3FSSA

Structure of the tandem ph domains of rtt106
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
222
Chain Sequence
b'TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 57
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2009-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3fssA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3fssA01
3KRXA 2Z0QA 2YVCA 4H8SA 1J19A 4ZRKA 1BTNA 2CRFA 2N23A 3QBVB 1XD4A 1V5PA 3PVLA 2YRYA 4Y94A 2K2UA 2D9ZA 2L2IA 2OQBA 2E2XA 4EJNA 4F7GA 2Y8GA 3DXEA 3P6AA 4HATB 4WJ7A 2MDXA 2DA0A 3FSSA 2MWNB 2KUPA 2D10A 3SYXA 2MFQA 3HK0A 4ZRIA 2DFKA 4L6EA 5KCVA 1FHOA 1WJMA 4KHBB 5J3TA 2P8VA 2W2XD 4MK0A 3P7ZA 2DYNA 3WA0A 4A6FA 2AL6A 1DYNA 1DROA 1QQGA 2LOXA 5HE3A 1N3HA 4EMOA 2P0DA 1FOEA 2D4QA 1UPRA 1IRSA 1BTKA 2Q13A 1B55A 2QKMA 4DBBA 5D3VA 3TFMA 2D9XA 4TYZA 3A98B 2GCLA 3LJUX 1MAIA 1W1DA 4DXAB 3CIKA 4KVGB 3G9WA 2L1CA 1FGZA 5L81A 1U29A 1ZM0A 2EJ8A 3ODXA 1UEFA 1WI1A 5KQ1A 2M14A 4Z2NA 5J3QA 2EC1A 5LONB 3GYPA 1OY2A 4KHAA 1WG7A 2ELAA 4PNKA 5CLLB 2DHKA 2I5CA 1DDMA 1MIZB 2GS0A 3SNHA 2Y7BA 2W2XC 2J0KA 5DHAB 5DI9B 2ROZB 3PVWA 2LYDA 2YS5A 3HQCA 4HAYB 4GPTB 1WVHA 1NTYA 4HAZB 5JHHA 1K5GB 2DYQA 5EFXA 1SGHA 3AJ4A 1MPHA 2I1JA 4HHVA 1TQZA 5DHFB 4CHMA 5JHGA 1BWNA 1V61A 2RVBB 2XQNM 3HW2B 3UZTA 5C16A 1XX0A 2DN6A 2DTCA 1K5DB 2VSZA 3QIJA 4IFSA 1EAZA 3U7DA 4HAXB 4MY6A 3F0WA 3CXBB 3ZVRA 5D3WA 3U8ZA 1U5GA 3SV1A 1X86A 1ZC4B 2QKLA 2G35A 3AU4A 4A6KA 2LULA 1I7AA 3WYFB 4HAUB 4K17A 2R0DA 1LW3A 1X11A 1NU2A 2JP2A 3D8DA 4IOYX 5FI1A 5C5BA 4HB2B 3KZ1A 1KZ7A 1V5MA 4A6FB 3O96A 1EF1A 3OANA 1OMWA 2D9VA 2J0JA 2CAYA 2DHIA 1I2HA 2CY5A 3F5RA 4YL8A 3VIAA 2DX1A 5D27A 2UZSA 4GZUA 5GOWB 2KGXB 2IYBA 2NZ8B 4A6HA 5C79A 2NMBA 2COFA 2LOZA 1X05A 1H4RA 2FJLA 2Y8FA 1H10A 2I5FA 3N7CA 3TVVA 4WVFB 5JLJB 4D0NB 2Z0OA 1U5EA 1MK9B 1LB1A 4HDOA 2EMTA 2M38A 1V89A 2YSZA 5JP4A 4K81A 3FEHA 1UNRA 4IAPA 2UZRA 2CY4A 1X1GA 2ADZA 3T06A 4GMVA 2D11A 1FHWA 1QC6A 1UNPA 2RSGA 1J0WA 3DXCA 2PZ1A 1Y19B 1Y5OA 2YF0A 1X1FA 3IVFA 2AEHA 4HDQA 2VRWB 3QWMA 4XWXA 4ZRJA 1ZSQA 1AWEA 4HB0B 2IFSA 5FI0A 1FB8A 2Z0PA 3M1IB 3RCPA 2KCJA 4A5KA 1W1GA 2COCA 3PSCA 4HB3B 1RJ2A 1KZGA 3A8QA 1FHXA 2H7EA 1EVHA 4BBKA 1XKEA 1FGYA 2UVMA 1DDVA 2N0YA 2LG1A 5C5BB 5J3YA 3KY9A 4HAWB 2DKQA 5HE0A 1ZVRA 2RGNB 5CLQB 3PG7A 1U5FA 1GC6A 2CODA 1PFJA 2GCJA 3PP2A 2EMSA 1TJ6A 4KAXB 3KSYA 1ISNA 3BINA 4EKUA 4CYEA 1U2BA 3FM8C 5D3YA 1GG3A 1GC7A 4C0AA 5HE1A 1WJ1A 2LKOA 5C6RA 5DH9B 2GJYA 1V5UA 4DX8A 2P0HA 1DBHA 3MDBC 3PEGA 3V5WA 1U5DA 3BJIA 3KRWA 1NI2A 1RRPB 4HB4B 2RNRB 2YS1A 2ZPYA 2P0FA 4P7IA 4B6HA 1P3RA 2D9WA 2HE7A 3D8FA 4NSWA 3SO6A 4K2OA 2V76A 4TKNA 5LOPB 2RUKB 2OTXA 3SUZA 3AU5A 4WSFA 1Z87A 2VKIA 1DDWA 1V88A 5D3XA 1EGXA 1FAOA 1WGQA 2DHJA 2X18A 5DIFB 1MK7B 4K2PA 3ZDTA 1PLSA 3ML4A 4HAVB 2I1KA 1ZC3B 1P6SA 3PZDA 1XODA 2YS3A 4NY0A 2R09A 2HTHB 3ODOA 4GN1A 2ELBA 3D8EA 4GMXB 1NTVA 4KHOA 3GYOA 4F7HA 1KI1B 2K00A 3ULCA 2ROVA 2K2JA 4PQ0A 5HE2A 1SHCA 5KQ4A 3PVUA 1AQCA 2DLWA 1XR0B 3TO1A 3A8PA 2J0MA 4Z2MB 1BAKA 1UNQA 1TXDA 3NSUA 3ULBA 1UPQA 2D9YA 2H7DA 3DXDA 1MKEA 2MKRA 4CHJA 3ODWA 4MT7A 1U27A 2J59M 1PMSA 1OQNA 3MPXA 1XCGA 3TW1A 1E5WA 1MIXA 2BCJA 2COAA 2DKPA 2YT1A 2YT0A 4F7UP 1M7EA 4DX90 1WGUA 1M7RA 1W1HA 1P5TA 4GXBA 4YONA 2W2WA 3TCAA 2DX5A 2RLOA 2D2QA 3VOQA 1Q67A 3X23A
chains in the Genus database with same CATH superfamily
3KRXA 2Z0QA 2YVCA 4H8SA 1J19A 4ZRKA 5M4YB 1BTNA 2CRFA 2Z13A 2N23A 3QBVB 1XD4A 1V5PA 3PVLA 2YRYA 4Y94A 2K2UA 2D9ZA 5IRSA 1MI1A 3HIEA 2L2IA 2OQBA 2E2XA 4EJNA 4F7GA 2Y8GA 4QJ4B 3DXEA 3P6AA 4HATB 4WJ7A 2MDXA 2DA0A 3FSSA 2MWNB 2KUPA 2D10A 3SYXA 2MFQA 3B77A 3HK0A 4ZRIA 2DFKA 4L6EA 1T77A 4QXAB 5KCVA 1FHOA 1WJMA 4KHBB 3DCXA 5J3TA 2P8VA 2W2XD 4MK0A 3P7ZA 2DYNA 3WA0A 4A6FA 2AL6A 1DYNA 1DROA 1QQGA 2LOXA 5HE3A 1N3HA 4EMOA 2P0DA 1FOEA 2D4QA 1UPRA 1IRSA 1BTKA 2Q13A 1B55A 2QKMA 4DBBA 5D3VA 3TFMA 2D9XA 4TYZA 2KIGA 3A98B 2GCLA 5LG4B 3LJUX 1MAIA 1W1DA 4DXAB 3CIKA 4KVGB 3G9WA 2L1CA 1FGZA 5L81A 1U29A 3OHMB 1ZM0A 2EJ8A 3ODXA 1UEFA 1WI1A 5KQ1A 2M14A 3FVCA 4Z2NA 5J3QA 2EC1A 5LONB 3GYPA 1OY2A 4CSQA 4KHAA 1WG7A 2ELAA 4PNKA 5CLLB 2DHKA 2I5CA 1DDMA 1MIZB 2GS0A 3SNHA 2Y7BA 2W2XC 2J0KA 5DHAB 5DI9B 2ROZB 3PVWA 2LYDA 2YS5A 3HQCA 4HAYB 4GPTB 1WVHA 1NTYA 4HAZB 5JHHA 1K5GB 2DYQA 5EFXA 1SGHA 3AJ4A 1MPHA 2I1JA 4HHVA 1TQZA 5DHFB 4CHMA 2K49A 5JHGA 1BWNA 1V61A 2RVBB 2XQNM 3HW2B 3UZTA 5C16A 1XX0A 2DN6A 3A58A 2DTCA 1K5DB 2VSZA 3QIJA 4IFSA 1EAZA 3U7DA 4HAXB 4MY6A 3F0WA 3CXBB 3ZVRA 2KR0A 5D3WA 3U8ZA 4QJ5B 1U5GA 3SV1A 1X86A 1ZC4B 2QKLA 2G35A 3AU4A 4A6KA 2LULA 1I7AA 3WYFB 4HAUB 2Z4DA 4K17A 2R0DA 1LW3A 1X11A 1NU2A 2JP2A 3D8DA 4IOYX 5FI1A 5C5BA 4HB2B 3KZ1A 1KZ7A 2K8EA 1V5MA 4A6FB 3O96A 1EF1A 3OANA 1OMWA 2D9VA 2J0JA 2CAYA 2DHIA 1I2HA 2CY5A 3F5RA 3NWAA 4GNKB 4YL8A 3VIAA 2DX1A 5D27A 2UZSA 4GZUA 5GOWB 2KGXB 2IYBA 2NZ8B 4A6HA 5C79A 2NMBA 2COFA 2LOZA 1X05A 2NBVA 1H4RA 2FJLA 2FJUB 2Y8FA 2YT2A 1H10A 2I5FA 4D6WA 3N7CA 3TVVA 4WVFB 5JLJB 4D0NB 2Z0OA 1U5EA 1MK9B 1LB1A 4HDOA 2EMTA 2M38A 1V89A 2YSZA 5JP4A 4QJ3B 4K81A 3FEHA 1UNRA 2Z59A 4IAPA 2UZRA 2CY4A 1X1GA 2ADZA 3T06A 4GMVA 2D11A 1FHWA 1QC6A 1UNPA 2RSGA 1J0WA 3DXCA 2PZ1A 1Y19B 1Y5OA 2YF0A 4KHBA 4DIXA 1X1FA 3IVFA 2AEHA 4HDQA 2GUMA 2VRWB 3QWMA 4XWXA 4ZRJA 1ZSQA 1AWEA 4HB0B 2IFSA 5FI0A 1FB8A 2Z0PA 3M1IB 3RCPA 2KCJA 4A5KA 1W1GA 2COCA 3PSCA 4HB3B 1RJ2A 4HSIA 1KZGA 3A8QA 1FHXA 4OT1A 2H7EA 1EVHA 4BBKA 1XKEA 1FGYA 2UVMA 1DDVA 2N0YA 2LG1A 5C5BB 5J3YA 3KY9A 4HAWB 2DKQA 5HE0A 1ZVRA 2RGNB 5CLQB 3PG7A 1U5FA 1GC6A 2CODA 1PFJA 4L1RA 2GCJA 2KIEA 3PP2A 2EMSA 2RRFA 3HSAA 1TJ6A 4KAXB 3KSYA 1ISNA 1ZYIA 3BINA 3NW8A 4EKUA 4CYEA 1U2BA 3FM8C 5D3YA 1GG3A 1GC7A 4C0AA 5HE1A 1WJ1A 3NWDA 2LKOA 5C6RA 5DH9B 2GJYA 1V5UA 4DX8A 2P0HA 1DBHA 3U12A 3MDBC 3PEGA 3V5WA 1U5DA 3BJIA 3KRWA 1NI2A 1RRPB 4HB4B 2RNRB 2YS1A 2ZPYA 2P0FA 4P7IA 4B6HA 1P3RA 2D9WA 2HE7A 3D8FA 4NSWA 3SO6A 4K2OA 2V76A 4TKNA 5LOPB 2RUKB 2OTXA 3SUZA 3AU5A 4WSFA 1Z87A 2VKIA 1DDWA 1V88A 5D3XA 4OSNA 1EGXA 1FAOA 1WGQA 2DHJA 2X18A 5DIFB 1MK7B 4K2PA 3ZDTA 1PLSA 3ML4A 4HAVB 2I1KA 1ZC3B 1P6SA 3PZDA 2KUQA 1XODA 2YS3A 4NY0A 2R09A 2HTHB 3ODOA 4GN1A 2ELBA 3D8EA 4GMXB 1NTVA 4KHOA 3GYOA 4F7HA 1KI1B 2K00A 3ULCA 2ROVA 2K2JA 4PQ0A 4GOUA 5HE2A 1SHCA 5KQ4A 3PVUA 1AQCA 2DLWA 1XR0B 3TO1A 3A8PA 2J0MA 4Z2MB 1BAKA 1UNQA 2ZKMX 1TXDA 3NSUA 3ULBA 1UPQA 2D9YA 2R2YA 2H7DA 3DXDA 1MKEA 2MKRA 4CHJA 3ODWA 4MT7A 1U27A 2J59M 1PMSA 2Z14A 1OQNA 3MPXA 1XCGA 3TW1A 5I2MA 1E5WA 1MIXA 2BCJA 2COAA 2DKPA 2YT1A 3NWFA 2YT0A 4F7UP 5I2SA 1M7EA 4DX90 1WGUA 1M7RA 1W1HA 1P5TA 4GXBA 4YONA 2W2WA 3TCAA 2DX5A 2RLOA 2D2QA 3VOQA 1Q67A 3X23A
chains in the Genus database with same CATH topology
3KRXA 2Z0QA 2YVCA 4H8SA 1J19A 4ZRKA 5M4YB 1BTNA 2CRFA 2Z13A 2N23A 3QBVB 1XD4A 1V5PA 3PVLA 2YRYA 4Y94A 2K2UA 2D9ZA 5IRSA 3HIEA 2L2IA 2OQBA 2E2XA 4EJNA 4F7GA 2Y8GA 4QJ4B 3DXEA 3P6AA 4HATB 4WJ7A 2MDXA 2DA0A 3FSSA 2MWNB 2KUPA 2D10A 3SYXA 2MFQA 3HK0A 4ZRIA 2DFKA 4L6EA 5KCVA 1FHOA 4QXAB 1WJMA 4KHBB 5J3TA 2P8VA 2W2XD 4MK0A 3P7ZA 2DYNA 3WA0A 4A6FA 2AL6A 1DYNA 1DROA 1QQGA 2LOXA 5HE3A 1N3HA 4EMOA 2P0DA 1FOEA 2D4QA 1UPRA 1IRSA 1BTKA 2Q13A 1B55A 2QKMA 4DBBA 5D3VA 3TFMA 2D9XA 4TYZA 2KIGA 3A98B 2GCLA 5LG4B 3LJUX 1MAIA 1W1DA 4DXAB 3CIKA 4KVGB 3G9WA 2L1CA 1FGZA 5L81A 1U29A 3OHMB 1ZM0A 2EJ8A 3ODXA 1UEFA 1WI1A 5KQ1A 2M14A 4Z2NA 3FVCA 5J3QA 2EC1A 5LONB 3GYPA 1OY2A 4CSQA 4KHAA 1WG7A 2ELAA 4PNKA 5CLLB 2DHKA 2I5CA 1DDMA 1MIZB 2GS0A 3SNHA 2Y7BA 2W2XC 2J0KA 5DHAB 5DI9B 2ROZB 3PVWA 2LYDA 2YS5A 3HQCA 4HAYB 4GPTB 1WVHA 1NTYA 4HAZB 5JHHA 1K5GB 2DYQA 5EFXA 1SGHA 3AJ4A 1MPHA 2I1JA 4HHVA 1TQZA 5DHFB 4CHMA 2K49A 5JHGA 1BWNA 1V61A 2RVBB 2XQNM 3HW2B 3UZTA 5C16A 1XX0A 2DN6A 3A58A 2DTCA 1K5DB 2VSZA 3QIJA 4IFSA 1EAZA 3U7DA 4HAXB 4MY6A 3F0WA 3CXBB 3ZVRA 2KR0A 5D3WA 3U8ZA 4QJ5B 1U5GA 3SV1A 1X86A 1ZC4B 2QKLA 2G35A 3AU4A 4A6KA 2LULA 1I7AA 3WYFB 4HAUB 2Z4DA 4K17A 2R0DA 1LW3A 1X11A 1NU2A 2JP2A 3D8DA 4IOYX 5FI1A 5C5BA 4HB2B 3KZ1A 1KZ7A 2K8EA 1V5MA 4A6FB 3O96A 1EF1A 3OANA 1OMWA 2D9VA 2J0JA 2CAYA 2DHIA 1I2HA 2CY5A 3F5RA 3NWAA 4GNKB 4YL8A 3VIAA 2DX1A 5D27A 2UZSA 4GZUA 5GOWB 2KGXB 2IYBA 2NZ8B 4A6HA 5C79A 2NMBA 2COFA 2LOZA 1X05A 2NBVA 1H4RA 2FJLA 2FJUB 2Y8FA 2YT2A 1H10A 2I5FA 4D6WA 3N7CA 3TVVA 4WVFB 5JLJB 4D0NB 2Z0OA 1U5EA 1MK9B 1LB1A 4HDOA 2EMTA 2M38A 1V89A 2YSZA 5JP4A 4QJ3B 4K81A 3FEHA 1UNRA 2Z59A 4IAPA 2UZRA 2CY4A 1X1GA 2ADZA 3T06A 4GMVA 2D11A 1FHWA 1QC6A 1UNPA 2RSGA 1J0WA 3DXCA 2PZ1A 1Y19B 1Y5OA 2YF0A 4KHBA 4DIXA 1X1FA 3IVFA 2AEHA 4HDQA 2VRWB 3QWMA 4XWXA 4ZRJA 2GUMA 1ZSQA 1AWEA 4HB0B 2IFSA 5FI0A 1FB8A 2Z0PA 3M1IB 3RCPA 2KCJA 4A5KA 1W1GA 2COCA 3PSCA 4HB3B 1RJ2A 4HSIA 1KZGA 3A8QA 1FHXA 4OT1A 2H7EA 1EVHA 4BBKA 1XKEA 1FGYA 2UVMA 1DDVA 2N0YA 2LG1A 5C5BB 5J3YA 3KY9A 4HAWB 2DKQA 5HE0A 1ZVRA 2RGNB 5CLQB 3PG7A 1U5FA 1GC6A 2CODA 1PFJA 4L1RA 2GCJA 2KIEA 3PP2A 2EMSA 2RRFA 1TJ6A 4KAXB 3KSYA 1ISNA 3BINA 1ZYIA 3NW8A 4EKUA 4CYEA 1U2BA 3FM8C 5D3YA 1GG3A 1GC7A 4C0AA 5HE1A 1WJ1A 3NWDA 2LKOA 5C6RA 5DH9B 2GJYA 1V5UA 4DX8A 2P0HA 1DBHA 3U12A 3MDBC 3PEGA 3V5WA 1U5DA 3BJIA 3KRWA 1NI2A 1RRPB 4HB4B 2RNRB 2YS1A 2ZPYA 2P0FA 4P7IA 4B6HA 1P3RA 2D9WA 2HE7A 3D8FA 4NSWA 3SO6A 4K2OA 2V76A 4TKNA 5LOPB 2RUKB 2OTXA 3SUZA 3AU5A 4WSFA 1Z87A 2VKIA 1DDWA 1V88A 5D3XA 4OSNA 1EGXA 1FAOA 1WGQA 2DHJA 2X18A 5DIFB 1MK7B 4K2PA 3ZDTA 1PLSA 3ML4A 4HAVB 2I1KA 1ZC3B 1P6SA 3PZDA 2KUQA 1XODA 2YS3A 4NY0A 2R09A 2HTHB 3ODOA 4GN1A 2ELBA 3D8EA 4GMXB 1NTVA 4KHOA 3GYOA 4F7HA 1KI1B 2K00A 3ULCA 2ROVA 2K2JA 4PQ0A 4GOUA 5HE2A 1SHCA 5KQ4A 3PVUA 1AQCA 2DLWA 1XR0B 3TO1A 3A8PA 2J0MA 4Z2MB 1BAKA 1UNQA 2ZKMX 1TXDA 3NSUA 3ULBA 1UPQA 2D9YA 2R2YA 2H7DA 3DXDA 1MKEA 2MKRA 4CHJA 3ODWA 4MT7A 1U27A 2J59M 1PMSA 2Z14A 1OQNA 3MPXA 1XCGA 3TW1A 5I2MA 1E5WA 1MIXA 2BCJA 2COAA 2DKPA 2YT1A 3NWFA 2YT0A 4F7UP 5I2SA 1M7EA 4DX90 1WGUA 1M7RA 1W1HA 1P5TA 4GXBA 4YONA 2W2WA 3TCAA 2DX5A 2RLOA 2D2QA 3VOQA 1Q67A 3X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRX A;  2Z0Q A;  2YVC A;  4H8S A;  1J19 A;  4ZRK A;  1BTN A;  2CRF A;  2N23 A;  3QBV B;  1XD4 A;  1V5P A;  3PVL A;  2YRY A;  4Y94 A;  2K2U A;  2D9Z A;  2L2I A;  2OQB A;  2E2X A;  4EJN A;  4F7G A;  2Y8G A;  3DXE A;  3P6A A;  4HAT B;  4WJ7 A;  2MDX A;  2DA0 A;  3FSS A;  2MWN B;  2KUP A;  2D10 A;  3SYX A;  2MFQ A;  3HK0 A;  4ZRI A;  2DFK A;  4L6E A;  5KCV A;  1FHO A;  1WJM A;  4KHB B;  5J3T A;  2P8V A;  2W2X D;  4MK0 A;  3P7Z A;  2DYN A;  3WA0 A;  4A6F A;  2AL6 A;  1DYN A;  1DRO A;  1QQG A;  2LOX A;  5HE3 A;  1N3H A;  4EMO A;  2P0D A;  1FOE A;  2D4Q A;  1UPR A;  1IRS A;  1BTK A;  2Q13 A;  1B55 A;  2QKM A;  4DBB A;  5D3V A;  3TFM A;  2D9X A;  4TYZ A;  3A98 B;  2GCL A;  3LJU X;  1MAI A;  1W1D A;  4DXA B;  3CIK A;  4KVG B;  3G9W A;  2L1C A;  1FGZ A;  5L81 A;  1U29 A;  1ZM0 A;  2EJ8 A;  3ODX A;  1UEF A;  1WI1 A;  5KQ1 A;  2M14 A;  4Z2N A;  5J3Q A;  2EC1 A;  5LON B;  3GYP A;  1OY2 A;  4KHA A;  1WG7 A;  2ELA A;  4PNK A;  5CLL B;  2DHK A;  2I5C A;  1DDM A;  1MIZ B;  2GS0 A;  3SNH A;  2Y7B A;  2W2X C;  2J0K A;  5DHA B;  5DI9 B;  2ROZ B;  3PVW A;  2LYD A;  2YS5 A;  3HQC A;  4HAY B;  4GPT B;  1WVH A;  1NTY A;  4HAZ B;  5JHH A;  1K5G B;  2DYQ A;  5EFX A;  1SGH A;  3AJ4 A;  1MPH A;  2I1J A;  4HHV A;  1TQZ A;  5DHF B;  4CHM A;  5JHG A;  1BWN A;  1V61 A;  2RVB B;  2XQN M;  3HW2 B;  3UZT A;  5C16 A;  1XX0 A;  2DN6 A;  2DTC A;  1K5D B;  2VSZ A;  3QIJ A;  4IFS A;  1EAZ A;  3U7D A;  4HAX B;  4MY6 A;  3F0W A;  3CXB B;  3ZVR A;  5D3W A;  3U8Z A;  1U5G A;  3SV1 A;  1X86 A;  1ZC4 B;  2QKL A;  2G35 A;  3AU4 A;  4A6K A;  2LUL A;  1I7A A;  3WYF B;  4HAU B;  4K17 A;  2R0D A;  1LW3 A;  1X11 A;  1NU2 A;  2JP2 A;  3D8D A;  4IOY X;  5FI1 A;  5C5B A;  4HB2 B;  3KZ1 A;  1KZ7 A;  1V5M A;  4A6F B;  3O96 A;  1EF1 A;  3OAN A;  1OMW A;  2D9V A;  2J0J A;  2CAY A;  2DHI A;  1I2H A;  2CY5 A;  3F5R A;  4YL8 A;  3VIA A;  2DX1 A;  5D27 A;  2UZS A;  4GZU A;  5GOW B;  2KGX B;  2IYB A;  2NZ8 B;  4A6H A;  5C79 A;  2NMB A;  2COF A;  2LOZ A;  1X05 A;  1H4R A;  2FJL A;  2Y8F A;  1H10 A;  2I5F A;  3N7C A;  3TVV A;  4WVF B;  5JLJ B;  4D0N B;  2Z0O A;  1U5E A;  1MK9 B;  1LB1 A;  4HDO A;  2EMT A;  2M38 A;  1V89 A;  2YSZ A;  5JP4 A;  4K81 A;  3FEH A;  1UNR A;  4IAP A;  2UZR A;  2CY4 A;  1X1G A;  2ADZ A;  3T06 A;  4GMV A;  2D11 A;  1FHW A;  1QC6 A;  1UNP A;  2RSG A;  1J0W A;  3DXC A;  2PZ1 A;  1Y19 B;  1Y5O A;  2YF0 A;  1X1F A;  3IVF A;  2AEH A;  4HDQ A;  2VRW B;  3QWM A;  4XWX A;  4ZRJ A;  1ZSQ A;  1AWE A;  4HB0 B;  2IFS A;  5FI0 A;  1FB8 A;  2Z0P A;  3M1I B;  3RCP A;  2KCJ A;  4A5K A;  1W1G A;  2COC A;  3PSC A;  4HB3 B;  1RJ2 A;  1KZG A;  3A8Q A;  1FHX A;  2H7E A;  1EVH A;  4BBK A;  1XKE A;  1FGY A;  2UVM A;  1DDV A;  2N0Y A;  2LG1 A;  5C5B B;  5J3Y A;  3KY9 A;  4HAW B;  2DKQ A;  5HE0 A;  1ZVR A;  2RGN B;  5CLQ B;  3PG7 A;  1U5F A;  1GC6 A;  2COD A;  1PFJ A;  2GCJ A;  3PP2 A;  2EMS A;  1TJ6 A;  4KAX B;  3KSY A;  1ISN A;  3BIN A;  4EKU A;  4CYE A;  1U2B A;  3FM8 C;  5D3Y A;  1GG3 A;  1GC7 A;  4C0A A;  5HE1 A;  1WJ1 A;  2LKO A;  5C6R A;  5DH9 B;  2GJY A;  1V5U A;  4DX8 A;  2P0H A;  1DBH A;  3MDB C;  3PEG A;  3V5W A;  1U5D A;  3BJI A;  3KRW A;  1NI2 A;  1RRP B;  4HB4 B;  2RNR B;  2YS1 A;  2ZPY A;  2P0F A;  4P7I A;  4B6H A;  1P3R A;  2D9W A;  2HE7 A;  3D8F A;  4NSW A;  3SO6 A;  4K2O A;  2V76 A;  4TKN A;  5LOP B;  2RUK B;  2OTX A;  3SUZ A;  3AU5 A;  4WSF A;  1Z87 A;  2VKI A;  1DDW A;  1V88 A;  5D3X A;  1EGX A;  1FAO A;  1WGQ A;  2DHJ A;  2X18 A;  5DIF B;  1MK7 B;  4K2P A;  3ZDT A;  1PLS A;  3ML4 A;  4HAV B;  2I1K A;  1ZC3 B;  1P6S A;  3PZD A;  1XOD A;  2YS3 A;  4NY0 A;  2R09 A;  2HTH B;  3ODO A;  4GN1 A;  2ELB A;  3D8E A;  4GMX B;  1NTV A;  4KHO A;  3GYO A;  4F7H A;  1KI1 B;  2K00 A;  3ULC A;  2ROV A;  2K2J A;  4PQ0 A;  5HE2 A;  1SHC A;  5KQ4 A;  3PVU A;  1AQC A;  2DLW A;  1XR0 B;  3TO1 A;  3A8P A;  2J0M A;  4Z2M B;  1BAK A;  1UNQ A;  1TXD A;  3NSU A;  3ULB A;  1UPQ A;  2D9Y A;  2H7D A;  3DXD A;  1MKE A;  2MKR A;  4CHJ A;  3ODW A;  4MT7 A;  1U27 A;  2J59 M;  1PMS A;  1OQN A;  3MPX A;  1XCG A;  3TW1 A;  1E5W A;  1MIX A;  2BCJ A;  2COA A;  2DKP A;  2YT1 A;  2YT0 A;  4F7U P;  1M7E A;  4DX9 0;  1WGU A;  1M7R A;  1W1H A;  1P5T A;  4GXB A;  4YON A;  2W2W A;  3TCA A;  2DX5 A;  2RLO A;  2D2Q A;  3VOQ A;  1Q67 A;  3X23 A; 
#chains in the Genus database with same CATH topology
 3KRX A;  2Z0Q A;  2YVC A;  4H8S A;  1J19 A;  4ZRK A;  5M4Y B;  1BTN A;  2CRF A;  2Z13 A;  2N23 A;  3QBV B;  1XD4 A;  1V5P A;  3PVL A;  2YRY A;  4Y94 A;  2K2U A;  2D9Z A;  5IRS A;  1MI1 A;  3HIE A;  2L2I A;  2OQB A;  2E2X A;  4EJN A;  4F7G A;  2Y8G A;  4QJ4 B;  3DXE A;  3P6A A;  4HAT B;  4WJ7 A;  2MDX A;  2DA0 A;  3FSS A;  2MWN B;  2KUP A;  2D10 A;  3SYX A;  2MFQ A;  3B77 A;  3HK0 A;  4ZRI A;  2DFK A;  4L6E A;  1T77 A;  4QXA B;  5KCV A;  1FHO A;  1WJM A;  4KHB B;  3DCX A;  5J3T A;  2P8V A;  2W2X D;  4MK0 A;  3P7Z A;  2DYN A;  3WA0 A;  4A6F A;  2AL6 A;  1DYN A;  1DRO A;  1QQG A;  2LOX A;  5HE3 A;  1N3H A;  4EMO A;  2P0D A;  1FOE A;  2D4Q A;  1UPR A;  1IRS A;  1BTK A;  2Q13 A;  1B55 A;  2QKM A;  4DBB A;  5D3V A;  3TFM A;  2D9X A;  4TYZ A;  2KIG A;  3A98 B;  2GCL A;  5LG4 B;  3LJU X;  1MAI A;  1W1D A;  4DXA B;  3CIK A;  4KVG B;  3G9W A;  2L1C A;  1FGZ A;  5L81 A;  1U29 A;  3OHM B;  1ZM0 A;  2EJ8 A;  3ODX A;  1UEF A;  1WI1 A;  5KQ1 A;  2M14 A;  3FVC A;  4Z2N A;  5J3Q A;  2EC1 A;  5LON B;  3GYP A;  1OY2 A;  4CSQ A;  4KHA A;  1WG7 A;  2ELA A;  4PNK A;  5CLL B;  2DHK A;  2I5C A;  1DDM A;  1MIZ B;  2GS0 A;  3SNH A;  2Y7B A;  2W2X C;  2J0K A;  5DHA B;  5DI9 B;  2ROZ B;  3PVW A;  2LYD A;  2YS5 A;  3HQC A;  4HAY B;  4GPT B;  1WVH A;  1NTY A;  4HAZ B;  5JHH A;  1K5G B;  2DYQ A;  5EFX A;  1SGH A;  3AJ4 A;  1MPH A;  2I1J A;  4HHV A;  1TQZ A;  5DHF B;  4CHM A;  2K49 A;  5JHG A;  1BWN A;  1V61 A;  2RVB B;  2XQN M;  3HW2 B;  3UZT A;  5C16 A;  1XX0 A;  2DN6 A;  3A58 A;  2DTC A;  1K5D B;  2VSZ A;  3QIJ A;  4IFS A;  1EAZ A;  3U7D A;  4HAX B;  4MY6 A;  3F0W A;  3CXB B;  3ZVR A;  2KR0 A;  5D3W A;  3U8Z A;  4QJ5 B;  1U5G A;  3SV1 A;  1X86 A;  1ZC4 B;  2QKL A;  2G35 A;  3AU4 A;  4A6K A;  2LUL A;  1I7A A;  3WYF B;  4HAU B;  2Z4D A;  4K17 A;  2R0D A;  1LW3 A;  1X11 A;  1NU2 A;  2JP2 A;  3D8D A;  4IOY X;  5FI1 A;  5C5B A;  4HB2 B;  3KZ1 A;  1KZ7 A;  2K8E A;  1V5M A;  4A6F B;  3O96 A;  1EF1 A;  3OAN A;  1OMW A;  2D9V A;  2J0J A;  2CAY A;  2DHI A;  1I2H A;  2CY5 A;  3F5R A;  3NWA A;  4GNK B;  4YL8 A;  3VIA A;  2DX1 A;  5D27 A;  2UZS A;  4GZU A;  5GOW B;  2KGX B;  2IYB A;  2NZ8 B;  4A6H A;  5C79 A;  2NMB A;  2COF A;  2LOZ A;  1X05 A;  2NBV A;  1H4R A;  2FJL A;  2FJU B;  2Y8F A;  2YT2 A;  1H10 A;  2I5F A;  4D6W A;  3N7C A;  3TVV A;  4WVF B;  5JLJ B;  4D0N B;  2Z0O A;  1U5E A;  1MK9 B;  1LB1 A;  4HDO A;  2EMT A;  2M38 A;  1V89 A;  2YSZ A;  5JP4 A;  4QJ3 B;  4K81 A;  3FEH A;  1UNR A;  2Z59 A;  4IAP A;  2UZR A;  2CY4 A;  1X1G A;  2ADZ A;  3T06 A;  4GMV A;  2D11 A;  1FHW A;  1QC6 A;  1UNP A;  2RSG A;  1J0W A;  3DXC A;  2PZ1 A;  1Y19 B;  1Y5O A;  2YF0 A;  4KHB A;  4DIX A;  1X1F A;  3IVF A;  2AEH A;  4HDQ A;  2GUM A;  2VRW B;  3QWM A;  4XWX A;  4ZRJ A;  1ZSQ A;  1AWE A;  4HB0 B;  2IFS A;  5FI0 A;  1FB8 A;  2Z0P A;  3M1I B;  3RCP A;  2KCJ A;  4A5K A;  1W1G A;  2COC A;  3PSC A;  4HB3 B;  1RJ2 A;  4HSI A;  1KZG A;  3A8Q A;  1FHX A;  4OT1 A;  2H7E A;  1EVH A;  4BBK A;  1XKE A;  1FGY A;  2UVM A;  1DDV A;  2N0Y A;  2LG1 A;  5C5B B;  5J3Y A;  3KY9 A;  4HAW B;  2DKQ A;  5HE0 A;  1ZVR A;  2RGN B;  5CLQ B;  3PG7 A;  1U5F A;  1GC6 A;  2COD A;  1PFJ A;  4L1R A;  2GCJ A;  2KIE A;  3PP2 A;  2EMS A;  2RRF A;  3HSA A;  1TJ6 A;  4KAX B;  3KSY A;  1ISN A;  1ZYI A;  3BIN A;  3NW8 A;  4EKU A;  4CYE A;  1U2B A;  3FM8 C;  5D3Y A;  1GG3 A;  1GC7 A;  4C0A A;  5HE1 A;  1WJ1 A;  3NWD A;  2LKO A;  5C6R A;  5DH9 B;  2GJY A;  1V5U A;  4DX8 A;  2P0H A;  1DBH A;  3U12 A;  3MDB C;  3PEG A;  3V5W A;  1U5D A;  3BJI A;  3KRW A;  1NI2 A;  1RRP B;  4HB4 B;  2RNR B;  2YS1 A;  2ZPY A;  2P0F A;  4P7I A;  4B6H A;  1P3R A;  2D9W A;  2HE7 A;  3D8F A;  4NSW A;  3SO6 A;  4K2O A;  2V76 A;  4TKN A;  5LOP B;  2RUK B;  2OTX A;  3SUZ A;  3AU5 A;  4WSF A;  1Z87 A;  2VKI A;  1DDW A;  1V88 A;  5D3X A;  4OSN A;  1EGX A;  1FAO A;  1WGQ A;  2DHJ A;  2X18 A;  5DIF B;  1MK7 B;  4K2P A;  3ZDT A;  1PLS A;  3ML4 A;  4HAV B;  2I1K A;  1ZC3 B;  1P6S A;  3PZD A;  2KUQ A;  1XOD A;  2YS3 A;  4NY0 A;  2R09 A;  2HTH B;  3ODO A;  4GN1 A;  2ELB A;  3D8E A;  4GMX B;  1NTV A;  4KHO A;  3GYO A;  4F7H A;  1KI1 B;  2K00 A;  3ULC A;  2ROV A;  2K2J A;  4PQ0 A;  4GOU A;  5HE2 A;  1SHC A;  5KQ4 A;  3PVU A;  1AQC A;  2DLW A;  1XR0 B;  3TO1 A;  3A8P A;  2J0M A;  4Z2M B;  1BAK A;  1UNQ A;  2ZKM X;  1TXD A;  3NSU A;  3ULB A;  1UPQ A;  2D9Y A;  2R2Y A;  2H7D A;  3DXD A;  1MKE A;  2MKR A;  4CHJ A;  3ODW A;  4MT7 A;  1U27 A;  2J59 M;  1PMS A;  2Z14 A;  1OQN A;  3MPX A;  1XCG A;  3TW1 A;  5I2M A;  1E5W A;  1MIX A;  2BCJ A;  2COA A;  2DKP A;  2YT1 A;  3NWF A;  2YT0 A;  4F7U P;  5I2S A;  1M7E A;  4DX9 0;  1WGU A;  1M7R A;  1W1H A;  1P5T A;  4GXB A;  4YON A;  2W2W A;  3TCA A;  2DX5 A;  2RLO A;  2D2Q A;  3VOQ A;  1Q67 A;  3X23 A; 
#chains in the Genus database with same CATH homology
 3KRX A;  2Z0Q A;  2YVC A;  4H8S A;  1J19 A;  4ZRK A;  5M4Y B;  1BTN A;  2CRF A;  2Z13 A;  2N23 A;  3QBV B;  1XD4 A;  1V5P A;  3PVL A;  2YRY A;  4Y94 A;  2K2U A;  2D9Z A;  5IRS A;  3HIE A;  2L2I A;  2OQB A;  2E2X A;  4EJN A;  4F7G A;  2Y8G A;  4QJ4 B;  3DXE A;  3P6A A;  4HAT B;  4WJ7 A;  2MDX A;  2DA0 A;  3FSS A;  2MWN B;  2KUP A;  2D10 A;  3SYX A;  2MFQ A;  3HK0 A;  4ZRI A;  2DFK A;  4L6E A;  5KCV A;  1FHO A;  4QXA B;  1WJM A;  4KHB B;  5J3T A;  2P8V A;  2W2X D;  4MK0 A;  3P7Z A;  2DYN A;  3WA0 A;  4A6F A;  2AL6 A;  1DYN A;  1DRO A;  1QQG A;  2LOX A;  5HE3 A;  1N3H A;  4EMO A;  2P0D A;  1FOE A;  2D4Q A;  1UPR A;  1IRS A;  1BTK A;  2Q13 A;  1B55 A;  2QKM A;  4DBB A;  5D3V A;  3TFM A;  2D9X A;  4TYZ A;  2KIG A;  3A98 B;  2GCL A;  5LG4 B;  3LJU X;  1MAI A;  1W1D A;  4DXA B;  3CIK A;  4KVG B;  3G9W A;  2L1C A;  1FGZ A;  5L81 A;  1U29 A;  3OHM B;  1ZM0 A;  2EJ8 A;  3ODX A;  1UEF A;  1WI1 A;  5KQ1 A;  2M14 A;  4Z2N A;  3FVC A;  5J3Q A;  2EC1 A;  5LON B;  3GYP A;  1OY2 A;  4CSQ A;  4KHA A;  1WG7 A;  2ELA A;  4PNK A;  5CLL B;  2DHK A;  2I5C A;  1DDM A;  1MIZ B;  2GS0 A;  3SNH A;  2Y7B A;  2W2X C;  2J0K A;  5DHA B;  5DI9 B;  2ROZ B;  3PVW A;  2LYD A;  2YS5 A;  3HQC A;  4HAY B;  4GPT B;  1WVH A;  1NTY A;  4HAZ B;  5JHH A;  1K5G B;  2DYQ A;  5EFX A;  1SGH A;  3AJ4 A;  1MPH A;  2I1J A;  4HHV A;  1TQZ A;  5DHF B;  4CHM A;  2K49 A;  5JHG A;  1BWN A;  1V61 A;  2RVB B;  2XQN M;  3HW2 B;  3UZT A;  5C16 A;  1XX0 A;  2DN6 A;  3A58 A;  2DTC A;  1K5D B;  2VSZ A;  3QIJ A;  4IFS A;  1EAZ A;  3U7D A;  4HAX B;  4MY6 A;  3F0W A;  3CXB B;  3ZVR A;  2KR0 A;  5D3W A;  3U8Z A;  4QJ5 B;  1U5G A;  3SV1 A;  1X86 A;  1ZC4 B;  2QKL A;  2G35 A;  3AU4 A;  4A6K A;  2LUL A;  1I7A A;  3WYF B;  4HAU B;  2Z4D A;  4K17 A;  2R0D A;  1LW3 A;  1X11 A;  1NU2 A;  2JP2 A;  3D8D A;  4IOY X;  5FI1 A;  5C5B A;  4HB2 B;  3KZ1 A;  1KZ7 A;  2K8E A;  1V5M A;  4A6F B;  3O96 A;  1EF1 A;  3OAN A;  1OMW A;  2D9V A;  2J0J A;  2CAY A;  2DHI A;  1I2H A;  2CY5 A;  3F5R A;  3NWA A;  4GNK B;  4YL8 A;  3VIA A;  2DX1 A;  5D27 A;  2UZS A;  4GZU A;  5GOW B;  2KGX B;  2IYB A;  2NZ8 B;  4A6H A;  5C79 A;  2NMB A;  2COF A;  2LOZ A;  1X05 A;  2NBV A;  1H4R A;  2FJL A;  2FJU B;  2Y8F A;  2YT2 A;  1H10 A;  2I5F A;  4D6W A;  3N7C A;  3TVV A;  4WVF B;  5JLJ B;  4D0N B;  2Z0O A;  1U5E A;  1MK9 B;  1LB1 A;  4HDO A;  2EMT A;  2M38 A;  1V89 A;  2YSZ A;  5JP4 A;  4QJ3 B;  4K81 A;  3FEH A;  1UNR A;  2Z59 A;  4IAP A;  2UZR A;  2CY4 A;  1X1G A;  2ADZ A;  3T06 A;  4GMV A;  2D11 A;  1FHW A;  1QC6 A;  1UNP A;  2RSG A;  1J0W A;  3DXC A;  2PZ1 A;  1Y19 B;  1Y5O A;  2YF0 A;  4KHB A;  4DIX A;  1X1F A;  3IVF A;  2AEH A;  4HDQ A;  2VRW B;  3QWM A;  4XWX A;  4ZRJ A;  2GUM A;  1ZSQ A;  1AWE A;  4HB0 B;  2IFS A;  5FI0 A;  1FB8 A;  2Z0P A;  3M1I B;  3RCP A;  2KCJ A;  4A5K A;  1W1G A;  2COC A;  3PSC A;  4HB3 B;  1RJ2 A;  4HSI A;  1KZG A;  3A8Q A;  1FHX A;  4OT1 A;  2H7E A;  1EVH A;  4BBK A;  1XKE A;  1FGY A;  2UVM A;  1DDV A;  2N0Y A;  2LG1 A;  5C5B B;  5J3Y A;  3KY9 A;  4HAW B;  2DKQ A;  5HE0 A;  1ZVR A;  2RGN B;  5CLQ B;  3PG7 A;  1U5F A;  1GC6 A;  2COD A;  1PFJ A;  4L1R A;  2GCJ A;  2KIE A;  3PP2 A;  2EMS A;  2RRF A;  1TJ6 A;  4KAX B;  3KSY A;  1ISN A;  3BIN A;  1ZYI A;  3NW8 A;  4EKU A;  4CYE A;  1U2B A;  3FM8 C;  5D3Y A;  1GG3 A;  1GC7 A;  4C0A A;  5HE1 A;  1WJ1 A;  3NWD A;  2LKO A;  5C6R A;  5DH9 B;  2GJY A;  1V5U A;  4DX8 A;  2P0H A;  1DBH A;  3U12 A;  3MDB C;  3PEG A;  3V5W A;  1U5D A;  3BJI A;  3KRW A;  1NI2 A;  1RRP B;  4HB4 B;  2RNR B;  2YS1 A;  2ZPY A;  2P0F A;  4P7I A;  4B6H A;  1P3R A;  2D9W A;  2HE7 A;  3D8F A;  4NSW A;  3SO6 A;  4K2O A;  2V76 A;  4TKN A;  5LOP B;  2RUK B;  2OTX A;  3SUZ A;  3AU5 A;  4WSF A;  1Z87 A;  2VKI A;  1DDW A;  1V88 A;  5D3X A;  4OSN A;  1EGX A;  1FAO A;  1WGQ A;  2DHJ A;  2X18 A;  5DIF B;  1MK7 B;  4K2P A;  3ZDT A;  1PLS A;  3ML4 A;  4HAV B;  2I1K A;  1ZC3 B;  1P6S A;  3PZD A;  2KUQ A;  1XOD A;  2YS3 A;  4NY0 A;  2R09 A;  2HTH B;  3ODO A;  4GN1 A;  2ELB A;  3D8E A;  4GMX B;  1NTV A;  4KHO A;  3GYO A;  4F7H A;  1KI1 B;  2K00 A;  3ULC A;  2ROV A;  2K2J A;  4PQ0 A;  4GOU A;  5HE2 A;  1SHC A;  5KQ4 A;  3PVU A;  1AQC A;  2DLW A;  1XR0 B;  3TO1 A;  3A8P A;  2J0M A;  4Z2M B;  1BAK A;  1UNQ A;  2ZKM X;  1TXD A;  3NSU A;  3ULB A;  1UPQ A;  2D9Y A;  2R2Y A;  2H7D A;  3DXD A;  1MKE A;  2MKR A;  4CHJ A;  3ODW A;  4MT7 A;  1U27 A;  2J59 M;  1PMS A;  2Z14 A;  1OQN A;  3MPX A;  1XCG A;  3TW1 A;  5I2M A;  1E5W A;  1MIX A;  2BCJ A;  2COA A;  2DKP A;  2YT1 A;  3NWF A;  2YT0 A;  4F7U P;  5I2S A;  1M7E A;  4DX9 0;  1WGU A;  1M7R A;  1W1H A;  1P5T A;  4GXB A;  4YON A;  2W2W A;  3TCA A;  2DX5 A;  2RLO A;  2D2Q A;  3VOQ A;  1Q67 A;  3X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...