2ELAA

Crystal structure of the ptb domain of human appl1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
131
Chain Sequence
SILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Adapter protein containing PH domain, PTB domain and leucine
publication title Crystal Structures of the BAR-PH and PTB Domains of Human APPL1
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2elaA00
2J0MA 2DHKA 3ML4A 1XODA 3G9WA 1XKEA 2R0DA 4A6HA 5D3WA 1P3RA 4F7HA 4MK0A 3TFMA 4WSFA 1MPHA 1NTYA 1J0WA 3TO1A 1GG3A 5C6RA 2KUPA 3PVUA 1IRSA 2DYQA 1DBHA 2Q13A 1FHOA 2N0YA 1ZSQA 1QC6A 1ZVRA 3SUZA 3O96A 2COFA 3CIKA 3FM8C 1BTNA 1WJMA 3QIJA 2YSZA 3TCAA 4CHJA 1X05A 2ROZB 4WVFB 1PLSA 2ZPYA 2LYDA 1NI2A 1M7EA 1TQZA 4XWXA 3ZVRA 3PZDA 1AQCA 2OQBA 1DROA 3ODXA 4MT7A 2P8VA 3AU5A 1LB1A 1DDVA 2GCLA 4Z2NA 3DXDA 4ZRKA 1E5WA 2V76A 1EVHA 5DIFB 4NY0A 4KVGB 4IFSA 4HDQA 1WGUA 4KHBB 5D3YA 1W1HA 2ROVA 5C5BA 3P7ZA 3KSYA 1XCGA 3DXEA 4WJ7A 2EJ8A 1WI1A 3A98B 2MKRA 4HAUB 3ODOA 3VOQA 4A6FA 5JHHA 4DX8A 4IOYX 1Y5OA 2G35A 1RRPB 3A8QA 3T06A 1SHCA 2P0HA 2IFSA 1U5GA 2R09A 2YRYA 4ZRIA 4DX90 2K2JA 1WJ1A 3ULCA 1X1GA 5KCVA 3V5WA 5HE2A 2DA0A 2W2XD 4HATB 1FGYA 2YS3A 1P6SA 2CY5A 5CLQB 3LJUX 1MAIA 1Z87A 3BJIA 2AL6A 1FGZA 1U5FA 5C16A 4Y94A 5DHFB 1KZGA 1H10A 1WVHA 1N3HA 3AU4A 1DDMA 5D3VA 4MY6A 2D9WA 3ZDTA 5JHGA 4A6KA 2DKPA 4K2PA 2E2XA 4EJNA 1V61A 4PNKA 3GYOA 4KHOA 3D8DA 1Y19B 4YL8A 2VKIA 3GYPA 4GMXB 4F7UP 2EMTA 2KGXB 2XQNM 2W2XC 4BBKA 1UPRA 2QKMA 1ISNA 3UZTA 1FB8A 1U27A 3AJ4A 4HDOA 2D11A 4K81A 2L2IA 1UNPA 2Z0OA 2Z0PA 2CAYA 2DKQA 1NU2A 3VIAA 3CXBB 2D2QA 1V88A 2MDXA 2YS5A 2N23A 1U29A 2J0KA 4HAVB 2VRWB 2PZ1A 3KRWA 5LOPB 2RGNB 2Y8FA 3TVVA 3PP2A 2H7EA 2UZSA 1K5GB 3BINA 2D9VA 2RNRB 5C79A 4C0AA 3HQCA 1Q67A 2Y8GA 2CY4A 1TXDA 1UNRA 2FJLA 3ODWA 4KAXB 5HE3A 5DI9B 1WG7A 5LONB 3NSUA 1PMSA 3P6AA 1M7RA 2Y7BA 4GXBA 1V5PA 5D27A 1UNQA 3QBVB 3F0WA 2UZRA 1MK7B 1KI1B 2EMSA 4YONA 2BCJA 5L81A 3SNHA 1RJ2A 3A8PA 2GCJA 1ZC3B 3U8ZA 1FOEA 5HE1A 4HAWB 4TKNA 2COAA 2MFQA 1ZC4B 2Z0QA 4K2OA 1W1DA 2D10A 1P5TA 2VSZA 3D8EA 2RLOA 2H7DA 3MDBC 5HE0A 1PFJA 3PSCA 5EFXA 2COCA 1H4RA 5KQ1A 2ADZA 1X1FA 2DHJA 5DH9B 1EF1A 1UEFA 3OANA 2L1CA 2RVBB 2RUKB 2LOZA 2IYBA 4CYEA 3RCPA 2YS1A 2DN6A 3PG7A 4H8SA 2D9YA 2I1JA 5D3XA 3F5RA 2J59M 1AWEA 4HAZB 4L6EA 1TJ6A 2NZ8B 2LKOA 5J3TA 3ULBA 2DFKA 1KZ7A 2CRFA 4CHMA 2JP2A 3IVFA 4Z2MB 2K00A 3DXCA 3MPXA 3QWMA 2J0JA 2OTXA 4HB3B 2X18A 2YF0A 2P0FA 2DX5A 1QQGA 2YT0A 5C5BB 5J3YA 4HB0B 1DDWA 3KZ1A 1BAKA 2W2WA 2YVCA 4KHAA 4GPTB 1SGHA 1MKEA 5FI0A 5JP4A 4EKUA 2DHIA 2I5CA 3SYXA 2EC1A 1MIZB 3TW1A 4HHVA 2K2UA 4IAPA 4A6FB 2LOXA 1UPQA 5GOWB 1B55A 3WA0A 1NTVA 4HAXB 2I5FA 3M1IB 1EGXA 1U2BA 4TYZA 3D8FA 1U5EA 4EMOA 1XD4A 2D9XA 3SO6A 3PVLA 2P0DA 4A5KA 1MK9B 1V5MA 2YT1A 1FHWA 4GZUA 2M38A 2AEHA 2CODA 2HTHB 2LG1A 2ELAA 4DBBA 1J19A 1V5UA 2MWNB 3KY9A 2NMBA 4GN1A 2QKLA 1XR0B 4K17A 5JLJB 4B6HA 2LULA 4HAYB 4P7IA 5DHAB 1EAZA 2RSGA 3PEGA 3N7CA 4ZRJA 3KRXA 1BWNA 1FAOA 2D4QA 1DYNA 4HB2B 5KQ4A 1FHXA 1ZM0A 1MIXA 1X11A 4F7GA 1GC6A 2GS0A 2I1KA 2DYNA 3SV1A 1OQNA 1V89A 2M14A 4DXAB 5CLLB 1WGQA 2KCJA 3HK0A 4HB4B 2HE7A 2DTCA 4NSWA 4D0NB 1XX0A 4GMVA 3X23A 1I2HA 1W1GA 1I7AA 3PVWA 3HW2B 2ELBA 3U7DA 1K5DB 1OY2A 2GJYA 1BTKA 1LW3A 1U5DA 2DX1A 5J3QA 1GC7A 3WYFB 3FSSA 3FEHA 5FI1A 2UVMA 2D9ZA 2DLWA 4PQ0A 1X86A 1OMWA
chains in the Genus database with same CATH superfamily
2J0MA 2DHKA 3ML4A 1XODA 2FJUB 3G9WA 1XKEA 2R0DA 4A6HA 5D3WA 1P3RA 4F7HA 4MK0A 3TFMA 4WSFA 1MPHA 1NTYA 1J0WA 3TO1A 3HSAA 1GG3A 4CSQA 5C6RA 2KUPA 3PVUA 1IRSA 2K49A 2DYQA 1DBHA 2Q13A 1FHOA 2N0YA 1ZSQA 1QC6A 1ZVRA 3SUZA 3O96A 2COFA 3CIKA 3FM8C 1BTNA 1WJMA 3QIJA 2YSZA 3TCAA 4CHJA 1X05A 2ROZB 4WVFB 1PLSA 2ZPYA 2LYDA 5LG4B 1NI2A 1M7EA 1TQZA 4XWXA 3ZVRA 3PZDA 1AQCA 2OQBA 1DROA 3ODXA 4MT7A 2P8VA 3AU5A 1LB1A 4L1RA 1DDVA 2GCLA 4Z2NA 3OHMB 3DXDA 4ZRKA 1E5WA 2V76A 3A58A 1EVHA 5DIFB 4NY0A 4KVGB 4IFSA 4HDQA 4OT1A 2Z14A 1WGUA 3NWDA 4KHBB 5D3YA 1W1HA 2ROVA 5C5BA 3P7ZA 3KSYA 1XCGA 3DXEA 2KIGA 4WJ7A 2EJ8A 1WI1A 3HIEA 3A98B 2MKRA 4HAUB 3ODOA 3VOQA 4A6FA 5JHHA 4DX8A 4IOYX 1Y5OA 2G35A 1RRPB 3A8QA 3T06A 1SHCA 2P0HA 2IFSA 2NBVA 1U5GA 2R09A 2YRYA 4ZRIA 4DX90 2K2JA 1WJ1A 3ULCA 1X1GA 5KCVA 5M4YB 2KR0A 3V5WA 5HE2A 2DA0A 2W2XD 2GUMA 4HATB 1FGYA 2YS3A 1P6SA 2CY5A 5CLQB 3LJUX 1MAIA 1Z87A 3BJIA 2AL6A 1FGZA 1U5FA 4QJ5B 5C16A 4Y94A 5DHFB 1KZGA 1H10A 1WVHA 1N3HA 3AU4A 1DDMA 5D3VA 4MY6A 2D9WA 3ZDTA 5JHGA 4A6KA 2DKPA 4K2PA 2E2XA 4EJNA 1V61A 4PNKA 3GYOA 4KHOA 3D8DA 1Y19B 4YL8A 2VKIA 3GYPA 4GMXB 4F7UP 2EMTA 2KGXB 2XQNM 2W2XC 4BBKA 1UPRA 3NWAA 2QKMA 1ISNA 3UZTA 1FB8A 1U27A 2RRFA 3AJ4A 4HDOA 2D11A 4K81A 2L2IA 1UNPA 2Z0OA 2Z0PA 2CAYA 2DKQA 1NU2A 3VIAA 3CXBB 2D2QA 4HSIA 1V88A 2MDXA 2YS5A 2N23A 2KIEA 1U29A 2J0KA 4HAVB 2Z59A 2VRWB 2PZ1A 3KRWA 5LOPB 2RGNB 2Y8FA 3TVVA 3PP2A 2H7EA 2UZSA 1K5GB 3BINA 2D9VA 2RNRB 5C79A 4C0AA 3HQCA 1Q67A 2Y8GA 2CY4A 1TXDA 4QJ4B 1UNRA 2FJLA 3ODWA 4KAXB 5HE3A 5DI9B 1WG7A 5LONB 3NSUA 1PMSA 3P6AA 1M7RA 2Y7BA 4GXBA 1V5PA 5D27A 1UNQA 3QBVB 3F0WA 2UZRA 1MK7B 1KI1B 5I2SA 2EMSA 4YONA 2BCJA 5L81A 3SNHA 1RJ2A 3A8PA 2GCJA 5IRSA 1ZC3B 3U8ZA 1FOEA 5HE1A 4HAWB 4TKNA 4DIXA 2COAA 2MFQA 2Z13A 1ZC4B 2Z0QA 4K2OA 1W1DA 4QXAB 2D10A 1P5TA 2VSZA 3D8EA 2RLOA 2ZKMX 2H7DA 4GNKB 3MDBC 5HE0A 1PFJA 3PSCA 5EFXA 2COCA 1H4RA 5KQ1A 2ADZA 1X1FA 2DHJA 5DH9B 1EF1A 3B77A 1UEFA 3OANA 2L1CA 2RVBB 2RUKB 2LOZA 2IYBA 4CYEA 3RCPA 2YS1A 2DN6A 3PG7A 4H8SA 2D9YA 2I1JA 5D3XA 3F5RA 2J59M 1AWEA 4HAZB 4L6EA 1TJ6A 2NZ8B 2LKOA 5J3TA 3ULBA 2DFKA 1ZYIA 1KZ7A 2CRFA 4CHMA 2JP2A 3IVFA 4Z2MB 2K00A 3DXCA 3MPXA 3QWMA 2J0JA 2OTXA 3NWFA 4HB3B 2X18A 2YF0A 2P0FA 2DX5A 1T77A 1QQGA 3NW8A 2YT0A 5C5BB 5J3YA 4HB0B 1DDWA 3KZ1A 1BAKA 2W2WA 2YVCA 4KHAA 4GPTB 1SGHA 1MKEA 5FI0A 5JP4A 4EKUA 2DHIA 2I5CA 3SYXA 2EC1A 2K8EA 1MIZB 3TW1A 4HHVA 2K2UA 4IAPA 4A6FB 2LOXA 1UPQA 5GOWB 1B55A 3WA0A 1NTVA 4HAXB 4GOUA 2I5FA 3M1IB 2R2YA 1EGXA 1U2BA 4TYZA 3D8FA 1U5EA 4EMOA 1XD4A 2D9XA 3SO6A 3PVLA 2P0DA 4A5KA 1MK9B 1V5MA 2YT1A 1FHWA 4GZUA 2M38A 4QJ3B 2AEHA 3DCXA 2CODA 2HTHB 2LG1A 2ELAA 4DBBA 1J19A 1V5UA 2MWNB 3KY9A 2NMBA 4GN1A 2QKLA 1XR0B 4K17A 5JLJB 1MI1A 4B6HA 2LULA 4HAYB 4P7IA 2YT2A 5DHAB 1EAZA 2RSGA 3PEGA 3N7CA 4ZRJA 3KRXA 2Z4DA 1BWNA 1FAOA 2D4QA 1DYNA 4HB2B 5KQ4A 1FHXA 1ZM0A 1MIXA 1X11A 4F7GA 1GC6A 2GS0A 3U12A 2I1KA 4OSNA 2DYNA 3SV1A 1OQNA 1V89A 4D6WA 2M14A 4DXAB 5CLLB 1WGQA 2KCJA 3HK0A 4HB4B 2HE7A 2DTCA 4NSWA 4D0NB 1XX0A 4GMVA 3X23A 5I2MA 1I2HA 1W1GA 1I7AA 3PVWA 3HW2B 4KHBA 2ELBA 3U7DA 1K5DB 1OY2A 2GJYA 3FVCA 1BTKA 1LW3A 1U5DA 2DX1A 5J3QA 1GC7A 3WYFB 3FSSA 3FEHA 5FI1A 2UVMA 2D9ZA 2KUQA 2DLWA 4PQ0A 1X86A 1OMWA
chains in the Genus database with same CATH topology
2J0MA 2DHKA 3ML4A 1XODA 3G9WA 1XKEA 2R0DA 4A6HA 5D3WA 1P3RA 4F7HA 4MK0A 3TFMA 4WSFA 1MPHA 1NTYA 1J0WA 3TO1A 1GG3A 5C6RA 2KUPA 3PVUA 1IRSA 2DYQA 1DBHA 2Q13A 1FHOA 2N0YA 1ZSQA 1QC6A 1ZVRA 3SUZA 3O96A 2COFA 3CIKA 3FM8C 1BTNA 1WJMA 3QIJA 2YSZA 3TCAA 4CHJA 1X05A 2ROZB 4WVFB 1PLSA 2ZPYA 2LYDA 1NI2A 1M7EA 1TQZA 4XWXA 3ZVRA 3PZDA 1AQCA 2OQBA 1DROA 3ODXA 4MT7A 2P8VA 3AU5A 1LB1A 1DDVA 2GCLA 4Z2NA 3DXDA 4ZRKA 1E5WA 2V76A 1EVHA 5DIFB 4NY0A 4KVGB 4IFSA 4HDQA 1WGUA 4KHBB 5D3YA 1W1HA 2ROVA 5C5BA 3P7ZA 3KSYA 1XCGA 3DXEA 4WJ7A 2EJ8A 1WI1A 3A98B 2MKRA 4HAUB 3ODOA 3VOQA 4A6FA 5JHHA 4DX8A 4IOYX 1Y5OA 2G35A 1RRPB 3A8QA 3T06A 1SHCA 2P0HA 2IFSA 1U5GA 2R09A 2YRYA 4ZRIA 4DX90 2K2JA 1WJ1A 3ULCA 1X1GA 5KCVA 3V5WA 5HE2A 2DA0A 2W2XD 4HATB 1FGYA 2YS3A 1P6SA 2CY5A 5CLQB 3LJUX 1MAIA 1Z87A 3BJIA 2AL6A 1FGZA 1U5FA 5C16A 4Y94A 5DHFB 1KZGA 1H10A 1WVHA 1N3HA 3AU4A 1DDMA 5D3VA 4MY6A 2D9WA 3ZDTA 5JHGA 4A6KA 2DKPA 4K2PA 2E2XA 4EJNA 1V61A 4PNKA 3GYOA 4KHOA 3D8DA 1Y19B 4YL8A 2VKIA 3GYPA 4GMXB 4F7UP 2EMTA 2KGXB 2XQNM 2W2XC 4BBKA 1UPRA 2QKMA 1ISNA 3UZTA 1FB8A 1U27A 3AJ4A 4HDOA 2D11A 4K81A 2L2IA 1UNPA 2Z0OA 2Z0PA 2CAYA 2DKQA 1NU2A 3VIAA 3CXBB 2D2QA 1V88A 2MDXA 2YS5A 2N23A 1U29A 2J0KA 4HAVB 2VRWB 2PZ1A 3KRWA 5LOPB 2RGNB 2Y8FA 3TVVA 3PP2A 2H7EA 2UZSA 1K5GB 3BINA 2D9VA 2RNRB 5C79A 4C0AA 3HQCA 1Q67A 2Y8GA 2CY4A 1TXDA 1UNRA 2FJLA 3ODWA 4KAXB 5HE3A 5DI9B 1WG7A 5LONB 3NSUA 1PMSA 3P6AA 1M7RA 2Y7BA 4GXBA 1V5PA 5D27A 1UNQA 3QBVB 3F0WA 2UZRA 1MK7B 1KI1B 2EMSA 4YONA 2BCJA 5L81A 3SNHA 1RJ2A 3A8PA 2GCJA 1ZC3B 3U8ZA 1FOEA 5HE1A 4HAWB 4TKNA 2COAA 2MFQA 1ZC4B 2Z0QA 4K2OA 1W1DA 2D10A 1P5TA 2VSZA 3D8EA 2RLOA 2H7DA 3MDBC 5HE0A 1PFJA 3PSCA 5EFXA 2COCA 1H4RA 5KQ1A 2ADZA 1X1FA 2DHJA 5DH9B 1EF1A 1UEFA 3OANA 2L1CA 2RVBB 2RUKB 2LOZA 2IYBA 4CYEA 3RCPA 2YS1A 2DN6A 3PG7A 4H8SA 2D9YA 2I1JA 5D3XA 3F5RA 2J59M 1AWEA 4HAZB 4L6EA 1TJ6A 2NZ8B 2LKOA 5J3TA 3ULBA 2DFKA 1KZ7A 2CRFA 4CHMA 2JP2A 3IVFA 4Z2MB 2K00A 3DXCA 3MPXA 3QWMA 2J0JA 2OTXA 4HB3B 2X18A 2YF0A 2P0FA 2DX5A 1QQGA 2YT0A 5C5BB 5J3YA 4HB0B 1DDWA 3KZ1A 1BAKA 2W2WA 2YVCA 4KHAA 4GPTB 1SGHA 1MKEA 5FI0A 5JP4A 4EKUA 2DHIA 2I5CA 3SYXA 2EC1A 1MIZB 3TW1A 4HHVA 2K2UA 4IAPA 4A6FB 2LOXA 1UPQA 5GOWB 1B55A 3WA0A 1NTVA 4HAXB 2I5FA 3M1IB 1EGXA 1U2BA 4TYZA 3D8FA 1U5EA 4EMOA 1XD4A 2D9XA 3SO6A 3PVLA 2P0DA 4A5KA 1MK9B 1V5MA 2YT1A 1FHWA 4GZUA 2M38A 2AEHA 2CODA 2HTHB 2LG1A 2ELAA 4DBBA 1J19A 1V5UA 2MWNB 3KY9A 2NMBA 4GN1A 2QKLA 1XR0B 4K17A 5JLJB 4B6HA 2LULA 4HAYB 4P7IA 5DHAB 1EAZA 2RSGA 3PEGA 3N7CA 4ZRJA 3KRXA 1BWNA 1FAOA 2D4QA 1DYNA 4HB2B 5KQ4A 1FHXA 1ZM0A 1MIXA 1X11A 4F7GA 1GC6A 2GS0A 2I1KA 2DYNA 3SV1A 1OQNA 1V89A 2M14A 4DXAB 5CLLB 1WGQA 2KCJA 3HK0A 4HB4B 2HE7A 2DTCA 4NSWA 4D0NB 1XX0A 4GMVA 3X23A 1I2HA 1W1GA 1I7AA 3PVWA 3HW2B 2ELBA 3U7DA 1K5DB 1OY2A 2GJYA 1BTKA 1LW3A 1U5DA 2DX1A 5J3QA 1GC7A 3WYFB 3FSSA 3FEHA 5FI1A 2UVMA 2D9ZA 2DLWA 4PQ0A 1X86A 1OMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0M A;  2DHK A;  3ML4 A;  1XOD A;  3G9W A;  1XKE A;  2R0D A;  4A6H A;  5D3W A;  1P3R A;  4F7H A;  4MK0 A;  3TFM A;  4WSF A;  1MPH A;  1NTY A;  1J0W A;  3TO1 A;  1GG3 A;  5C6R A;  2KUP A;  3PVU A;  1IRS A;  2DYQ A;  1DBH A;  2Q13 A;  1FHO A;  2N0Y A;  1ZSQ A;  1QC6 A;  1ZVR A;  3SUZ A;  3O96 A;  2COF A;  3CIK A;  3FM8 C;  1BTN A;  1WJM A;  3QIJ A;  2YSZ A;  3TCA A;  4CHJ A;  1X05 A;  2ROZ B;  4WVF B;  1PLS A;  2ZPY A;  2LYD A;  1NI2 A;  1M7E A;  1TQZ A;  4XWX A;  3ZVR A;  3PZD A;  1AQC A;  2OQB A;  1DRO A;  3ODX A;  4MT7 A;  2P8V A;  3AU5 A;  1LB1 A;  1DDV A;  2GCL A;  4Z2N A;  3DXD A;  4ZRK A;  1E5W A;  2V76 A;  1EVH A;  5DIF B;  4NY0 A;  4KVG B;  4IFS A;  4HDQ A;  1WGU A;  4KHB B;  5D3Y A;  1W1H A;  2ROV A;  5C5B A;  3P7Z A;  3KSY A;  1XCG A;  3DXE A;  4WJ7 A;  2EJ8 A;  1WI1 A;  3A98 B;  2MKR A;  4HAU B;  3ODO A;  3VOQ A;  4A6F A;  5JHH A;  4DX8 A;  4IOY X;  1Y5O A;  2G35 A;  1RRP B;  3A8Q A;  3T06 A;  1SHC A;  2P0H A;  2IFS A;  1U5G A;  2R09 A;  2YRY A;  4ZRI A;  4DX9 0;  2K2J A;  1WJ1 A;  3ULC A;  1X1G A;  5KCV A;  3V5W A;  5HE2 A;  2DA0 A;  2W2X D;  4HAT B;  1FGY A;  2YS3 A;  1P6S A;  2CY5 A;  5CLQ B;  3LJU X;  1MAI A;  1Z87 A;  3BJI A;  2AL6 A;  1FGZ A;  1U5F A;  5C16 A;  4Y94 A;  5DHF B;  1KZG A;  1H10 A;  1WVH A;  1N3H A;  3AU4 A;  1DDM A;  5D3V A;  4MY6 A;  2D9W A;  3ZDT A;  5JHG A;  4A6K A;  2DKP A;  4K2P A;  2E2X A;  4EJN A;  1V61 A;  4PNK A;  3GYO A;  4KHO A;  3D8D A;  1Y19 B;  4YL8 A;  2VKI A;  3GYP A;  4GMX B;  4F7U P;  2EMT A;  2KGX B;  2XQN M;  2W2X C;  4BBK A;  1UPR A;  2QKM A;  1ISN A;  3UZT A;  1FB8 A;  1U27 A;  3AJ4 A;  4HDO A;  2D11 A;  4K81 A;  2L2I A;  1UNP A;  2Z0O A;  2Z0P A;  2CAY A;  2DKQ A;  1NU2 A;  3VIA A;  3CXB B;  2D2Q A;  1V88 A;  2MDX A;  2YS5 A;  2N23 A;  1U29 A;  2J0K A;  4HAV B;  2VRW B;  2PZ1 A;  3KRW A;  5LOP B;  2RGN B;  2Y8F A;  3TVV A;  3PP2 A;  2H7E A;  2UZS A;  1K5G B;  3BIN A;  2D9V A;  2RNR B;  5C79 A;  4C0A A;  3HQC A;  1Q67 A;  2Y8G A;  2CY4 A;  1TXD A;  1UNR A;  2FJL A;  3ODW A;  4KAX B;  5HE3 A;  5DI9 B;  1WG7 A;  5LON B;  3NSU A;  1PMS A;  3P6A A;  1M7R A;  2Y7B A;  4GXB A;  1V5P A;  5D27 A;  1UNQ A;  3QBV B;  3F0W A;  2UZR A;  1MK7 B;  1KI1 B;  2EMS A;  4YON A;  2BCJ A;  5L81 A;  3SNH A;  1RJ2 A;  3A8P A;  2GCJ A;  1ZC3 B;  3U8Z A;  1FOE A;  5HE1 A;  4HAW B;  4TKN A;  2COA A;  2MFQ A;  1ZC4 B;  2Z0Q A;  4K2O A;  1W1D A;  2D10 A;  1P5T A;  2VSZ A;  3D8E A;  2RLO A;  2H7D A;  3MDB C;  5HE0 A;  1PFJ A;  3PSC A;  5EFX A;  2COC A;  1H4R A;  5KQ1 A;  2ADZ A;  1X1F A;  2DHJ A;  5DH9 B;  1EF1 A;  1UEF A;  3OAN A;  2L1C A;  2RVB B;  2RUK B;  2LOZ A;  2IYB A;  4CYE A;  3RCP A;  2YS1 A;  2DN6 A;  3PG7 A;  4H8S A;  2D9Y A;  2I1J A;  5D3X A;  3F5R A;  2J59 M;  1AWE A;  4HAZ B;  4L6E A;  1TJ6 A;  2NZ8 B;  2LKO A;  5J3T A;  3ULB A;  2DFK A;  1KZ7 A;  2CRF A;  4CHM A;  2JP2 A;  3IVF A;  4Z2M B;  2K00 A;  3DXC A;  3MPX A;  3QWM A;  2J0J A;  2OTX A;  4HB3 B;  2X18 A;  2YF0 A;  2P0F A;  2DX5 A;  1QQG A;  2YT0 A;  5C5B B;  5J3Y A;  4HB0 B;  1DDW A;  3KZ1 A;  1BAK A;  2W2W A;  2YVC A;  4KHA A;  4GPT B;  1SGH A;  1MKE A;  5FI0 A;  5JP4 A;  4EKU A;  2DHI A;  2I5C A;  3SYX A;  2EC1 A;  1MIZ B;  3TW1 A;  4HHV A;  2K2U A;  4IAP A;  4A6F B;  2LOX A;  1UPQ A;  5GOW B;  1B55 A;  3WA0 A;  1NTV A;  4HAX B;  2I5F A;  3M1I B;  1EGX A;  1U2B A;  4TYZ A;  3D8F A;  1U5E A;  4EMO A;  1XD4 A;  2D9X A;  3SO6 A;  3PVL A;  2P0D A;  4A5K A;  1MK9 B;  1V5M A;  2YT1 A;  1FHW A;  4GZU A;  2M38 A;  2AEH A;  2COD A;  2HTH B;  2LG1 A;  2ELA A;  4DBB A;  1J19 A;  1V5U A;  2MWN B;  3KY9 A;  2NMB A;  4GN1 A;  2QKL A;  1XR0 B;  4K17 A;  5JLJ B;  4B6H A;  2LUL A;  4HAY B;  4P7I A;  5DHA B;  1EAZ A;  2RSG A;  3PEG A;  3N7C A;  4ZRJ A;  3KRX A;  1BWN A;  1FAO A;  2D4Q A;  1DYN A;  4HB2 B;  5KQ4 A;  1FHX A;  1ZM0 A;  1MIX A;  1X11 A;  4F7G A;  1GC6 A;  2GS0 A;  2I1K A;  2DYN A;  3SV1 A;  1OQN A;  1V89 A;  2M14 A;  4DXA B;  5CLL B;  1WGQ A;  2KCJ A;  3HK0 A;  4HB4 B;  2HE7 A;  2DTC A;  4NSW A;  4D0N B;  1XX0 A;  4GMV A;  3X23 A;  1I2H A;  1W1G A;  1I7A A;  3PVW A;  3HW2 B;  2ELB A;  3U7D A;  1K5D B;  1OY2 A;  2GJY A;  1BTK A;  1LW3 A;  1U5D A;  2DX1 A;  5J3Q A;  1GC7 A;  3WYF B;  3FSS A;  3FEH A;  5FI1 A;  2UVM A;  2D9Z A;  2DLW A;  4PQ0 A;  1X86 A;  1OMW A; 
#chains in the Genus database with same CATH topology
 2J0M A;  2DHK A;  3ML4 A;  1XOD A;  2FJU B;  3G9W A;  1XKE A;  2R0D A;  4A6H A;  5D3W A;  1P3R A;  4F7H A;  4MK0 A;  3TFM A;  4WSF A;  1MPH A;  1NTY A;  1J0W A;  3TO1 A;  3HSA A;  1GG3 A;  4CSQ A;  5C6R A;  2KUP A;  3PVU A;  1IRS A;  2K49 A;  2DYQ A;  1DBH A;  2Q13 A;  1FHO A;  2N0Y A;  1ZSQ A;  1QC6 A;  1ZVR A;  3SUZ A;  3O96 A;  2COF A;  3CIK A;  3FM8 C;  1BTN A;  1WJM A;  3QIJ A;  2YSZ A;  3TCA A;  4CHJ A;  1X05 A;  2ROZ B;  4WVF B;  1PLS A;  2ZPY A;  2LYD A;  5LG4 B;  1NI2 A;  1M7E A;  1TQZ A;  4XWX A;  3ZVR A;  3PZD A;  1AQC A;  2OQB A;  1DRO A;  3ODX A;  4MT7 A;  2P8V A;  3AU5 A;  1LB1 A;  4L1R A;  1DDV A;  2GCL A;  4Z2N A;  3OHM B;  3DXD A;  4ZRK A;  1E5W A;  2V76 A;  3A58 A;  1EVH A;  5DIF B;  4NY0 A;  4KVG B;  4IFS A;  4HDQ A;  4OT1 A;  2Z14 A;  1WGU A;  3NWD A;  4KHB B;  5D3Y A;  1W1H A;  2ROV A;  5C5B A;  3P7Z A;  3KSY A;  1XCG A;  3DXE A;  2KIG A;  4WJ7 A;  2EJ8 A;  1WI1 A;  3HIE A;  3A98 B;  2MKR A;  4HAU B;  3ODO A;  3VOQ A;  4A6F A;  5JHH A;  4DX8 A;  4IOY X;  1Y5O A;  2G35 A;  1RRP B;  3A8Q A;  3T06 A;  1SHC A;  2P0H A;  2IFS A;  2NBV A;  1U5G A;  2R09 A;  2YRY A;  4ZRI A;  4DX9 0;  2K2J A;  1WJ1 A;  3ULC A;  1X1G A;  5KCV A;  5M4Y B;  2KR0 A;  3V5W A;  5HE2 A;  2DA0 A;  2W2X D;  2GUM A;  4HAT B;  1FGY A;  2YS3 A;  1P6S A;  2CY5 A;  5CLQ B;  3LJU X;  1MAI A;  1Z87 A;  3BJI A;  2AL6 A;  1FGZ A;  1U5F A;  4QJ5 B;  5C16 A;  4Y94 A;  5DHF B;  1KZG A;  1H10 A;  1WVH A;  1N3H A;  3AU4 A;  1DDM A;  5D3V A;  4MY6 A;  2D9W A;  3ZDT A;  5JHG A;  4A6K A;  2DKP A;  4K2P A;  2E2X A;  4EJN A;  1V61 A;  4PNK A;  3GYO A;  4KHO A;  3D8D A;  1Y19 B;  4YL8 A;  2VKI A;  3GYP A;  4GMX B;  4F7U P;  2EMT A;  2KGX B;  2XQN M;  2W2X C;  4BBK A;  1UPR A;  3NWA A;  2QKM A;  1ISN A;  3UZT A;  1FB8 A;  1U27 A;  2RRF A;  3AJ4 A;  4HDO A;  2D11 A;  4K81 A;  2L2I A;  1UNP A;  2Z0O A;  2Z0P A;  2CAY A;  2DKQ A;  1NU2 A;  3VIA A;  3CXB B;  2D2Q A;  4HSI A;  1V88 A;  2MDX A;  2YS5 A;  2N23 A;  2KIE A;  1U29 A;  2J0K A;  4HAV B;  2Z59 A;  2VRW B;  2PZ1 A;  3KRW A;  5LOP B;  2RGN B;  2Y8F A;  3TVV A;  3PP2 A;  2H7E A;  2UZS A;  1K5G B;  3BIN A;  2D9V A;  2RNR B;  5C79 A;  4C0A A;  3HQC A;  1Q67 A;  2Y8G A;  2CY4 A;  1TXD A;  4QJ4 B;  1UNR A;  2FJL A;  3ODW A;  4KAX B;  5HE3 A;  5DI9 B;  1WG7 A;  5LON B;  3NSU A;  1PMS A;  3P6A A;  1M7R A;  2Y7B A;  4GXB A;  1V5P A;  5D27 A;  1UNQ A;  3QBV B;  3F0W A;  2UZR A;  1MK7 B;  1KI1 B;  5I2S A;  2EMS A;  4YON A;  2BCJ A;  5L81 A;  3SNH A;  1RJ2 A;  3A8P A;  2GCJ A;  5IRS A;  1ZC3 B;  3U8Z A;  1FOE A;  5HE1 A;  4HAW B;  4TKN A;  4DIX A;  2COA A;  2MFQ A;  2Z13 A;  1ZC4 B;  2Z0Q A;  4K2O A;  1W1D A;  4QXA B;  2D10 A;  1P5T A;  2VSZ A;  3D8E A;  2RLO A;  2ZKM X;  2H7D A;  4GNK B;  3MDB C;  5HE0 A;  1PFJ A;  3PSC A;  5EFX A;  2COC A;  1H4R A;  5KQ1 A;  2ADZ A;  1X1F A;  2DHJ A;  5DH9 B;  1EF1 A;  3B77 A;  1UEF A;  3OAN A;  2L1C A;  2RVB B;  2RUK B;  2LOZ A;  2IYB A;  4CYE A;  3RCP A;  2YS1 A;  2DN6 A;  3PG7 A;  4H8S A;  2D9Y A;  2I1J A;  5D3X A;  3F5R A;  2J59 M;  1AWE A;  4HAZ B;  4L6E A;  1TJ6 A;  2NZ8 B;  2LKO A;  5J3T A;  3ULB A;  2DFK A;  1ZYI A;  1KZ7 A;  2CRF A;  4CHM A;  2JP2 A;  3IVF A;  4Z2M B;  2K00 A;  3DXC A;  3MPX A;  3QWM A;  2J0J A;  2OTX A;  3NWF A;  4HB3 B;  2X18 A;  2YF0 A;  2P0F A;  2DX5 A;  1T77 A;  1QQG A;  3NW8 A;  2YT0 A;  5C5B B;  5J3Y A;  4HB0 B;  1DDW A;  3KZ1 A;  1BAK A;  2W2W A;  2YVC A;  4KHA A;  4GPT B;  1SGH A;  1MKE A;  5FI0 A;  5JP4 A;  4EKU A;  2DHI A;  2I5C A;  3SYX A;  2EC1 A;  2K8E A;  1MIZ B;  3TW1 A;  4HHV A;  2K2U A;  4IAP A;  4A6F B;  2LOX A;  1UPQ A;  5GOW B;  1B55 A;  3WA0 A;  1NTV A;  4HAX B;  4GOU A;  2I5F A;  3M1I B;  2R2Y A;  1EGX A;  1U2B A;  4TYZ A;  3D8F A;  1U5E A;  4EMO A;  1XD4 A;  2D9X A;  3SO6 A;  3PVL A;  2P0D A;  4A5K A;  1MK9 B;  1V5M A;  2YT1 A;  1FHW A;  4GZU A;  2M38 A;  4QJ3 B;  2AEH A;  3DCX A;  2COD A;  2HTH B;  2LG1 A;  2ELA A;  4DBB A;  1J19 A;  1V5U A;  2MWN B;  3KY9 A;  2NMB A;  4GN1 A;  2QKL A;  1XR0 B;  4K17 A;  5JLJ B;  1MI1 A;  4B6H A;  2LUL A;  4HAY B;  4P7I A;  2YT2 A;  5DHA B;  1EAZ A;  2RSG A;  3PEG A;  3N7C A;  4ZRJ A;  3KRX A;  2Z4D A;  1BWN A;  1FAO A;  2D4Q A;  1DYN A;  4HB2 B;  5KQ4 A;  1FHX A;  1ZM0 A;  1MIX A;  1X11 A;  4F7G A;  1GC6 A;  2GS0 A;  3U12 A;  2I1K A;  4OSN A;  2DYN A;  3SV1 A;  1OQN A;  1V89 A;  4D6W A;  2M14 A;  4DXA B;  5CLL B;  1WGQ A;  2KCJ A;  3HK0 A;  4HB4 B;  2HE7 A;  2DTC A;  4NSW A;  4D0N B;  1XX0 A;  4GMV A;  3X23 A;  5I2M A;  1I2H A;  1W1G A;  1I7A A;  3PVW A;  3HW2 B;  4KHB A;  2ELB A;  3U7D A;  1K5D B;  1OY2 A;  2GJY A;  3FVC A;  1BTK A;  1LW3 A;  1U5D A;  2DX1 A;  5J3Q A;  1GC7 A;  3WYF B;  3FSS A;  3FEH A;  5FI1 A;  2UVM A;  2D9Z A;  2KUQ A;  2DLW A;  4PQ0 A;  1X86 A;  1OMW A; 
#chains in the Genus database with same CATH homology
 2J0M A;  2DHK A;  3ML4 A;  1XOD A;  3G9W A;  1XKE A;  2R0D A;  4A6H A;  5D3W A;  1P3R A;  4F7H A;  4MK0 A;  3TFM A;  4WSF A;  1MPH A;  1NTY A;  1J0W A;  3TO1 A;  1GG3 A;  5C6R A;  2KUP A;  3PVU A;  1IRS A;  2DYQ A;  1DBH A;  2Q13 A;  1FHO A;  2N0Y A;  1ZSQ A;  1QC6 A;  1ZVR A;  3SUZ A;  3O96 A;  2COF A;  3CIK A;  3FM8 C;  1BTN A;  1WJM A;  3QIJ A;  2YSZ A;  3TCA A;  4CHJ A;  1X05 A;  2ROZ B;  4WVF B;  1PLS A;  2ZPY A;  2LYD A;  1NI2 A;  1M7E A;  1TQZ A;  4XWX A;  3ZVR A;  3PZD A;  1AQC A;  2OQB A;  1DRO A;  3ODX A;  4MT7 A;  2P8V A;  3AU5 A;  1LB1 A;  1DDV A;  2GCL A;  4Z2N A;  3DXD A;  4ZRK A;  1E5W A;  2V76 A;  1EVH A;  5DIF B;  4NY0 A;  4KVG B;  4IFS A;  4HDQ A;  1WGU A;  4KHB B;  5D3Y A;  1W1H A;  2ROV A;  5C5B A;  3P7Z A;  3KSY A;  1XCG A;  3DXE A;  4WJ7 A;  2EJ8 A;  1WI1 A;  3A98 B;  2MKR A;  4HAU B;  3ODO A;  3VOQ A;  4A6F A;  5JHH A;  4DX8 A;  4IOY X;  1Y5O A;  2G35 A;  1RRP B;  3A8Q A;  3T06 A;  1SHC A;  2P0H A;  2IFS A;  1U5G A;  2R09 A;  2YRY A;  4ZRI A;  4DX9 0;  2K2J A;  1WJ1 A;  3ULC A;  1X1G A;  5KCV A;  3V5W A;  5HE2 A;  2DA0 A;  2W2X D;  4HAT B;  1FGY A;  2YS3 A;  1P6S A;  2CY5 A;  5CLQ B;  3LJU X;  1MAI A;  1Z87 A;  3BJI A;  2AL6 A;  1FGZ A;  1U5F A;  5C16 A;  4Y94 A;  5DHF B;  1KZG A;  1H10 A;  1WVH A;  1N3H A;  3AU4 A;  1DDM A;  5D3V A;  4MY6 A;  2D9W A;  3ZDT A;  5JHG A;  4A6K A;  2DKP A;  4K2P A;  2E2X A;  4EJN A;  1V61 A;  4PNK A;  3GYO A;  4KHO A;  3D8D A;  1Y19 B;  4YL8 A;  2VKI A;  3GYP A;  4GMX B;  4F7U P;  2EMT A;  2KGX B;  2XQN M;  2W2X C;  4BBK A;  1UPR A;  2QKM A;  1ISN A;  3UZT A;  1FB8 A;  1U27 A;  3AJ4 A;  4HDO A;  2D11 A;  4K81 A;  2L2I A;  1UNP A;  2Z0O A;  2Z0P A;  2CAY A;  2DKQ A;  1NU2 A;  3VIA A;  3CXB B;  2D2Q A;  1V88 A;  2MDX A;  2YS5 A;  2N23 A;  1U29 A;  2J0K A;  4HAV B;  2VRW B;  2PZ1 A;  3KRW A;  5LOP B;  2RGN B;  2Y8F A;  3TVV A;  3PP2 A;  2H7E A;  2UZS A;  1K5G B;  3BIN A;  2D9V A;  2RNR B;  5C79 A;  4C0A A;  3HQC A;  1Q67 A;  2Y8G A;  2CY4 A;  1TXD A;  1UNR A;  2FJL A;  3ODW A;  4KAX B;  5HE3 A;  5DI9 B;  1WG7 A;  5LON B;  3NSU A;  1PMS A;  3P6A A;  1M7R A;  2Y7B A;  4GXB A;  1V5P A;  5D27 A;  1UNQ A;  3QBV B;  3F0W A;  2UZR A;  1MK7 B;  1KI1 B;  2EMS A;  4YON A;  2BCJ A;  5L81 A;  3SNH A;  1RJ2 A;  3A8P A;  2GCJ A;  1ZC3 B;  3U8Z A;  1FOE A;  5HE1 A;  4HAW B;  4TKN A;  2COA A;  2MFQ A;  1ZC4 B;  2Z0Q A;  4K2O A;  1W1D A;  2D10 A;  1P5T A;  2VSZ A;  3D8E A;  2RLO A;  2H7D A;  3MDB C;  5HE0 A;  1PFJ A;  3PSC A;  5EFX A;  2COC A;  1H4R A;  5KQ1 A;  2ADZ A;  1X1F A;  2DHJ A;  5DH9 B;  1EF1 A;  1UEF A;  3OAN A;  2L1C A;  2RVB B;  2RUK B;  2LOZ A;  2IYB A;  4CYE A;  3RCP A;  2YS1 A;  2DN6 A;  3PG7 A;  4H8S A;  2D9Y A;  2I1J A;  5D3X A;  3F5R A;  2J59 M;  1AWE A;  4HAZ B;  4L6E A;  1TJ6 A;  2NZ8 B;  2LKO A;  5J3T A;  3ULB A;  2DFK A;  1KZ7 A;  2CRF A;  4CHM A;  2JP2 A;  3IVF A;  4Z2M B;  2K00 A;  3DXC A;  3MPX A;  3QWM A;  2J0J A;  2OTX A;  4HB3 B;  2X18 A;  2YF0 A;  2P0F A;  2DX5 A;  1QQG A;  2YT0 A;  5C5B B;  5J3Y A;  4HB0 B;  1DDW A;  3KZ1 A;  1BAK A;  2W2W A;  2YVC A;  4KHA A;  4GPT B;  1SGH A;  1MKE A;  5FI0 A;  5JP4 A;  4EKU A;  2DHI A;  2I5C A;  3SYX A;  2EC1 A;  1MIZ B;  3TW1 A;  4HHV A;  2K2U A;  4IAP A;  4A6F B;  2LOX A;  1UPQ A;  5GOW B;  1B55 A;  3WA0 A;  1NTV A;  4HAX B;  2I5F A;  3M1I B;  1EGX A;  1U2B A;  4TYZ A;  3D8F A;  1U5E A;  4EMO A;  1XD4 A;  2D9X A;  3SO6 A;  3PVL A;  2P0D A;  4A5K A;  1MK9 B;  1V5M A;  2YT1 A;  1FHW A;  4GZU A;  2M38 A;  2AEH A;  2COD A;  2HTH B;  2LG1 A;  2ELA A;  4DBB A;  1J19 A;  1V5U A;  2MWN B;  3KY9 A;  2NMB A;  4GN1 A;  2QKL A;  1XR0 B;  4K17 A;  5JLJ B;  4B6H A;  2LUL A;  4HAY B;  4P7I A;  5DHA B;  1EAZ A;  2RSG A;  3PEG A;  3N7C A;  4ZRJ A;  3KRX A;  1BWN A;  1FAO A;  2D4Q A;  1DYN A;  4HB2 B;  5KQ4 A;  1FHX A;  1ZM0 A;  1MIX A;  1X11 A;  4F7G A;  1GC6 A;  2GS0 A;  2I1K A;  2DYN A;  3SV1 A;  1OQN A;  1V89 A;  2M14 A;  4DXA B;  5CLL B;  1WGQ A;  2KCJ A;  3HK0 A;  4HB4 B;  2HE7 A;  2DTC A;  4NSW A;  4D0N B;  1XX0 A;  4GMV A;  3X23 A;  1I2H A;  1W1G A;  1I7A A;  3PVW A;  3HW2 B;  2ELB A;  3U7D A;  1K5D B;  1OY2 A;  2GJY A;  1BTK A;  1LW3 A;  1U5D A;  2DX1 A;  5J3Q A;  1GC7 A;  3WYF B;  3FSS A;  3FEH A;  5FI1 A;  2UVM A;  2D9Z A;  2DLW A;  4PQ0 A;  1X86 A;  1OMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...