2ELAA

Crystal structure of the ptb domain of human appl1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
131
Chain Sequence
b'SILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter protein containing PH domain, PTB domain and leucine
publication title Crystal Structures of the BAR-PH and PTB Domains of Human APPL1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 33
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2elaA00
3F0WA 5D27A 1Z87A 2L2IA 5D3VA 3A8QA 1GC7A 3PZDA 5C6RA 4EMOA 1AWEA 1DYNA 5FI1A 5D3YA 4Z2MB 2RUKB 5HE1A 1B55A 1NU2A 1ZM0A 4PQ0A 2NMBA 1KZ7A 1RRPB 2LYDA 1X1GA 2I1JA 4P7IA 4A5KA 5C16A 5JLJB 1DDMA 1WGUA 1LB1A 2VKIA 1FHOA 1UPQA 2XQNM 3GYPA 1BTKA 2P0FA 3P6AA 2DKQA 2J0MA 3O96A 3PSCA 3SNHA 4HAUB 3QBVB 4EJNA 2YF0A 4A6KA 1TXDA 1W1DA 2DX1A 2DHKA 1AQCA 1UPRA 3TW1A 3CIKA 5C5BA 5FI0A 1K5DB 2YT0A 1PFJA 2UVMA 2Z0PA 2QKMA 4GZUA 5JHGA 3VIAA 1U2BA 5DIFB 1H10A 2LOXA 3WA0A 2CRFA 2EC1A 1X1FA 2Q13A 5J3QA 4CHJA 1WVHA 1U5EA 3TFMA 1P3RA 4K2PA 5HE0A 4MK0A 4HB4B 2IFSA 2DHIA 4F7HA 2MFQA 1J19A 2W2WA 4IFSA 1X11A 1W1GA 2QKLA 5JP4A 1XD4A 1XX0A 1FHXA 4CHMA 5C79A 4HATB 4NSWA 3FSSA 3AU5A 2HE7A 5KQ4A 1U5DA 2OTXA 4WVFB 5HE2A 3KY9A 4MT7A 2UZRA 3HQCA 3PVUA 3SO6A 4KAXB 4D0NB 1ISNA 4BBKA 1DROA 3ZVRA 2DYNA 1WJ1A 1DBHA 3HW2B 3ZDTA 1GC6A 3U7DA 1V88A 2GCLA 4HAZB 2R09A 1UNRA 1WI1A 2W2XC 1V61A 3U8ZA 1DDVA 4C0AA 2COFA 3QIJA 4NY0A 1WG7A 2D9XA 4DX8A 2H7EA 3PP2A 5KQ1A 1MK7B 2CAYA 3X23A 4B6HA 4GMXB 3D8DA 2D9WA 5DH9B 1KI1B 1NTVA 1KZGA 2KGXB 1K5GB 2GS0A 1U29A 2R0DA 5HE3A 1XKEA 3AU4A 3HK0A 2NZ8B 2CY4A 3QWMA 2DA0A 4YONA 2AL6A 4PNKA 1E5WA 5L81A 1GG3A 2D4QA 1MK9B 2Z0OA 1EF1A 4TKNA 1MIZB 4GN1A 4L6EA 5LONB 1OY2A 3KRWA 3VOQA 4A6FA 2DN6A 4TYZA 2D2QA 2MKRA 3N7CA 4MY6A 4DBBA 4GPTB 2N23A 2I5CA 2ADZA 4KHAA 1PLSA 2LOZA 1V5MA 3D8EA 2DFKA 1FHWA 2I5FA 3PVLA 1V5PA 2DYQA 3OANA 4F7GA 4GXBA 2Y8FA 3UZTA 4HB0B 2P0HA 3IVFA 3SV1A 1I7AA 1WJMA 1FOEA 2K2UA 2DLWA 2YRYA 2YS1A 2AEHA 1PMSA 5D3WA 4ZRKA 3T06A 3SYXA 2V76A 1X05A 1V89A 4HB2B 2YSZA 4Z2NA 1EAZA 1SHCA 1BTNA 1DDWA 4DX90 4K17A 2LKOA 5D3XA 2ELAA 4K2OA 2COCA 3FEHA 1FGZA 2JP2A 3D8FA 5CLLB 2ZPYA 1UNPA 2Y8GA 1MIXA 3NSUA 4EKUA 2J0JA 2D11A 2G35A 3BJIA 1OMWA 4YL8A 1MAIA 2P8VA 3ODWA 3GYOA 1P6SA 1Y5OA 3DXCA 3ODOA 1FGYA 4KVGB 2KCJA 3AJ4A 2Y7BA 3WYFB 3G9WA 4IOYX 3DXDA 5C5BB 2COAA 1NTYA 4F7UP 4A6FB 2CODA 2D9VA 2J0KA 4GMVA 4Y94A 3TVVA 2PZ1A 3M1IB 4HDOA 2RGNB 4CYEA 5J3YA 1TQZA 2DKPA 2J59M 2EMSA 2OQBA 2X18A 1OQNA 3FM8C 5KCVA 2LG1A 2LULA 1RJ2A 3MDBC 1J0WA 2VSZA 1UEFA 1I2HA 4ZRJA 1V5UA 2N0YA 2EJ8A 5GOWB 4HDQA 3TCAA 2GJYA 1MKEA 1UNQA 2EMTA 2RNRB 2YT1A 3ODXA 3ML4A 3RCPA 2HTHB 3P7ZA 4WJ7A 1BAKA 4HB3B 1NI2A 2RSGA 2FJLA 1FB8A 3F5RA 1ZVRA 4HAWB 2GCJA 4DXAB 2K00A 3A98B 2H7DA 1BWNA 2DHJA 2YVCA 1XCGA 3PVWA 1ZC3B 1EVHA 2CY5A 1QC6A 4HAYB 1X86A 2D10A 1H4RA 4IAPA 4H8SA 2RVBB 5J3TA 2DX5A 3DXEA 2UZSA 2E2XA 3KRXA 2YS3A 5LOPB 3ULCA 3CXBB 4HAVB 1U27A 4KHBB 1WGQA 2VRWB 3PEGA 4A6HA 2K2JA 4KHOA 1EGXA 1QQGA 2DTCA 2D9ZA 3KZ1A 2RLOA 2W2XD 2YS5A 3PG7A 3V5WA 1P5TA 1U5GA 2I1KA 5DHFB 5JHHA 2Z0QA 1IRSA 5CLQB 4WSFA 1W1HA 3BINA 2IYBA 1Y19B 3TO1A 1MPHA 1ZSQA 2MDXA 2ROVA 5DHAB 1U5FA 4XWXA 3SUZA 4ZRIA 4HAXB 2D9YA 1N3HA 1TJ6A 3A8PA 4HHVA 2ELBA 2L1CA 1XR0B 1M7RA 2BCJA 2MWNB 2P0DA 1Q67A 2M38A 5DI9B 5EFXA 3ULBA 2KUPA 1FAOA 1LW3A 1ZC4B 3LJUX 1XODA 1SGHA 3MPXA 2ROZB 2M14A 4K81A 3KSYA 1M7EA
chains in the Genus database with same CATH superfamily
3F0WA 5D27A 1Z87A 2L2IA 5D3VA 3A8QA 1GC7A 3PZDA 5C6RA 4EMOA 1AWEA 1DYNA 5FI1A 5D3YA 4Z2MB 2RUKB 5HE1A 1B55A 1NU2A 1ZM0A 4PQ0A 2NMBA 1KZ7A 1RRPB 2LYDA 1X1GA 2I1JA 4P7IA 4A5KA 2Z14A 5C16A 5JLJB 1DDMA 1WGUA 1LB1A 2VKIA 1FHOA 1UPQA 2XQNM 3GYPA 1BTKA 2P0FA 3P6AA 2DKQA 2J0MA 3O96A 3PSCA 3SNHA 4HAUB 3QBVB 4EJNA 2YF0A 4A6KA 1TXDA 1W1DA 2DX1A 2DHKA 1AQCA 1UPRA 3TW1A 3CIKA 5C5BA 5FI0A 1K5DB 2YT0A 1PFJA 2UVMA 3OHMB 2Z0PA 3DCXA 2QKMA 4GZUA 5JHGA 4GNKB 3VIAA 1U2BA 5DIFB 1H10A 2LOXA 3FVCA 3WA0A 2CRFA 2RRFA 2EC1A 1X1FA 2Q13A 5J3QA 4CHJA 1WVHA 1U5EA 3TFMA 1P3RA 4K2PA 5HE0A 4DIXA 4QJ4B 4MK0A 4HB4B 1MI1A 2IFSA 2DHIA 4F7HA 2MFQA 1J19A 2W2WA 4IFSA 4GOUA 1X11A 1W1GA 2QKLA 5JP4A 1XD4A 1XX0A 1FHXA 4CHMA 2Z59A 5C79A 4HATB 4NSWA 3FSSA 1ZYIA 3AU5A 2HE7A 5KQ4A 5IRSA 1U5DA 2OTXA 4WVFB 5HE2A 3KY9A 4MT7A 2UZRA 3HQCA 3PVUA 3SO6A 4KAXB 4D0NB 1ISNA 4BBKA 1DROA 3ZVRA 2DYNA 1WJ1A 1DBHA 3HW2B 3ZDTA 1GC6A 3U7DA 1V88A 2ZKMX 2GCLA 4HAZB 2R09A 1UNRA 3B77A 1WI1A 2W2XC 1V61A 3U8ZA 1DDVA 4C0AA 2COFA 3QIJA 4NY0A 1WG7A 2D9XA 4DX8A 2H7EA 3PP2A 5KQ1A 1MK7B 2CAYA 3X23A 4B6HA 4GMXB 3HSAA 3D8DA 2D9WA 5DH9B 1KI1B 1NTVA 1KZGA 2KGXB 1K5GB 2GS0A 1U29A 2R0DA 5HE3A 1XKEA 3AU4A 3HK0A 2NZ8B 2CY4A 3QWMA 2DA0A 4YONA 2AL6A 4PNKA 1E5WA 5L81A 1GG3A 2D4QA 1MK9B 2Z0OA 1EF1A 4TKNA 1MIZB 4GN1A 4L1RA 4L6EA 5LONB 1OY2A 3KRWA 3VOQA 4A6FA 2DN6A 2GUMA 4TYZA 2D2QA 2MKRA 3N7CA 4MY6A 4DBBA 4GPTB 2N23A 2I5CA 2ADZA 4KHAA 1PLSA 2LOZA 1V5MA 3D8EA 2DFKA 1FHWA 2I5FA 3PVLA 3A58A 1V5PA 2DYQA 3OANA 4F7GA 4GXBA 2Y8FA 3UZTA 4HB0B 2P0HA 3IVFA 5M4YB 3SV1A 1I7AA 1WJMA 1FOEA 2K2UA 2DLWA 2YRYA 2YS1A 2AEHA 1PMSA 5D3WA 4ZRKA 3T06A 3SYXA 2V76A 1X05A 2K49A 1V89A 4D6WA 4HB2B 2YSZA 4Z2NA 4CSQA 1EAZA 1SHCA 1BTNA 1DDWA 4DX90 4K17A 2LKOA 5D3XA 2ELAA 4K2OA 2COCA 3FEHA 1FGZA 2KR0A 2JP2A 3D8FA 5CLLB 2ZPYA 1UNPA 2Y8GA 1MIXA 3NSUA 4EKUA 2J0JA 2D11A 2G35A 3BJIA 1OMWA 4YL8A 1MAIA 2P8VA 3ODWA 3GYOA 1P6SA 4KHBA 1Y5OA 3DXCA 3ODOA 1FGYA 4KVGB 2KCJA 3AJ4A 2Y7BA 3WYFB 3G9WA 2K8EA 4IOYX 3DXDA 5C5BB 3NW8A 2COAA 1NTYA 4F7UP 4A6FB 2CODA 2D9VA 1T77A 2J0KA 2KIEA 4GMVA 4Y94A 3TVVA 2PZ1A 3M1IB 4HDOA 2RGNB 4CYEA 5J3YA 1TQZA 2DKPA 2J59M 2EMSA 2OQBA 3U12A 2X18A 1OQNA 3NWDA 3FM8C 2YT2A 5KCVA 2LG1A 2LULA 1RJ2A 3MDBC 1J0WA 2VSZA 1UEFA 1I2HA 4ZRJA 1V5UA 2N0YA 2EJ8A 5GOWB 4HDQA 3TCAA 2GJYA 1MKEA 1UNQA 2EMTA 4HSIA 2RNRB 2YT1A 3ODXA 3ML4A 3RCPA 2HTHB 3P7ZA 4WJ7A 1BAKA 4HB3B 1NI2A 2RSGA 2FJLA 1FB8A 3F5RA 1ZVRA 4HAWB 2GCJA 4DXAB 2NBVA 2K00A 3A98B 2H7DA 1BWNA 2DHJA 2R2YA 2YVCA 1XCGA 3PVWA 1ZC3B 1EVHA 2CY5A 1QC6A 4HAYB 1X86A 2D10A 1H4RA 4IAPA 4H8SA 2RVBB 5J3TA 2DX5A 3DXEA 2UZSA 2E2XA 3KRXA 2YS3A 5LOPB 3ULCA 3CXBB 4HAVB 1U27A 4KHBB 1WGQA 3NWFA 2VRWB 3PEGA 4A6HA 2K2JA 4KHOA 1EGXA 1QQGA 2DTCA 2D9ZA 3KZ1A 2RLOA 2W2XD 2YS5A 3NWAA 3PG7A 5I2MA 3V5WA 1P5TA 1U5GA 2I1KA 5DHFB 5JHHA 2Z0QA 1IRSA 4QJ5B 2FJUB 5CLQB 4WSFA 5LG4B 1W1HA 3BINA 2IYBA 1Y19B 3TO1A 1MPHA 1ZSQA 2MDXA 2ROVA 5DHAB 2KIGA 1U5FA 4OT1A 4XWXA 3SUZA 4ZRIA 2Z4DA 4HAXB 4QXAB 2D9YA 1N3HA 1TJ6A 2KUQA 3A8PA 4HHVA 2ELBA 2L1CA 1XR0B 1M7RA 2BCJA 2MWNB 2P0DA 1Q67A 2M38A 5DI9B 2Z13A 3HIEA 5EFXA 3ULBA 2KUPA 1FAOA 1LW3A 1ZC4B 3LJUX 1XODA 5I2SA 1SGHA 3MPXA 4OSNA 4QJ3B 2ROZB 2M14A 4K81A 3KSYA 1M7EA
chains in the Genus database with same CATH topology
3F0WA 5D27A 1Z87A 2L2IA 5D3VA 3A8QA 1GC7A 3PZDA 5C6RA 4EMOA 1AWEA 1DYNA 5FI1A 5D3YA 4Z2MB 2RUKB 5HE1A 1B55A 1NU2A 1ZM0A 4PQ0A 2NMBA 1KZ7A 1RRPB 2LYDA 1X1GA 2I1JA 4P7IA 4A5KA 5C16A 5JLJB 1DDMA 1WGUA 1LB1A 2VKIA 1FHOA 1UPQA 2XQNM 3GYPA 1BTKA 2P0FA 3P6AA 2DKQA 2J0MA 3O96A 3PSCA 3SNHA 4HAUB 3QBVB 4EJNA 2YF0A 4A6KA 1TXDA 1W1DA 2DX1A 2DHKA 1AQCA 1UPRA 3TW1A 3CIKA 5C5BA 5FI0A 1K5DB 2YT0A 1PFJA 2UVMA 2Z0PA 2QKMA 4GZUA 5JHGA 3VIAA 1U2BA 5DIFB 1H10A 2LOXA 3WA0A 2CRFA 2EC1A 1X1FA 2Q13A 5J3QA 4CHJA 1WVHA 1U5EA 3TFMA 1P3RA 4K2PA 5HE0A 4MK0A 4HB4B 2IFSA 2DHIA 4F7HA 2MFQA 1J19A 2W2WA 4IFSA 1X11A 1W1GA 2QKLA 5JP4A 1XD4A 1XX0A 1FHXA 4CHMA 5C79A 4HATB 4NSWA 3FSSA 3AU5A 2HE7A 5KQ4A 1U5DA 2OTXA 4WVFB 5HE2A 3KY9A 4MT7A 2UZRA 3HQCA 3PVUA 3SO6A 4KAXB 4D0NB 1ISNA 4BBKA 1DROA 3ZVRA 2DYNA 1WJ1A 1DBHA 3HW2B 3ZDTA 1GC6A 3U7DA 1V88A 2GCLA 4HAZB 2R09A 1UNRA 1WI1A 2W2XC 1V61A 3U8ZA 1DDVA 4C0AA 2COFA 3QIJA 4NY0A 1WG7A 2D9XA 4DX8A 2H7EA 3PP2A 5KQ1A 1MK7B 2CAYA 3X23A 4B6HA 4GMXB 3D8DA 2D9WA 5DH9B 1KI1B 1NTVA 1KZGA 2KGXB 1K5GB 2GS0A 1U29A 2R0DA 5HE3A 1XKEA 3AU4A 3HK0A 2NZ8B 2CY4A 3QWMA 2DA0A 4YONA 2AL6A 4PNKA 1E5WA 5L81A 1GG3A 2D4QA 1MK9B 2Z0OA 1EF1A 4TKNA 1MIZB 4GN1A 4L6EA 5LONB 1OY2A 3KRWA 3VOQA 4A6FA 2DN6A 4TYZA 2D2QA 2MKRA 3N7CA 4MY6A 4DBBA 4GPTB 2N23A 2I5CA 2ADZA 4KHAA 1PLSA 2LOZA 1V5MA 3D8EA 2DFKA 1FHWA 2I5FA 3PVLA 1V5PA 2DYQA 3OANA 4F7GA 4GXBA 2Y8FA 3UZTA 4HB0B 2P0HA 3IVFA 3SV1A 1I7AA 1WJMA 1FOEA 2K2UA 2DLWA 2YRYA 2YS1A 2AEHA 1PMSA 5D3WA 4ZRKA 3T06A 3SYXA 2V76A 1X05A 1V89A 4HB2B 2YSZA 4Z2NA 1EAZA 1SHCA 1BTNA 1DDWA 4DX90 4K17A 2LKOA 5D3XA 2ELAA 4K2OA 2COCA 3FEHA 1FGZA 2JP2A 3D8FA 5CLLB 2ZPYA 1UNPA 2Y8GA 1MIXA 3NSUA 4EKUA 2J0JA 2D11A 2G35A 3BJIA 1OMWA 4YL8A 1MAIA 2P8VA 3ODWA 3GYOA 1P6SA 1Y5OA 3DXCA 3ODOA 1FGYA 4KVGB 2KCJA 3AJ4A 2Y7BA 3WYFB 3G9WA 4IOYX 3DXDA 5C5BB 2COAA 1NTYA 4F7UP 4A6FB 2CODA 2D9VA 2J0KA 4GMVA 4Y94A 3TVVA 2PZ1A 3M1IB 4HDOA 2RGNB 4CYEA 5J3YA 1TQZA 2DKPA 2J59M 2EMSA 2OQBA 2X18A 1OQNA 3FM8C 5KCVA 2LG1A 2LULA 1RJ2A 3MDBC 1J0WA 2VSZA 1UEFA 1I2HA 4ZRJA 1V5UA 2N0YA 2EJ8A 5GOWB 4HDQA 3TCAA 2GJYA 1MKEA 1UNQA 2EMTA 2RNRB 2YT1A 3ODXA 3ML4A 3RCPA 2HTHB 3P7ZA 4WJ7A 1BAKA 4HB3B 1NI2A 2RSGA 2FJLA 1FB8A 3F5RA 1ZVRA 4HAWB 2GCJA 4DXAB 2K00A 3A98B 2H7DA 1BWNA 2DHJA 2YVCA 1XCGA 3PVWA 1ZC3B 1EVHA 2CY5A 1QC6A 4HAYB 1X86A 2D10A 1H4RA 4IAPA 4H8SA 2RVBB 5J3TA 2DX5A 3DXEA 2UZSA 2E2XA 3KRXA 2YS3A 5LOPB 3ULCA 3CXBB 4HAVB 1U27A 4KHBB 1WGQA 2VRWB 3PEGA 4A6HA 2K2JA 4KHOA 1EGXA 1QQGA 2DTCA 2D9ZA 3KZ1A 2RLOA 2W2XD 2YS5A 3PG7A 3V5WA 1P5TA 1U5GA 2I1KA 5DHFB 5JHHA 2Z0QA 1IRSA 5CLQB 4WSFA 1W1HA 3BINA 2IYBA 1Y19B 3TO1A 1MPHA 1ZSQA 2MDXA 2ROVA 5DHAB 1U5FA 4XWXA 3SUZA 4ZRIA 4HAXB 2D9YA 1N3HA 1TJ6A 3A8PA 4HHVA 2ELBA 2L1CA 1XR0B 1M7RA 2BCJA 2MWNB 2P0DA 1Q67A 2M38A 5DI9B 5EFXA 3ULBA 2KUPA 1FAOA 1LW3A 1ZC4B 3LJUX 1XODA 1SGHA 3MPXA 2ROZB 2M14A 4K81A 3KSYA 1M7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0W A;  5D27 A;  1Z87 A;  2L2I A;  5D3V A;  3A8Q A;  1GC7 A;  3PZD A;  5C6R A;  4EMO A;  1AWE A;  1DYN A;  5FI1 A;  5D3Y A;  4Z2M B;  2RUK B;  5HE1 A;  1B55 A;  1NU2 A;  1ZM0 A;  4PQ0 A;  2NMB A;  1KZ7 A;  1RRP B;  2LYD A;  1X1G A;  2I1J A;  4P7I A;  4A5K A;  5C16 A;  5JLJ B;  1DDM A;  1WGU A;  1LB1 A;  2VKI A;  1FHO A;  1UPQ A;  2XQN M;  3GYP A;  1BTK A;  2P0F A;  3P6A A;  2DKQ A;  2J0M A;  3O96 A;  3PSC A;  3SNH A;  4HAU B;  3QBV B;  4EJN A;  2YF0 A;  4A6K A;  1TXD A;  1W1D A;  2DX1 A;  2DHK A;  1AQC A;  1UPR A;  3TW1 A;  3CIK A;  5C5B A;  5FI0 A;  1K5D B;  2YT0 A;  1PFJ A;  2UVM A;  2Z0P A;  2QKM A;  4GZU A;  5JHG A;  3VIA A;  1U2B A;  5DIF B;  1H10 A;  2LOX A;  3WA0 A;  2CRF A;  2EC1 A;  1X1F A;  2Q13 A;  5J3Q A;  4CHJ A;  1WVH A;  1U5E A;  3TFM A;  1P3R A;  4K2P A;  5HE0 A;  4MK0 A;  4HB4 B;  2IFS A;  2DHI A;  4F7H A;  2MFQ A;  1J19 A;  2W2W A;  4IFS A;  1X11 A;  1W1G A;  2QKL A;  5JP4 A;  1XD4 A;  1XX0 A;  1FHX A;  4CHM A;  5C79 A;  4HAT B;  4NSW A;  3FSS A;  3AU5 A;  2HE7 A;  5KQ4 A;  1U5D A;  2OTX A;  4WVF B;  5HE2 A;  3KY9 A;  4MT7 A;  2UZR A;  3HQC A;  3PVU A;  3SO6 A;  4KAX B;  4D0N B;  1ISN A;  4BBK A;  1DRO A;  3ZVR A;  2DYN A;  1WJ1 A;  1DBH A;  3HW2 B;  3ZDT A;  1GC6 A;  3U7D A;  1V88 A;  2GCL A;  4HAZ B;  2R09 A;  1UNR A;  1WI1 A;  2W2X C;  1V61 A;  3U8Z A;  1DDV A;  4C0A A;  2COF A;  3QIJ A;  4NY0 A;  1WG7 A;  2D9X A;  4DX8 A;  2H7E A;  3PP2 A;  5KQ1 A;  1MK7 B;  2CAY A;  3X23 A;  4B6H A;  4GMX B;  3D8D A;  2D9W A;  5DH9 B;  1KI1 B;  1NTV A;  1KZG A;  2KGX B;  1K5G B;  2GS0 A;  1U29 A;  2R0D A;  5HE3 A;  1XKE A;  3AU4 A;  3HK0 A;  2NZ8 B;  2CY4 A;  3QWM A;  2DA0 A;  4YON A;  2AL6 A;  4PNK A;  1E5W A;  5L81 A;  1GG3 A;  2D4Q A;  1MK9 B;  2Z0O A;  1EF1 A;  4TKN A;  1MIZ B;  4GN1 A;  4L6E A;  5LON B;  1OY2 A;  3KRW A;  3VOQ A;  4A6F A;  2DN6 A;  4TYZ A;  2D2Q A;  2MKR A;  3N7C A;  4MY6 A;  4DBB A;  4GPT B;  2N23 A;  2I5C A;  2ADZ A;  4KHA A;  1PLS A;  2LOZ A;  1V5M A;  3D8E A;  2DFK A;  1FHW A;  2I5F A;  3PVL A;  1V5P A;  2DYQ A;  3OAN A;  4F7G A;  4GXB A;  2Y8F A;  3UZT A;  4HB0 B;  2P0H A;  3IVF A;  3SV1 A;  1I7A A;  1WJM A;  1FOE A;  2K2U A;  2DLW A;  2YRY A;  2YS1 A;  2AEH A;  1PMS A;  5D3W A;  4ZRK A;  3T06 A;  3SYX A;  2V76 A;  1X05 A;  1V89 A;  4HB2 B;  2YSZ A;  4Z2N A;  1EAZ A;  1SHC A;  1BTN A;  1DDW A;  4DX9 0;  4K17 A;  2LKO A;  5D3X A;  2ELA A;  4K2O A;  2COC A;  3FEH A;  1FGZ A;  2JP2 A;  3D8F A;  5CLL B;  2ZPY A;  1UNP A;  2Y8G A;  1MIX A;  3NSU A;  4EKU A;  2J0J A;  2D11 A;  2G35 A;  3BJI A;  1OMW A;  4YL8 A;  1MAI A;  2P8V A;  3ODW A;  3GYO A;  1P6S A;  1Y5O A;  3DXC A;  3ODO A;  1FGY A;  4KVG B;  2KCJ A;  3AJ4 A;  2Y7B A;  3WYF B;  3G9W A;  4IOY X;  3DXD A;  5C5B B;  2COA A;  1NTY A;  4F7U P;  4A6F B;  2COD A;  2D9V A;  2J0K A;  4GMV A;  4Y94 A;  3TVV A;  2PZ1 A;  3M1I B;  4HDO A;  2RGN B;  4CYE A;  5J3Y A;  1TQZ A;  2DKP A;  2J59 M;  2EMS A;  2OQB A;  2X18 A;  1OQN A;  3FM8 C;  5KCV A;  2LG1 A;  2LUL A;  1RJ2 A;  3MDB C;  1J0W A;  2VSZ A;  1UEF A;  1I2H A;  4ZRJ A;  1V5U A;  2N0Y A;  2EJ8 A;  5GOW B;  4HDQ A;  3TCA A;  2GJY A;  1MKE A;  1UNQ A;  2EMT A;  2RNR B;  2YT1 A;  3ODX A;  3ML4 A;  3RCP A;  2HTH B;  3P7Z A;  4WJ7 A;  1BAK A;  4HB3 B;  1NI2 A;  2RSG A;  2FJL A;  1FB8 A;  3F5R A;  1ZVR A;  4HAW B;  2GCJ A;  4DXA B;  2K00 A;  3A98 B;  2H7D A;  1BWN A;  2DHJ A;  2YVC A;  1XCG A;  3PVW A;  1ZC3 B;  1EVH A;  2CY5 A;  1QC6 A;  4HAY B;  1X86 A;  2D10 A;  1H4R A;  4IAP A;  4H8S A;  2RVB B;  5J3T A;  2DX5 A;  3DXE A;  2UZS A;  2E2X A;  3KRX A;  2YS3 A;  5LOP B;  3ULC A;  3CXB B;  4HAV B;  1U27 A;  4KHB B;  1WGQ A;  2VRW B;  3PEG A;  4A6H A;  2K2J A;  4KHO A;  1EGX A;  1QQG A;  2DTC A;  2D9Z A;  3KZ1 A;  2RLO A;  2W2X D;  2YS5 A;  3PG7 A;  3V5W A;  1P5T A;  1U5G A;  2I1K A;  5DHF B;  5JHH A;  2Z0Q A;  1IRS A;  5CLQ B;  4WSF A;  1W1H A;  3BIN A;  2IYB A;  1Y19 B;  3TO1 A;  1MPH A;  1ZSQ A;  2MDX A;  2ROV A;  5DHA B;  1U5F A;  4XWX A;  3SUZ A;  4ZRI A;  4HAX B;  2D9Y A;  1N3H A;  1TJ6 A;  3A8P A;  4HHV A;  2ELB A;  2L1C A;  1XR0 B;  1M7R A;  2BCJ A;  2MWN B;  2P0D A;  1Q67 A;  2M38 A;  5DI9 B;  5EFX A;  3ULB A;  2KUP A;  1FAO A;  1LW3 A;  1ZC4 B;  3LJU X;  1XOD A;  1SGH A;  3MPX A;  2ROZ B;  2M14 A;  4K81 A;  3KSY A;  1M7E A; 
#chains in the Genus database with same CATH topology
 3F0W A;  5D27 A;  1Z87 A;  2L2I A;  5D3V A;  3A8Q A;  1GC7 A;  3PZD A;  5C6R A;  4EMO A;  1AWE A;  1DYN A;  5FI1 A;  5D3Y A;  4Z2M B;  2RUK B;  5HE1 A;  1B55 A;  1NU2 A;  1ZM0 A;  4PQ0 A;  2NMB A;  1KZ7 A;  1RRP B;  2LYD A;  1X1G A;  2I1J A;  4P7I A;  4A5K A;  2Z14 A;  5C16 A;  5JLJ B;  1DDM A;  1WGU A;  1LB1 A;  2VKI A;  1FHO A;  1UPQ A;  2XQN M;  3GYP A;  1BTK A;  2P0F A;  3P6A A;  2DKQ A;  2J0M A;  3O96 A;  3PSC A;  3SNH A;  4HAU B;  3QBV B;  4EJN A;  2YF0 A;  4A6K A;  1TXD A;  1W1D A;  2DX1 A;  2DHK A;  1AQC A;  1UPR A;  3TW1 A;  3CIK A;  5C5B A;  5FI0 A;  1K5D B;  2YT0 A;  1PFJ A;  2UVM A;  3OHM B;  2Z0P A;  3DCX A;  2QKM A;  4GZU A;  5JHG A;  4GNK B;  3VIA A;  1U2B A;  5DIF B;  1H10 A;  2LOX A;  3FVC A;  3WA0 A;  2CRF A;  2RRF A;  2EC1 A;  1X1F A;  2Q13 A;  5J3Q A;  4CHJ A;  1WVH A;  1U5E A;  3TFM A;  1P3R A;  4K2P A;  5HE0 A;  4DIX A;  4QJ4 B;  4MK0 A;  4HB4 B;  1MI1 A;  2IFS A;  2DHI A;  4F7H A;  2MFQ A;  1J19 A;  2W2W A;  4IFS A;  4GOU A;  1X11 A;  1W1G A;  2QKL A;  5JP4 A;  1XD4 A;  1XX0 A;  1FHX A;  4CHM A;  2Z59 A;  5C79 A;  4HAT B;  4NSW A;  3FSS A;  1ZYI A;  3AU5 A;  2HE7 A;  5KQ4 A;  5IRS A;  1U5D A;  2OTX A;  4WVF B;  5HE2 A;  3KY9 A;  4MT7 A;  2UZR A;  3HQC A;  3PVU A;  3SO6 A;  4KAX B;  4D0N B;  1ISN A;  4BBK A;  1DRO A;  3ZVR A;  2DYN A;  1WJ1 A;  1DBH A;  3HW2 B;  3ZDT A;  1GC6 A;  3U7D A;  1V88 A;  2ZKM X;  2GCL A;  4HAZ B;  2R09 A;  1UNR A;  3B77 A;  1WI1 A;  2W2X C;  1V61 A;  3U8Z A;  1DDV A;  4C0A A;  2COF A;  3QIJ A;  4NY0 A;  1WG7 A;  2D9X A;  4DX8 A;  2H7E A;  3PP2 A;  5KQ1 A;  1MK7 B;  2CAY A;  3X23 A;  4B6H A;  4GMX B;  3HSA A;  3D8D A;  2D9W A;  5DH9 B;  1KI1 B;  1NTV A;  1KZG A;  2KGX B;  1K5G B;  2GS0 A;  1U29 A;  2R0D A;  5HE3 A;  1XKE A;  3AU4 A;  3HK0 A;  2NZ8 B;  2CY4 A;  3QWM A;  2DA0 A;  4YON A;  2AL6 A;  4PNK A;  1E5W A;  5L81 A;  1GG3 A;  2D4Q A;  1MK9 B;  2Z0O A;  1EF1 A;  4TKN A;  1MIZ B;  4GN1 A;  4L1R A;  4L6E A;  5LON B;  1OY2 A;  3KRW A;  3VOQ A;  4A6F A;  2DN6 A;  2GUM A;  4TYZ A;  2D2Q A;  2MKR A;  3N7C A;  4MY6 A;  4DBB A;  4GPT B;  2N23 A;  2I5C A;  2ADZ A;  4KHA A;  1PLS A;  2LOZ A;  1V5M A;  3D8E A;  2DFK A;  1FHW A;  2I5F A;  3PVL A;  3A58 A;  1V5P A;  2DYQ A;  3OAN A;  4F7G A;  4GXB A;  2Y8F A;  3UZT A;  4HB0 B;  2P0H A;  3IVF A;  5M4Y B;  3SV1 A;  1I7A A;  1WJM A;  1FOE A;  2K2U A;  2DLW A;  2YRY A;  2YS1 A;  2AEH A;  1PMS A;  5D3W A;  4ZRK A;  3T06 A;  3SYX A;  2V76 A;  1X05 A;  2K49 A;  1V89 A;  4D6W A;  4HB2 B;  2YSZ A;  4Z2N A;  4CSQ A;  1EAZ A;  1SHC A;  1BTN A;  1DDW A;  4DX9 0;  4K17 A;  2LKO A;  5D3X A;  2ELA A;  4K2O A;  2COC A;  3FEH A;  1FGZ A;  2KR0 A;  2JP2 A;  3D8F A;  5CLL B;  2ZPY A;  1UNP A;  2Y8G A;  1MIX A;  3NSU A;  4EKU A;  2J0J A;  2D11 A;  2G35 A;  3BJI A;  1OMW A;  4YL8 A;  1MAI A;  2P8V A;  3ODW A;  3GYO A;  1P6S A;  4KHB A;  1Y5O A;  3DXC A;  3ODO A;  1FGY A;  4KVG B;  2KCJ A;  3AJ4 A;  2Y7B A;  3WYF B;  3G9W A;  2K8E A;  4IOY X;  3DXD A;  5C5B B;  3NW8 A;  2COA A;  1NTY A;  4F7U P;  4A6F B;  2COD A;  2D9V A;  1T77 A;  2J0K A;  2KIE A;  4GMV A;  4Y94 A;  3TVV A;  2PZ1 A;  3M1I B;  4HDO A;  2RGN B;  4CYE A;  5J3Y A;  1TQZ A;  2DKP A;  2J59 M;  2EMS A;  2OQB A;  3U12 A;  2X18 A;  1OQN A;  3NWD A;  3FM8 C;  2YT2 A;  5KCV A;  2LG1 A;  2LUL A;  1RJ2 A;  3MDB C;  1J0W A;  2VSZ A;  1UEF A;  1I2H A;  4ZRJ A;  1V5U A;  2N0Y A;  2EJ8 A;  5GOW B;  4HDQ A;  3TCA A;  2GJY A;  1MKE A;  1UNQ A;  2EMT A;  4HSI A;  2RNR B;  2YT1 A;  3ODX A;  3ML4 A;  3RCP A;  2HTH B;  3P7Z A;  4WJ7 A;  1BAK A;  4HB3 B;  1NI2 A;  2RSG A;  2FJL A;  1FB8 A;  3F5R A;  1ZVR A;  4HAW B;  2GCJ A;  4DXA B;  2NBV A;  2K00 A;  3A98 B;  2H7D A;  1BWN A;  2DHJ A;  2R2Y A;  2YVC A;  1XCG A;  3PVW A;  1ZC3 B;  1EVH A;  2CY5 A;  1QC6 A;  4HAY B;  1X86 A;  2D10 A;  1H4R A;  4IAP A;  4H8S A;  2RVB B;  5J3T A;  2DX5 A;  3DXE A;  2UZS A;  2E2X A;  3KRX A;  2YS3 A;  5LOP B;  3ULC A;  3CXB B;  4HAV B;  1U27 A;  4KHB B;  1WGQ A;  3NWF A;  2VRW B;  3PEG A;  4A6H A;  2K2J A;  4KHO A;  1EGX A;  1QQG A;  2DTC A;  2D9Z A;  3KZ1 A;  2RLO A;  2W2X D;  2YS5 A;  3NWA A;  3PG7 A;  5I2M A;  3V5W A;  1P5T A;  1U5G A;  2I1K A;  5DHF B;  5JHH A;  2Z0Q A;  1IRS A;  4QJ5 B;  2FJU B;  5CLQ B;  4WSF A;  5LG4 B;  1W1H A;  3BIN A;  2IYB A;  1Y19 B;  3TO1 A;  1MPH A;  1ZSQ A;  2MDX A;  2ROV A;  5DHA B;  2KIG A;  1U5F A;  4OT1 A;  4XWX A;  3SUZ A;  4ZRI A;  2Z4D A;  4HAX B;  4QXA B;  2D9Y A;  1N3H A;  1TJ6 A;  2KUQ A;  3A8P A;  4HHV A;  2ELB A;  2L1C A;  1XR0 B;  1M7R A;  2BCJ A;  2MWN B;  2P0D A;  1Q67 A;  2M38 A;  5DI9 B;  2Z13 A;  3HIE A;  5EFX A;  3ULB A;  2KUP A;  1FAO A;  1LW3 A;  1ZC4 B;  3LJU X;  1XOD A;  5I2S A;  1SGH A;  3MPX A;  4OSN A;  4QJ3 B;  2ROZ B;  2M14 A;  4K81 A;  3KSY A;  1M7E A; 
#chains in the Genus database with same CATH homology
 3F0W A;  5D27 A;  1Z87 A;  2L2I A;  5D3V A;  3A8Q A;  1GC7 A;  3PZD A;  5C6R A;  4EMO A;  1AWE A;  1DYN A;  5FI1 A;  5D3Y A;  4Z2M B;  2RUK B;  5HE1 A;  1B55 A;  1NU2 A;  1ZM0 A;  4PQ0 A;  2NMB A;  1KZ7 A;  1RRP B;  2LYD A;  1X1G A;  2I1J A;  4P7I A;  4A5K A;  5C16 A;  5JLJ B;  1DDM A;  1WGU A;  1LB1 A;  2VKI A;  1FHO A;  1UPQ A;  2XQN M;  3GYP A;  1BTK A;  2P0F A;  3P6A A;  2DKQ A;  2J0M A;  3O96 A;  3PSC A;  3SNH A;  4HAU B;  3QBV B;  4EJN A;  2YF0 A;  4A6K A;  1TXD A;  1W1D A;  2DX1 A;  2DHK A;  1AQC A;  1UPR A;  3TW1 A;  3CIK A;  5C5B A;  5FI0 A;  1K5D B;  2YT0 A;  1PFJ A;  2UVM A;  2Z0P A;  2QKM A;  4GZU A;  5JHG A;  3VIA A;  1U2B A;  5DIF B;  1H10 A;  2LOX A;  3WA0 A;  2CRF A;  2EC1 A;  1X1F A;  2Q13 A;  5J3Q A;  4CHJ A;  1WVH A;  1U5E A;  3TFM A;  1P3R A;  4K2P A;  5HE0 A;  4MK0 A;  4HB4 B;  2IFS A;  2DHI A;  4F7H A;  2MFQ A;  1J19 A;  2W2W A;  4IFS A;  1X11 A;  1W1G A;  2QKL A;  5JP4 A;  1XD4 A;  1XX0 A;  1FHX A;  4CHM A;  5C79 A;  4HAT B;  4NSW A;  3FSS A;  3AU5 A;  2HE7 A;  5KQ4 A;  1U5D A;  2OTX A;  4WVF B;  5HE2 A;  3KY9 A;  4MT7 A;  2UZR A;  3HQC A;  3PVU A;  3SO6 A;  4KAX B;  4D0N B;  1ISN A;  4BBK A;  1DRO A;  3ZVR A;  2DYN A;  1WJ1 A;  1DBH A;  3HW2 B;  3ZDT A;  1GC6 A;  3U7D A;  1V88 A;  2GCL A;  4HAZ B;  2R09 A;  1UNR A;  1WI1 A;  2W2X C;  1V61 A;  3U8Z A;  1DDV A;  4C0A A;  2COF A;  3QIJ A;  4NY0 A;  1WG7 A;  2D9X A;  4DX8 A;  2H7E A;  3PP2 A;  5KQ1 A;  1MK7 B;  2CAY A;  3X23 A;  4B6H A;  4GMX B;  3D8D A;  2D9W A;  5DH9 B;  1KI1 B;  1NTV A;  1KZG A;  2KGX B;  1K5G B;  2GS0 A;  1U29 A;  2R0D A;  5HE3 A;  1XKE A;  3AU4 A;  3HK0 A;  2NZ8 B;  2CY4 A;  3QWM A;  2DA0 A;  4YON A;  2AL6 A;  4PNK A;  1E5W A;  5L81 A;  1GG3 A;  2D4Q A;  1MK9 B;  2Z0O A;  1EF1 A;  4TKN A;  1MIZ B;  4GN1 A;  4L6E A;  5LON B;  1OY2 A;  3KRW A;  3VOQ A;  4A6F A;  2DN6 A;  4TYZ A;  2D2Q A;  2MKR A;  3N7C A;  4MY6 A;  4DBB A;  4GPT B;  2N23 A;  2I5C A;  2ADZ A;  4KHA A;  1PLS A;  2LOZ A;  1V5M A;  3D8E A;  2DFK A;  1FHW A;  2I5F A;  3PVL A;  1V5P A;  2DYQ A;  3OAN A;  4F7G A;  4GXB A;  2Y8F A;  3UZT A;  4HB0 B;  2P0H A;  3IVF A;  3SV1 A;  1I7A A;  1WJM A;  1FOE A;  2K2U A;  2DLW A;  2YRY A;  2YS1 A;  2AEH A;  1PMS A;  5D3W A;  4ZRK A;  3T06 A;  3SYX A;  2V76 A;  1X05 A;  1V89 A;  4HB2 B;  2YSZ A;  4Z2N A;  1EAZ A;  1SHC A;  1BTN A;  1DDW A;  4DX9 0;  4K17 A;  2LKO A;  5D3X A;  2ELA A;  4K2O A;  2COC A;  3FEH A;  1FGZ A;  2JP2 A;  3D8F A;  5CLL B;  2ZPY A;  1UNP A;  2Y8G A;  1MIX A;  3NSU A;  4EKU A;  2J0J A;  2D11 A;  2G35 A;  3BJI A;  1OMW A;  4YL8 A;  1MAI A;  2P8V A;  3ODW A;  3GYO A;  1P6S A;  1Y5O A;  3DXC A;  3ODO A;  1FGY A;  4KVG B;  2KCJ A;  3AJ4 A;  2Y7B A;  3WYF B;  3G9W A;  4IOY X;  3DXD A;  5C5B B;  2COA A;  1NTY A;  4F7U P;  4A6F B;  2COD A;  2D9V A;  2J0K A;  4GMV A;  4Y94 A;  3TVV A;  2PZ1 A;  3M1I B;  4HDO A;  2RGN B;  4CYE A;  5J3Y A;  1TQZ A;  2DKP A;  2J59 M;  2EMS A;  2OQB A;  2X18 A;  1OQN A;  3FM8 C;  5KCV A;  2LG1 A;  2LUL A;  1RJ2 A;  3MDB C;  1J0W A;  2VSZ A;  1UEF A;  1I2H A;  4ZRJ A;  1V5U A;  2N0Y A;  2EJ8 A;  5GOW B;  4HDQ A;  3TCA A;  2GJY A;  1MKE A;  1UNQ A;  2EMT A;  2RNR B;  2YT1 A;  3ODX A;  3ML4 A;  3RCP A;  2HTH B;  3P7Z A;  4WJ7 A;  1BAK A;  4HB3 B;  1NI2 A;  2RSG A;  2FJL A;  1FB8 A;  3F5R A;  1ZVR A;  4HAW B;  2GCJ A;  4DXA B;  2K00 A;  3A98 B;  2H7D A;  1BWN A;  2DHJ A;  2YVC A;  1XCG A;  3PVW A;  1ZC3 B;  1EVH A;  2CY5 A;  1QC6 A;  4HAY B;  1X86 A;  2D10 A;  1H4R A;  4IAP A;  4H8S A;  2RVB B;  5J3T A;  2DX5 A;  3DXE A;  2UZS A;  2E2X A;  3KRX A;  2YS3 A;  5LOP B;  3ULC A;  3CXB B;  4HAV B;  1U27 A;  4KHB B;  1WGQ A;  2VRW B;  3PEG A;  4A6H A;  2K2J A;  4KHO A;  1EGX A;  1QQG A;  2DTC A;  2D9Z A;  3KZ1 A;  2RLO A;  2W2X D;  2YS5 A;  3PG7 A;  3V5W A;  1P5T A;  1U5G A;  2I1K A;  5DHF B;  5JHH A;  2Z0Q A;  1IRS A;  5CLQ B;  4WSF A;  1W1H A;  3BIN A;  2IYB A;  1Y19 B;  3TO1 A;  1MPH A;  1ZSQ A;  2MDX A;  2ROV A;  5DHA B;  1U5F A;  4XWX A;  3SUZ A;  4ZRI A;  4HAX B;  2D9Y A;  1N3H A;  1TJ6 A;  3A8P A;  4HHV A;  2ELB A;  2L1C A;  1XR0 B;  1M7R A;  2BCJ A;  2MWN B;  2P0D A;  1Q67 A;  2M38 A;  5DI9 B;  5EFX A;  3ULB A;  2KUP A;  1FAO A;  1LW3 A;  1ZC4 B;  3LJU X;  1XOD A;  1SGH A;  3MPX A;  2ROZ B;  2M14 A;  4K81 A;  3KSY A;  1M7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...