGH A;  5LON B;  5D3Y A;  2YSZ A;  4HB2 B;  1P3R A;  3M1I B;  3QWM A;  5J3Q A;  5HE1 A;  3PVL A;  1P5T A;  2D9Z A;  2FJU B;  4QJ5 B;  1KZG A;  1RRP B;  4XWX A;  3TO1 A;  4NSW A;  2DKP A;  3VOQ A;  4Y94 A;  4ZRK A;  3GYP A;  4A6H A;  2LKO A;  3A58 A;  3G9W A;  3ZVR A;  1LW3 A;  3SNH A;  1FGZ A;  3PSC A;  2D9V A;  2D2Q A;  2R09 A;  2EMS A;  2ROZ B;  4BBK A;  4GOU A;  1AWE A;  1V61 A;  4DX8 A;  3F0W A;  1MPH A;  5M4Y B;  1BTN A;  5LOP B;  4QJ3 B;  3U8Z A;  3QIJ A;  1MKE A;  1WGQ A;  1UNQ A;  3DXE A;  5KQ1 A;  1BTK A;  1MK9 B;  2HE7 A;  5JP4 A;  3O96 A;  2N23 A;  2PZ1 A;  2CY5 A;  1ZYI A;  3AJ4 A;  1M7E A;  3SYX A;  3U12 A;  3TFM A;  1Y19 B;  2D9W A;  3NW8 A;  5L81 A;  4DIX A;  2ELB A;  2LG1 A;  1OMW A;  4CHM A;  2NBV A;  3NWD A;  1Y5O A;  1FB8 A;  2CY4 A;  2YT0 A;  2COC A;  3KSY A;  3ULC A;  5JHG A;  2ADZ A;  4OSN A;  4H8S A;  3ML4 A;  4P7I A;  4QXA B;  4HAU B;  3SUZ A;  2COA A;  2J0M A;  3D8D A;  5D27 A;  3CXB B;  2ELA A;  2IFS A;  4GPT B;  2J0K A;  2VKI A;  1GG3 A;  3KZ1 A;  3RCP A;  4WSF A;  4K81 A;  1I7A A;  2RSG A;  1W1H A;  3GYO A;  2AL6 A;  1WGU A;  2K2U A;  1XX0 A;  3NWA A;  1J19 A;  2DHI A;  5C6R A;  4D6W A;  2N0Y A;  2R2Y A;  3AU5 A;  4QJ4 B;  2AEH A;  3HK0 A;  3CIK A;  2DLW A;  3WYF B;  2Z59 A;  1OY2 A;  5DI9 B;  2P8V A;  4ZRI A;  1EVH A;  2DX5 A;  2L2I A;  3OHM B;  2IYB A;  2YVC A;  2RUK B;  2Y8F A;  3TW1 A;  2I5F A;  2GS0 A;  4CSQ A;  1XOD A;  1W1D A;  4MT7 A;  3N7C A;  2E2X A;  2KGX B;  2EC1 A;  1N3H A;  3ODX A;  2DA0 A;  2DHJ A;  2K2J A;  4HDO A;  3P6A A;  3DXD A;  3U7D A;  4HAW B;  2RLO A;  3PP2 A;  5D3W A;  2Y8G A;  3NSU A;  4F7G A;  3TCA A;  2D9Y A;  1MIZ B;  5HE2 A;  2MWN B;  4KHO A;  1FAO A;  2RRF A;  2P0H A;  1XD4 A;  4ZRJ A;  4Z2M B;  1J0W A;  1U29 A;  5FI0 A;  5DIF B;  1DBH A;  1DDV A;  2KUQ A;  1BWN A;  2DX1 A;  3AU4 A;  2Z0O A;  3QBV B;  5DHA B;  3BIN A;  2LUL A;  2LYD A;  1I2H A;  3KY9 A;  2UZR A;  4PNK A;  3A8Q A;  1PMS A;  1DDW A;  1WJM A;  3D8E A;  3BJI A;  5D3V A;  4A6F A;  4L6E A;  1EF1 A;  1TJ6 A;  2CAY A;  2KCJ A;  2FJL A;  1XKE A;  1ZC3 B;  2MDX A;  5FI1 A;  2Q13 A;  2DN6 A;  4HAV B;  1U5G A;  4WVF B;  2I1K A;  2H7E A;  4TYZ A;  4F7H A;  3PG7 A;  3X23 A;  2V76 A;  4HAY B;  2LOX A;  3V5W A;  5GOW B;  1QC6 A;  4KVG B;  2W2W A;  2JP2 A;  4L1R A;  1PFJ A;  2ZPY A;  2GUM A;  5CLQ B;  3NWF A;  3MDB C;  2KIG A;  2NMB A;  2GCL A;  3SV1 A;  4HDQ A;  2M14 A;  2DTC A;  3PEG A;  3UZT A;  4Z2N A;  1U27 A;  1DRO A;  2D9X A;  2Z4D A;  2DKQ A;  2J59 M;  4D0N B;  5C5B A;  4A6F B;  4HAT B;  3WA0 A;  1K5G B;  2YT2 A;  3TVV A;  1V88 A;  2QKM A;  1TXD A;  1H10 A;  1IRS A;  3FVC A;  1X1F A;  2OQB A;  4GXB A;  2L1C A;  3MPX A;  1X1G A;  2I5C A;  4OT1 A;  2K00 A;  1NI2 A;  4IAP A;  1EGX A;  1AQC A;  1K5D B;  3FSS A;  2KIE A;  1FOE A;  1WVH A;  3PVW A;  2DYQ A;  4K17 A;  4KHA A;  4GMV A;  5J3Y A;  1UNR A;  2GJY A;  2Z14 A;  2RVB B;  1DDM A;  2H7D A;  1SHC A;  2G35 A;  4GNK B;  1V5M A;  1GC6 A;  5KCV A;  1TQZ A;  5KQ4 A;  4KHB A;  3HW2 B;  4HAZ B;  2UZS A;  5CLL B;  1V89 A;  1FHW A;  2Z13 A;  3T06 A;  1WI1 A;  2W2X C;  1UNP A;  5C5B B;  2VSZ A;  3A98 B;  4KAX B;  4GN1 A;  1FGY A;  2LOZ A;  3ODW A;  1QQG A;  1UPQ A;  2DYN A;  3A8P A;  1V5P A;  2D10 A;  4EJN A;  1NTV A;  3D8F A;  1BAK A;  2W2X D;  2D4Q A;  1V5U A;  2Y7B A;  2Z0Q A;  4GZU A;  1UEF A;  5JHH A;  2I1J A;  2MKR A;  3HQC A;  4CHJ A;  2DHK A;  5I2M A;  5IRS A;  2QKL A;  3ULB A;  5D3X A;  1GC7 A;  1DYN A;  1MIX A;  3DXC A;  4HAX B;  1P6S A;  4YL8 A;  3IVF A;  2ROV A;  2DFK A;  2EMT A;  2BCJ A;  4KHB B;  5C16 A;  2K49 A;  1UPR A;  2MFQ A;  1NTY A;  2X18 A;  1U5D A;  3KRW A;  2GCJ A;  2VRW B;  2HTH B;  4MY6 A;  4DX9 0;  1X05 A;  4HHV A;  3FM8 C;  1W1G A;  1H4R A;  2R0D A;  1MAI A;  2K8E A;  4MK0 A;  2D11 A;  3OAN A;  1MK7 B;  1ZSQ A;  2YRY A;  3HIE A;  3ZDT A;  2NZ8 B;  1XR0 B;  4F7U P;  1U5E A;  2YS1 A;  4K2O A;  5C79 A;  1Z87 A;  1ZM0 A;  2COD A;  1X11 A;  2KR0 A;  4NY0 A;  4A6K A;  4HB0 B;  4GMX B;  5DH9 B;  1ZVR A;  2YT1 A;  3PZD A;  1ISN A;  2ZKM X;  5EFX A;  1FHO A;  2XQN M;  4EKU A;  2P0F A;  4TKN A;  1FHX A;  4EMO A;  3LJU X;  5JLJ B;  1XCG A;  5LG4 B;  3P7Z A;  1ZC4 B;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...