3FSSA

Structure of the tandem ph domains of rtt106
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
total genus 57
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2009-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3fssA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3fssA01
1U5GA 5FI1A 1K5GB 2Z0QA 3HQCA 2W2WA 2YSZA 5CLLB 5HE2A 2PZ1A 2RSGA 5C16A 1MK7B 4GXBA 2IFSA 4HB0B 2E2XA 1UPQA 4ZRJA 3AU4A 5C5BB 1UNRA 2KUPA 1U2BA 2LOZA 5DI9B 2HTHB 2R0DA 1V61A 2DYNA 5HE3A 3PVWA 2BCJA 2XQNM 1MK9B 2YS1A 2D10A 2LULA 2YS5A 4YONA 4K2OA 2MDXA 1QQGA 5CLQB 3SNHA 1FHWA 1UNQA 4GMVA 1XR0B 1ZM0A 4HDOA 4HB2B 2K2UA 1KI1B 3RCPA 5KCVA 1WJ1A 1KZGA 3SV1A 5DHFB 1U27A 2COAA 5DHAB 3AJ4A 4KHAA 3NSUA 2LYDA 5HE1A 2DKQA 2KGXB 4HAYB 3VIAA 2G35A 4DX90 2LKOA 3TFMA 5D3YA 3KRXA 5J3TA 2DTCA 4CHMA 3DXEA 4D0NB 2H7EA 4EJNA 4XWXA 4B6HA 1FHXA 4GZUA 4HAWB 1DYNA 4MK0A 4PQ0A 2P0DA 2CY4A 4HHVA 2CRFA 2HE7A 1RRPB 1NTYA 1PLSA 2N23A 2GS0A 3KZ1A 4GN1A 2YT1A 3SO6A 2RVBB 4KHOA 2ROZB 2ZPYA 3KY9A 1P5TA 1WI1A 2L2IA 5JLJB 1XKEA 2COCA 1DBHA 1XODA 1H10A 1AWEA 2RUKB 1UPRA 1Y19B 2AEHA 3SUZA 1NI2A 4EKUA 4CYEA 1TXDA 3PVUA 1GC6A 5JHGA 3D8FA 3ULCA 1MKEA 4IAPA 1UEFA 1V88A 1W1GA 1BWNA 3P6AA 5KQ1A 4A6HA 3UZTA 3A8PA 1GC7A 2AL6A 4Y94A 1UNPA 1J19A 1X05A 3CXBB 3TO1A 2M38A 4A6FA 1X86A 2EMTA 2I5FA 4K17A 2GCLA 1SGHA 1WJMA 3ODXA 5C79A 3CIKA 2GJYA 2MFQA 3QIJA 4A5KA 2DA0A 4HAZB 1FGYA 3HW2B 2D9ZA 3VOQA 1P3RA 2CY5A 2J59M 5J3YA 1X1GA 1U5DA 4BBKA 4EMOA 3DXCA 1TQZA 1OQNA 3BJIA 2EC1A 2W2XC 2ELAA 3KRWA 5L81A 2I5CA 3GYOA 2DLWA 2Y8GA 1BTKA 2UVMA 5DH9B 1FOEA 3WA0A 1W1HA 4A6KA 2Z0OA 4F7UP 2D2QA 1XCGA 5D3WA 2LG1A 2RGNB 2COFA 4MT7A 2Q13A 1DDWA 1ZSQA 4IFSA 2IYBA 2ELBA 3U7DA 1K5DB 2VSZA 1MIZB 1Y5OA 1X11A 2D9XA 3OANA 2RNRB 4C0AA 2K2JA 2N0YA 4P7IA 5C6RA 1OY2A 5D3XA 1W1DA 1PFJA 3PZDA 2Y8FA 2YVCA 1B55A 4DXAB 1WG7A 1TJ6A 1Q67A 2I1JA 2NMBA 4KHBB 2ROVA 1P6SA 2M14A 3ULBA 1M7EA 5D3VA 4HAVB 4A6FB 4WJ7A 1U5FA 2I1KA 4L6EA 2YRYA 2DHJA 3A8QA 3PP2A 3N7CA 2QKLA 1ZC3B 4Z2MB 1ISNA 2DHIA 1MIXA 2CODA 5LOPB 3O96A 4YL8A 1J0WA 1XD4A 4ZRKA 1EVHA 1X1FA 5KQ4A 3BINA 1ZVRA 3TW1A 4F7GA 5JHHA 2P8VA 3WYFB 3PEGA 3FSSA 2L1CA 2MKRA 5HE0A 1V5UA 2R09A 2DFKA 3AU5A 3GYPA 3ODOA 4PNKA 2QKMA 2LOXA 3X23A 4GMXB 1FGZA 3F5RA 4DBBA 4WSFA 2D4QA 4H8SA 3IVFA 2DX5A 2EJ8A 1SHCA 2DHKA 3ZDTA 4K2PA 2UZRA 2D11A 2W2XD 1RJ2A 4HB3B 4CHJA 1NTVA 2KCJA 4HDQA 4NY0A 5J3QA 3ML4A 2D9YA 3V5WA 1IRSA 2P0HA 4HAXB 1U5EA 3DXDA 3F0WA 2ADZA 1DDVA 4K81A 5D27A 1N3HA 3PVLA 3QWMA 4Z2NA 1WGUA 2NZ8B 1DDMA 1BTNA 3MDBC 4HAUB 1MPHA 4HATB 2DKPA 1GG3A 5GOWB 5FI0A 3QBVB 1LB1A 2J0MA 3D8DA 2J0JA 2FJLA 3M1IB 2OQBA 5EFXA 2CAYA 4ZRIA 1FAOA 1QC6A 3T06A 2Y7BA 1LW3A 4F7HA 1XX0A 1EF1A 1V5PA 1V89A 1AQCA 1E5WA 1ZC4B 5LONB 1FHOA 2D9VA 2VRWB 3HK0A 1U29A 2DYQA 1I2HA 1PMSA 1KZ7A 3A98B 1H4RA 4WVFB 1I7AA 1Z87A 2GCJA 2OTXA 2YS3A 2K00A 2JP2A 1DROA 3TVVA 3D8EA 2EMSA 2Z0PA 3PG7A 3PSCA 3G9WA 4TYZA 3U8ZA 1V5MA 3FEHA 1EAZA 1NU2A 4MY6A 3TCAA 4DX8A 1WVHA 2D9WA 2UZSA 2H7DA 3LJUX 1FB8A 1OMWA 5C5BA 2MWNB 3FM8C 3ODWA 2J0KA 3KSYA 4KAXB 4IOYX 4NSWA 1BAKA 2DN6A 1EGXA 2X18A 3MPXA 1MAIA 2YT0A 1WGQA 4GPTB 4TKNA 2P0FA 2VKIA 3SYXA 2YF0A 3ZVRA 4HB4B 2DX1A 5DIFB 5JP4A 4KVGB 1M7RA 3P7ZA 2RLOA 2V76A
chains in the Genus database with same CATH superfamily
1U5GA 5FI1A 1K5GB 2Z0QA 3HQCA 2W2WA 2YSZA 5CLLB 3HIEA 2Z13A 5HE2A 2PZ1A 2RSGA 5C16A 1MK7B 2K8EA 4GXBA 2IFSA 4HB0B 2E2XA 1UPQA 2YT2A 4ZRJA 3AU4A 5C5BB 1UNRA 2KUPA 1U2BA 2LOZA 5DI9B 2HTHB 2R0DA 1V61A 2DYNA 5HE3A 3PVWA 2BCJA 2XQNM 1MK9B 2YS1A 4DIXA 2D10A 2LULA 2YS5A 3NWDA 4YONA 4K2OA 2MDXA 1QQGA 5CLQB 3SNHA 2R2YA 1FHWA 1UNQA 4GMVA 1XR0B 1ZM0A 4HDOA 4HB2B 2K2UA 1KI1B 3RCPA 5KCVA 1WJ1A 1KZGA 3SV1A 3B77A 5DHFB 1U27A 2COAA 5DHAB 3AJ4A 4KHAA 3NSUA 2LYDA 5HE1A 2DKQA 5I2SA 2KGXB 4HAYB 3VIAA 2G35A 4DX90 2LKOA 3TFMA 5D3YA 3KRXA 4D6WA 2K49A 5J3TA 2DTCA 4CHMA 3DXEA 4D0NB 2H7EA 3OHMB 4EJNA 4XWXA 4B6HA 1FHXA 4GZUA 4HAWB 1DYNA 4MK0A 4PQ0A 2P0DA 2CY4A 4HHVA 2CRFA 2HE7A 1RRPB 1NTYA 1PLSA 2N23A 2GS0A 3KZ1A 4GN1A 2YT1A 3SO6A 2RVBB 4KHOA 2ROZB 2ZPYA 3KY9A 1P5TA 1WI1A 2L2IA 3NWAA 5JLJB 1XKEA 2COCA 1DBHA 1XODA 1H10A 1AWEA 2RUKB 1UPRA 1Y19B 2AEHA 3SUZA 1NI2A 4EKUA 4CYEA 1TXDA 3PVUA 1GC6A 5JHGA 3D8FA 3ULCA 4CSQA 1MKEA 2KR0A 4QJ3B 4IAPA 1UEFA 1V88A 1W1GA 4HSIA 2ZKMX 1BWNA 3P6AA 5KQ1A 4A6HA 3UZTA 3A8PA 1GC7A 2AL6A 4Y94A 1UNPA 1J19A 1X05A 3CXBB 3TO1A 2M38A 4A6FA 1X86A 2EMTA 2I5FA 4K17A 2GCLA 1SGHA 1WJMA 3ODXA 5C79A 3CIKA 2GJYA 2MFQA 3QIJA 4A5KA 2DA0A 4HAZB 1FGYA 3HW2B 2D9ZA 3VOQA 1P3RA 2CY5A 2Z14A 2J59M 5J3YA 4GOUA 5LG4B 1X1GA 1U5DA 4BBKA 4EMOA 3DXCA 1TQZA 1OQNA 3BJIA 2EC1A 2W2XC 2ELAA 3KRWA 5L81A 2I5CA 3GYOA 2DLWA 2Y8GA 3HSAA 1BTKA 4QJ4B 2UVMA 5DH9B 1FOEA 3WA0A 1W1HA 4A6KA 2Z0OA 4F7UP 2D2QA 1XCGA 5M4YB 5D3WA 2LG1A 2RGNB 2COFA 4MT7A 2Q13A 5I2MA 1DDWA 1ZSQA 4IFSA 2IYBA 2ELBA 3U7DA 1K5DB 2VSZA 1MIZB 1Y5OA 1X11A 2D9XA 3OANA 2RNRB 4C0AA 3DCXA 2K2JA 2N0YA 4P7IA 5C6RA 1OY2A 5D3XA 1W1DA 1PFJA 3PZDA 2Y8FA 2YVCA 1B55A 4DXAB 1WG7A 1TJ6A 1Q67A 2I1JA 4GNKB 2FJUB 2NMBA 4KHBB 2RRFA 2ROVA 1P6SA 2KIEA 2M14A 3ULBA 1M7EA 5D3VA 4HAVB 4A6FB 4WJ7A 1U5FA 2I1KA 4L6EA 2YRYA 2DHJA 3A8QA 3PP2A 3N7CA 2QKLA 1ZC3B 4Z2MB 4KHBA 1ISNA 2DHIA 1MIXA 2CODA 5LOPB 3O96A 4YL8A 1J0WA 1XD4A 4ZRKA 1EVHA 1X1FA 5KQ4A 3BINA 1ZVRA 3TW1A 4F7GA 5JHHA 2P8VA 3WYFB 3PEGA 3FSSA 3NWFA 2L1CA 2MKRA 5HE0A 1V5UA 2R09A 2DFKA 3AU5A 3GYPA 3ODOA 4PNKA 2QKMA 2LOXA 3X23A 4GMXB 1FGZA 2GUMA 3F5RA 4DBBA 4WSFA 2D4QA 4H8SA 3IVFA 2DX5A 2EJ8A 4QJ5B 1SHCA 2DHKA 3ZDTA 4K2PA 2UZRA 2D11A 2W2XD 1RJ2A 4HB3B 4CHJA 1NTVA 2KCJA 4HDQA 4NY0A 5J3QA 3ML4A 2D9YA 2Z59A 3V5WA 1T77A 1IRSA 2P0HA 4HAXB 1U5EA 3DXDA 3F0WA 2ADZA 1DDVA 4K81A 5D27A 1N3HA 4L1RA 5IRSA 3PVLA 3QWMA 4Z2NA 1WGUA 2NZ8B 1DDMA 1BTNA 3MDBC 4HAUB 1MPHA 4HATB 2DKPA 1GG3A 5GOWB 5FI0A 3QBVB 1LB1A 2Z4DA 2J0MA 3D8DA 2J0JA 2NBVA 2FJLA 3M1IB 2OQBA 5EFXA 2CAYA 4ZRIA 1FAOA 1QC6A 3T06A 2Y7BA 1LW3A 4F7HA 1XX0A 4OT1A 1EF1A 1V5PA 1V89A 1AQCA 1E5WA 1ZC4B 5LONB 1FHOA 2D9VA 2VRWB 3HK0A 1U29A 2DYQA 3FVCA 1I2HA 1PMSA 1KZ7A 3A98B 1H4RA 4WVFB 1I7AA 1Z87A 2KUQA 3NW8A 2KIGA 2GCJA 2OTXA 2YS3A 2K00A 2JP2A 1DROA 3TVVA 3D8EA 2EMSA 2Z0PA 3PSCA 3PG7A 3G9WA 4TYZA 3U8ZA 1V5MA 3FEHA 4OSNA 1EAZA 1NU2A 4MY6A 3TCAA 4DX8A 1WVHA 2D9WA 2UZSA 2H7DA 3LJUX 1FB8A 1OMWA 1ZYIA 5C5BA 2MWNB 3FM8C 3ODWA 2J0KA 3A58A 3U12A 3KSYA 4KAXB 4IOYX 4NSWA 1BAKA 2DN6A 1EGXA 2X18A 3MPXA 1MAIA 2YT0A 1WGQA 4GPTB 4TKNA 2P0FA 1MI1A 2VKIA 3SYXA 2YF0A 3ZVRA 4HB4B 2DX1A 5DIFB 5JP4A 4KVGB 1M7RA 4QXAB 3P7ZA 2RLOA 2V76A
chains in the Genus database with same CATH topology
1U5GA 5FI1A 1K5GB 2Z0QA 3HQCA 2W2WA 2YSZA 5CLLB 3HIEA 2Z13A 5HE2A 2PZ1A 2RSGA 5C16A 1MK7B 2K8EA 4GXBA 2IFSA 4HB0B 2E2XA 1UPQA 2YT2A 4ZRJA 3AU4A 5C5BB 1UNRA 2KUPA 1U2BA 2LOZA 5DI9B 2HTHB 2R0DA 1V61A 2DYNA 5HE3A 3PVWA 2BCJA 2XQNM 1MK9B 2YS1A 4DIXA 2D10A 2LULA 2YS5A 3NWDA 4YONA 4K2OA 2MDXA 1QQGA 5CLQB 3SNHA 2R2YA 1FHWA 1UNQA 4GMVA 1XR0B 1ZM0A 4HDOA 4HB2B 2K2UA 1KI1B 3RCPA 5KCVA 1WJ1A 1KZGA 3SV1A 5DHFB 1U27A 2COAA 5DHAB 3AJ4A 4KHAA 3NSUA 2LYDA 5HE1A 2DKQA 5I2SA 2KGXB 4HAYB 3VIAA 2G35A 4DX90 2LKOA 3TFMA 5D3YA 3KRXA 4D6WA 5J3TA 2K49A 2DTCA 4CHMA 3DXEA 4D0NB 2H7EA 3OHMB 4EJNA 4XWXA 4B6HA 1FHXA 4GZUA 4HAWB 1DYNA 4MK0A 4PQ0A 2P0DA 2CY4A 4HHVA 2CRFA 2HE7A 1RRPB 1NTYA 1PLSA 2N23A 2GS0A 3KZ1A 4GN1A 2YT1A 3SO6A 2RVBB 4KHOA 2ROZB 2ZPYA 3KY9A 1P5TA 1WI1A 2L2IA 3NWAA 5JLJB 1XKEA 2COCA 1DBHA 1XODA 1H10A 1AWEA 2RUKB 1UPRA 1Y19B 2AEHA 3SUZA 1NI2A 4EKUA 4CYEA 1TXDA 3PVUA 1GC6A 5JHGA 3D8FA 3ULCA 4CSQA 1MKEA 2KR0A 4QJ3B 4IAPA 1UEFA 1V88A 1W1GA 4HSIA 2ZKMX 1BWNA 3P6AA 5KQ1A 4A6HA 3UZTA 3A8PA 1GC7A 2AL6A 4Y94A 1UNPA 1J19A 1X05A 3CXBB 3TO1A 2M38A 4A6FA 1X86A 2EMTA 2I5FA 4K17A 2GCLA 1SGHA 1WJMA 3ODXA 5C79A 3CIKA 2GJYA 2MFQA 3QIJA 4A5KA 2DA0A 4HAZB 1FGYA 3HW2B 2D9ZA 3VOQA 1P3RA 2CY5A 2Z14A 2J59M 5J3YA 4GOUA 5LG4B 1X1GA 1U5DA 4BBKA 4EMOA 3DXCA 1TQZA 1OQNA 3BJIA 2EC1A 2W2XC 2ELAA 3KRWA 5L81A 2I5CA 3GYOA 2DLWA 2Y8GA 1BTKA 4QJ4B 2UVMA 5DH9B 1FOEA 3WA0A 1W1HA 4A6KA 2Z0OA 4F7UP 2D2QA 1XCGA 5M4YB 5D3WA 2LG1A 2RGNB 2COFA 4MT7A 2Q13A 5I2MA 1DDWA 1ZSQA 4IFSA 2IYBA 2ELBA 3U7DA 1K5DB 2VSZA 1MIZB 1Y5OA 1X11A 2D9XA 3OANA 2RNRB 4C0AA 2K2JA 2N0YA 4P7IA 5C6RA 1OY2A 5D3XA 1W1DA 1PFJA 3PZDA 2Y8FA 2YVCA 1B55A 4DXAB 1WG7A 1TJ6A 1Q67A 2I1JA 4GNKB 2FJUB 2NMBA 4KHBB 2RRFA 2ROVA 1P6SA 2KIEA 2M14A 3ULBA 1M7EA 5D3VA 4HAVB 4A6FB 4WJ7A 1U5FA 2I1KA 4L6EA 2YRYA 2DHJA 3A8QA 3PP2A 3N7CA 2QKLA 1ZC3B 4Z2MB 4KHBA 1ISNA 2DHIA 1MIXA 2CODA 5LOPB 3O96A 4YL8A 1J0WA 1XD4A 4ZRKA 1EVHA 1X1FA 5KQ4A 3BINA 1ZVRA 3TW1A 4F7GA 5JHHA 2P8VA 3WYFB 3PEGA 3FSSA 3NWFA 2L1CA 2MKRA 5HE0A 1V5UA 2R09A 2DFKA 3AU5A 3GYPA 3ODOA 4PNKA 2QKMA 2LOXA 3X23A 4GMXB 1FGZA 2GUMA 3F5RA 4DBBA 4WSFA 2D4QA 4H8SA 3IVFA 2DX5A 2EJ8A 4QJ5B 1SHCA 2DHKA 3ZDTA 4K2PA 2UZRA 2D11A 2W2XD 1RJ2A 4HB3B 4CHJA 1NTVA 2KCJA 4HDQA 4NY0A 5J3QA 3ML4A 2D9YA 3V5WA 2Z59A 1IRSA 2P0HA 4HAXB 1U5EA 3DXDA 3F0WA 2ADZA 1DDVA 4K81A 5D27A 1N3HA 4L1RA 5IRSA 3PVLA 3QWMA 4Z2NA 1WGUA 2NZ8B 1DDMA 1BTNA 3MDBC 4HAUB 1MPHA 4HATB 2DKPA 1GG3A 5GOWB 5FI0A 3QBVB 1LB1A 2Z4DA 2J0MA 3D8DA 2J0JA 2NBVA 2FJLA 3M1IB 2OQBA 5EFXA 2CAYA 4ZRIA 1FAOA 1QC6A 3T06A 2Y7BA 1LW3A 4F7HA 1XX0A 4OT1A 1EF1A 1V5PA 1V89A 1AQCA 1E5WA 1ZC4B 5LONB 1FHOA 2D9VA 2VRWB 3HK0A 1U29A 2DYQA 3FVCA 1I2HA 1PMSA 1KZ7A 3A98B 1H4RA 4WVFB 1I7AA 1Z87A 2KUQA 3NW8A 2KIGA 2GCJA 2OTXA 2YS3A 2K00A 2JP2A 1DROA 3TVVA 3D8EA 2EMSA 2Z0PA 3PG7A 3PSCA 3G9WA 4TYZA 3U8ZA 1V5MA 3FEHA 4OSNA 1EAZA 1NU2A 4MY6A 3TCAA 4DX8A 1WVHA 2D9WA 2UZSA 2H7DA 3LJUX 1FB8A 1OMWA 1ZYIA 5C5BA 2MWNB 3FM8C 3ODWA 2J0KA 3A58A 3U12A 3KSYA 4KAXB 4IOYX 4NSWA 1BAKA 2DN6A 1EGXA 2X18A 3MPXA 1MAIA 2YT0A 1WGQA 4GPTB 4TKNA 2P0FA 2VKIA 3SYXA 2YF0A 3ZVRA 4HB4B 2DX1A 5DIFB 5JP4A 4KVGB 1M7RA 4QXAB 3P7ZA 2RLOA 2V76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5G A;  5FI1 A;  1K5G B;  2Z0Q A;  3HQC A;  2W2W A;  2YSZ A;  5CLL B;  5HE2 A;  2PZ1 A;  2RSG A;  5C16 A;  1MK7 B;  4GXB A;  2IFS A;  4HB0 B;  2E2X A;  1UPQ A;  4ZRJ A;  3AU4 A;  5C5B B;  1UNR A;  2KUP A;  1U2B A;  2LOZ A;  5DI9 B;  2HTH B;  2R0D A;  1V61 A;  2DYN A;  5HE3 A;  3PVW A;  2BCJ A;  2XQN M;  1MK9 B;  2YS1 A;  2D10 A;  2LUL A;  2YS5 A;  4YON A;  4K2O A;  2MDX A;  1QQG A;  5CLQ B;  3SNH A;  1FHW A;  1UNQ A;  4GMV A;  1XR0 B;  1ZM0 A;  4HDO A;  4HB2 B;  2K2U A;  1KI1 B;  3RCP A;  5KCV A;  1WJ1 A;  1KZG A;  3SV1 A;  5DHF B;  1U27 A;  2COA A;  5DHA B;  3AJ4 A;  4KHA A;  3NSU A;  2LYD A;  5HE1 A;  2DKQ A;  2KGX B;  4HAY B;  3VIA A;  2G35 A;  4DX9 0;  2LKO A;  3TFM A;  5D3Y A;  3KRX A;  5J3T A;  2DTC A;  4CHM A;  3DXE A;  4D0N B;  2H7E A;  4EJN A;  4XWX A;  4B6H A;  1FHX A;  4GZU A;  4HAW B;  1DYN A;  4MK0 A;  4PQ0 A;  2P0D A;  2CY4 A;  4HHV A;  2CRF A;  2HE7 A;  1RRP B;  1NTY A;  1PLS A;  2N23 A;  2GS0 A;  3KZ1 A;  4GN1 A;  2YT1 A;  3SO6 A;  2RVB B;  4KHO A;  2ROZ B;  2ZPY A;  3KY9 A;  1P5T A;  1WI1 A;  2L2I A;  5JLJ B;  1XKE A;  2COC A;  1DBH A;  1XOD A;  1H10 A;  1AWE A;  2RUK B;  1UPR A;  1Y19 B;  2AEH A;  3SUZ A;  1NI2 A;  4EKU A;  4CYE A;  1TXD A;  3PVU A;  1GC6 A;  5JHG A;  3D8F A;  3ULC A;  1MKE A;  4IAP A;  1UEF A;  1V88 A;  1W1G A;  1BWN A;  3P6A A;  5KQ1 A;  4A6H A;  3UZT A;  3A8P A;  1GC7 A;  2AL6 A;  4Y94 A;  1UNP A;  1J19 A;  1X05 A;  3CXB B;  3TO1 A;  2M38 A;  4A6F A;  1X86 A;  2EMT A;  2I5F A;  4K17 A;  2GCL A;  1SGH A;  1WJM A;  3ODX A;  5C79 A;  3CIK A;  2GJY A;  2MFQ A;  3QIJ A;  4A5K A;  2DA0 A;  4HAZ B;  1FGY A;  3HW2 B;  2D9Z A;  3VOQ A;  1P3R A;  2CY5 A;  2J59 M;  5J3Y A;  1X1G A;  1U5D A;  4BBK A;  4EMO A;  3DXC A;  1TQZ A;  1OQN A;  3BJI A;  2EC1 A;  2W2X C;  2ELA A;  3KRW A;  5L81 A;  2I5C A;  3GYO A;  2DLW A;  2Y8G A;  1BTK A;  2UVM A;  5DH9 B;  1FOE A;  3WA0 A;  1W1H A;  4A6K A;  2Z0O A;  4F7U P;  2D2Q A;  1XCG A;  5D3W A;  2LG1 A;  2RGN B;  2COF A;  4MT7 A;  2Q13 A;  1DDW A;  1ZSQ A;  4IFS A;  2IYB A;  2ELB A;  3U7D A;  1K5D B;  2VSZ A;  1MIZ B;  1Y5O A;  1X11 A;  2D9X A;  3OAN A;  2RNR B;  4C0A A;  2K2J A;  2N0Y A;  4P7I A;  5C6R A;  1OY2 A;  5D3X A;  1W1D A;  1PFJ A;  3PZD A;  2Y8F A;  2YVC A;  1B55 A;  4DXA B;  1WG7 A;  1TJ6 A;  1Q67 A;  2I1J A;  2NMB A;  4KHB B;  2ROV A;  1P6S A;  2M14 A;  3ULB A;  1M7E A;  5D3V A;  4HAV B;  4A6F B;  4WJ7 A;  1U5F A;  2I1K A;  4L6E A;  2YRY A;  2DHJ A;  3A8Q A;  3PP2 A;  3N7C A;  2QKL A;  1ZC3 B;  4Z2M B;  1ISN A;  2DHI A;  1MIX A;  2COD A;  5LOP B;  3O96 A;  4YL8 A;  1J0W A;  1XD4 A;  4ZRK A;  1EVH A;  1X1F A;  5KQ4 A;  3BIN A;  1ZVR A;  3TW1 A;  4F7G A;  5JHH A;  2P8V A;  3WYF B;  3PEG A;  3FSS A;  2L1C A;  2MKR A;  5HE0 A;  1V5U A;  2R09 A;  2DFK A;  3AU5 A;  3GYP A;  3ODO A;  4PNK A;  2QKM A;  2LOX A;  3X23 A;  4GMX B;  1FGZ A;  3F5R A;  4DBB A;  4WSF A;  2D4Q A;  4H8S A;  3IVF A;  2DX5 A;  2EJ8 A;  1SHC A;  2DHK A;  3ZDT A;  4K2P A;  2UZR A;  2D11 A;  2W2X D;  1RJ2 A;  4HB3 B;  4CHJ A;  1NTV A;  2KCJ A;  4HDQ A;  4NY0 A;  5J3Q A;  3ML4 A;  2D9Y A;  3V5W A;  1IRS A;  2P0H A;  4HAX B;  1U5E A;  3DXD A;  3F0W A;  2ADZ A;  1DDV A;  4K81 A;  5D27 A;  1N3H A;  3PVL A;  3QWM A;  4Z2N A;  1WGU A;  2NZ8 B;  1DDM A;  1BTN A;  3MDB C;  4HAU B;  1MPH A;  4HAT B;  2DKP A;  1GG3 A;  5GOW B;  5FI0 A;  3QBV B;  1LB1 A;  2J0M A;  3D8D A;  2J0J A;  2FJL A;  3M1I B;  2OQB A;  5EFX A;  2CAY A;  4ZRI A;  1FAO A;  1QC6 A;  3T06 A;  2Y7B A;  1LW3 A;  4F7H A;  1XX0 A;  1EF1 A;  1V5P A;  1V89 A;  1AQC A;  1E5W A;  1ZC4 B;  5LON B;  1FHO A;  2D9V A;  2VRW B;  3HK0 A;  1U29 A;  2DYQ A;  1I2H A;  1PMS A;  1KZ7 A;  3A98 B;  1H4R A;  4WVF B;  1I7A A;  1Z87 A;  2GCJ A;  2OTX A;  2YS3 A;  2K00 A;  2JP2 A;  1DRO A;  3TVV A;  3D8E A;  2EMS A;  2Z0P A;  3PG7 A;  3PSC A;  3G9W A;  4TYZ A;  3U8Z A;  1V5M A;  3FEH A;  1EAZ A;  1NU2 A;  4MY6 A;  3TCA A;  4DX8 A;  1WVH A;  2D9W A;  2UZS A;  2H7D A;  3LJU X;  1FB8 A;  1OMW A;  5C5B A;  2MWN B;  3FM8 C;  3ODW A;  2J0K A;  3KSY A;  4KAX B;  4IOY X;  4NSW A;  1BAK A;  2DN6 A;  1EGX A;  2X18 A;  3MPX A;  1MAI A;  2YT0 A;  1WGQ A;  4GPT B;  4TKN A;  2P0F A;  2VKI A;  3SYX A;  2YF0 A;  3ZVR A;  4HB4 B;  2DX1 A;  5DIF B;  5JP4 A;  4KVG B;  1M7R A;  3P7Z A;  2RLO A;  2V76 A; 
#chains in the Genus database with same CATH topology
 1U5G A;  5FI1 A;  1K5G B;  2Z0Q A;  3HQC A;  2W2W A;  2YSZ A;  5CLL B;  3HIE A;  2Z13 A;  5HE2 A;  2PZ1 A;  2RSG A;  5C16 A;  1MK7 B;  2K8E A;  4GXB A;  2IFS A;  4HB0 B;  2E2X A;  1UPQ A;  2YT2 A;  4ZRJ A;  3AU4 A;  5C5B B;  1UNR A;  2KUP A;  1U2B A;  2LOZ A;  5DI9 B;  2HTH B;  2R0D A;  1V61 A;  2DYN A;  5HE3 A;  3PVW A;  2BCJ A;  2XQN M;  1MK9 B;  2YS1 A;  4DIX A;  2D10 A;  2LUL A;  2YS5 A;  3NWD A;  4YON A;  4K2O A;  2MDX A;  1QQG A;  5CLQ B;  3SNH A;  2R2Y A;  1FHW A;  1UNQ A;  4GMV A;  1XR0 B;  1ZM0 A;  4HDO A;  4HB2 B;  2K2U A;  1KI1 B;  3RCP A;  5KCV A;  1WJ1 A;  1KZG A;  3SV1 A;  3B77 A;  5DHF B;  1U27 A;  2COA A;  5DHA B;  3AJ4 A;  4KHA A;  3NSU A;  2LYD A;  5HE1 A;  2DKQ A;  5I2S A;  2KGX B;  4HAY B;  3VIA A;  2G35 A;  4DX9 0;  2LKO A;  3TFM A;  5D3Y A;  3KRX A;  4D6W A;  2K49 A;  5J3T A;  2DTC A;  4CHM A;  3DXE A;  4D0N B;  2H7E A;  3OHM B;  4EJN A;  4XWX A;  4B6H A;  1FHX A;  4GZU A;  4HAW B;  1DYN A;  4MK0 A;  4PQ0 A;  2P0D A;  2CY4 A;  4HHV A;  2CRF A;  2HE7 A;  1RRP B;  1NTY A;  1PLS A;  2N23 A;  2GS0 A;  3KZ1 A;  4GN1 A;  2YT1 A;  3SO6 A;  2RVB B;  4KHO A;  2ROZ B;  2ZPY A;  3KY9 A;  1P5T A;  1WI1 A;  2L2I A;  3NWA A;  5JLJ B;  1XKE A;  2COC A;  1DBH A;  1XOD A;  1H10 A;  1AWE A;  2RUK B;  1UPR A;  1Y19 B;  2AEH A;  3SUZ A;  1NI2 A;  4EKU A;  4CYE A;  1TXD A;  3PVU A;  1GC6 A;  5JHG A;  3D8F A;  3ULC A;  4CSQ A;  1MKE A;  2KR0 A;  4QJ3 B;  4IAP A;  1UEF A;  1V88 A;  1W1G A;  4HSI A;  2ZKM X;  1BWN A;  3P6A A;  5KQ1 A;  4A6H A;  3UZT A;  3A8P A;  1GC7 A;  2AL6 A;  4Y94 A;  1UNP A;  1J19 A;  1X05 A;  3CXB B;  3TO1 A;  2M38 A;  4A6F A;  1X86 A;  2EMT A;  2I5F A;  4K17 A;  2GCL A;  1SGH A;  1WJM A;  3ODX A;  5C79 A;  3CIK A;  2GJY A;  2MFQ A;  3QIJ A;  4A5K A;  2DA0 A;  4HAZ B;  1FGY A;  3HW2 B;  2D9Z A;  3VOQ A;  1P3R A;  2CY5 A;  2Z14 A;  2J59 M;  5J3Y A;  4GOU A;  5LG4 B;  1X1G A;  1U5D A;  4BBK A;  4EMO A;  3DXC A;  1TQZ A;  1OQN A;  3BJI A;  2EC1 A;  2W2X C;  2ELA A;  3KRW A;  5L81 A;  2I5C A;  3GYO A;  2DLW A;  2Y8G A;  3HSA A;  1BTK A;  4QJ4 B;  2UVM A;  5DH9 B;  1FOE A;  3WA0 A;  1W1H A;  4A6K A;  2Z0O A;  4F7U P;  2D2Q A;  1XCG A;  5M4Y B;  5D3W A;  2LG1 A;  2RGN B;  2COF A;  4MT7 A;  2Q13 A;  5I2M A;  1DDW A;  1ZSQ A;  4IFS A;  2IYB A;  2ELB A;  3U7D A;  1K5D B;  2VSZ A;  1MIZ B;  1Y5O A;  1X11 A;  2D9X A;  3OAN A;  2RNR B;  4C0A A;  3DCX A;  2K2J A;  2N0Y A;  4P7I A;  5C6R A;  1OY2 A;  5D3X A;  1W1D A;  1PFJ A;  3PZD A;  2Y8F A;  2YVC A;  1B55 A;  4DXA B;  1WG7 A;  1TJ6 A;  1Q67 A;  2I1J A;  4GNK B;  2FJU B;  2NMB A;  4KHB B;  2RRF A;  2ROV A;  1P6S A;  2KIE A;  2M14 A;  3ULB A;  1M7E A;  5D3V A;  4HAV B;  4A6F B;  4WJ7 A;  1U5F A;  2I1K A;  4L6E A;  2YRY A;  2DHJ A;  3A8Q A;  3PP2 A;  3N7C A;  2QKL A;  1ZC3 B;  4Z2M B;  4KHB A;  1ISN A;  2DHI A;  1MIX A;  2COD A;  5LOP B;  3O96 A;  4YL8 A;  1J0W A;  1XD4 A;  4ZRK A;  1EVH A;  1X1F A;  5KQ4 A;  3BIN A;  1ZVR A;  3TW1 A;  4F7G A;  5JHH A;  2P8V A;  3WYF B;  3PEG A;  3FSS A;  3NWF A;  2L1C A;  2MKR A;  5HE0 A;  1V5U A;  2R09 A;  2DFK A;  3AU5 A;  3GYP A;  3ODO A;  4PNK A;  2QKM A;  2LOX A;  3X23 A;  4GMX B;  1FGZ A;  2GUM A;  3F5R A;  4DBB A;  4WSF A;  2D4Q A;  4H8S A;  3IVF A;  2DX5 A;  2EJ8 A;  4QJ5 B;  1SHC A;  2DHK A;  3ZDT A;  4K2P A;  2UZR A;  2D11 A;  2W2X D;  1RJ2 A;  4HB3 B;  4CHJ A;  1NTV A;  2KCJ A;  4HDQ A;  4NY0 A;  5J3Q A;  3ML4 A;  2D9Y A;  2Z59 A;  3V5W A;  1T77 A;  1IRS A;  2P0H A;  4HAX B;  1U5E A;  3DXD A;  3F0W A;  2ADZ A;  1DDV A;  4K81 A;  5D27 A;  1N3H A;  4L1R A;  5IRS A;  3PVL A;  3QWM A;  4Z2N A;  1WGU A;  2NZ8 B;  1DDM A;  1BTN A;  3MDB C;  4HAU B;  1MPH A;  4HAT B;  2DKP A;  1GG3 A;  5GOW B;  5FI0 A;  3QBV B;  1LB1 A;  2Z4D A;  2J0M A;  3D8D A;  2J0J A;  2NBV A;  2FJL A;  3M1I B;  2OQB A;  5EFX A;  2CAY A;  4ZRI A;  1FAO A;  1QC6 A;  3T06 A;  2Y7B A;  1LW3 A;  4F7H A;  1XX0 A;  4OT1 A;  1EF1 A;  1V5P A;  1V89 A;  1AQC A;  1E5W A;  1ZC4 B;  5LON B;  1FHO A;  2D9V A;  2VRW B;  3HK0 A;  1U29 A;  2DYQ A;  3FVC A;  1I2H A;  1PMS A;  1KZ7 A;  3A98 B;  1H4R A;  4WVF B;  1I7A A;  1Z87 A;  2KUQ A;  3NW8 A;  2KIG A;  2GCJ A;  2OTX A;  2YS3 A;  2K00 A;  2JP2 A;  1DRO A;  3TVV A;  3D8E A;  2EMS A;  2Z0P A;  3PSC A;  3PG7 A;  3G9W A;  4TYZ A;  3U8Z A;  1V5M A;  3FEH A;  4OSN A;  1EAZ A;  1NU2 A;  4MY6 A;  3TCA A;  4DX8 A;  1WVH A;  2D9W A;  2UZS A;  2H7D A;  3LJU X;  1FB8 A;  1OMW A;  1ZYI A;  5C5B A;  2MWN B;  3FM8 C;  3ODW A;  2J0K A;  3A58 A;  3U12 A;  3KSY A;  4KAX B;  4IOY X;  4NSW A;  1BAK A;  2DN6 A;  1EGX A;  2X18 A;  3MPX A;  1MAI A;  2YT0 A;  1WGQ A;  4GPT B;  4TKN A;  2P0F A;  1MI1 A;  2VKI A;  3SYX A;  2YF0 A;  3ZVR A;  4HB4 B;  2DX1 A;  5DIF B;  5JP4 A;  4KVG B;  1M7R A;  4QXA B;  3P7Z A;  2RLO A;  2V76 A; 
#chains in the Genus database with same CATH homology
 1U5G A;  5FI1 A;  1K5G B;  2Z0Q A;  3HQC A;  2W2W A;  2YSZ A;  5CLL B;  3HIE A;  2Z13 A;  5HE2 A;  2PZ1 A;  2RSG A;  5C16 A;  1MK7 B;  2K8E A;  4GXB A;  2IFS A;  4HB0 B;  2E2X A;  1UPQ A;  2YT2 A;  4ZRJ A;  3AU4 A;  5C5B B;  1UNR A;  2KUP A;  1U2B A;  2LOZ A;  5DI9 B;  2HTH B;  2R0D A;  1V61 A;  2DYN A;  5HE3 A;  3PVW A;  2BCJ A;  2XQN M;  1MK9 B;  2YS1 A;  4DIX A;  2D10 A;  2LUL A;  2YS5 A;  3NWD A;  4YON A;  4K2O A;  2MDX A;  1QQG A;  5CLQ B;  3SNH A;  2R2Y A;  1FHW A;  1UNQ A;  4GMV A;  1XR0 B;  1ZM0 A;  4HDO A;  4HB2 B;  2K2U A;  1KI1 B;  3RCP A;  5KCV A;  1WJ1 A;  1KZG A;  3SV1 A;  5DHF B;  1U27 A;  2COA A;  5DHA B;  3AJ4 A;  4KHA A;  3NSU A;  2LYD A;  5HE1 A;  2DKQ A;  5I2S A;  2KGX B;  4HAY B;  3VIA A;  2G35 A;  4DX9 0;  2LKO A;  3TFM A;  5D3Y A;  3KRX A;  4D6W A;  5J3T A;  2K49 A;  2DTC A;  4CHM A;  3DXE A;  4D0N B;  2H7E A;  3OHM B;  4EJN A;  4XWX A;  4B6H A;  1FHX A;  4GZU A;  4HAW B;  1DYN A;  4MK0 A;  4PQ0 A;  2P0D A;  2CY4 A;  4HHV A;  2CRF A;  2HE7 A;  1RRP B;  1NTY A;  1PLS A;  2N23 A;  2GS0 A;  3KZ1 A;  4GN1 A;  2YT1 A;  3SO6 A;  2RVB B;  4KHO A;  2ROZ B;  2ZPY A;  3KY9 A;  1P5T A;  1WI1 A;  2L2I A;  3NWA A;  5JLJ B;  1XKE A;  2COC A;  1DBH A;  1XOD A;  1H10 A;  1AWE A;  2RUK B;  1UPR A;  1Y19 B;  2AEH A;  3SUZ A;  1NI2 A;  4EKU A;  4CYE A;  1TXD A;  3PVU A;  1GC6 A;  5JHG A;  3D8F A;  3ULC A;  4CSQ A;  1MKE A;  2KR0 A;  4QJ3 B;  4IAP A;  1UEF A;  1V88 A;  1W1G A;  4HSI A;  2ZKM X;  1BWN A;  3P6A A;  5KQ1 A;  4A6H A;  3UZT A;  3A8P A;  1GC7 A;  2AL6 A;  4Y94 A;  1UNP A;  1J19 A;  1X05 A;  3CXB B;  3TO1 A;  2M38 A;  4A6F A;  1X86 A;  2EMT A;  2I5F A;  4K17 A;  2GCL A;  1SGH A;  1WJM A;  3ODX A;  5C79 A;  3CIK A;  2GJY A;  2MFQ A;  3QIJ A;  4A5K A;  2DA0 A;  4HAZ B;  1FGY A;  3HW2 B;  2D9Z A;  3VOQ A;  1P3R A;  2CY5 A;  2Z14 A;  2J59 M;  5J3Y A;  4GOU A;  5LG4 B;  1X1G A;  1U5D A;  4BBK A;  4EMO A;  3DXC A;  1TQZ A;  1OQN A;  3BJI A;  2EC1 A;  2W2X C;  2ELA A;  3KRW A;  5L81 A;  2I5C A;  3GYO A;  2DLW A;  2Y8G A;  1BTK A;  4QJ4 B;  2UVM A;  5DH9 B;  1FOE A;  3WA0 A;  1W1H A;  4A6K A;  2Z0O A;  4F7U P;  2D2Q A;  1XCG A;  5M4Y B;  5D3W A;  2LG1 A;  2RGN B;  2COF A;  4MT7 A;  2Q13 A;  5I2M A;  1DDW A;  1ZSQ A;  4IFS A;  2IYB A;  2ELB A;  3U7D A;  1K5D B;  2VSZ A;  1MIZ B;  1Y5O A;  1X11 A;  2D9X A;  3OAN A;  2RNR B;  4C0A A;  2K2J A;  2N0Y A;  4P7I A;  5C6R A;  1OY2 A;  5D3X A;  1W1D A;  1PFJ A;  3PZD A;  2Y8F A;  2YVC A;  1B55 A;  4DXA B;  1WG7 A;  1TJ6 A;  1Q67 A;  2I1J A;  4GNK B;  2FJU B;  2NMB A;  4KHB B;  2RRF A;  2ROV A;  1P6S A;  2KIE A;  2M14 A;  3ULB A;  1M7E A;  5D3V A;  4HAV B;  4A6F B;  4WJ7 A;  1U5F A;  2I1K A;  4L6E A;  2YRY A;  2DHJ A;  3A8Q A;  3PP2 A;  3N7C A;  2QKL A;  1ZC3 B;  4Z2M B;  4KHB A;  1ISN A;  2DHI A;  1MIX A;  2COD A;  5LOP B;  3O96 A;  4YL8 A;  1J0W A;  1XD4 A;  4ZRK A;  1EVH A;  1X1F A;  5KQ4 A;  3BIN A;  1ZVR A;  3TW1 A;  4F7G A;  5JHH A;  2P8V A;  3WYF B;  3PEG A;  3FSS A;  3NWF A;  2L1C A;  2MKR A;  5HE0 A;  1V5U A;  2R09 A;  2DFK A;  3AU5 A;  3GYP A;  3ODO A;  4PNK A;  2QKM A;  2LOX A;  3X23 A;  4GMX B;  1FGZ A;  2GUM A;  3F5R A;  4DBB A;  4WSF A;  2D4Q A;  4H8S A;  3IVF A;  2DX5 A;  2EJ8 A;  4QJ5 B;  1SHC A;  2DHK A;  3ZDT A;  4K2P A;  2UZR A;  2D11 A;  2W2X D;  1RJ2 A;  4HB3 B;  4CHJ A;  1NTV A;  2KCJ A;  4HDQ A;  4NY0 A;  5J3Q A;  3ML4 A;  2D9Y A;  3V5W A;  2Z59 A;  1IRS A;  2P0H A;  4HAX B;  1U5E A;  3DXD A;  3F0W A;  2ADZ A;  1DDV A;  4K81 A;  5D27 A;  1N3H A;  4L1R A;  5IRS A;  3PVL A;  3QWM A;  4Z2N A;  1WGU A;  2NZ8 B;  1DDM A;  1BTN A;  3MDB C;  4HAU B;  1MPH A;  4HAT B;  2DKP A;  1GG3 A;  5GOW B;  5FI0 A;  3QBV B;  1LB1 A;  2Z4D A;  2J0M A;  3D8D A;  2J0J A;  2NBV A;  2FJL A;  3M1I B;  2OQB A;  5EFX A;  2CAY A;  4ZRI A;  1FAO A;  1QC6 A;  3T06 A;  2Y7B A;  1LW3 A;  4F7H A;  1XX0 A;  4OT1 A;  1EF1 A;  1V5P A;  1V89 A;  1AQC A;  1E5W A;  1ZC4 B;  5LON B;  1FHO A;  2D9V A;  2VRW B;  3HK0 A;  1U29 A;  2DYQ A;  3FVC A;  1I2H A;  1PMS A;  1KZ7 A;  3A98 B;  1H4R A;  4WVF B;  1I7A A;  1Z87 A;  2KUQ A;  3NW8 A;  2KIG A;  2GCJ A;  2OTX A;  2YS3 A;  2K00 A;  2JP2 A;  1DRO A;  3TVV A;  3D8E A;  2EMS A;  2Z0P A;  3PG7 A;  3PSC A;  3G9W A;  4TYZ A;  3U8Z A;  1V5M A;  3FEH A;  4OSN A;  1EAZ A;  1NU2 A;  4MY6 A;  3TCA A;  4DX8 A;  1WVH A;  2D9W A;  2UZS A;  2H7D A;  3LJU X;  1FB8 A;  1OMW A;  1ZYI A;  5C5B A;  2MWN B;  3FM8 C;  3ODW A;  2J0K A;  3A58 A;  3U12 A;  3KSY A;  4KAX B;  4IOY X;  4NSW A;  1BAK A;  2DN6 A;  1EGX A;  2X18 A;  3MPX A;  1MAI A;  2YT0 A;  1WGQ A;  4GPT B;  4TKN A;  2P0F A;  2VKI A;  3SYX A;  2YF0 A;  3ZVR A;  4HB4 B;  2DX1 A;  5DIF B;  5JP4 A;  4KVG B;  1M7R A;  4QXA B;  3P7Z A;  2RLO A;  2V76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...