2ELAA

Crystal structure of the ptb domain of human appl1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
131
Chain Sequence
SILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the BAR-PH and PTB Domains of Human APPL1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Adapter protein containing PH domain, PTB domain and leucine
total genus 33
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2elaA00
4P7IA 2Y7BA 2EC1A 4F7UP 2VSZA 1NI2A 2D9WA 4HAWB 2LULA 2N23A 5FI0A 1MKEA 2K2UA 2KUPA 3G9WA 5C6RA 2CRFA 1FHOA 1U2BA 1MK7B 2VRWB 1OQNA 2RVBB 5HE1A 5C5BA 1FGZA 4K17A 5CLLB 2YS3A 4A6HA 4EKUA 2H7EA 4K81A 4XWXA 1NU2A 4HHVA 3D8DA 2MDXA 2XQNM 2D4QA 4HATB 3SUZA 2W2WA 2KCJA 2J0MA 5LONB 2ADZA 3HQCA 4HB4B 1UNPA 1EVHA 1MPHA 1V61A 2RGNB 3CXBB 4GPTB 3FSSA 2VKIA 4HAZB 5C79A 1FOEA 1OMWA 1DDMA 2HTHB 1SGHA 1BWNA 4KHAA 5HE3A 1XX0A 3PZDA 1N3HA 4CHJA 5JHHA 5DIFB 1K5GB 2DKPA 1FHWA 2LOXA 2LKOA 4IFSA 1M7RA 1J0WA 3TVVA 2IYBA 4WVFB 3KZ1A 3ULCA 1BTKA 1WVHA 1DROA 2DFKA 3WYFB 4DXAB 2YF0A 4MY6A 4EMOA 1X11A 2AL6A 3PSCA 4A6FB 2EMSA 2CY4A 4HB0B 2GJYA 2FJLA 1MAIA 2QKLA 1I7AA 2M14A 2R0DA 2DHKA 3TFMA 1XR0B 4HDOA 3DXDA 1AQCA 2UZRA 2UZSA 3ZDTA 4DBBA 1ZSQA 2K2JA 1K5DB 2IFSA 1ZVRA 1XODA 1MK9B 3A98B 2I1JA 3AJ4A 1H10A 1RJ2A 2YRYA 3IVFA 2DHIA 2QKMA 2P0DA 4NY0A 2COFA 5KQ1A 3BJIA 3CIKA 1DDVA 2YS1A 1U5DA 5D3VA 2D9XA 4GXBA 3KRXA 1Z87A 1OY2A 4MT7A 1WGUA 1X05A 1EGXA 4F7GA 3ULBA 5KQ4A 2Z0QA 2LOZA 1PMSA 2MWNB 2RUKB 1V89A 2OQBA 3P6AA 4TKNA 3AU4A 2DYQA 3ODXA 1EF1A 3GYPA 1NTYA 4EJNA 5FI1A 3ML4A 1FB8A 4GZUA 3FM8C 2J59M 2AEHA 3MPXA 4F7HA 4K2PA 2KGXB 4DX90 1NTVA 2X18A 3GYOA 4A5KA 1IRSA 2I5FA 3U7DA 1XKEA 2D9VA 1X86A 2W2XD 1FGYA 3PEGA 1U5EA 3D8FA 4KVGB 4A6KA 1ZC3B 1M7EA 2P8VA 5CLQB 1GC7A 1Y5OA 2D9YA 1MIZB 3N7CA 2DX1A 2ZPYA 3SO6A 4MK0A 2L2IA 2YT1A 3A8QA 1KZGA 1X1GA 2P0FA 3F5RA 1H4RA 3MDBC 1LW3A 3ODWA 2MKRA 2Q13A 1J19A 2JP2A 1P3RA 5D3WA 3ODOA 2DHJA 2OTXA 2DA0A 1ISNA 2ELBA 2YSZA 4HB2B 1KZ7A 1DDWA 1WJ1A 2K00A 1MIXA 1I2HA 1DYNA 1PFJA 5JP4A 2BCJA 2D9ZA 1V5UA 4YL8A 1TQZA 3TO1A 2EJ8A 2NMBA 1UNRA 4CYEA 1UEFA 2DX5A 1LB1A 4ZRJA 5HE0A 3X23A 1WI1A 5C16A 3U8ZA 1UPRA 5D3YA 5DI9B 4NSWA 2DLWA 5HE2A 3VIAA 1RRPB 1W1HA 1ZM0A 3FEHA 1U27A 2W2XC 1EAZA 4IOYX 3PP2A 1TXDA 3WA0A 4CHMA 1P6SA 5GOWB 1QC6A 1FHXA 4H8SA 2CODA 2V76A 4L6EA 1XD4A 2ROZB 4WJ7A 2GCLA 2DN6A 3F0WA 2R09A 4ZRKA 2RSGA 5JHGA 3HW2B 2DYNA 5EFXA 1V5MA 4GMVA 4B6HA 1Y19B 5L81A 4A6FA 2Y8FA 2I1KA 3VOQA 1V5PA 4HAVB 1UPQA 4HAUB 5J3QA 5KCVA 2RLOA 1E5WA 1WGQA 3QBVB 2DTCA 2Y8GA 2EMTA 2CY5A 4HB3B 2ELAA 1TJ6A 3O96A 3DXCA 3HK0A 4WSFA 2ROVA 2DKQA 3BINA 2Z0PA 2Z0OA 3LJUX 1UNQA 1X1FA 4Y94A 4HAXB 1W1GA 2E2XA 2M38A 3KSYA 3TW1A 2RNRB 1GC6A 4D0NB 2D10A 2PZ1A 3AU5A 5J3YA 2J0KA 2I5CA 5DH9B 3SYXA 4GMXB 2UVMA 1U5FA 4IAPA 3D8EA 1FAOA 4K2OA 2COCA 3OANA 1PLSA 5C5BB 2LYDA 4KHOA 1SHCA 4TYZA 1GG3A 2YS5A 3PVLA 2L1CA 3PG7A 2LG1A 3QWMA 3A8PA 4KHBB 2N0YA 3DXEA 3PVWA 1KI1B 1DBHA 3RCPA 2GCJA 2YVCA 3KRWA 5LOPB 4HDQA 2H7DA 4ZRIA 4GN1A 1P5TA 3SNHA 2COAA 4KAXB 4BBKA 2D2QA 1BTNA 2YT0A 1ZC4B 1B55A 5DHAB 1WJMA 1QQGA 3QIJA 1W1DA 3SV1A 4YONA 1Q67A 3PVUA 5J3TA 1U5GA 5DHFB 2NZ8B 2CAYA 1V88A 2P0HA 3NSUA 3KY9A 1WG7A 5JLJB 4DX8A 5D27A 2G35A 4HAYB 3UZTA 2HE7A 1XCGA 2GS0A 4Z2NA 3T06A 3TCAA 2J0JA 3P7ZA 3ZVRA 4PQ0A 2MFQA 1U29A 1BAKA 1AWEA 4PNKA 5D3XA 3M1IB 4Z2MB 3V5WA 2D11A 4C0AA
chains in the Genus database with same CATH superfamily
3NWAA 4P7IA 2Y7BA 2EC1A 2Z4DA 4F7UP 2VSZA 1NI2A 2D9WA 4HAWB 2LULA 2N23A 5FI0A 1MKEA 2K2UA 2KUPA 3G9WA 5C6RA 2CRFA 1FHOA 4HSIA 1U2BA 1MK7B 2VRWB 1OQNA 2RVBB 5HE1A 5C5BA 1FGZA 4K17A 5CLLB 2YS3A 4A6HA 4EKUA 2H7EA 4K81A 4XWXA 1NU2A 4HHVA 3D8DA 2MDXA 2XQNM 2D4QA 4HATB 3SUZA 2W2WA 2KCJA 2J0MA 5I2SA 5LONB 2ADZA 2Z13A 3HQCA 4HB4B 1UNPA 1EVHA 1MPHA 1V61A 2RGNB 3CXBB 4GPTB 3FSSA 2VKIA 4HAZB 2FJUB 5C79A 1FOEA 1OMWA 1DDMA 1ZYIA 2HTHB 1SGHA 1BWNA 4KHAA 5HE3A 1XX0A 3PZDA 1N3HA 4CHJA 5JHHA 5DIFB 1K5GB 2DKPA 1FHWA 4QJ4B 1T77A 2LOXA 2LKOA 4IFSA 1M7RA 1J0WA 3FVCA 3TVVA 2IYBA 4WVFB 3KZ1A 3ULCA 1BTKA 3NWDA 1WVHA 1DROA 2DFKA 3WYFB 4DXAB 2YF0A 4MY6A 4EMOA 1X11A 2AL6A 3PSCA 4A6FB 2EMSA 2CY4A 4HB0B 2GJYA 2FJLA 4QXAB 1MAIA 2QKLA 1I7AA 2M14A 2R0DA 2DHKA 3TFMA 1XR0B 4HDOA 3DXDA 1AQCA 2UZRA 2UZSA 3ZDTA 4DBBA 1ZSQA 2K2JA 1K5DB 2IFSA 1ZVRA 1XODA 1MK9B 3A98B 2I1JA 3AJ4A 1H10A 1RJ2A 2YRYA 3IVFA 2DHIA 2QKMA 2P0DA 4NY0A 2Z59A 2COFA 4DIXA 5KQ1A 3BJIA 3CIKA 5LG4B 1DDVA 2YS1A 1U5DA 1MI1A 5D3VA 2D9XA 4GXBA 3KRXA 1Z87A 1OY2A 4MT7A 1WGUA 1X05A 1EGXA 4F7GA 3ULBA 2KR0A 5KQ4A 2Z0QA 2LOZA 1PMSA 2MWNB 2RUKB 1V89A 2OQBA 4GOUA 3P6AA 4TKNA 3AU4A 2DYQA 3ODXA 1EF1A 3GYPA 3HSAA 1NTYA 4EJNA 5FI1A 3ML4A 1FB8A 4GZUA 3FM8C 2J59M 2AEHA 3MPXA 4F7HA 4K2PA 2KGXB 4DX90 1NTVA 4CSQA 2X18A 3GYOA 4A5KA 1IRSA 2I5FA 3U7DA 1XKEA 2D9VA 1X86A 2W2XD 1FGYA 3PEGA 1U5EA 3D8FA 4KVGB 4A6KA 1ZC3B 1M7EA 2P8VA 5CLQB 1GC7A 1Y5OA 2D9YA 5I2MA 1MIZB 3N7CA 2DX1A 2ZPYA 3SO6A 4MK0A 2L2IA 2YT1A 3A8QA 1KZGA 1X1GA 2P0FA 3F5RA 1H4RA 3MDBC 1LW3A 3U12A 4QJ3B 3ODWA 2MKRA 2Q13A 1J19A 2JP2A 1P3RA 5D3WA 3ODOA 2DHJA 2OTXA 2DA0A 1ISNA 2ELBA 4OSNA 2YSZA 4HB2B 1KZ7A 1DDWA 1WJ1A 2K00A 1MIXA 4OT1A 1I2HA 1DYNA 3HIEA 1PFJA 5JP4A 2BCJA 2D9ZA 1V5UA 4YL8A 1TQZA 3TO1A 2EJ8A 2NMBA 1UNRA 2R2YA 4CYEA 1UEFA 2DX5A 1LB1A 4ZRJA 5HE0A 3X23A 3NWFA 1WI1A 5C16A 3U8ZA 1UPRA 2YT2A 5D3YA 4NSWA 5DI9B 2DLWA 5HE2A 3VIAA 1RRPB 1W1HA 1ZM0A 3FEHA 1U27A 2W2XC 1EAZA 4IOYX 3PP2A 1TXDA 3WA0A 4CHMA 1P6SA 5GOWB 1QC6A 1FHXA 4H8SA 2CODA 2V76A 4L6EA 1XD4A 2ROZB 4KHBA 4WJ7A 2GCLA 2DN6A 3F0WA 2R09A 4ZRKA 2RSGA 5JHGA 3HW2B 2DYNA 5EFXA 1V5MA 4GMVA 4B6HA 1Y19B 5L81A 4A6FA 4GNKB 2Y8FA 2I1KA 3VOQA 2K49A 1V5PA 4HAVB 1UPQA 4HAUB 5J3QA 5KCVA 2RLOA 1E5WA 5M4YB 1WGQA 3A58A 3QBVB 2DTCA 2Y8GA 2EMTA 2CY5A 4HB3B 2ELAA 1TJ6A 3O96A 3DXCA 3HK0A 4WSFA 2ROVA 2DKQA 3BINA 2Z0PA 2Z0OA 3LJUX 1UNQA 1X1FA 4Y94A 4HAXB 1W1GA 2E2XA 3DCXA 2M38A 3KSYA 4D6WA 2KUQA 3TW1A 2RNRB 1GC6A 4D0NB 2D10A 3OHMB 2PZ1A 3AU5A 5J3YA 2J0KA 2I5CA 5DH9B 3SYXA 4GMXB 2UVMA 1U5FA 4IAPA 3D8EA 1FAOA 4K2OA 2COCA 3OANA 1PLSA 5C5BB 3B77A 2LYDA 4KHOA 2GUMA 1SHCA 4TYZA 1GG3A 2YS5A 3PVLA 2L1CA 3PG7A 2LG1A 3QWMA 3A8PA 4KHBB 2N0YA 3DXEA 3PVWA 1KI1B 1DBHA 3NW8A 3RCPA 2GCJA 2YVCA 3KRWA 2NBVA 5LOPB 2ZKMX 2KIGA 4HDQA 2H7DA 4ZRIA 4GN1A 1P5TA 3SNHA 2COAA 2KIEA 4KAXB 4BBKA 2D2QA 1BTNA 2YT0A 1ZC4B 1B55A 5DHAB 1WJMA 1QQGA 3QIJA 5IRSA 1W1DA 3SV1A 4YONA 1Q67A 3PVUA 5J3TA 1U5GA 5DHFB 2RRFA 2NZ8B 2CAYA 1V88A 2P0HA 3NSUA 3KY9A 1WG7A 5JLJB 4DX8A 5D27A 2G35A 4HAYB 3UZTA 2Z14A 2HE7A 1XCGA 2GS0A 4Z2NA 3T06A 3TCAA 4L1RA 2J0JA 3P7ZA 3ZVRA 4PQ0A 2K8EA 2MFQA 1U29A 1BAKA 1AWEA 4PNKA 5D3XA 3M1IB 4Z2MB 3V5WA 2D11A 4C0AA 4QJ5B
chains in the Genus database with same CATH topology
4P7IA 2Y7BA 2EC1A 4F7UP 2VSZA 1NI2A 2D9WA 4HAWB 2LULA 2N23A 5FI0A 1MKEA 2K2UA 2KUPA 3G9WA 5C6RA 2CRFA 1FHOA 1U2BA 1MK7B 2VRWB 1OQNA 2RVBB 5HE1A 5C5BA 1FGZA 4K17A 5CLLB 2YS3A 4A6HA 4EKUA 2H7EA 4K81A 4XWXA 1NU2A 4HHVA 3D8DA 2MDXA 2XQNM 2D4QA 4HATB 3SUZA 2W2WA 2KCJA 2J0MA 5LONB 2ADZA 3HQCA 4HB4B 1UNPA 1EVHA 1MPHA 1V61A 2RGNB 3CXBB 4GPTB 3FSSA 2VKIA 4HAZB 5C79A 1FOEA 1OMWA 1DDMA 2HTHB 1SGHA 1BWNA 4KHAA 5HE3A 1XX0A 3PZDA 1N3HA 4CHJA 5JHHA 5DIFB 1K5GB 2DKPA 1FHWA 2LOXA 2LKOA 4IFSA 1M7RA 1J0WA 3TVVA 2IYBA 4WVFB 3KZ1A 3ULCA 1BTKA 1WVHA 1DROA 2DFKA 3WYFB 4DXAB 2YF0A 4MY6A 4EMOA 1X11A 2AL6A 3PSCA 4A6FB 2EMSA 2CY4A 4HB0B 2GJYA 2FJLA 1MAIA 2QKLA 1I7AA 2M14A 2R0DA 2DHKA 3TFMA 1XR0B 4HDOA 3DXDA 1AQCA 2UZRA 2UZSA 3ZDTA 4DBBA 1ZSQA 2K2JA 1K5DB 2IFSA 1ZVRA 1XODA 1MK9B 3A98B 2I1JA 3AJ4A 1H10A 1RJ2A 2YRYA 3IVFA 2DHIA 2QKMA 2P0DA 4NY0A 2COFA 5KQ1A 3BJIA 3CIKA 1DDVA 2YS1A 1U5DA 5D3VA 2D9XA 4GXBA 3KRXA 1Z87A 1OY2A 4MT7A 1WGUA 1X05A 1EGXA 4F7GA 3ULBA 5KQ4A 2Z0QA 2LOZA 1PMSA 2MWNB 2RUKB 1V89A 2OQBA 3P6AA 4TKNA 3AU4A 2DYQA 3ODXA 1EF1A 3GYPA 1NTYA 4EJNA 5FI1A 3ML4A 1FB8A 4GZUA 3FM8C 2J59M 2AEHA 3MPXA 4F7HA 4K2PA 2KGXB 4DX90 1NTVA 2X18A 3GYOA 4A5KA 1IRSA 2I5FA 3U7DA 1XKEA 2D9VA 1X86A 2W2XD 1FGYA 3PEGA 1U5EA 3D8FA 4KVGB 4A6KA 1ZC3B 1M7EA 2P8VA 5CLQB 1GC7A 1Y5OA 2D9YA 1MIZB 3N7CA 2DX1A 2ZPYA 3SO6A 4MK0A 2L2IA 2YT1A 3A8QA 1KZGA 1X1GA 2P0FA 3F5RA 1H4RA 3MDBC 1LW3A 3ODWA 2MKRA 2Q13A 1J19A 2JP2A 1P3RA 5D3WA 3ODOA 2DHJA 2OTXA 2DA0A 1ISNA 2ELBA 2YSZA 4HB2B 1KZ7A 1DDWA 1WJ1A 2K00A 1MIXA 1I2HA 1DYNA 1PFJA 5JP4A 2BCJA 2D9ZA 1V5UA 4YL8A 1TQZA 3TO1A 2EJ8A 2NMBA 1UNRA 4CYEA 1UEFA 2DX5A 1LB1A 4ZRJA 5HE0A 3X23A 1WI1A 5C16A 3U8ZA 1UPRA 5D3YA 5DI9B 4NSWA 2DLWA 5HE2A 3VIAA 1RRPB 1W1HA 1ZM0A 3FEHA 1U27A 2W2XC 1EAZA 4IOYX 3PP2A 1TXDA 3WA0A 4CHMA 1P6SA 5GOWB 1QC6A 1FHXA 4H8SA 2CODA 2V76A 4L6EA 1XD4A 2ROZB 4WJ7A 2GCLA 2DN6A 3F0WA 2R09A 4ZRKA 2RSGA 5JHGA 3HW2B 2DYNA 5EFXA 1V5MA 4GMVA 4B6HA 1Y19B 5L81A 4A6FA 2Y8FA 2I1KA 3VOQA 1V5PA 4HAVB 1UPQA 4HAUB 5J3QA 5KCVA 2RLOA 1E5WA 1WGQA 3QBVB 2DTCA 2Y8GA 2EMTA 2CY5A 4HB3B 2ELAA 1TJ6A 3O96A 3DXCA 3HK0A 4WSFA 2ROVA 2DKQA 3BINA 2Z0PA 2Z0OA 3LJUX 1UNQA 1X1FA 4Y94A 4HAXB 1W1GA 2E2XA 2M38A 3KSYA 3TW1A 2RNRB 1GC6A 4D0NB 2D10A 2PZ1A 3AU5A 5J3YA 2J0KA 2I5CA 5DH9B 3SYXA 4GMXB 2UVMA 1U5FA 4IAPA 3D8EA 1FAOA 4K2OA 2COCA 3OANA 1PLSA 5C5BB 2LYDA 4KHOA 1SHCA 4TYZA 1GG3A 2YS5A 3PVLA 2L1CA 3PG7A 2LG1A 3QWMA 3A8PA 4KHBB 2N0YA 3DXEA 3PVWA 1KI1B 1DBHA 3RCPA 2GCJA 2YVCA 3KRWA 5LOPB 4HDQA 2H7DA 4ZRIA 4GN1A 1P5TA 3SNHA 2COAA 4KAXB 4BBKA 2D2QA 1BTNA 2YT0A 1ZC4B 1B55A 5DHAB 1WJMA 1QQGA 3QIJA 1W1DA 3SV1A 4YONA 1Q67A 3PVUA 5J3TA 1U5GA 5DHFB 2NZ8B 2CAYA 1V88A 2P0HA 3NSUA 3KY9A 1WG7A 5JLJB 4DX8A 5D27A 2G35A 4HAYB 3UZTA 2HE7A 1XCGA 2GS0A 4Z2NA 3T06A 3TCAA 2J0JA 3P7ZA 3ZVRA 4PQ0A 2MFQA 1U29A 1BAKA 1AWEA 4PNKA 5D3XA 3M1IB 4Z2MB 3V5WA 2D11A 4C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7I A;  2Y7B A;  2EC1 A;  4F7U P;  2VSZ A;  1NI2 A;  2D9W A;  4HAW B;  2LUL A;  2N23 A;  5FI0 A;  1MKE A;  2K2U A;  2KUP A;  3G9W A;  5C6R A;  2CRF A;  1FHO A;  1U2B A;  1MK7 B;  2VRW B;  1OQN A;  2RVB B;  5HE1 A;  5C5B A;  1FGZ A;  4K17 A;  5CLL B;  2YS3 A;  4A6H A;  4EKU A;  2H7E A;  4K81 A;  4XWX A;  1NU2 A;  4HHV A;  3D8D A;  2MDX A;  2XQN M;  2D4Q A;  4HAT B;  3SUZ A;  2W2W A;  2KCJ A;  2J0M A;  5LON B;  2ADZ A;  3HQC A;  4HB4 B;  1UNP A;  1EVH A;  1MPH A;  1V61 A;  2RGN B;  3CXB B;  4GPT B;  3FSS A;  2VKI A;  4HAZ B;  5C79 A;  1FOE A;  1OMW A;  1DDM A;  2HTH B;  1SGH A;  1BWN A;  4KHA A;  5HE3 A;  1XX0 A;  3PZD A;  1N3H A;  4CHJ A;  5JHH A;  5DIF B;  1K5G B;  2DKP A;  1FHW A;  2LOX A;  2LKO A;  4IFS A;  1M7R A;  1J0W A;  3TVV A;  2IYB A;  4WVF B;  3KZ1 A;  3ULC A;  1BTK A;  1WVH A;  1DRO A;  2DFK A;  3WYF B;  4DXA B;  2YF0 A;  4MY6 A;  4EMO A;  1X11 A;  2AL6 A;  3PSC A;  4A6F B;  2EMS A;  2CY4 A;  4HB0 B;  2GJY A;  2FJL A;  1MAI A;  2QKL A;  1I7A A;  2M14 A;  2R0D A;  2DHK A;  3TFM A;  1XR0 B;  4HDO A;  3DXD A;  1AQC A;  2UZR A;  2UZS A;  3ZDT A;  4DBB A;  1ZSQ A;  2K2J A;  1K5D B;  2IFS A;  1ZVR A;  1XOD A;  1MK9 B;  3A98 B;  2I1J A;  3AJ4 A;  1H10 A;  1RJ2 A;  2YRY A;  3IVF A;  2DHI A;  2QKM A;  2P0D A;  4NY0 A;  2COF A;  5KQ1 A;  3BJI A;  3CIK A;  1DDV A;  2YS1 A;  1U5D A;  5D3V A;  2D9X A;  4GXB A;  3KRX A;  1Z87 A;  1OY2 A;  4MT7 A;  1WGU A;  1X05 A;  1EGX A;  4F7G A;  3ULB A;  5KQ4 A;  2Z0Q A;  2LOZ A;  1PMS A;  2MWN B;  2RUK B;  1V89 A;  2OQB A;  3P6A A;  4TKN A;  3AU4 A;  2DYQ A;  3ODX A;  1EF1 A;  3GYP A;  1NTY A;  4EJN A;  5FI1 A;  3ML4 A;  1FB8 A;  4GZU A;  3FM8 C;  2J59 M;  2AEH A;  3MPX A;  4F7H A;  4K2P A;  2KGX B;  4DX9 0;  1NTV A;  2X18 A;  3GYO A;  4A5K A;  1IRS A;  2I5F A;  3U7D A;  1XKE A;  2D9V A;  1X86 A;  2W2X D;  1FGY A;  3PEG A;  1U5E A;  3D8F A;  4KVG B;  4A6K A;  1ZC3 B;  1M7E A;  2P8V A;  5CLQ B;  1GC7 A;  1Y5O A;  2D9Y A;  1MIZ B;  3N7C A;  2DX1 A;  2ZPY A;  3SO6 A;  4MK0 A;  2L2I A;  2YT1 A;  3A8Q A;  1KZG A;  1X1G A;  2P0F A;  3F5R A;  1H4R A;  3MDB C;  1LW3 A;  3ODW A;  2MKR A;  2Q13 A;  1J19 A;  2JP2 A;  1P3R A;  5D3W A;  3ODO A;  2DHJ A;  2OTX A;  2DA0 A;  1ISN A;  2ELB A;  2YSZ A;  4HB2 B;  1KZ7 A;  1DDW A;  1WJ1 A;  2K00 A;  1MIX A;  1I2H A;  1DYN A;  1PFJ A;  5JP4 A;  2BCJ A;  2D9Z A;  1V5U A;  4YL8 A;  1TQZ A;  3TO1 A;  2EJ8 A;  2NMB A;  1UNR A;  4CYE A;  1UEF A;  2DX5 A;  1LB1 A;  4ZRJ A;  5HE0 A;  3X23 A;  1WI1 A;  5C16 A;  3U8Z A;  1UPR A;  5D3Y A;  5DI9 B;  4NSW A;  2DLW A;  5HE2 A;  3VIA A;  1RRP B;  1W1H A;  1ZM0 A;  3FEH A;  1U27 A;  2W2X C;  1EAZ A;  4IOY X;  3PP2 A;  1TXD A;  3WA0 A;  4CHM A;  1P6S A;  5GOW B;  1QC6 A;  1FHX A;  4H8S A;  2COD A;  2V76 A;  4L6E A;  1XD4 A;  2ROZ B;  4WJ7 A;  2GCL A;  2DN6 A;  3F0W A;  2R09 A;  4ZRK A;  2RSG A;  5JHG A;  3HW2 B;  2DYN A;  5EFX A;  1V5M A;  4GMV A;  4B6H A;  1Y19 B;  5L81 A;  4A6F A;  2Y8F A;  2I1K A;  3VOQ A;  1V5P A;  4HAV B;  1UPQ A;  4HAU B;  5J3Q A;  5KCV A;  2RLO A;  1E5W A;  1WGQ A;  3QBV B;  2DTC A;  2Y8G A;  2EMT A;  2CY5 A;  4HB3 B;  2ELA A;  1TJ6 A;  3O96 A;  3DXC A;  3HK0 A;  4WSF A;  2ROV A;  2DKQ A;  3BIN A;  2Z0P A;  2Z0O A;  3LJU X;  1UNQ A;  1X1F A;  4Y94 A;  4HAX B;  1W1G A;  2E2X A;  2M38 A;  3KSY A;  3TW1 A;  2RNR B;  1GC6 A;  4D0N B;  2D10 A;  2PZ1 A;  3AU5 A;  5J3Y A;  2J0K A;  2I5C A;  5DH9 B;  3SYX A;  4GMX B;  2UVM A;  1U5F A;  4IAP A;  3D8E A;  1FAO A;  4K2O A;  2COC A;  3OAN A;  1PLS A;  5C5B B;  2LYD A;  4KHO A;  1SHC A;  4TYZ A;  1GG3 A;  2YS5 A;  3PVL A;  2L1C A;  3PG7 A;  2LG1 A;  3QWM A;  3A8P A;  4KHB B;  2N0Y A;  3DXE A;  3PVW A;  1KI1 B;  1DBH A;  3RCP A;  2GCJ A;  2YVC A;  3KRW A;  5LOP B;  4HDQ A;  2H7D A;  4ZRI A;  4GN1 A;  1P5T A;  3SNH A;  2COA A;  4KAX B;  4BBK A;  2D2Q A;  1BTN A;  2YT0 A;  1ZC4 B;  1B55 A;  5DHA B;  1WJM A;  1QQG A;  3QIJ A;  1W1D A;  3SV1 A;  4YON A;  1Q67 A;  3PVU A;  5J3T A;  1U5G A;  5DHF B;  2NZ8 B;  2CAY A;  1V88 A;  2P0H A;  3NSU A;  3KY9 A;  1WG7 A;  5JLJ B;  4DX8 A;  5D27 A;  2G35 A;  4HAY B;  3UZT A;  2HE7 A;  1XCG A;  2GS0 A;  4Z2N A;  3T06 A;  3TCA A;  2J0J A;  3P7Z A;  3ZVR A;  4PQ0 A;  2MFQ A;  1U29 A;  1BAK A;  1AWE A;  4PNK A;  5D3X A;  3M1I B;  4Z2M B;  3V5W A;  2D11 A;  4C0A A; 
#chains in the Genus database with same CATH topology
 3NWA A;  4P7I A;  2Y7B A;  2EC1 A;  2Z4D A;  4F7U P;  2VSZ A;  1NI2 A;  2D9W A;  4HAW B;  2LUL A;  2N23 A;  5FI0 A;  1MKE A;  2K2U A;  2KUP A;  3G9W A;  5C6R A;  2CRF A;  1FHO A;  4HSI A;  1U2B A;  1MK7 B;  2VRW B;  1OQN A;  2RVB B;  5HE1 A;  5C5B A;  1FGZ A;  4K17 A;  5CLL B;  2YS3 A;  4A6H A;  4EKU A;  2H7E A;  4K81 A;  4XWX A;  1NU2 A;  4HHV A;  3D8D A;  2MDX A;  2XQN M;  2D4Q A;  4HAT B;  3SUZ A;  2W2W A;  2KCJ A;  2J0M A;  5I2S A;  5LON B;  2ADZ A;  2Z13 A;  3HQC A;  4HB4 B;  1UNP A;  1EVH A;  1MPH A;  1V61 A;  2RGN B;  3CXB B;  4GPT B;  3FSS A;  2VKI A;  4HAZ B;  2FJU B;  5C79 A;  1FOE A;  1OMW A;  1DDM A;  1ZYI A;  2HTH B;  1SGH A;  1BWN A;  4KHA A;  5HE3 A;  1XX0 A;  3PZD A;  1N3H A;  4CHJ A;  5JHH A;  5DIF B;  1K5G B;  2DKP A;  1FHW A;  4QJ4 B;  1T77 A;  2LOX A;  2LKO A;  4IFS A;  1M7R A;  1J0W A;  3FVC A;  3TVV A;  2IYB A;  4WVF B;  3KZ1 A;  3ULC A;  1BTK A;  3NWD A;  1WVH A;  1DRO A;  2DFK A;  3WYF B;  4DXA B;  2YF0 A;  4MY6 A;  4EMO A;  1X11 A;  2AL6 A;  3PSC A;  4A6F B;  2EMS A;  2CY4 A;  4HB0 B;  2GJY A;  2FJL A;  4QXA B;  1MAI A;  2QKL A;  1I7A A;  2M14 A;  2R0D A;  2DHK A;  3TFM A;  1XR0 B;  4HDO A;  3DXD A;  1AQC A;  2UZR A;  2UZS A;  3ZDT A;  4DBB A;  1ZSQ A;  2K2J A;  1K5D B;  2IFS A;  1ZVR A;  1XOD A;  1MK9 B;  3A98 B;  2I1J A;  3AJ4 A;  1H10 A;  1RJ2 A;  2YRY A;  3IVF A;  2DHI A;  2QKM A;  2P0D A;  4NY0 A;  2Z59 A;  2COF A;  4DIX A;  5KQ1 A;  3BJI A;  3CIK A;  5LG4 B;  1DDV A;  2YS1 A;  1U5D A;  1MI1 A;  5D3V A;  2D9X A;  4GXB A;  3KRX A;  1Z87 A;  1OY2 A;  4MT7 A;  1WGU A;  1X05 A;  1EGX A;  4F7G A;  3ULB A;  2KR0 A;  5KQ4 A;  2Z0Q A;  2LOZ A;  1PMS A;  2MWN B;  2RUK B;  1V89 A;  2OQB A;  4GOU A;  3P6A A;  4TKN A;  3AU4 A;  2DYQ A;  3ODX A;  1EF1 A;  3GYP A;  3HSA A;  1NTY A;  4EJN A;  5FI1 A;  3ML4 A;  1FB8 A;  4GZU A;  3FM8 C;  2J59 M;  2AEH A;  3MPX A;  4F7H A;  4K2P A;  2KGX B;  4DX9 0;  1NTV A;  4CSQ A;  2X18 A;  3GYO A;  4A5K A;  1IRS A;  2I5F A;  3U7D A;  1XKE A;  2D9V A;  1X86 A;  2W2X D;  1FGY A;  3PEG A;  1U5E A;  3D8F A;  4KVG B;  4A6K A;  1ZC3 B;  1M7E A;  2P8V A;  5CLQ B;  1GC7 A;  1Y5O A;  2D9Y A;  5I2M A;  1MIZ B;  3N7C A;  2DX1 A;  2ZPY A;  3SO6 A;  4MK0 A;  2L2I A;  2YT1 A;  3A8Q A;  1KZG A;  1X1G A;  2P0F A;  3F5R A;  1H4R A;  3MDB C;  1LW3 A;  3U12 A;  4QJ3 B;  3ODW A;  2MKR A;  2Q13 A;  1J19 A;  2JP2 A;  1P3R A;  5D3W A;  3ODO A;  2DHJ A;  2OTX A;  2DA0 A;  1ISN A;  2ELB A;  4OSN A;  2YSZ A;  4HB2 B;  1KZ7 A;  1DDW A;  1WJ1 A;  2K00 A;  1MIX A;  4OT1 A;  1I2H A;  1DYN A;  3HIE A;  1PFJ A;  5JP4 A;  2BCJ A;  2D9Z A;  1V5U A;  4YL8 A;  1TQZ A;  3TO1 A;  2EJ8 A;  2NMB A;  1UNR A;  2R2Y A;  4CYE A;  1UEF A;  2DX5 A;  1LB1 A;  4ZRJ A;  5HE0 A;  3X23 A;  3NWF A;  1WI1 A;  5C16 A;  3U8Z A;  1UPR A;  2YT2 A;  5D3Y A;  4NSW A;  5DI9 B;  2DLW A;  5HE2 A;  3VIA A;  1RRP B;  1W1H A;  1ZM0 A;  3FEH A;  1U27 A;  2W2X C;  1EAZ A;  4IOY X;  3PP2 A;  1TXD A;  3WA0 A;  4CHM A;  1P6S A;  5GOW B;  1QC6 A;  1FHX A;  4H8S A;  2COD A;  2V76 A;  4L6E A;  1XD4 A;  2ROZ B;  4KHB A;  4WJ7 A;  2GCL A;  2DN6 A;  3F0W A;  2R09 A;  4ZRK A;  2RSG A;  5JHG A;  3HW2 B;  2DYN A;  5EFX A;  1V5M A;  4GMV A;  4B6H A;  1Y19 B;  5L81 A;  4A6F A;  4GNK B;  2Y8F A;  2I1K A;  3VOQ A;  2K49 A;  1V5P A;  4HAV B;  1UPQ A;  4HAU B;  5J3Q A;  5KCV A;  2RLO A;  1E5W A;  5M4Y B;  1WGQ A;  3A58 A;  3QBV B;  2DTC A;  2Y8G A;  2EMT A;  2CY5 A;  4HB3 B;  2ELA A;  1TJ6 A;  3O96 A;  3DXC A;  3HK0 A;  4WSF A;  2ROV A;  2DKQ A;  3BIN A;  2Z0P A;  2Z0O A;  3LJU X;  1UNQ A;  1X1F A;  4Y94 A;  4HAX B;  1W1G A;  2E2X A;  3DCX A;  2M38 A;  3KSY A;  4D6W A;  2KUQ A;  3TW1 A;  2RNR B;  1GC6 A;  4D0N B;  2D10 A;  3OHM B;  2PZ1 A;  3AU5 A;  5J3Y A;  2J0K A;  2I5C A;  5DH9 B;  3SYX A;  4GMX B;  2UVM A;  1U5F A;  4IAP A;  3D8E A;  1FAO A;  4K2O A;  2COC A;  3OAN A;  1PLS A;  5C5B B;  3B77 A;  2LYD A;  4KHO A;  2GUM A;  1SHC A;  4TYZ A;  1GG3 A;  2YS5 A;  3PVL A;  2L1C A;  3PG7 A;  2LG1 A;  3QWM A;  3A8P A;  4KHB B;  2N0Y A;  3DXE A;  3PVW A;  1KI1 B;  1DBH A;  3NW8 A;  3RCP A;  2GCJ A;  2YVC A;  3KRW A;  2NBV A;  5LOP B;  2ZKM X;  2KIG A;  4HDQ A;  2H7D A;  4ZRI A;  4GN1 A;  1P5T A;  3SNH A;  2COA A;  2KIE A;  4KAX B;  4BBK A;  2D2Q A;  1BTN A;  2YT0 A;  1ZC4 B;  1B55 A;  5DHA B;  1WJM A;  1QQG A;  3QIJ A;  5IRS A;  1W1D A;  3SV1 A;  4YON A;  1Q67 A;  3PVU A;  5J3T A;  1U5G A;  5DHF B;  2RRF A;  2NZ8 B;  2CAY A;  1V88 A;  2P0H A;  3NSU A;  3KY9 A;  1WG7 A;  5JLJ B;  4DX8 A;  5D27 A;  2G35 A;  4HAY B;  3UZT A;  2Z14 A;  2HE7 A;  1XCG A;  2GS0 A;  4Z2N A;  3T06 A;  3TCA A;  4L1R A;  2J0J A;  3P7Z A;  3ZVR A;  4PQ0 A;  2K8E A;  2MFQ A;  1U29 A;  1BAK A;  1AWE A;  4PNK A;  5D3X A;  3M1I B;  4Z2M B;  3V5W A;  2D11 A;  4C0A A;  4QJ5 B; 
#chains in the Genus database with same CATH homology
 4P7I A;  2Y7B A;  2EC1 A;  4F7U P;  2VSZ A;  1NI2 A;  2D9W A;  4HAW B;  2LUL A;  2N23 A;  5FI0 A;  1MKE A;  2K2U A;  2KUP A;  3G9W A;  5C6R A;  2CRF A;  1FHO A;  1U2B A;  1MK7 B;  2VRW B;  1OQN A;  2RVB B;  5HE1 A;  5C5B A;  1FGZ A;  4K17 A;  5CLL B;  2YS3 A;  4A6H A;  4EKU A;  2H7E A;  4K81 A;  4XWX A;  1NU2 A;  4HHV A;  3D8D A;  2MDX A;  2XQN M;  2D4Q A;  4HAT B;  3SUZ A;  2W2W A;  2KCJ A;  2J0M A;  5LON B;  2ADZ A;  3HQC A;  4HB4 B;  1UNP A;  1EVH A;  1MPH A;  1V61 A;  2RGN B;  3CXB B;  4GPT B;  3FSS A;  2VKI A;  4HAZ B;  5C79 A;  1FOE A;  1OMW A;  1DDM A;  2HTH B;  1SGH A;  1BWN A;  4KHA A;  5HE3 A;  1XX0 A;  3PZD A;  1N3H A;  4CHJ A;  5JHH A;  5DIF B;  1K5G B;  2DKP A;  1FHW A;  2LOX A;  2LKO A;  4IFS A;  1M7R A;  1J0W A;  3TVV A;  2IYB A;  4WVF B;  3KZ1 A;  3ULC A;  1BTK A;  1WVH A;  1DRO A;  2DFK A;  3WYF B;  4DXA B;  2YF0 A;  4MY6 A;  4EMO A;  1X11 A;  2AL6 A;  3PSC A;  4A6F B;  2EMS A;  2CY4 A;  4HB0 B;  2GJY A;  2FJL A;  1MAI A;  2QKL A;  1I7A A;  2M14 A;  2R0D A;  2DHK A;  3TFM A;  1XR0 B;  4HDO A;  3DXD A;  1AQC A;  2UZR A;  2UZS A;  3ZDT A;  4DBB A;  1ZSQ A;  2K2J A;  1K5D B;  2IFS A;  1ZVR A;  1XOD A;  1MK9 B;  3A98 B;  2I1J A;  3AJ4 A;  1H10 A;  1RJ2 A;  2YRY A;  3IVF A;  2DHI A;  2QKM A;  2P0D A;  4NY0 A;  2COF A;  5KQ1 A;  3BJI A;  3CIK A;  1DDV A;  2YS1 A;  1U5D A;  5D3V A;  2D9X A;  4GXB A;  3KRX A;  1Z87 A;  1OY2 A;  4MT7 A;  1WGU A;  1X05 A;  1EGX A;  4F7G A;  3ULB A;  5KQ4 A;  2Z0Q A;  2LOZ A;  1PMS A;  2MWN B;  2RUK B;  1V89 A;  2OQB A;  3P6A A;  4TKN A;  3AU4 A;  2DYQ A;  3ODX A;  1EF1 A;  3GYP A;  1NTY A;  4EJN A;  5FI1 A;  3ML4 A;  1FB8 A;  4GZU A;  3FM8 C;  2J59 M;  2AEH A;  3MPX A;  4F7H A;  4K2P A;  2KGX B;  4DX9 0;  1NTV A;  2X18 A;  3GYO A;  4A5K A;  1IRS A;  2I5F A;  3U7D A;  1XKE A;  2D9V A;  1X86 A;  2W2X D;  1FGY A;  3PEG A;  1U5E A;  3D8F A;  4KVG B;  4A6K A;  1ZC3 B;  1M7E A;  2P8V A;  5CLQ B;  1GC7 A;  1Y5O A;  2D9Y A;  1MIZ B;  3N7C A;  2DX1 A;  2ZPY A;  3SO6 A;  4MK0 A;  2L2I A;  2YT1 A;  3A8Q A;  1KZG A;  1X1G A;  2P0F A;  3F5R A;  1H4R A;  3MDB C;  1LW3 A;  3ODW A;  2MKR A;  2Q13 A;  1J19 A;  2JP2 A;  1P3R A;  5D3W A;  3ODO A;  2DHJ A;  2OTX A;  2DA0 A;  1ISN A;  2ELB A;  2YSZ A;  4HB2 B;  1KZ7 A;  1DDW A;  1WJ1 A;  2K00 A;  1MIX A;  1I2H A;  1DYN A;  1PFJ A;  5JP4 A;  2BCJ A;  2D9Z A;  1V5U A;  4YL8 A;  1TQZ A;  3TO1 A;  2EJ8 A;  2NMB A;  1UNR A;  4CYE A;  1UEF A;  2DX5 A;  1LB1 A;  4ZRJ A;  5HE0 A;  3X23 A;  1WI1 A;  5C16 A;  3U8Z A;  1UPR A;  5D3Y A;  5DI9 B;  4NSW A;  2DLW A;  5HE2 A;  3VIA A;  1RRP B;  1W1H A;  1ZM0 A;  3FEH A;  1U27 A;  2W2X C;  1EAZ A;  4IOY X;  3PP2 A;  1TXD A;  3WA0 A;  4CHM A;  1P6S A;  5GOW B;  1QC6 A;  1FHX A;  4H8S A;  2COD A;  2V76 A;  4L6E A;  1XD4 A;  2ROZ B;  4WJ7 A;  2GCL A;  2DN6 A;  3F0W A;  2R09 A;  4ZRK A;  2RSG A;  5JHG A;  3HW2 B;  2DYN A;  5EFX A;  1V5M A;  4GMV A;  4B6H A;  1Y19 B;  5L81 A;  4A6F A;  2Y8F A;  2I1K A;  3VOQ A;  1V5P A;  4HAV B;  1UPQ A;  4HAU B;  5J3Q A;  5KCV A;  2RLO A;  1E5W A;  1WGQ A;  3QBV B;  2DTC A;  2Y8G A;  2EMT A;  2CY5 A;  4HB3 B;  2ELA A;  1TJ6 A;  3O96 A;  3DXC A;  3HK0 A;  4WSF A;  2ROV A;  2DKQ A;  3BIN A;  2Z0P A;  2Z0O A;  3LJU X;  1UNQ A;  1X1F A;  4Y94 A;  4HAX B;  1W1G A;  2E2X A;  2M38 A;  3KSY A;  3TW1 A;  2RNR B;  1GC6 A;  4D0N B;  2D10 A;  2PZ1 A;  3AU5 A;  5J3Y A;  2J0K A;  2I5C A;  5DH9 B;  3SYX A;  4GMX B;  2UVM A;  1U5F A;  4IAP A;  3D8E A;  1FAO A;  4K2O A;  2COC A;  3OAN A;  1PLS A;  5C5B B;  2LYD A;  4KHO A;  1SHC A;  4TYZ A;  1GG3 A;  2YS5 A;  3PVL A;  2L1C A;  3PG7 A;  2LG1 A;  3QWM A;  3A8P A;  4KHB B;  2N0Y A;  3DXE A;  3PVW A;  1KI1 B;  1DBH A;  3RCP A;  2GCJ A;  2YVC A;  3KRW A;  5LOP B;  4HDQ A;  2H7D A;  4ZRI A;  4GN1 A;  1P5T A;  3SNH A;  2COA A;  4KAX B;  4BBK A;  2D2Q A;  1BTN A;  2YT0 A;  1ZC4 B;  1B55 A;  5DHA B;  1WJM A;  1QQG A;  3QIJ A;  1W1D A;  3SV1 A;  4YON A;  1Q67 A;  3PVU A;  5J3T A;  1U5G A;  5DHF B;  2NZ8 B;  2CAY A;  1V88 A;  2P0H A;  3NSU A;  3KY9 A;  1WG7 A;  5JLJ B;  4DX8 A;  5D27 A;  2G35 A;  4HAY B;  3UZT A;  2HE7 A;  1XCG A;  2GS0 A;  4Z2N A;  3T06 A;  3TCA A;  2J0J A;  3P7Z A;  3ZVR A;  4PQ0 A;  2MFQ A;  1U29 A;  1BAK A;  1AWE A;  4PNK A;  5D3X A;  3M1I B;  4Z2M B;  3V5W A;  2D11 A;  4C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...