2ELAA

Crystal structure of the ptb domain of human appl1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
131
Chain Sequence
SILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the BAR-PH and PTB Domains of Human APPL1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Adapter protein containing PH domain, PTB domain and leucine
total genus 33
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2elaA00
1WJ1A 2D11A 1EGXA 5KCVA 3ULBA 3AJ4A 3ZDTA 4ZRJA 2RUKB 1OY2A 1U27A 2ROZB 2ELAA 1BTNA 2COCA 1ISNA 4IAPA 1P3RA 4GZUA 3P6AA 2UVMA 3BINA 5HE3A 2I5FA 4BBKA 1AWEA 4HAXB 4DX90 3DXCA 1BAKA 2DX1A 4GPTB 1FGYA 2K00A 5D3WA 3QWMA 4C0AA 1K5DB 2P8VA 1FHXA 4MY6A 3A8PA 1UNQA 1X1FA 2NZ8B 3ULCA 3AU5A 3VIAA 3PP2A 2CODA 2R0DA 1IRSA 4K81A 3SYXA 4EJNA 5GOWB 3WYFB 1I7AA 2J59M 5LONB 1FGZA 2D2QA 3N7CA 2I1JA 3MDBC 3QIJA 3HW2B 3KRWA 2LOXA 1U5DA 1V5UA 2J0MA 3PVLA 5C5BB 3WA0A 1GC6A 2Z0OA 5D27A 5C16A 4HB3B 1DYNA 4GXBA 2DHJA 1W1GA 2K2JA 5JHHA 1TJ6A 2IYBA 2OQBA 2H7EA 4WSFA 3PSCA 1FAOA 5J3QA 2DN6A 1U5FA 2ADZA 1V5PA 2PZ1A 3ODXA 4Z2MB 2RLOA 2J0KA 2I1KA 2YT1A 2D9ZA 4GMXB 2DHKA 4TKNA 4CYEA 4CHMA 2D9YA 1NI2A 4KHAA 2DHIA 2CY4A 1X1GA 5FI1A 5C5BA 2BCJA 2M14A 4P7IA 1OMWA 2W2WA 2LKOA 3KSYA 4HB4B 4PNKA 1UNPA 4K2PA 2RVBB 3D8EA 1ZC4B 5HE2A 2LG1A 1FHOA 2MKRA 5JHGA 2RNRB 2W2XD 1EAZA 1FB8A 1FHWA 4IOYX 1NU2A 3TW1A 1K5GB 2UZSA 1V89A 2HTHB 3TCAA 3F0WA 5KQ1A 4F7GA 3IVFA 2L2IA 2QKMA 3PVUA 3OANA 5C79A 1WGQA 1XODA 1WG7A 3GYOA 4HATB 3KY9A 2MDXA 4XWXA 2EMSA 3FSSA 1KZ7A 5HE0A 1LB1A 4MK0A 2VRWB 2EJ8A 2GCLA 3F5RA 3SUZA 5D3VA 1LW3A 3O96A 1DDMA 5EFXA 1WVHA 2EMTA 4K2OA 1XR0B 1GG3A 1J0WA 1MAIA 1WI1A 2JP2A 4HHVA 3AU4A 4D0NB 2UZRA 2NMBA 3D8FA 1EF1A 5JLJB 1Y19B 2AL6A 1V5MA 4HAUB 1SGHA 2E2XA 5DH9B 1PFJA 3TFMA 3BJIA 2I5CA 2YT0A 1X86A 3CIKA 3ODOA 1KZGA 1PMSA 2COAA 2LYDA 5JP4A 2H7DA 1UPRA 1U5EA 4KHOA 2P0FA 3A98B 3G9WA 2IFSA 1OQNA 1Z87A 3SNHA 1I2HA 2Z0PA 3PZDA 1M7RA 1W1HA 3U7DA 1GC7A 1PLSA 2KCJA 3D8DA 1ZC3B 2MFQA 4PQ0A 1Q67A 4ZRKA 1KI1B 4WJ7A 1DBHA 2D4QA 1RRPB 1U5GA 4L6EA 3TO1A 3DXEA 5HE1A 1XCGA 3HK0A 1J19A 4DBBA 2GJYA 2P0HA 3SV1A 4A6FA 4HB2B 1M7EA 4HAWB 2EC1A 4HAYB 4A6KA 2DKPA 2DYQA 2LULA 1XX0A 5C6RA 2P0DA 2ROVA 1V88A 2KUPA 1AQCA 2RGNB 4ZRIA 2ZPYA 4DXAB 3KRXA 3M1IB 4NY0A 2GCJA 2CRFA 2XQNM 4YL8A 4A5KA 2YVCA 4EMOA 2N23A 1P5TA 2Y8FA 2D9XA 1UPQA 1DROA 2DKQA 2LOZA 1TQZA 2DTCA 2J0JA 1EVHA 2D9VA 1P6SA 4WVFB 5DIFB 4HDQA 3P7ZA 3NSUA 3RCPA 2CY5A 4GMVA 4A6HA 4KVGB 5L81A 1FOEA 2AEHA 2RSGA 3U8ZA 4B6HA 5DHFB 1NTVA 3UZTA 2YRYA 4HAVB 4F7HA 5LOPB 4GN1A 2OTXA 1QC6A 2YSZA 4TYZA 3PG7A 2YS5A 1E5WA 2X18A 1BTKA 2DX5A 2M38A 2G35A 4Z2NA 1U29A 3PEGA 2L1CA 1X05A 5D3XA 3X23A 4HAZB 1SHCA 3PVWA 2V76A 4A6FB 2KGXB 1RJ2A 1W1DA 1Y5OA 3VOQA 1UNRA 5CLQB 2W2XC 1MPHA 2COFA 2D10A 3HQCA 4Y94A 2Q13A 4HDOA 3KZ1A 3V5WA 2DA0A 1ZVRA 2YF0A 1XKEA 3CXBB 3ODWA 3FM8C 2GS0A 2YS1A 1TXDA 3ZVRA 1N3HA 1X11A 5J3TA 1MK7B 4IFSA 3SO6A 5KQ4A 4KAXB 1MIXA 1BWNA 2Y7BA 1NTYA 5CLLB 4EKUA 2D9WA 4YONA 2N0YA 2DYNA 3TVVA 4KHBB 2MWNB 4K17A 1MK9B 3LJUX 5FI0A 2FJLA 3ML4A 1MIZB 4MT7A 3T06A 5D3YA 3FEHA 2CAYA 4F7UP 1H4RA 4CHJA 1MKEA 2Z0QA 1UEFA 3QBVB 2Y8GA 2QKLA 1QQGA 2YS3A 3MPXA 1ZSQA 5DI9B 2DFKA 5DHAB 2VSZA 4H8SA 1DDVA 1H10A 1V61A 2DLWA 1WJMA 1B55A 3A8QA 2VKIA 1U2BA 2K2UA 1DDWA 1XD4A 2HE7A 2R09A 1WGUA 3DXDA 5J3YA 4NSWA 1ZM0A 4DX8A 3GYPA 4HB0B 2ELBA
chains in the Genus database with same CATH superfamily
1WJ1A 2D11A 1EGXA 5I2MA 5KCVA 3ULBA 4L1RA 3AJ4A 3ZDTA 4ZRJA 2RUKB 1OY2A 1U27A 2ROZB 2ELAA 1BTNA 2COCA 1ISNA 4IAPA 1P3RA 4GZUA 3HIEA 3P6AA 2UVMA 3BINA 5HE3A 2I5FA 4BBKA 1AWEA 4HAXB 4DX90 3DXCA 1BAKA 2DX1A 4GPTB 1FGYA 2K00A 2Z14A 5D3WA 3QWMA 4CSQA 4C0AA 1K5DB 2P8VA 1FHXA 4MY6A 3A8PA 1UNQA 1X1FA 2NZ8B 3ULCA 3AU5A 3VIAA 3PP2A 2CODA 2R0DA 1IRSA 4K81A 3SYXA 4EJNA 5GOWB 3WYFB 1I7AA 2J59M 5LONB 1FGZA 2D2QA 3N7CA 2I1JA 2Z4DA 3MDBC 3QIJA 3HW2B 3KRWA 2LOXA 1U5DA 1V5UA 3PVLA 2J0MA 3B77A 4KHBA 1GC6A 2Z0OA 5D27A 5C5BB 3WA0A 5C16A 1ZYIA 4HB3B 3OHMB 1DYNA 4GXBA 2DHJA 1W1GA 2K2JA 5JHHA 1TJ6A 2IYBA 2OQBA 2H7EA 4WSFA 3PSCA 2NBVA 3DCXA 1FAOA 5J3QA 2DN6A 1U5FA 2ADZA 1V5PA 5M4YB 2PZ1A 3ODXA 4Z2MB 2RLOA 2J0KA 2I1KA 2YT1A 2D9ZA 4GMXB 2DHKA 4TKNA 4CYEA 4CHMA 2Z13A 2D9YA 1NI2A 4KHAA 2DHIA 2CY4A 2YT2A 1X1GA 5FI1A 5C5BA 2BCJA 2M14A 2KIEA 4QJ3B 2Z59A 4P7IA 1OMWA 2W2WA 2LKOA 3KSYA 4HB4B 4PNKA 1UNPA 4K2PA 2RVBB 3D8EA 1ZC4B 5HE2A 2LG1A 1FHOA 2MKRA 5JHGA 2RNRB 2W2XD 2R2YA 1EAZA 1FB8A 1FHWA 4IOYX 1NU2A 3TW1A 1K5GB 2UZSA 1V89A 2HTHB 3TCAA 3F0WA 5KQ1A 4F7GA 3IVFA 2L2IA 2QKMA 3PVUA 3OANA 5C79A 1WGQA 1XODA 1WG7A 3GYOA 4QJ5B 4HATB 3KY9A 2MDXA 2K8EA 4XWXA 2EMSA 3FSSA 1KZ7A 5HE0A 1LB1A 4MK0A 2VRWB 2EJ8A 2GCLA 3F5RA 3SUZA 5D3VA 4D6WA 2KUQA 1LW3A 3O96A 1DDMA 5EFXA 1WVHA 2EMTA 4K2OA 1XR0B 1GG3A 1J0WA 1MAIA 1WI1A 2JP2A 4HHVA 3AU4A 4D0NB 2UZRA 4HSIA 3U12A 2NMBA 3D8FA 1EF1A 5JLJB 5IRSA 1Y19B 2AL6A 1V5MA 4HAUB 1SGHA 2E2XA 1MI1A 5DH9B 1PFJA 3TFMA 3BJIA 2I5CA 2YT0A 1X86A 3CIKA 3ODOA 1KZGA 1PMSA 2COAA 2LYDA 5JP4A 2H7DA 1UPRA 1U5EA 3NW8A 4KHOA 4OT1A 2P0FA 3A98B 3G9WA 2IFSA 1OQNA 5LG4B 1Z87A 3SNHA 1I2HA 2Z0PA 3PZDA 1M7RA 1W1HA 3U7DA 1GC7A 1PLSA 2KCJA 3D8DA 1ZC3B 2MFQA 4PQ0A 1Q67A 4ZRKA 1T77A 1KI1B 4WJ7A 1DBHA 2D4QA 1RRPB 1U5GA 4L6EA 3TO1A 3DXEA 5HE1A 1XCGA 3HK0A 1J19A 4DBBA 2GJYA 2P0HA 3SV1A 4A6FA 4HB2B 1M7EA 4HAWB 2EC1A 4HAYB 4A6KA 4GOUA 2DKPA 2DYQA 2LULA 1XX0A 5C6RA 2P0DA 2ROVA 1V88A 3NWAA 2KUPA 1AQCA 2RGNB 4ZRIA 2ZPYA 4DXAB 3KRXA 3M1IB 4NY0A 2GCJA 2CRFA 2XQNM 4YL8A 4A5KA 2YVCA 2KIGA 4EMOA 2N23A 1P5TA 2Y8FA 2D9XA 1UPQA 1DROA 2DKQA 2LOZA 1TQZA 2DTCA 2J0JA 1EVHA 2D9VA 1P6SA 4WVFB 5DIFB 4HDQA 3P7ZA 3NSUA 3RCPA 2CY5A 4GMVA 3NWFA 4A6HA 4KVGB 2FJUB 5L81A 1FOEA 2AEHA 2RSGA 3U8ZA 2ZKMX 2GUMA 4B6HA 5DHFB 1NTVA 3A58A 3UZTA 2YRYA 4HAVB 4F7HA 5LOPB 4GN1A 2OTXA 1QC6A 2YSZA 4TYZA 3PG7A 2YS5A 1E5WA 2X18A 1BTKA 2DX5A 2M38A 2G35A 4Z2NA 1U29A 3PEGA 2L1CA 1X05A 5D3XA 3X23A 4HAZB 1SHCA 3PVWA 2V76A 4A6FB 5I2SA 2KGXB 1RJ2A 1W1DA 1Y5OA 3VOQA 2KR0A 1UNRA 5CLQB 2W2XC 4GNKB 1MPHA 2COFA 2D10A 3HQCA 3HSAA 4Y94A 2Q13A 4HDOA 3KZ1A 3V5WA 2DA0A 1ZVRA 2YF0A 1XKEA 3CXBB 3ODWA 3FM8C 2GS0A 2YS1A 1TXDA 4OSNA 3ZVRA 1N3HA 1X11A 5J3TA 1MK7B 3NWDA 4IFSA 3SO6A 5KQ4A 4KAXB 1MIXA 1BWNA 2Y7BA 1NTYA 5CLLB 4EKUA 2D9WA 4YONA 2N0YA 2DYNA 3TVVA 4QXAB 3FVCA 4KHBB 2MWNB 4K17A 1MK9B 3LJUX 5FI0A 2FJLA 2RRFA 3ML4A 4DIXA 1MIZB 4MT7A 3T06A 5D3YA 4QJ4B 3FEHA 2CAYA 4F7UP 1H4RA 4CHJA 1MKEA 2Z0QA 1UEFA 3QBVB 2Y8GA 2QKLA 1QQGA 2YS3A 2K49A 3MPXA 1ZSQA 5DI9B 2DFKA 5DHAB 2VSZA 4H8SA 1DDVA 1H10A 1V61A 2DLWA 1WJMA 1B55A 3A8QA 2VKIA 1U2BA 2K2UA 1DDWA 1XD4A 2HE7A 2R09A 1WGUA 3DXDA 5J3YA 4NSWA 1ZM0A 4DX8A 3GYPA 4HB0B 2ELBA
chains in the Genus database with same CATH topology
1WJ1A 2D11A 1EGXA 5KCVA 3ULBA 3AJ4A 3ZDTA 4ZRJA 2RUKB 1OY2A 1U27A 2ROZB 2ELAA 1BTNA 2COCA 1ISNA 4IAPA 1P3RA 4GZUA 3P6AA 2UVMA 3BINA 5HE3A 2I5FA 4BBKA 1AWEA 4HAXB 4DX90 3DXCA 1BAKA 2DX1A 4GPTB 1FGYA 2K00A 5D3WA 3QWMA 4C0AA 1K5DB 2P8VA 1FHXA 4MY6A 3A8PA 1UNQA 1X1FA 2NZ8B 3ULCA 3AU5A 3VIAA 3PP2A 2CODA 2R0DA 1IRSA 4K81A 3SYXA 4EJNA 5GOWB 3WYFB 1I7AA 2J59M 5LONB 1FGZA 2D2QA 3N7CA 2I1JA 3MDBC 3QIJA 3HW2B 3KRWA 2LOXA 1U5DA 1V5UA 2J0MA 3PVLA 5C5BB 3WA0A 1GC6A 2Z0OA 5D27A 5C16A 4HB3B 1DYNA 4GXBA 2DHJA 1W1GA 2K2JA 5JHHA 1TJ6A 2IYBA 2OQBA 2H7EA 4WSFA 3PSCA 1FAOA 5J3QA 2DN6A 1U5FA 2ADZA 1V5PA 2PZ1A 3ODXA 4Z2MB 2RLOA 2J0KA 2I1KA 2YT1A 2D9ZA 4GMXB 2DHKA 4TKNA 4CYEA 4CHMA 2D9YA 1NI2A 4KHAA 2DHIA 2CY4A 1X1GA 5FI1A 5C5BA 2BCJA 2M14A 4P7IA 1OMWA 2W2WA 2LKOA 3KSYA 4HB4B 4PNKA 1UNPA 4K2PA 2RVBB 3D8EA 1ZC4B 5HE2A 2LG1A 1FHOA 2MKRA 5JHGA 2RNRB 2W2XD 1EAZA 1FB8A 1FHWA 4IOYX 1NU2A 3TW1A 1K5GB 2UZSA 1V89A 2HTHB 3TCAA 3F0WA 5KQ1A 4F7GA 3IVFA 2L2IA 2QKMA 3PVUA 3OANA 5C79A 1WGQA 1XODA 1WG7A 3GYOA 4HATB 3KY9A 2MDXA 4XWXA 2EMSA 3FSSA 1KZ7A 5HE0A 1LB1A 4MK0A 2VRWB 2EJ8A 2GCLA 3F5RA 3SUZA 5D3VA 1LW3A 3O96A 1DDMA 5EFXA 1WVHA 2EMTA 4K2OA 1XR0B 1GG3A 1J0WA 1MAIA 1WI1A 2JP2A 4HHVA 3AU4A 4D0NB 2UZRA 2NMBA 3D8FA 1EF1A 5JLJB 1Y19B 2AL6A 1V5MA 4HAUB 1SGHA 2E2XA 5DH9B 1PFJA 3TFMA 3BJIA 2I5CA 2YT0A 1X86A 3CIKA 3ODOA 1KZGA 1PMSA 2COAA 2LYDA 5JP4A 2H7DA 1UPRA 1U5EA 4KHOA 2P0FA 3A98B 3G9WA 2IFSA 1OQNA 1Z87A 3SNHA 1I2HA 2Z0PA 3PZDA 1M7RA 1W1HA 3U7DA 1GC7A 1PLSA 2KCJA 3D8DA 1ZC3B 2MFQA 4PQ0A 1Q67A 4ZRKA 1KI1B 4WJ7A 1DBHA 2D4QA 1RRPB 1U5GA 4L6EA 3TO1A 3DXEA 5HE1A 1XCGA 3HK0A 1J19A 4DBBA 2GJYA 2P0HA 3SV1A 4A6FA 4HB2B 1M7EA 4HAWB 2EC1A 4HAYB 4A6KA 2DKPA 2DYQA 2LULA 1XX0A 5C6RA 2P0DA 2ROVA 1V88A 2KUPA 1AQCA 2RGNB 4ZRIA 2ZPYA 4DXAB 3KRXA 3M1IB 4NY0A 2GCJA 2CRFA 2XQNM 4YL8A 4A5KA 2YVCA 4EMOA 2N23A 1P5TA 2Y8FA 2D9XA 1UPQA 1DROA 2DKQA 2LOZA 1TQZA 2DTCA 2J0JA 1EVHA 2D9VA 1P6SA 4WVFB 5DIFB 4HDQA 3P7ZA 3NSUA 3RCPA 2CY5A 4GMVA 4A6HA 4KVGB 5L81A 1FOEA 2AEHA 2RSGA 3U8ZA 4B6HA 5DHFB 1NTVA 3UZTA 2YRYA 4HAVB 4F7HA 5LOPB 4GN1A 2OTXA 1QC6A 2YSZA 4TYZA 3PG7A 2YS5A 1E5WA 2X18A 1BTKA 2DX5A 2M38A 2G35A 4Z2NA 1U29A 3PEGA 2L1CA 1X05A 5D3XA 3X23A 4HAZB 1SHCA 3PVWA 2V76A 4A6FB 2KGXB 1RJ2A 1W1DA 1Y5OA 3VOQA 1UNRA 5CLQB 2W2XC 1MPHA 2COFA 2D10A 3HQCA 4Y94A 2Q13A 4HDOA 3KZ1A 3V5WA 2DA0A 1ZVRA 2YF0A 1XKEA 3CXBB 3ODWA 3FM8C 2GS0A 2YS1A 1TXDA 3ZVRA 1N3HA 1X11A 5J3TA 1MK7B 4IFSA 3SO6A 5KQ4A 4KAXB 1MIXA 1BWNA 2Y7BA 1NTYA 5CLLB 4EKUA 2D9WA 4YONA 2N0YA 2DYNA 3TVVA 4KHBB 2MWNB 4K17A 1MK9B 3LJUX 5FI0A 2FJLA 3ML4A 1MIZB 4MT7A 3T06A 5D3YA 3FEHA 2CAYA 4F7UP 1H4RA 4CHJA 1MKEA 2Z0QA 1UEFA 3QBVB 2Y8GA 2QKLA 1QQGA 2YS3A 3MPXA 1ZSQA 5DI9B 2DFKA 5DHAB 2VSZA 4H8SA 1DDVA 1H10A 1V61A 2DLWA 1WJMA 1B55A 3A8QA 2VKIA 1U2BA 2K2UA 1DDWA 1XD4A 2HE7A 2R09A 1WGUA 3DXDA 5J3YA 4NSWA 1ZM0A 4DX8A 3GYPA 4HB0B 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ1 A;  2D11 A;  1EGX A;  5KCV A;  3ULB A;  3AJ4 A;  3ZDT A;  4ZRJ A;  2RUK B;  1OY2 A;  1U27 A;  2ROZ B;  2ELA A;  1BTN A;  2COC A;  1ISN A;  4IAP A;  1P3R A;  4GZU A;  3P6A A;  2UVM A;  3BIN A;  5HE3 A;  2I5F A;  4BBK A;  1AWE A;  4HAX B;  4DX9 0;  3DXC A;  1BAK A;  2DX1 A;  4GPT B;  1FGY A;  2K00 A;  5D3W A;  3QWM A;  4C0A A;  1K5D B;  2P8V A;  1FHX A;  4MY6 A;  3A8P A;  1UNQ A;  1X1F A;  2NZ8 B;  3ULC A;  3AU5 A;  3VIA A;  3PP2 A;  2COD A;  2R0D A;  1IRS A;  4K81 A;  3SYX A;  4EJN A;  5GOW B;  3WYF B;  1I7A A;  2J59 M;  5LON B;  1FGZ A;  2D2Q A;  3N7C A;  2I1J A;  3MDB C;  3QIJ A;  3HW2 B;  3KRW A;  2LOX A;  1U5D A;  1V5U A;  2J0M A;  3PVL A;  5C5B B;  3WA0 A;  1GC6 A;  2Z0O A;  5D27 A;  5C16 A;  4HB3 B;  1DYN A;  4GXB A;  2DHJ A;  1W1G A;  2K2J A;  5JHH A;  1TJ6 A;  2IYB A;  2OQB A;  2H7E A;  4WSF A;  3PSC A;  1FAO A;  5J3Q A;  2DN6 A;  1U5F A;  2ADZ A;  1V5P A;  2PZ1 A;  3ODX A;  4Z2M B;  2RLO A;  2J0K A;  2I1K A;  2YT1 A;  2D9Z A;  4GMX B;  2DHK A;  4TKN A;  4CYE A;  4CHM A;  2D9Y A;  1NI2 A;  4KHA A;  2DHI A;  2CY4 A;  1X1G A;  5FI1 A;  5C5B A;  2BCJ A;  2M14 A;  4P7I A;  1OMW A;  2W2W A;  2LKO A;  3KSY A;  4HB4 B;  4PNK A;  1UNP A;  4K2P A;  2RVB B;  3D8E A;  1ZC4 B;  5HE2 A;  2LG1 A;  1FHO A;  2MKR A;  5JHG A;  2RNR B;  2W2X D;  1EAZ A;  1FB8 A;  1FHW A;  4IOY X;  1NU2 A;  3TW1 A;  1K5G B;  2UZS A;  1V89 A;  2HTH B;  3TCA A;  3F0W A;  5KQ1 A;  4F7G A;  3IVF A;  2L2I A;  2QKM A;  3PVU A;  3OAN A;  5C79 A;  1WGQ A;  1XOD A;  1WG7 A;  3GYO A;  4HAT B;  3KY9 A;  2MDX A;  4XWX A;  2EMS A;  3FSS A;  1KZ7 A;  5HE0 A;  1LB1 A;  4MK0 A;  2VRW B;  2EJ8 A;  2GCL A;  3F5R A;  3SUZ A;  5D3V A;  1LW3 A;  3O96 A;  1DDM A;  5EFX A;  1WVH A;  2EMT A;  4K2O A;  1XR0 B;  1GG3 A;  1J0W A;  1MAI A;  1WI1 A;  2JP2 A;  4HHV A;  3AU4 A;  4D0N B;  2UZR A;  2NMB A;  3D8F A;  1EF1 A;  5JLJ B;  1Y19 B;  2AL6 A;  1V5M A;  4HAU B;  1SGH A;  2E2X A;  5DH9 B;  1PFJ A;  3TFM A;  3BJI A;  2I5C A;  2YT0 A;  1X86 A;  3CIK A;  3ODO A;  1KZG A;  1PMS A;  2COA A;  2LYD A;  5JP4 A;  2H7D A;  1UPR A;  1U5E A;  4KHO A;  2P0F A;  3A98 B;  3G9W A;  2IFS A;  1OQN A;  1Z87 A;  3SNH A;  1I2H A;  2Z0P A;  3PZD A;  1M7R A;  1W1H A;  3U7D A;  1GC7 A;  1PLS A;  2KCJ A;  3D8D A;  1ZC3 B;  2MFQ A;  4PQ0 A;  1Q67 A;  4ZRK A;  1KI1 B;  4WJ7 A;  1DBH A;  2D4Q A;  1RRP B;  1U5G A;  4L6E A;  3TO1 A;  3DXE A;  5HE1 A;  1XCG A;  3HK0 A;  1J19 A;  4DBB A;  2GJY A;  2P0H A;  3SV1 A;  4A6F A;  4HB2 B;  1M7E A;  4HAW B;  2EC1 A;  4HAY B;  4A6K A;  2DKP A;  2DYQ A;  2LUL A;  1XX0 A;  5C6R A;  2P0D A;  2ROV A;  1V88 A;  2KUP A;  1AQC A;  2RGN B;  4ZRI A;  2ZPY A;  4DXA B;  3KRX A;  3M1I B;  4NY0 A;  2GCJ A;  2CRF A;  2XQN M;  4YL8 A;  4A5K A;  2YVC A;  4EMO A;  2N23 A;  1P5T A;  2Y8F A;  2D9X A;  1UPQ A;  1DRO A;  2DKQ A;  2LOZ A;  1TQZ A;  2DTC A;  2J0J A;  1EVH A;  2D9V A;  1P6S A;  4WVF B;  5DIF B;  4HDQ A;  3P7Z A;  3NSU A;  3RCP A;  2CY5 A;  4GMV A;  4A6H A;  4KVG B;  5L81 A;  1FOE A;  2AEH A;  2RSG A;  3U8Z A;  4B6H A;  5DHF B;  1NTV A;  3UZT A;  2YRY A;  4HAV B;  4F7H A;  5LOP B;  4GN1 A;  2OTX A;  1QC6 A;  2YSZ A;  4TYZ A;  3PG7 A;  2YS5 A;  1E5W A;  2X18 A;  1BTK A;  2DX5 A;  2M38 A;  2G35 A;  4Z2N A;  1U29 A;  3PEG A;  2L1C A;  1X05 A;  5D3X A;  3X23 A;  4HAZ B;  1SHC A;  3PVW A;  2V76 A;  4A6F B;  2KGX B;  1RJ2 A;  1W1D A;  1Y5O A;  3VOQ A;  1UNR A;  5CLQ B;  2W2X C;  1MPH A;  2COF A;  2D10 A;  3HQC A;  4Y94 A;  2Q13 A;  4HDO A;  3KZ1 A;  3V5W A;  2DA0 A;  1ZVR A;  2YF0 A;  1XKE A;  3CXB B;  3ODW A;  3FM8 C;  2GS0 A;  2YS1 A;  1TXD A;  3ZVR A;  1N3H A;  1X11 A;  5J3T A;  1MK7 B;  4IFS A;  3SO6 A;  5KQ4 A;  4KAX B;  1MIX A;  1BWN A;  2Y7B A;  1NTY A;  5CLL B;  4EKU A;  2D9W A;  4YON A;  2N0Y A;  2DYN A;  3TVV A;  4KHB B;  2MWN B;  4K17 A;  1MK9 B;  3LJU X;  5FI0 A;  2FJL A;  3ML4 A;  1MIZ B;  4MT7 A;  3T06 A;  5D3Y A;  3FEH A;  2CAY A;  4F7U P;  1H4R A;  4CHJ A;  1MKE A;  2Z0Q A;  1UEF A;  3QBV B;  2Y8G A;  2QKL A;  1QQG A;  2YS3 A;  3MPX A;  1ZSQ A;  5DI9 B;  2DFK A;  5DHA B;  2VSZ A;  4H8S A;  1DDV A;  1H10 A;  1V61 A;  2DLW A;  1WJM A;  1B55 A;  3A8Q A;  2VKI A;  1U2B A;  2K2U A;  1DDW A;  1XD4 A;  2HE7 A;  2R09 A;  1WGU A;  3DXD A;  5J3Y A;  4NSW A;  1ZM0 A;  4DX8 A;  3GYP A;  4HB0 B;  2ELB A; 
#chains in the Genus database with same CATH topology
 1WJ1 A;  2D11 A;  1EGX A;  5I2M A;  5KCV A;  3ULB A;  4L1R A;  3AJ4 A;  3ZDT A;  4ZRJ A;  2RUK B;  1OY2 A;  1U27 A;  2ROZ B;  2ELA A;  1BTN A;  2COC A;  1ISN A;  4IAP A;  1P3R A;  4GZU A;  3HIE A;  3P6A A;  2UVM A;  3BIN A;  5HE3 A;  2I5F A;  4BBK A;  1AWE A;  4HAX B;  4DX9 0;  3DXC A;  1BAK A;  2DX1 A;  4GPT B;  1FGY A;  2K00 A;  2Z14 A;  5D3W A;  3QWM A;  4CSQ A;  4C0A A;  1K5D B;  2P8V A;  1FHX A;  4MY6 A;  3A8P A;  1UNQ A;  1X1F A;  2NZ8 B;  3ULC A;  3AU5 A;  3VIA A;  3PP2 A;  2COD A;  2R0D A;  1IRS A;  4K81 A;  3SYX A;  4EJN A;  5GOW B;  3WYF B;  1I7A A;  2J59 M;  5LON B;  1FGZ A;  2D2Q A;  3N7C A;  2I1J A;  2Z4D A;  3MDB C;  3QIJ A;  3HW2 B;  3KRW A;  2LOX A;  1U5D A;  1V5U A;  3PVL A;  2J0M A;  3B77 A;  4KHB A;  1GC6 A;  2Z0O A;  5D27 A;  5C5B B;  3WA0 A;  5C16 A;  1ZYI A;  4HB3 B;  3OHM B;  1DYN A;  4GXB A;  2DHJ A;  1W1G A;  2K2J A;  5JHH A;  1TJ6 A;  2IYB A;  2OQB A;  2H7E A;  4WSF A;  3PSC A;  2NBV A;  3DCX A;  1FAO A;  5J3Q A;  2DN6 A;  1U5F A;  2ADZ A;  1V5P A;  5M4Y B;  2PZ1 A;  3ODX A;  4Z2M B;  2RLO A;  2J0K A;  2I1K A;  2YT1 A;  2D9Z A;  4GMX B;  2DHK A;  4TKN A;  4CYE A;  4CHM A;  2Z13 A;  2D9Y A;  1NI2 A;  4KHA A;  2DHI A;  2CY4 A;  2YT2 A;  1X1G A;  5FI1 A;  5C5B A;  2BCJ A;  2M14 A;  2KIE A;  4QJ3 B;  2Z59 A;  4P7I A;  1OMW A;  2W2W A;  2LKO A;  3KSY A;  4HB4 B;  4PNK A;  1UNP A;  4K2P A;  2RVB B;  3D8E A;  1ZC4 B;  5HE2 A;  2LG1 A;  1FHO A;  2MKR A;  5JHG A;  2RNR B;  2W2X D;  2R2Y A;  1EAZ A;  1FB8 A;  1FHW A;  4IOY X;  1NU2 A;  3TW1 A;  1K5G B;  2UZS A;  1V89 A;  2HTH B;  3TCA A;  3F0W A;  5KQ1 A;  4F7G A;  3IVF A;  2L2I A;  2QKM A;  3PVU A;  3OAN A;  5C79 A;  1WGQ A;  1XOD A;  1WG7 A;  3GYO A;  4QJ5 B;  4HAT B;  3KY9 A;  2MDX A;  2K8E A;  4XWX A;  2EMS A;  3FSS A;  1KZ7 A;  5HE0 A;  1LB1 A;  4MK0 A;  2VRW B;  2EJ8 A;  2GCL A;  3F5R A;  3SUZ A;  5D3V A;  4D6W A;  2KUQ A;  1LW3 A;  3O96 A;  1DDM A;  5EFX A;  1WVH A;  2EMT A;  4K2O A;  1XR0 B;  1GG3 A;  1J0W A;  1MAI A;  1WI1 A;  2JP2 A;  4HHV A;  3AU4 A;  4D0N B;  2UZR A;  4HSI A;  3U12 A;  2NMB A;  3D8F A;  1EF1 A;  5JLJ B;  5IRS A;  1Y19 B;  2AL6 A;  1V5M A;  4HAU B;  1SGH A;  2E2X A;  1MI1 A;  5DH9 B;  1PFJ A;  3TFM A;  3BJI A;  2I5C A;  2YT0 A;  1X86 A;  3CIK A;  3ODO A;  1KZG A;  1PMS A;  2COA A;  2LYD A;  5JP4 A;  2H7D A;  1UPR A;  1U5E A;  3NW8 A;  4KHO A;  4OT1 A;  2P0F A;  3A98 B;  3G9W A;  2IFS A;  1OQN A;  5LG4 B;  1Z87 A;  3SNH A;  1I2H A;  2Z0P A;  3PZD A;  1M7R A;  1W1H A;  3U7D A;  1GC7 A;  1PLS A;  2KCJ A;  3D8D A;  1ZC3 B;  2MFQ A;  4PQ0 A;  1Q67 A;  4ZRK A;  1T77 A;  1KI1 B;  4WJ7 A;  1DBH A;  2D4Q A;  1RRP B;  1U5G A;  4L6E A;  3TO1 A;  3DXE A;  5HE1 A;  1XCG A;  3HK0 A;  1J19 A;  4DBB A;  2GJY A;  2P0H A;  3SV1 A;  4A6F A;  4HB2 B;  1M7E A;  4HAW B;  2EC1 A;  4HAY B;  4A6K A;  4GOU A;  2DKP A;  2DYQ A;  2LUL A;  1XX0 A;  5C6R A;  2P0D A;  2ROV A;  1V88 A;  3NWA A;  2KUP A;  1AQC A;  2RGN B;  4ZRI A;  2ZPY A;  4DXA B;  3KRX A;  3M1I B;  4NY0 A;  2GCJ A;  2CRF A;  2XQN M;  4YL8 A;  4A5K A;  2YVC A;  2KIG A;  4EMO A;  2N23 A;  1P5T A;  2Y8F A;  2D9X A;  1UPQ A;  1DRO A;  2DKQ A;  2LOZ A;  1TQZ A;  2DTC A;  2J0J A;  1EVH A;  2D9V A;  1P6S A;  4WVF B;  5DIF B;  4HDQ A;  3P7Z A;  3NSU A;  3RCP A;  2CY5 A;  4GMV A;  3NWF A;  4A6H A;  4KVG B;  2FJU B;  5L81 A;  1FOE A;  2AEH A;  2RSG A;  3U8Z A;  2ZKM X;  2GUM A;  4B6H A;  5DHF B;  1NTV A;  3A58 A;  3UZT A;  2YRY A;  4HAV B;  4F7H A;  5LOP B;  4GN1 A;  2OTX A;  1QC6 A;  2YSZ A;  4TYZ A;  3PG7 A;  2YS5 A;  1E5W A;  2X18 A;  1BTK A;  2DX5 A;  2M38 A;  2G35 A;  4Z2N A;  1U29 A;  3PEG A;  2L1C A;  1X05 A;  5D3X A;  3X23 A;  4HAZ B;  1SHC A;  3PVW A;  2V76 A;  4A6F B;  5I2S A;  2KGX B;  1RJ2 A;  1W1D A;  1Y5O A;  3VOQ A;  2KR0 A;  1UNR A;  5CLQ B;  2W2X C;  4GNK B;  1MPH A;  2COF A;  2D10 A;  3HQC A;  3HSA A;  4Y94 A;  2Q13 A;  4HDO A;  3KZ1 A;  3V5W A;  2DA0 A;  1ZVR A;  2YF0 A;  1XKE A;  3CXB B;  3ODW A;  3FM8 C;  2GS0 A;  2YS1 A;  1TXD A;  4OSN A;  3ZVR A;  1N3H A;  1X11 A;  5J3T A;  1MK7 B;  3NWD A;  4IFS A;  3SO6 A;  5KQ4 A;  4KAX B;  1MIX A;  1BWN A;  2Y7B A;  1NTY A;  5CLL B;  4EKU A;  2D9W A;  4YON A;  2N0Y A;  2DYN A;  3TVV A;  4QXA B;  3FVC A;  4KHB B;  2MWN B;  4K17 A;  1MK9 B;  3LJU X;  5FI0 A;  2FJL A;  2RRF A;  3ML4 A;  4DIX A;  1MIZ B;  4MT7 A;  3T06 A;  5D3Y A;  4QJ4 B;  3FEH A;  2CAY A;  4F7U P;  1H4R A;  4CHJ A;  1MKE A;  2Z0Q A;  1UEF A;  3QBV B;  2Y8G A;  2QKL A;  1QQG A;  2YS3 A;  2K49 A;  3MPX A;  1ZSQ A;  5DI9 B;  2DFK A;  5DHA B;  2VSZ A;  4H8S A;  1DDV A;  1H10 A;  1V61 A;  2DLW A;  1WJM A;  1B55 A;  3A8Q A;  2VKI A;  1U2B A;  2K2U A;  1DDW A;  1XD4 A;  2HE7 A;  2R09 A;  1WGU A;  3DXD A;  5J3Y A;  4NSW A;  1ZM0 A;  4DX8 A;  3GYP A;  4HB0 B;  2ELB A; 
#chains in the Genus database with same CATH homology
 1WJ1 A;  2D11 A;  1EGX A;  5KCV A;  3ULB A;  3AJ4 A;  3ZDT A;  4ZRJ A;  2RUK B;  1OY2 A;  1U27 A;  2ROZ B;  2ELA A;  1BTN A;  2COC A;  1ISN A;  4IAP A;  1P3R A;  4GZU A;  3P6A A;  2UVM A;  3BIN A;  5HE3 A;  2I5F A;  4BBK A;  1AWE A;  4HAX B;  4DX9 0;  3DXC A;  1BAK A;  2DX1 A;  4GPT B;  1FGY A;  2K00 A;  5D3W A;  3QWM A;  4C0A A;  1K5D B;  2P8V A;  1FHX A;  4MY6 A;  3A8P A;  1UNQ A;  1X1F A;  2NZ8 B;  3ULC A;  3AU5 A;  3VIA A;  3PP2 A;  2COD A;  2R0D A;  1IRS A;  4K81 A;  3SYX A;  4EJN A;  5GOW B;  3WYF B;  1I7A A;  2J59 M;  5LON B;  1FGZ A;  2D2Q A;  3N7C A;  2I1J A;  3MDB C;  3QIJ A;  3HW2 B;  3KRW A;  2LOX A;  1U5D A;  1V5U A;  2J0M A;  3PVL A;  5C5B B;  3WA0 A;  1GC6 A;  2Z0O A;  5D27 A;  5C16 A;  4HB3 B;  1DYN A;  4GXB A;  2DHJ A;  1W1G A;  2K2J A;  5JHH A;  1TJ6 A;  2IYB A;  2OQB A;  2H7E A;  4WSF A;  3PSC A;  1FAO A;  5J3Q A;  2DN6 A;  1U5F A;  2ADZ A;  1V5P A;  2PZ1 A;  3ODX A;  4Z2M B;  2RLO A;  2J0K A;  2I1K A;  2YT1 A;  2D9Z A;  4GMX B;  2DHK A;  4TKN A;  4CYE A;  4CHM A;  2D9Y A;  1NI2 A;  4KHA A;  2DHI A;  2CY4 A;  1X1G A;  5FI1 A;  5C5B A;  2BCJ A;  2M14 A;  4P7I A;  1OMW A;  2W2W A;  2LKO A;  3KSY A;  4HB4 B;  4PNK A;  1UNP A;  4K2P A;  2RVB B;  3D8E A;  1ZC4 B;  5HE2 A;  2LG1 A;  1FHO A;  2MKR A;  5JHG A;  2RNR B;  2W2X D;  1EAZ A;  1FB8 A;  1FHW A;  4IOY X;  1NU2 A;  3TW1 A;  1K5G B;  2UZS A;  1V89 A;  2HTH B;  3TCA A;  3F0W A;  5KQ1 A;  4F7G A;  3IVF A;  2L2I A;  2QKM A;  3PVU A;  3OAN A;  5C79 A;  1WGQ A;  1XOD A;  1WG7 A;  3GYO A;  4HAT B;  3KY9 A;  2MDX A;  4XWX A;  2EMS A;  3FSS A;  1KZ7 A;  5HE0 A;  1LB1 A;  4MK0 A;  2VRW B;  2EJ8 A;  2GCL A;  3F5R A;  3SUZ A;  5D3V A;  1LW3 A;  3O96 A;  1DDM A;  5EFX A;  1WVH A;  2EMT A;  4K2O A;  1XR0 B;  1GG3 A;  1J0W A;  1MAI A;  1WI1 A;  2JP2 A;  4HHV A;  3AU4 A;  4D0N B;  2UZR A;  2NMB A;  3D8F A;  1EF1 A;  5JLJ B;  1Y19 B;  2AL6 A;  1V5M A;  4HAU B;  1SGH A;  2E2X A;  5DH9 B;  1PFJ A;  3TFM A;  3BJI A;  2I5C A;  2YT0 A;  1X86 A;  3CIK A;  3ODO A;  1KZG A;  1PMS A;  2COA A;  2LYD A;  5JP4 A;  2H7D A;  1UPR A;  1U5E A;  4KHO A;  2P0F A;  3A98 B;  3G9W A;  2IFS A;  1OQN A;  1Z87 A;  3SNH A;  1I2H A;  2Z0P A;  3PZD A;  1M7R A;  1W1H A;  3U7D A;  1GC7 A;  1PLS A;  2KCJ A;  3D8D A;  1ZC3 B;  2MFQ A;  4PQ0 A;  1Q67 A;  4ZRK A;  1KI1 B;  4WJ7 A;  1DBH A;  2D4Q A;  1RRP B;  1U5G A;  4L6E A;  3TO1 A;  3DXE A;  5HE1 A;  1XCG A;  3HK0 A;  1J19 A;  4DBB A;  2GJY A;  2P0H A;  3SV1 A;  4A6F A;  4HB2 B;  1M7E A;  4HAW B;  2EC1 A;  4HAY B;  4A6K A;  2DKP A;  2DYQ A;  2LUL A;  1XX0 A;  5C6R A;  2P0D A;  2ROV A;  1V88 A;  2KUP A;  1AQC A;  2RGN B;  4ZRI A;  2ZPY A;  4DXA B;  3KRX A;  3M1I B;  4NY0 A;  2GCJ A;  2CRF A;  2XQN M;  4YL8 A;  4A5K A;  2YVC A;  4EMO A;  2N23 A;  1P5T A;  2Y8F A;  2D9X A;  1UPQ A;  1DRO A;  2DKQ A;  2LOZ A;  1TQZ A;  2DTC A;  2J0J A;  1EVH A;  2D9V A;  1P6S A;  4WVF B;  5DIF B;  4HDQ A;  3P7Z A;  3NSU A;  3RCP A;  2CY5 A;  4GMV A;  4A6H A;  4KVG B;  5L81 A;  1FOE A;  2AEH A;  2RSG A;  3U8Z A;  4B6H A;  5DHF B;  1NTV A;  3UZT A;  2YRY A;  4HAV B;  4F7H A;  5LOP B;  4GN1 A;  2OTX A;  1QC6 A;  2YSZ A;  4TYZ A;  3PG7 A;  2YS5 A;  1E5W A;  2X18 A;  1BTK A;  2DX5 A;  2M38 A;  2G35 A;  4Z2N A;  1U29 A;  3PEG A;  2L1C A;  1X05 A;  5D3X A;  3X23 A;  4HAZ B;  1SHC A;  3PVW A;  2V76 A;  4A6F B;  2KGX B;  1RJ2 A;  1W1D A;  1Y5O A;  3VOQ A;  1UNR A;  5CLQ B;  2W2X C;  1MPH A;  2COF A;  2D10 A;  3HQC A;  4Y94 A;  2Q13 A;  4HDO A;  3KZ1 A;  3V5W A;  2DA0 A;  1ZVR A;  2YF0 A;  1XKE A;  3CXB B;  3ODW A;  3FM8 C;  2GS0 A;  2YS1 A;  1TXD A;  3ZVR A;  1N3H A;  1X11 A;  5J3T A;  1MK7 B;  4IFS A;  3SO6 A;  5KQ4 A;  4KAX B;  1MIX A;  1BWN A;  2Y7B A;  1NTY A;  5CLL B;  4EKU A;  2D9W A;  4YON A;  2N0Y A;  2DYN A;  3TVV A;  4KHB B;  2MWN B;  4K17 A;  1MK9 B;  3LJU X;  5FI0 A;  2FJL A;  3ML4 A;  1MIZ B;  4MT7 A;  3T06 A;  5D3Y A;  3FEH A;  2CAY A;  4F7U P;  1H4R A;  4CHJ A;  1MKE A;  2Z0Q A;  1UEF A;  3QBV B;  2Y8G A;  2QKL A;  1QQG A;  2YS3 A;  3MPX A;  1ZSQ A;  5DI9 B;  2DFK A;  5DHA B;  2VSZ A;  4H8S A;  1DDV A;  1H10 A;  1V61 A;  2DLW A;  1WJM A;  1B55 A;  3A8Q A;  2VKI A;  1U2B A;  2K2U A;  1DDW A;  1XD4 A;  2HE7 A;  2R09 A;  1WGU A;  3DXD A;  5J3Y A;  4NSW A;  1ZM0 A;  4DX8 A;  3GYP A;  4HB0 B;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...