3FSSA

Structure of the tandem ph domains of rtt106
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 57
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2009-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3fssA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3fssA01
2MWNB 2COCA 3BINA 4MT7A 4HAWB 2IFSA 3ODWA 3PZDA 2V76A 1X11A 1E5WA 4TYZA 1DROA 5L81A 3KRWA 3U7DA 1PMSA 2VKIA 2CODA 2D10A 1U5EA 2P0HA 5KCVA 3DXDA 2I1JA 4H8SA 1UNPA 3ODOA 3QIJA 3M1IB 2YF0A 4A6FB 3GYPA 1WVHA 4MK0A 3GYOA 4BBKA 4A6HA 1H10A 1W1GA 5FI0A 2ELBA 4YONA 1MIXA 3TO1A 2LOXA 3SUZA 5D27A 3T06A 1GC6A 1MAIA 2YT0A 2DKQA 1UEFA 3U8ZA 1V5PA 3TW1A 3MDBC 1V5UA 4ZRKA 2LOZA 4HAVB 4C0AA 1Y5OA 4HB3B 1DBHA 4EJNA 1Y19B 2Z0PA 2DHIA 5C16A 1V61A 4HDOA 2Q13A 1LB1A 2ZPYA 4WJ7A 1TJ6A 1DDVA 2DX1A 3P7ZA 2CY4A 4B6HA 1FHOA 3TVVA 2BCJA 2DA0A 3ZDTA 2H7EA 2MKRA 3UZTA 2YT1A 2P8VA 1RJ2A 4EMOA 1WGUA 2OQBA 1UPQA 1M7RA 2FJLA 1SGHA 3PVWA 2KCJA 2W2WA 4Z2NA 3SYXA 5KQ1A 1FGZA 1GG3A 1XD4A 2Y7BA 5C5BB 5HE2A 1N3HA 2LYDA 2DX5A 5JLJB 2J59M 4KHOA 5C79A 2EJ8A 2DHJA 4IAPA 1KZGA 4K2OA 2D9YA 3BJIA 3WA0A 1WJMA 2I1KA 2D2QA 1K5DB 2HE7A 2AEHA 4IFSA 1OMWA 2LULA 5DI9B 2Y8FA 2KUPA 2D9WA 4KHAA 4HB0B 1W1DA 4MY6A 5DIFB 3KZ1A 2DTCA 2JP2A 2MDXA 4KHBB 1AQCA 3QBVB 2GCJA 3D8EA 1NI2A 4GZUA 1AWEA 2HTHB 1Z87A 2E2XA 3FM8C 3NSUA 2GCLA 2DN6A 3A98B 5C5BA 2EMTA 2COAA 3F0WA 4F7UP 2GS0A 2K2JA 2R09A 1EAZA 2YS5A 4KAXB 4HATB 5CLLB 1FOEA 4IOYX 5DH9B 2RLOA 1EF1A 2RUKB 1UNQA 4ZRJA 2LG1A 4CHMA 2IYBA 5GOWB 3AU4A 5D3YA 2Z0OA 1BWNA 3HW2B 2QKLA 4F7GA 5LONB 2L2IA 3O96A 4L6EA 1BTKA 3ML4A 1ZC3B 3TCAA 1FAOA 1BAKA 1WG7A 2D9ZA 3KY9A 3ODXA 3SO6A 1I2HA 1OY2A 5HE3A 3TFMA 3PEGA 3SNHA 5KQ4A 4F7HA 2UVMA 2D4QA 1ZM0A 1P5TA 5D3VA 4A6KA 1Q67A 4WVFB 2M14A 2ROVA 3OANA 2YS1A 1ISNA 4GMVA 3ULBA 4A6FA 3A8PA 2J0KA 1TXDA 2PZ1A 1KI1B 2CRFA 4K17A 1OQNA 2OTXA 3LJUX 2CAYA 1QQGA 4HDQA 4HAZB 1FHWA 3FSSA 4ZRIA 4XWXA 4GN1A 1XCGA 3MPXA 1KZ7A 1NTYA 2VSZA 4DXAB 2K00A 2QKMA 3CXBB 4HB2B 1U27A 4P7IA 2K2UA 5JHGA 5EFXA 3A8QA 2R0DA 2ROZB 1U29A 2EC1A 5D3WA 4HHVA 2G35A 1MK9B 3IVFA 1MK7B 1X86A 3KSYA 4HAUB 4Z2MB 4DBBA 4K2PA 1W1HA 4PNKA 5JP4A 2DLWA 2NZ8B 1MPHA 2YSZA 3HQCA 1XX0A 3PVLA 1TQZA 4GMXB 1P6SA 1U5GA 5LOPB 1GC7A 5DHAB 2AL6A 1ZSQA 2DFKA 3SV1A 2CY5A 4GXBA 4PQ0A 4YL8A 1K5GB 1IRSA 4GPTB 1NU2A 3HK0A 2X18A 1FGYA 2H7DA 1UNRA 1NTVA 4NSWA 2DHKA 4CHJA 1BTNA 5JHHA 1DDMA 1PLSA 4NY0A 5CLQB 1U5DA 2RGNB 3D8FA 1EVHA 4HAXB 2RSGA 1U2BA 4DX8A 2I5FA 3PP2A 3G9WA 1WJ1A 3N7CA 1UPRA 2DKPA 2J0JA 5J3TA 2UZRA 2RNRB 1WGQA 3AJ4A 1P3RA 2N0YA 4D0NB 5DHFB 3KRXA 1XODA 5HE0A 1QC6A 3ULCA 1SHCA 3DXCA 1H4RA 3WYFB 1EGXA 3X23A 3V5WA 1PFJA 2P0FA 4HAYB 1XR0B 1LW3A 2ADZA 4K81A 1MIZB 2YVCA 1X1FA 1U5FA 1V88A 1RRPB 2RVBB 5C6RA 1J0WA 1I7AA 2ELAA 3F5RA 3P6AA 1DDWA 2D9VA 2UZSA 2P0DA 2M38A 2GJYA 2D9XA 3PSCA 2LKOA 1J19A 1DYNA 3ZVRA 4A5KA 2COFA 3D8DA 1FHXA 1WI1A 2VRWB 1X05A 5HE1A 4TKNA 2EMSA 1MKEA 3RCPA 4WSFA 2Z0QA 3VIAA 1ZVRA 4KVGB 5FI1A 2NMBA 2Y8GA 3PVUA 2YS3A 1B55A 1V5MA 5D3XA 2L1CA 2YRYA 1M7EA 5J3YA 2XQNM 2DYNA 2DYQA 3VOQA 2MFQA 2W2XD 1FB8A 4DX90 1V89A 1ZC4B 3PG7A 2I5CA 1XKEA 2J0MA 2D11A 3AU5A 3DXEA 3QWMA 4HB4B 2N23A 3CIKA 3FEHA 2W2XC 4CYEA 4EKUA 5J3QA 4Y94A 2KGXB 1X1GA
chains in the Genus database with same CATH superfamily
2MWNB 2COCA 3BINA 4MT7A 4GNKB 4HAWB 2IFSA 2Z59A 3ODWA 3PZDA 2V76A 1X11A 1E5WA 4TYZA 1DROA 2K8EA 5L81A 3KRWA 3U7DA 1PMSA 2VKIA 2CODA 2D10A 1U5EA 2P0HA 5KCVA 3DXDA 2I1JA 2Z4DA 4H8SA 4GOUA 1UNPA 3ODOA 3QIJA 3M1IB 2YF0A 4A6FB 3GYPA 1WVHA 4MK0A 3GYOA 4BBKA 4A6HA 1H10A 4QXAB 1W1GA 5FI0A 2ELBA 4YONA 1MIXA 4OSNA 3TO1A 2LOXA 3SUZA 4CSQA 5D27A 3T06A 1GC6A 1MAIA 2YT0A 2DKQA 1UEFA 3HIEA 3U8ZA 1V5PA 3TW1A 3MDBC 1V5UA 4ZRKA 2LOZA 4HAVB 2K49A 4C0AA 1Y5OA 4HB3B 1DBHA 4EJNA 2R2YA 1Y19B 2Z0PA 2DHIA 5C16A 3NWDA 1V61A 4HDOA 4QJ3B 2Q13A 1LB1A 2ZPYA 4WJ7A 1TJ6A 1DDVA 2DX1A 3P7ZA 2CY4A 4B6HA 2NBVA 1FHOA 3TVVA 2BCJA 2DA0A 3ZDTA 2H7EA 2MKRA 3UZTA 2YT1A 2P8VA 1RJ2A 4EMOA 1WGUA 2OQBA 1UPQA 1M7RA 2FJLA 1SGHA 3PVWA 2KCJA 2W2WA 4Z2NA 3SYXA 5KQ1A 1FGZA 1GG3A 1XD4A 2Y7BA 4QJ4B 5C5BB 5HE2A 1N3HA 2LYDA 2DX5A 5JLJB 2KIEA 2J59M 4KHOA 5C79A 2GUMA 2EJ8A 2DHJA 4IAPA 1KZGA 3NWAA 4K2OA 2D9YA 3BJIA 3WA0A 1WJMA 2I1KA 2D2QA 1K5DB 2HE7A 2AEHA 4IFSA 1OMWA 2LULA 3A58A 5DI9B 4L1RA 2Y8FA 2KUPA 2D9WA 4DIXA 4KHAA 4HB0B 1W1DA 4MY6A 5DIFB 3KZ1A 2DTCA 2JP2A 2MDXA 4KHBB 1AQCA 3QBVB 2GCJA 3D8EA 1NI2A 4GZUA 1AWEA 5LG4B 2HTHB 1Z87A 2E2XA 3FM8C 3NSUA 2GCLA 2DN6A 3A98B 3FVCA 2EMTA 5C5BA 2COAA 3U12A 3F0WA 4F7UP 2GS0A 2K2JA 2R09A 1EAZA 2YS5A 4KAXB 4HATB 5CLLB 1FOEA 4IOYX 5DH9B 2RLOA 1EF1A 2RUKB 2RRFA 1UNQA 3NW8A 2LG1A 4ZRJA 4CHMA 5IRSA 2IYBA 5GOWB 3AU4A 5D3YA 2Z0OA 1BWNA 3HW2B 2QKLA 4F7GA 5LONB 2L2IA 3O96A 4L6EA 1BTKA 3ML4A 1ZC3B 3TCAA 1FAOA 1BAKA 1WG7A 2D9ZA 3KY9A 3ODXA 4KHBA 3SO6A 1I2HA 1OY2A 5HE3A 2Z13A 3TFMA 3PEGA 3SNHA 5KQ4A 4F7HA 2UVMA 2D4QA 1ZM0A 1P5TA 5D3VA 4A6KA 1Q67A 4WVFB 2M14A 2ROVA 3OANA 2YS1A 1ISNA 4GMVA 3ULBA 4A6FA 3A8PA 5I2MA 2J0KA 1TXDA 2PZ1A 1KI1B 2CRFA 4K17A 1OQNA 2OTXA 3LJUX 2CAYA 1QQGA 4HDQA 4HAZB 1FHWA 3FSSA 4ZRIA 4XWXA 4GN1A 1XCGA 3MPXA 1KZ7A 1NTYA 3HSAA 2VSZA 4DXAB 2K00A 2QKMA 3CXBB 4HB2B 2KUQA 5I2SA 5M4YB 1U27A 4P7IA 2K2UA 5JHGA 5EFXA 3A8QA 2R0DA 2ROZB 1U29A 2EC1A 3B77A 5D3WA 4HHVA 2G35A 1MK9B 3OHMB 3IVFA 1MK7B 1X86A 3KSYA 4HAUB 4Z2MB 4DBBA 4K2PA 1T77A 1W1HA 4PNKA 5JP4A 2DLWA 2NZ8B 1MPHA 2YSZA 3HQCA 1XX0A 3PVLA 1TQZA 4GMXB 1P6SA 1U5GA 5LOPB 1GC7A 5DHAB 2AL6A 1ZSQA 2DFKA 3SV1A 2CY5A 4GXBA 4PQ0A 4YL8A 1K5GB 1IRSA 4GPTB 3HK0A 1MI1A 1NU2A 2X18A 4QJ5B 1FGYA 2H7DA 1UNRA 1NTVA 4NSWA 2DHKA 4CHJA 1BTNA 5JHHA 1DDMA 3NWFA 1PLSA 4NY0A 5CLQB 1U5DA 2RGNB 3D8FA 1EVHA 4HAXB 2RSGA 1U2BA 4DX8A 2I5FA 3PP2A 3G9WA 1WJ1A 3N7CA 1UPRA 2DKPA 2J0JA 5J3TA 2FJUB 2UZRA 1ZYIA 2RNRB 1WGQA 3AJ4A 1P3RA 2N0YA 4D0NB 2KIGA 5DHFB 3KRXA 1XODA 5HE0A 1QC6A 3ULCA 1SHCA 3DXCA 1H4RA 3WYFB 1EGXA 3X23A 3V5WA 1PFJA 2P0FA 4HAYB 1XR0B 1LW3A 2ADZA 4OT1A 4K81A 1MIZB 2YVCA 1X1FA 2ZKMX 1U5FA 1V88A 1RRPB 2RVBB 5C6RA 1J0WA 1I7AA 2ELAA 3F5RA 3P6AA 1DDWA 2D9VA 2KR0A 2UZSA 2P0DA 2M38A 2GJYA 2D9XA 3PSCA 2LKOA 1J19A 1DYNA 3ZVRA 4A5KA 2COFA 3D8DA 1FHXA 1WI1A 2VRWB 1X05A 5HE1A 4TKNA 2EMSA 1MKEA 3RCPA 4WSFA 2Z0QA 3VIAA 2YT2A 1ZVRA 4KVGB 4HSIA 5FI1A 2NMBA 2Y8GA 3PVUA 2YS3A 1B55A 1V5MA 3DCXA 5D3XA 2L1CA 2YRYA 4D6WA 1M7EA 5J3YA 2XQNM 2DYNA 2DYQA 3VOQA 2MFQA 2W2XD 1FB8A 4DX90 1V89A 1ZC4B 3PG7A 2I5CA 2Z14A 1XKEA 2J0MA 2D11A 3AU5A 3DXEA 3QWMA 4HB4B 2N23A 3CIKA 3FEHA 2W2XC 4CYEA 4EKUA 5J3QA 4Y94A 2KGXB 1X1GA
chains in the Genus database with same CATH topology
2MWNB 2COCA 3BINA 4MT7A 4GNKB 4HAWB 2IFSA 2Z59A 3ODWA 3PZDA 2V76A 1X11A 1E5WA 4TYZA 1DROA 2K8EA 5L81A 3KRWA 3U7DA 1PMSA 2VKIA 2CODA 2D10A 1U5EA 2P0HA 5KCVA 3DXDA 2I1JA 4H8SA 2Z4DA 4GOUA 1UNPA 3ODOA 3QIJA 3M1IB 2YF0A 4A6FB 3GYPA 1WVHA 4MK0A 3GYOA 4BBKA 4A6HA 1H10A 4QXAB 1W1GA 5FI0A 2ELBA 4YONA 1MIXA 4OSNA 3TO1A 2LOXA 3SUZA 4CSQA 5D27A 3T06A 1GC6A 1MAIA 2YT0A 2DKQA 1UEFA 3HIEA 3U8ZA 1V5PA 3TW1A 3MDBC 1V5UA 4ZRKA 2LOZA 4HAVB 2K49A 4C0AA 1Y5OA 4HB3B 1DBHA 4EJNA 2R2YA 1Y19B 2Z0PA 2DHIA 5C16A 3NWDA 1V61A 4HDOA 4QJ3B 2Q13A 1LB1A 2ZPYA 4WJ7A 1TJ6A 1DDVA 2DX1A 3P7ZA 2CY4A 4B6HA 2NBVA 1FHOA 3TVVA 2BCJA 2DA0A 3ZDTA 2H7EA 2MKRA 3UZTA 2YT1A 2P8VA 1RJ2A 4EMOA 1WGUA 2OQBA 1UPQA 1M7RA 2FJLA 1SGHA 3PVWA 2KCJA 2W2WA 4Z2NA 3SYXA 5KQ1A 1FGZA 1GG3A 1XD4A 2Y7BA 4QJ4B 5C5BB 5HE2A 1N3HA 2LYDA 2DX5A 5JLJB 2KIEA 2J59M 4KHOA 5C79A 2GUMA 2EJ8A 2DHJA 4IAPA 1KZGA 3NWAA 4K2OA 2D9YA 3BJIA 3WA0A 1WJMA 2I1KA 2D2QA 1K5DB 2HE7A 2AEHA 4IFSA 1OMWA 2LULA 3A58A 5DI9B 4L1RA 2Y8FA 2KUPA 2D9WA 4DIXA 4KHAA 4HB0B 1W1DA 4MY6A 5DIFB 3KZ1A 2DTCA 2JP2A 2MDXA 4KHBB 1AQCA 3QBVB 2GCJA 3D8EA 1NI2A 4GZUA 1AWEA 5LG4B 2HTHB 1Z87A 2E2XA 3FM8C 3NSUA 2GCLA 2DN6A 3A98B 5C5BA 2EMTA 3FVCA 2COAA 3U12A 3F0WA 4F7UP 2GS0A 2K2JA 2R09A 1EAZA 2YS5A 4KAXB 4HATB 5CLLB 1FOEA 4IOYX 5DH9B 2RLOA 1EF1A 2RUKB 2RRFA 1UNQA 4ZRJA 2LG1A 4CHMA 3NW8A 5IRSA 2IYBA 5GOWB 3AU4A 5D3YA 2Z0OA 1BWNA 3HW2B 2QKLA 4F7GA 5LONB 2L2IA 3O96A 4L6EA 1BTKA 3ML4A 1ZC3B 3TCAA 1FAOA 1BAKA 1WG7A 2D9ZA 3KY9A 3ODXA 4KHBA 3SO6A 1I2HA 1OY2A 5HE3A 2Z13A 3TFMA 3PEGA 3SNHA 5KQ4A 4F7HA 2UVMA 2D4QA 1ZM0A 1P5TA 5D3VA 4A6KA 1Q67A 4WVFB 2M14A 2ROVA 3OANA 2YS1A 1ISNA 4GMVA 3ULBA 4A6FA 3A8PA 5I2MA 2J0KA 1TXDA 2PZ1A 1KI1B 2CRFA 4K17A 1OQNA 2OTXA 3LJUX 2CAYA 1QQGA 4HDQA 4HAZB 1FHWA 3FSSA 4ZRIA 4XWXA 4GN1A 1XCGA 3MPXA 1KZ7A 1NTYA 2VSZA 4DXAB 2K00A 2QKMA 3CXBB 4HB2B 2KUQA 5I2SA 5M4YB 1U27A 4P7IA 2K2UA 5JHGA 5EFXA 3A8QA 2R0DA 2ROZB 1U29A 2EC1A 5D3WA 4HHVA 2G35A 1MK9B 3OHMB 3IVFA 1MK7B 1X86A 3KSYA 4HAUB 4Z2MB 4DBBA 4K2PA 1W1HA 4PNKA 5JP4A 2DLWA 2NZ8B 1MPHA 2YSZA 3HQCA 1XX0A 3PVLA 1TQZA 4GMXB 1P6SA 1U5GA 5LOPB 1GC7A 5DHAB 2AL6A 1ZSQA 2DFKA 3SV1A 2CY5A 4GXBA 4PQ0A 4YL8A 1K5GB 1IRSA 4GPTB 1NU2A 3HK0A 2X18A 4QJ5B 1FGYA 2H7DA 1UNRA 1NTVA 4NSWA 2DHKA 4CHJA 1BTNA 5JHHA 1DDMA 3NWFA 1PLSA 4NY0A 5CLQB 1U5DA 2RGNB 3D8FA 1EVHA 4HAXB 2RSGA 1U2BA 4DX8A 2I5FA 3PP2A 3G9WA 1WJ1A 3N7CA 1UPRA 2DKPA 2J0JA 5J3TA 2FJUB 2UZRA 1ZYIA 2RNRB 1WGQA 3AJ4A 1P3RA 2N0YA 4D0NB 2KIGA 5DHFB 3KRXA 1XODA 5HE0A 1QC6A 3ULCA 1SHCA 3DXCA 1H4RA 3WYFB 1EGXA 3X23A 3V5WA 1PFJA 2P0FA 4HAYB 1XR0B 1LW3A 2ADZA 4OT1A 4K81A 1MIZB 2YVCA 1X1FA 2ZKMX 1U5FA 1V88A 1RRPB 2RVBB 5C6RA 1J0WA 1I7AA 2ELAA 3F5RA 3P6AA 1DDWA 2D9VA 2UZSA 2KR0A 2P0DA 2M38A 2GJYA 2D9XA 3PSCA 2LKOA 1J19A 1DYNA 3ZVRA 4A5KA 2COFA 3D8DA 1FHXA 1WI1A 2VRWB 1X05A 5HE1A 4TKNA 2EMSA 1MKEA 3RCPA 4WSFA 2Z0QA 3VIAA 2YT2A 1ZVRA 4KVGB 4HSIA 5FI1A 2NMBA 2Y8GA 3PVUA 2YS3A 1B55A 1V5MA 5D3XA 2L1CA 2YRYA 4D6WA 1M7EA 5J3YA 2XQNM 2DYNA 2DYQA 3VOQA 2MFQA 2W2XD 1FB8A 4DX90 1V89A 1ZC4B 3PG7A 2I5CA 2Z14A 1XKEA 2J0MA 2D11A 3AU5A 3DXEA 3QWMA 4HB4B 2N23A 3CIKA 3FEHA 2W2XC 4CYEA 4EKUA 5J3QA 4Y94A 2KGXB 1X1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWN B;  2COC A;  3BIN A;  4MT7 A;  4HAW B;  2IFS A;  3ODW A;  3PZD A;  2V76 A;  1X11 A;  1E5W A;  4TYZ A;  1DRO A;  5L81 A;  3KRW A;  3U7D A;  1PMS A;  2VKI A;  2COD A;  2D10 A;  1U5E A;  2P0H A;  5KCV A;  3DXD A;  2I1J A;  4H8S A;  1UNP A;  3ODO A;  3QIJ A;  3M1I B;  2YF0 A;  4A6F B;  3GYP A;  1WVH A;  4MK0 A;  3GYO A;  4BBK A;  4A6H A;  1H10 A;  1W1G A;  5FI0 A;  2ELB A;  4YON A;  1MIX A;  3TO1 A;  2LOX A;  3SUZ A;  5D27 A;  3T06 A;  1GC6 A;  1MAI A;  2YT0 A;  2DKQ A;  1UEF A;  3U8Z A;  1V5P A;  3TW1 A;  3MDB C;  1V5U A;  4ZRK A;  2LOZ A;  4HAV B;  4C0A A;  1Y5O A;  4HB3 B;  1DBH A;  4EJN A;  1Y19 B;  2Z0P A;  2DHI A;  5C16 A;  1V61 A;  4HDO A;  2Q13 A;  1LB1 A;  2ZPY A;  4WJ7 A;  1TJ6 A;  1DDV A;  2DX1 A;  3P7Z A;  2CY4 A;  4B6H A;  1FHO A;  3TVV A;  2BCJ A;  2DA0 A;  3ZDT A;  2H7E A;  2MKR A;  3UZT A;  2YT1 A;  2P8V A;  1RJ2 A;  4EMO A;  1WGU A;  2OQB A;  1UPQ A;  1M7R A;  2FJL A;  1SGH A;  3PVW A;  2KCJ A;  2W2W A;  4Z2N A;  3SYX A;  5KQ1 A;  1FGZ A;  1GG3 A;  1XD4 A;  2Y7B A;  5C5B B;  5HE2 A;  1N3H A;  2LYD A;  2DX5 A;  5JLJ B;  2J59 M;  4KHO A;  5C79 A;  2EJ8 A;  2DHJ A;  4IAP A;  1KZG A;  4K2O A;  2D9Y A;  3BJI A;  3WA0 A;  1WJM A;  2I1K A;  2D2Q A;  1K5D B;  2HE7 A;  2AEH A;  4IFS A;  1OMW A;  2LUL A;  5DI9 B;  2Y8F A;  2KUP A;  2D9W A;  4KHA A;  4HB0 B;  1W1D A;  4MY6 A;  5DIF B;  3KZ1 A;  2DTC A;  2JP2 A;  2MDX A;  4KHB B;  1AQC A;  3QBV B;  2GCJ A;  3D8E A;  1NI2 A;  4GZU A;  1AWE A;  2HTH B;  1Z87 A;  2E2X A;  3FM8 C;  3NSU A;  2GCL A;  2DN6 A;  3A98 B;  5C5B A;  2EMT A;  2COA A;  3F0W A;  4F7U P;  2GS0 A;  2K2J A;  2R09 A;  1EAZ A;  2YS5 A;  4KAX B;  4HAT B;  5CLL B;  1FOE A;  4IOY X;  5DH9 B;  2RLO A;  1EF1 A;  2RUK B;  1UNQ A;  4ZRJ A;  2LG1 A;  4CHM A;  2IYB A;  5GOW B;  3AU4 A;  5D3Y A;  2Z0O A;  1BWN A;  3HW2 B;  2QKL A;  4F7G A;  5LON B;  2L2I A;  3O96 A;  4L6E A;  1BTK A;  3ML4 A;  1ZC3 B;  3TCA A;  1FAO A;  1BAK A;  1WG7 A;  2D9Z A;  3KY9 A;  3ODX A;  3SO6 A;  1I2H A;  1OY2 A;  5HE3 A;  3TFM A;  3PEG A;  3SNH A;  5KQ4 A;  4F7H A;  2UVM A;  2D4Q A;  1ZM0 A;  1P5T A;  5D3V A;  4A6K A;  1Q67 A;  4WVF B;  2M14 A;  2ROV A;  3OAN A;  2YS1 A;  1ISN A;  4GMV A;  3ULB A;  4A6F A;  3A8P A;  2J0K A;  1TXD A;  2PZ1 A;  1KI1 B;  2CRF A;  4K17 A;  1OQN A;  2OTX A;  3LJU X;  2CAY A;  1QQG A;  4HDQ A;  4HAZ B;  1FHW A;  3FSS A;  4ZRI A;  4XWX A;  4GN1 A;  1XCG A;  3MPX A;  1KZ7 A;  1NTY A;  2VSZ A;  4DXA B;  2K00 A;  2QKM A;  3CXB B;  4HB2 B;  1U27 A;  4P7I A;  2K2U A;  5JHG A;  5EFX A;  3A8Q A;  2R0D A;  2ROZ B;  1U29 A;  2EC1 A;  5D3W A;  4HHV A;  2G35 A;  1MK9 B;  3IVF A;  1MK7 B;  1X86 A;  3KSY A;  4HAU B;  4Z2M B;  4DBB A;  4K2P A;  1W1H A;  4PNK A;  5JP4 A;  2DLW A;  2NZ8 B;  1MPH A;  2YSZ A;  3HQC A;  1XX0 A;  3PVL A;  1TQZ A;  4GMX B;  1P6S A;  1U5G A;  5LOP B;  1GC7 A;  5DHA B;  2AL6 A;  1ZSQ A;  2DFK A;  3SV1 A;  2CY5 A;  4GXB A;  4PQ0 A;  4YL8 A;  1K5G B;  1IRS A;  4GPT B;  1NU2 A;  3HK0 A;  2X18 A;  1FGY A;  2H7D A;  1UNR A;  1NTV A;  4NSW A;  2DHK A;  4CHJ A;  1BTN A;  5JHH A;  1DDM A;  1PLS A;  4NY0 A;  5CLQ B;  1U5D A;  2RGN B;  3D8F A;  1EVH A;  4HAX B;  2RSG A;  1U2B A;  4DX8 A;  2I5F A;  3PP2 A;  3G9W A;  1WJ1 A;  3N7C A;  1UPR A;  2DKP A;  2J0J A;  5J3T A;  2UZR A;  2RNR B;  1WGQ A;  3AJ4 A;  1P3R A;  2N0Y A;  4D0N B;  5DHF B;  3KRX A;  1XOD A;  5HE0 A;  1QC6 A;  3ULC A;  1SHC A;  3DXC A;  1H4R A;  3WYF B;  1EGX A;  3X23 A;  3V5W A;  1PFJ A;  2P0F A;  4HAY B;  1XR0 B;  1LW3 A;  2ADZ A;  4K81 A;  1MIZ B;  2YVC A;  1X1F A;  1U5F A;  1V88 A;  1RRP B;  2RVB B;  5C6R A;  1J0W A;  1I7A A;  2ELA A;  3F5R A;  3P6A A;  1DDW A;  2D9V A;  2UZS A;  2P0D A;  2M38 A;  2GJY A;  2D9X A;  3PSC A;  2LKO A;  1J19 A;  1DYN A;  3ZVR A;  4A5K A;  2COF A;  3D8D A;  1FHX A;  1WI1 A;  2VRW B;  1X05 A;  5HE1 A;  4TKN A;  2EMS A;  1MKE A;  3RCP A;  4WSF A;  2Z0Q A;  3VIA A;  1ZVR A;  4KVG B;  5FI1 A;  2NMB A;  2Y8G A;  3PVU A;  2YS3 A;  1B55 A;  1V5M A;  5D3X A;  2L1C A;  2YRY A;  1M7E A;  5J3Y A;  2XQN M;  2DYN A;  2DYQ A;  3VOQ A;  2MFQ A;  2W2X D;  1FB8 A;  4DX9 0;  1V89 A;  1ZC4 B;  3PG7 A;  2I5C A;  1XKE A;  2J0M A;  2D11 A;  3AU5 A;  3DXE A;  3QWM A;  4HB4 B;  2N23 A;  3CIK A;  3FEH A;  2W2X C;  4CYE A;  4EKU A;  5J3Q A;  4Y94 A;  2KGX B;  1X1G A; 
#chains in the Genus database with same CATH topology
 2MWN B;  2COC A;  3BIN A;  4MT7 A;  4GNK B;  4HAW B;  2IFS A;  2Z59 A;  3ODW A;  3PZD A;  2V76 A;  1X11 A;  1E5W A;  4TYZ A;  1DRO A;  2K8E A;  5L81 A;  3KRW A;  3U7D A;  1PMS A;  2VKI A;  2COD A;  2D10 A;  1U5E A;  2P0H A;  5KCV A;  3DXD A;  2I1J A;  2Z4D A;  4H8S A;  4GOU A;  1UNP A;  3ODO A;  3QIJ A;  3M1I B;  2YF0 A;  4A6F B;  3GYP A;  1WVH A;  4MK0 A;  3GYO A;  4BBK A;  4A6H A;  1H10 A;  4QXA B;  1W1G A;  5FI0 A;  2ELB A;  4YON A;  1MIX A;  4OSN A;  3TO1 A;  2LOX A;  3SUZ A;  4CSQ A;  5D27 A;  3T06 A;  1GC6 A;  1MAI A;  2YT0 A;  2DKQ A;  1UEF A;  3HIE A;  3U8Z A;  1V5P A;  3TW1 A;  3MDB C;  1V5U A;  4ZRK A;  2LOZ A;  4HAV B;  2K49 A;  4C0A A;  1Y5O A;  4HB3 B;  1DBH A;  4EJN A;  2R2Y A;  1Y19 B;  2Z0P A;  2DHI A;  5C16 A;  3NWD A;  1V61 A;  4HDO A;  4QJ3 B;  2Q13 A;  1LB1 A;  2ZPY A;  4WJ7 A;  1TJ6 A;  1DDV A;  2DX1 A;  3P7Z A;  2CY4 A;  4B6H A;  2NBV A;  1FHO A;  3TVV A;  2BCJ A;  2DA0 A;  3ZDT A;  2H7E A;  2MKR A;  3UZT A;  2YT1 A;  2P8V A;  1RJ2 A;  4EMO A;  1WGU A;  2OQB A;  1UPQ A;  1M7R A;  2FJL A;  1SGH A;  3PVW A;  2KCJ A;  2W2W A;  4Z2N A;  3SYX A;  5KQ1 A;  1FGZ A;  1GG3 A;  1XD4 A;  2Y7B A;  4QJ4 B;  5C5B B;  5HE2 A;  1N3H A;  2LYD A;  2DX5 A;  5JLJ B;  2KIE A;  2J59 M;  4KHO A;  5C79 A;  2GUM A;  2EJ8 A;  2DHJ A;  4IAP A;  1KZG A;  3NWA A;  4K2O A;  2D9Y A;  3BJI A;  3WA0 A;  1WJM A;  2I1K A;  2D2Q A;  1K5D B;  2HE7 A;  2AEH A;  4IFS A;  1OMW A;  2LUL A;  3A58 A;  5DI9 B;  4L1R A;  2Y8F A;  2KUP A;  2D9W A;  4DIX A;  4KHA A;  4HB0 B;  1W1D A;  4MY6 A;  5DIF B;  3KZ1 A;  2DTC A;  2JP2 A;  2MDX A;  4KHB B;  1AQC A;  3QBV B;  2GCJ A;  3D8E A;  1NI2 A;  4GZU A;  1AWE A;  5LG4 B;  2HTH B;  1Z87 A;  2E2X A;  3FM8 C;  3NSU A;  2GCL A;  2DN6 A;  3A98 B;  3FVC A;  2EMT A;  5C5B A;  2COA A;  3U12 A;  3F0W A;  4F7U P;  2GS0 A;  2K2J A;  2R09 A;  1EAZ A;  2YS5 A;  4KAX B;  4HAT B;  5CLL B;  1FOE A;  4IOY X;  5DH9 B;  2RLO A;  1EF1 A;  2RUK B;  2RRF A;  1UNQ A;  3NW8 A;  2LG1 A;  4ZRJ A;  4CHM A;  5IRS A;  2IYB A;  5GOW B;  3AU4 A;  5D3Y A;  2Z0O A;  1BWN A;  3HW2 B;  2QKL A;  4F7G A;  5LON B;  2L2I A;  3O96 A;  4L6E A;  1BTK A;  3ML4 A;  1ZC3 B;  3TCA A;  1FAO A;  1BAK A;  1WG7 A;  2D9Z A;  3KY9 A;  3ODX A;  4KHB A;  3SO6 A;  1I2H A;  1OY2 A;  5HE3 A;  2Z13 A;  3TFM A;  3PEG A;  3SNH A;  5KQ4 A;  4F7H A;  2UVM A;  2D4Q A;  1ZM0 A;  1P5T A;  5D3V A;  4A6K A;  1Q67 A;  4WVF B;  2M14 A;  2ROV A;  3OAN A;  2YS1 A;  1ISN A;  4GMV A;  3ULB A;  4A6F A;  3A8P A;  5I2M A;  2J0K A;  1TXD A;  2PZ1 A;  1KI1 B;  2CRF A;  4K17 A;  1OQN A;  2OTX A;  3LJU X;  2CAY A;  1QQG A;  4HDQ A;  4HAZ B;  1FHW A;  3FSS A;  4ZRI A;  4XWX A;  4GN1 A;  1XCG A;  3MPX A;  1KZ7 A;  1NTY A;  3HSA A;  2VSZ A;  4DXA B;  2K00 A;  2QKM A;  3CXB B;  4HB2 B;  2KUQ A;  5I2S A;  5M4Y B;  1U27 A;  4P7I A;  2K2U A;  5JHG A;  5EFX A;  3A8Q A;  2R0D A;  2ROZ B;  1U29 A;  2EC1 A;  3B77 A;  5D3W A;  4HHV A;  2G35 A;  1MK9 B;  3OHM B;  3IVF A;  1MK7 B;  1X86 A;  3KSY A;  4HAU B;  4Z2M B;  4DBB A;  4K2P A;  1T77 A;  1W1H A;  4PNK A;  5JP4 A;  2DLW A;  2NZ8 B;  1MPH A;  2YSZ A;  3HQC A;  1XX0 A;  3PVL A;  1TQZ A;  4GMX B;  1P6S A;  1U5G A;  5LOP B;  1GC7 A;  5DHA B;  2AL6 A;  1ZSQ A;  2DFK A;  3SV1 A;  2CY5 A;  4GXB A;  4PQ0 A;  4YL8 A;  1K5G B;  1IRS A;  4GPT B;  3HK0 A;  1MI1 A;  1NU2 A;  2X18 A;  4QJ5 B;  1FGY A;  2H7D A;  1UNR A;  1NTV A;  4NSW A;  2DHK A;  4CHJ A;  1BTN A;  5JHH A;  1DDM A;  3NWF A;  1PLS A;  4NY0 A;  5CLQ B;  1U5D A;  2RGN B;  3D8F A;  1EVH A;  4HAX B;  2RSG A;  1U2B A;  4DX8 A;  2I5F A;  3PP2 A;  3G9W A;  1WJ1 A;  3N7C A;  1UPR A;  2DKP A;  2J0J A;  5J3T A;  2FJU B;  2UZR A;  1ZYI A;  2RNR B;  1WGQ A;  3AJ4 A;  1P3R A;  2N0Y A;  4D0N B;  2KIG A;  5DHF B;  3KRX A;  1XOD A;  5HE0 A;  1QC6 A;  3ULC A;  1SHC A;  3DXC A;  1H4R A;  3WYF B;  1EGX A;  3X23 A;  3V5W A;  1PFJ A;  2P0F A;  4HAY B;  1XR0 B;  1LW3 A;  2ADZ A;  4OT1 A;  4K81 A;  1MIZ B;  2YVC A;  1X1F A;  2ZKM X;  1U5F A;  1V88 A;  1RRP B;  2RVB B;  5C6R A;  1J0W A;  1I7A A;  2ELA A;  3F5R A;  3P6A A;  1DDW A;  2D9V A;  2KR0 A;  2UZS A;  2P0D A;  2M38 A;  2GJY A;  2D9X A;  3PSC A;  2LKO A;  1J19 A;  1DYN A;  3ZVR A;  4A5K A;  2COF A;  3D8D A;  1FHX A;  1WI1 A;  2VRW B;  1X05 A;  5HE1 A;  4TKN A;  2EMS A;  1MKE A;  3RCP A;  4WSF A;  2Z0Q A;  3VIA A;  2YT2 A;  1ZVR A;  4KVG B;  4HSI A;  5FI1 A;  2NMB A;  2Y8G A;  3PVU A;  2YS3 A;  1B55 A;  1V5M A;  3DCX A;  5D3X A;  2L1C A;  2YRY A;  4D6W A;  1M7E A;  5J3Y A;  2XQN M;  2DYN A;  2DYQ A;  3VOQ A;  2MFQ A;  2W2X D;  1FB8 A;  4DX9 0;  1V89 A;  1ZC4 B;  3PG7 A;  2I5C A;  2Z14 A;  1XKE A;  2J0M A;  2D11 A;  3AU5 A;  3DXE A;  3QWM A;  4HB4 B;  2N23 A;  3CIK A;  3FEH A;  2W2X C;  4CYE A;  4EKU A;  5J3Q A;  4Y94 A;  2KGX B;  1X1G A; 
#chains in the Genus database with same CATH homology
 2MWN B;  2COC A;  3BIN A;  4MT7 A;  4GNK B;  4HAW B;  2IFS A;  2Z59 A;  3ODW A;  3PZD A;  2V76 A;  1X11 A;  1E5W A;  4TYZ A;  1DRO A;  2K8E A;  5L81 A;  3KRW A;  3U7D A;  1PMS A;  2VKI A;  2COD A;  2D10 A;  1U5E A;  2P0H A;  5KCV A;  3DXD A;  2I1J A;  4H8S A;  2Z4D A;  4GOU A;  1UNP A;  3ODO A;  3QIJ A;  3M1I B;  2YF0 A;  4A6F B;  3GYP A;  1WVH A;  4MK0 A;  3GYO A;  4BBK A;  4A6H A;  1H10 A;  4QXA B;  1W1G A;  5FI0 A;  2ELB A;  4YON A;  1MIX A;  4OSN A;  3TO1 A;  2LOX A;  3SUZ A;  4CSQ A;  5D27 A;  3T06 A;  1GC6 A;  1MAI A;  2YT0 A;  2DKQ A;  1UEF A;  3HIE A;  3U8Z A;  1V5P A;  3TW1 A;  3MDB C;  1V5U A;  4ZRK A;  2LOZ A;  4HAV B;  2K49 A;  4C0A A;  1Y5O A;  4HB3 B;  1DBH A;  4EJN A;  2R2Y A;  1Y19 B;  2Z0P A;  2DHI A;  5C16 A;  3NWD A;  1V61 A;  4HDO A;  4QJ3 B;  2Q13 A;  1LB1 A;  2ZPY A;  4WJ7 A;  1TJ6 A;  1DDV A;  2DX1 A;  3P7Z A;  2CY4 A;  4B6H A;  2NBV A;  1FHO A;  3TVV A;  2BCJ A;  2DA0 A;  3ZDT A;  2H7E A;  2MKR A;  3UZT A;  2YT1 A;  2P8V A;  1RJ2 A;  4EMO A;  1WGU A;  2OQB A;  1UPQ A;  1M7R A;  2FJL A;  1SGH A;  3PVW A;  2KCJ A;  2W2W A;  4Z2N A;  3SYX A;  5KQ1 A;  1FGZ A;  1GG3 A;  1XD4 A;  2Y7B A;  4QJ4 B;  5C5B B;  5HE2 A;  1N3H A;  2LYD A;  2DX5 A;  5JLJ B;  2KIE A;  2J59 M;  4KHO A;  5C79 A;  2GUM A;  2EJ8 A;  2DHJ A;  4IAP A;  1KZG A;  3NWA A;  4K2O A;  2D9Y A;  3BJI A;  3WA0 A;  1WJM A;  2I1K A;  2D2Q A;  1K5D B;  2HE7 A;  2AEH A;  4IFS A;  1OMW A;  2LUL A;  3A58 A;  5DI9 B;  4L1R A;  2Y8F A;  2KUP A;  2D9W A;  4DIX A;  4KHA A;  4HB0 B;  1W1D A;  4MY6 A;  5DIF B;  3KZ1 A;  2DTC A;  2JP2 A;  2MDX A;  4KHB B;  1AQC A;  3QBV B;  2GCJ A;  3D8E A;  1NI2 A;  4GZU A;  1AWE A;  5LG4 B;  2HTH B;  1Z87 A;  2E2X A;  3FM8 C;  3NSU A;  2GCL A;  2DN6 A;  3A98 B;  5C5B A;  2EMT A;  3FVC A;  2COA A;  3U12 A;  3F0W A;  4F7U P;  2GS0 A;  2K2J A;  2R09 A;  1EAZ A;  2YS5 A;  4KAX B;  4HAT B;  5CLL B;  1FOE A;  4IOY X;  5DH9 B;  2RLO A;  1EF1 A;  2RUK B;  2RRF A;  1UNQ A;  4ZRJ A;  2LG1 A;  4CHM A;  3NW8 A;  5IRS A;  2IYB A;  5GOW B;  3AU4 A;  5D3Y A;  2Z0O A;  1BWN A;  3HW2 B;  2QKL A;  4F7G A;  5LON B;  2L2I A;  3O96 A;  4L6E A;  1BTK A;  3ML4 A;  1ZC3 B;  3TCA A;  1FAO A;  1BAK A;  1WG7 A;  2D9Z A;  3KY9 A;  3ODX A;  4KHB A;  3SO6 A;  1I2H A;  1OY2 A;  5HE3 A;  2Z13 A;  3TFM A;  3PEG A;  3SNH A;  5KQ4 A;  4F7H A;  2UVM A;  2D4Q A;  1ZM0 A;  1P5T A;  5D3V A;  4A6K A;  1Q67 A;  4WVF B;  2M14 A;  2ROV A;  3OAN A;  2YS1 A;  1ISN A;  4GMV A;  3ULB A;  4A6F A;  3A8P A;  5I2M A;  2J0K A;  1TXD A;  2PZ1 A;  1KI1 B;  2CRF A;  4K17 A;  1OQN A;  2OTX A;  3LJU X;  2CAY A;  1QQG A;  4HDQ A;  4HAZ B;  1FHW A;  3FSS A;  4ZRI A;  4XWX A;  4GN1 A;  1XCG A;  3MPX A;  1KZ7 A;  1NTY A;  2VSZ A;  4DXA B;  2K00 A;  2QKM A;  3CXB B;  4HB2 B;  2KUQ A;  5I2S A;  5M4Y B;  1U27 A;  4P7I A;  2K2U A;  5JHG A;  5EFX A;  3A8Q A;  2R0D A;  2ROZ B;  1U29 A;  2EC1 A;  5D3W A;  4HHV A;  2G35 A;  1MK9 B;  3OHM B;  3IVF A;  1MK7 B;  1X86 A;  3KSY A;  4HAU B;  4Z2M B;  4DBB A;  4K2P A;  1W1H A;  4PNK A;  5JP4 A;  2DLW A;  2NZ8 B;  1MPH A;  2YSZ A;  3HQC A;  1XX0 A;  3PVL A;  1TQZ A;  4GMX B;  1P6S A;  1U5G A;  5LOP B;  1GC7 A;  5DHA B;  2AL6 A;  1ZSQ A;  2DFK A;  3SV1 A;  2CY5 A;  4GXB A;  4PQ0 A;  4YL8 A;  1K5G B;  1IRS A;  4GPT B;  1NU2 A;  3HK0 A;  2X18 A;  4QJ5 B;  1FGY A;  2H7D A;  1UNR A;  1NTV A;  4NSW A;  2DHK A;  4CHJ A;  1BTN A;  5JHH A;  1DDM A;  3NWF A;  1PLS A;  4NY0 A;  5CLQ B;  1U5D A;  2RGN B;  3D8F A;  1EVH A;  4HAX B;  2RSG A;  1U2B A;  4DX8 A;  2I5F A;  3PP2 A;  3G9W A;  1WJ1 A;  3N7C A;  1UPR A;  2DKP A;  2J0J A;  5J3T A;  2FJU B;  2UZR A;  1ZYI A;  2RNR B;  1WGQ A;  3AJ4 A;  1P3R A;  2N0Y A;  4D0N B;  2KIG A;  5DHF B;  3KRX A;  1XOD A;  5HE0 A;  1QC6 A;  3ULC A;  1SHC A;  3DXC A;  1H4R A;  3WYF B;  1EGX A;  3X23 A;  3V5W A;  1PFJ A;  2P0F A;  4HAY B;  1XR0 B;  1LW3 A;  2ADZ A;  4OT1 A;  4K81 A;  1MIZ B;  2YVC A;  1X1F A;  2ZKM X;  1U5F A;  1V88 A;  1RRP B;  2RVB B;  5C6R A;  1J0W A;  1I7A A;  2ELA A;  3F5R A;  3P6A A;  1DDW A;  2D9V A;  2UZS A;  2KR0 A;  2P0D A;  2M38 A;  2GJY A;  2D9X A;  3PSC A;  2LKO A;  1J19 A;  1DYN A;  3ZVR A;  4A5K A;  2COF A;  3D8D A;  1FHX A;  1WI1 A;  2VRW B;  1X05 A;  5HE1 A;  4TKN A;  2EMS A;  1MKE A;  3RCP A;  4WSF A;  2Z0Q A;  3VIA A;  2YT2 A;  1ZVR A;  4KVG B;  4HSI A;  5FI1 A;  2NMB A;  2Y8G A;  3PVU A;  2YS3 A;  1B55 A;  1V5M A;  5D3X A;  2L1C A;  2YRY A;  4D6W A;  1M7E A;  5J3Y A;  2XQN M;  2DYN A;  2DYQ A;  3VOQ A;  2MFQ A;  2W2X D;  1FB8 A;  4DX9 0;  1V89 A;  1ZC4 B;  3PG7 A;  2I5C A;  2Z14 A;  1XKE A;  2J0M A;  2D11 A;  3AU5 A;  3DXE A;  3QWM A;  4HB4 B;  2N23 A;  3CIK A;  3FEH A;  2W2X C;  4CYE A;  4EKU A;  5J3Q A;  4Y94 A;  2KGX B;  1X1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...