2ELAA

Crystal structure of the ptb domain of human appl1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
131
Chain Sequence
SILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter protein containing PH domain, PTB domain and leucine
publication title Crystal Structures of the BAR-PH and PTB Domains of Human APPL1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 33
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2elaA00
4NSWA 3U8ZA 3NSUA 3G9WA 1TQZA 3VOQA 5HE3A 2LULA 2V76A 3TFMA 2YS1A 3HW2B 1NTYA 3ODWA 1H4RA 4MK0A 2DKQA 4HDOA 2Y8GA 2W2XD 3WA0A 2YF0A 2Z0OA 1DDVA 4P7IA 4TKNA 4GZUA 5GOWB 1XKEA 3A8PA 1EAZA 2R0DA 2P0FA 2PZ1A 2Z0QA 4EJNA 3D8FA 4K17A 3X23A 2OQBA 1M7RA 2Z0PA 5J3TA 5LONB 2BCJA 1FGZA 4CHJA 2DKPA 3T06A 2KUPA 5J3YA 2RGNB 1KI1B 1NTVA 5FI0A 3SV1A 2LYDA 4ZRIA 3ZVRA 5J3QA 2LOXA 4IAPA 2LG1A 1Y5OA 1MKEA 4EMOA 4GN1A 3ULBA 2VKIA 5C6RA 4EKUA 1V5MA 2NZ8B 3HQCA 1FHWA 1ZSQA 3D8EA 3TW1A 2Y7BA 2DFKA 3U7DA 2D2QA 5C16A 1KZGA 2YT0A 2DYNA 4NY0A 2L2IA 1MIXA 1X1GA 1SGHA 4Z2NA 2MDXA 3MPXA 1MPHA 2Y8FA 4WVFB 1XD4A 4HB3B 2DA0A 2EJ8A 2D9VA 1BTNA 3BJIA 4K2PA 1P3RA 1W1GA 5L81A 4CYEA 4F7UP 1X05A 3FEHA 1J19A 3RCPA 4BBKA 1GC7A 4HAXB 1U2BA 2H7EA 2MWNB 4HAVB 5JLJB 1FHXA 4HB4B 1ZC3B 1B55A 1MIZB 3PG7A 3KZ1A 1XX0A 2HE7A 2J0JA 1DDMA 2GJYA 1H10A 1N3HA 4WSFA 2JP2A 2NMBA 3AJ4A 4GPTB 2P0DA 2W2WA 4KHOA 2YRYA 3PZDA 1WG7A 5LOPB 1BTKA 1U5FA 5C5BA 1WI1A 1WGQA 3KRWA 1UPQA 1Q67A 2J0KA 4IOYX 3SNHA 2RNRB 1OQNA 2LKOA 1Z87A 1TJ6A 2RLOA 3DXCA 5DH9B 1QC6A 2I5CA 2ELAA 4KHAA 2I5FA 2L1CA 2VSZA 2CY4A 3PSCA 4KAXB 2DX5A 3ZDTA 4HAYB 1LB1A 1XCGA 2YS3A 4H8SA 2UVMA 3SUZA 3P7ZA 2D9XA 3P6AA 2EMTA 4GXBA 1ZM0A 1KZ7A 3QBVB 1X11A 2VRWB 4A5KA 4HATB 2RUKB 3CXBB 1UEFA 1K5DB 5D3WA 2DYQA 1DDWA 4GMXB 1PFJA 4XWXA 2COCA 4C0AA 1M7EA 5KCVA 2AEHA 2YS5A 4D0NB 2E2XA 2D9YA 1PLSA 1RRPB 1ZVRA 1IRSA 1MK7B 5CLQB 1WJ1A 5C79A 3PVLA 2MKRA 1UPRA 4B6HA 3ODOA 5DHAB 2ROVA 1WVHA 1X86A 2D9ZA 2KGXB 2M38A 2GS0A 2K2JA 5D3XA 3QIJA 1X1FA 5CLLB 1U27A 2P0HA 1Y19B 2DX1A 4A6FB 2N23A 3ML4A 1U5EA 2DHJA 2H7DA 4HAZB 4KVGB 4HAUB 4K81A 2I1KA 5DI9B 1FHOA 3PEGA 2D9WA 4GMVA 2CODA 2UZSA 3F0WA 1LW3A 1U5DA 2D4QA 2DHIA 5HE1A 1ISNA 1V61A 3FSSA 4DBBA 1UNRA 3HK0A 3PP2A 4HAWB 1W1HA 3KRXA 1FOEA 4A6FA 3KY9A 3DXDA 3TO1A 4KHBB 1WJMA 2DLWA 3KSYA 4IFSA 1DROA 1FB8A 1K5GB 1E5WA 4ZRJA 2X18A 1P6SA 5JP4A 2G35A 1GC6A 3ULCA 1WGUA 2ELBA 2DN6A 3GYOA 2RVBB 2ROZB 1AWEA 1BAKA 1DBHA 3N7CA 3WYFB 2OTXA 2YVCA 1SHCA 2W2XC 4PQ0A 1ZC4B 1OY2A 3V5WA 2DTCA 1PMSA 4WJ7A 2QKLA 3O96A 1UNQA 5D3YA 2K00A 1MK9B 4K2OA 1I7AA 3PVUA 4HHVA 1J0WA 5KQ4A 5HE2A 1U5GA 1GG3A 1NI2A 3AU5A 1I2HA 1XODA 3ODXA 3FM8C 3M1IB 4CHMA 3IVFA 3TVVA 4Y94A 5EFXA 2K2UA 1U29A 1W1DA 1EVHA 2QKMA 5HE0A 5D3VA 5JHGA 3CIKA 2AL6A 2YSZA 1DYNA 1FAOA 3LJUX 5D27A 4DX90 2FJLA 1EGXA 5KQ1A 2MFQA 2COAA 4YL8A 3UZTA 2EMSA 1AQCA 4HDQA 3D8DA 4DXAB 2D10A 1TXDA 4A6KA 4F7HA 1BWNA 2LOZA 4HB2B 2ADZA 2GCJA 4DX8A 3VIAA 3TCAA 1XR0B 1QQGA 3QWMA 4Z2MB 1V88A 4HB0B 2ZPYA 4MT7A 3SO6A 1OMWA 2CY5A 3A8QA 5DIFB 5FI1A 1P5TA 1V5PA 1MAIA 4PNKA 3MDBC 2CRFA 1NU2A 3GYPA 4ZRKA 2COFA 2N0YA 2KCJA 2HTHB 5JHHA 4A6HA 4F7GA 1V5UA 2Q13A 2UZRA 2DHKA 3PVWA 2IYBA 2EC1A 1RJ2A 5DHFB 2P8VA 2R09A 2I1JA 3AU4A 3A98B 5C5BB 1V89A 3BINA 2YT1A 4MY6A 4TYZA 2IFSA 3OANA 3DXEA 2J0MA 2XQNM 1FGYA 1EF1A 2J59M 1UNPA 2M14A 2CAYA 3SYXA 3F5RA 4L6EA 4YONA 2D11A 2GCLA 2RSGA
chains in the Genus database with same CATH superfamily
4NSWA 3U8ZA 3NSUA 3G9WA 1TQZA 3VOQA 5HE3A 2LULA 2V76A 3TFMA 2RRFA 2YS1A 3HW2B 1NTYA 4GOUA 3ODWA 1H4RA 4MK0A 2DKQA 4HDOA 3FVCA 2Y8GA 2W2XD 3WA0A 2YF0A 2Z0OA 1DDVA 4P7IA 3U12A 4TKNA 4GZUA 5GOWB 1XKEA 3A8PA 1EAZA 2R0DA 2P0FA 2PZ1A 2Z0QA 4EJNA 3D8FA 4K17A 3X23A 2OQBA 5LG4B 1M7RA 2Z0PA 5J3TA 5LONB 2BCJA 4QXAB 1FGZA 4CHJA 2DKPA 3T06A 2KUPA 4OSNA 5J3YA 5I2MA 2RGNB 1KI1B 1NTVA 5FI0A 3SV1A 2LYDA 4ZRIA 3ZVRA 5J3QA 2LOXA 4IAPA 3A58A 2LG1A 1Y5OA 1MKEA 4EMOA 4GN1A 3ULBA 2VKIA 5C6RA 4EKUA 1V5MA 2NZ8B 3HQCA 1FHWA 1ZSQA 3D8EA 3TW1A 2Y7BA 2DFKA 3U7DA 2D2QA 5C16A 1KZGA 2YT0A 2DYNA 4NY0A 2YT2A 2L2IA 1MIXA 1X1GA 1SGHA 4Z2NA 2MDXA 3MPXA 1MPHA 2Y8FA 4WVFB 1XD4A 1ZYIA 4HB3B 2DA0A 2EJ8A 2D9VA 1BTNA 3BJIA 4K2PA 1P3RA 1W1GA 5L81A 4CYEA 4F7UP 1X05A 3FEHA 1J19A 3RCPA 4BBKA 1GC7A 4HAXB 1U2BA 2H7EA 2MWNB 4HAVB 5JLJB 1FHXA 4HB4B 1ZC3B 1B55A 1MIZB 3PG7A 3KZ1A 1XX0A 2HE7A 2J0JA 2Z4DA 1DDMA 2GJYA 1H10A 1N3HA 4WSFA 2JP2A 2NMBA 3AJ4A 4GPTB 2P0DA 2W2WA 4KHOA 2YRYA 3PZDA 1WG7A 5LOPB 1BTKA 1U5FA 5C5BA 4HSIA 3B77A 1WI1A 3HIEA 1WGQA 1T77A 3KRWA 1UPQA 1Q67A 2J0KA 4IOYX 3SNHA 2RNRB 1OQNA 2LKOA 1Z87A 1TJ6A 2RLOA 2ZKMX 3DXCA 2Z14A 5DH9B 1QC6A 2I5CA 2ELAA 4KHAA 2I5FA 2L1CA 2VSZA 2CY4A 3PSCA 4KAXB 2DX5A 3ZDTA 4D6WA 4HAYB 1LB1A 1XCGA 2YS3A 4GNKB 5IRSA 4H8SA 2UVMA 3DCXA 3SUZA 3P7ZA 2D9XA 3P6AA 2EMTA 4GXBA 1ZM0A 1KZ7A 3QBVB 1X11A 2VRWB 4A5KA 4HATB 3HSAA 2RUKB 3CXBB 1UEFA 1K5DB 5D3WA 2DYQA 1DDWA 4GMXB 1PFJA 4XWXA 2COCA 4C0AA 1M7EA 5KCVA 2AEHA 2YS5A 4D0NB 2E2XA 2D9YA 1PLSA 1RRPB 4DIXA 1ZVRA 1IRSA 2GUMA 1MK7B 5CLQB 1WJ1A 5C79A 3PVLA 2MKRA 1UPRA 4B6HA 3ODOA 5DHAB 2ROVA 1WVHA 1X86A 2D9ZA 2KGXB 2M38A 2GS0A 2K2JA 5D3XA 3QIJA 1X1FA 5CLLB 1U27A 2P0HA 2Z13A 1Y19B 2DX1A 4A6FB 2N23A 3NW8A 3ML4A 1U5EA 4CSQA 2DHJA 2H7DA 4HAZB 4KVGB 4HAUB 4K81A 2I1KA 5DI9B 1FHOA 3PEGA 2D9WA 4GMVA 2CODA 2UZSA 3F0WA 1LW3A 1U5DA 2D4QA 2DHIA 5HE1A 1ISNA 1V61A 5I2SA 3FSSA 4DBBA 1UNRA 3HK0A 3PP2A 4HAWB 1W1HA 3KRXA 1FOEA 4A6FA 3KY9A 3DXDA 3TO1A 4KHBB 4L1RA 1WJMA 2DLWA 3KSYA 4IFSA 1DROA 1FB8A 1K5GB 1E5WA 4ZRJA 2X18A 1P6SA 5JP4A 2G35A 1GC6A 3ULCA 1WGUA 2ELBA 2DN6A 3GYOA 2RVBB 2ROZB 1AWEA 1BAKA 1DBHA 3N7CA 3WYFB 2OTXA 2YVCA 1SHCA 2W2XC 4PQ0A 1ZC4B 1OY2A 3V5WA 2DTCA 1PMSA 4WJ7A 2QKLA 3O96A 1UNQA 5D3YA 2K00A 1MK9B 3NWAA 4K2OA 1I7AA 3PVUA 4HHVA 1J0WA 5KQ4A 5HE2A 1U5GA 1GG3A 3AU5A 1NI2A 1I2HA 1XODA 3ODXA 3FM8C 3M1IB 4CHMA 3IVFA 3TVVA 4Y94A 5EFXA 2K2UA 1U29A 5M4YB 1W1DA 1EVHA 2QKMA 5HE0A 5D3VA 1MI1A 2R2YA 5JHGA 3CIKA 2AL6A 2YSZA 1DYNA 1FAOA 3LJUX 5D27A 4DX90 2FJLA 1EGXA 2NBVA 5KQ1A 2KUQA 4QJ3B 2MFQA 2COAA 4YL8A 3UZTA 2EMSA 1AQCA 4HDQA 3D8DA 4DXAB 2D10A 1TXDA 4A6KA 4F7HA 1BWNA 2LOZA 4HB2B 2ADZA 2GCJA 4DX8A 3VIAA 3TCAA 1XR0B 1QQGA 3QWMA 4Z2MB 1V88A 4HB0B 2ZPYA 4MT7A 3SO6A 1OMWA 2CY5A 3A8QA 5DIFB 5FI1A 1P5TA 1V5PA 3NWFA 1MAIA 4PNKA 3MDBC 3NWDA 2CRFA 3OHMB 1NU2A 3GYPA 4ZRKA 2COFA 2N0YA 2KCJA 4QJ4B 2HTHB 5JHHA 2KIGA 4A6HA 4F7GA 1V5UA 2Q13A 2KR0A 2UZRA 2DHKA 3PVWA 2IYBA 2EC1A 1RJ2A 5DHFB 2P8VA 2R09A 2K8EA 2I1JA 2KIEA 3AU4A 3A98B 5C5BB 1V89A 4QJ5B 3BINA 4OT1A 2YT1A 4MY6A 4TYZA 2IFSA 3OANA 3DXEA 2J0MA 2XQNM 1FGYA 2K49A 1EF1A 2J59M 2Z59A 1UNPA 2M14A 2CAYA 3SYXA 3F5RA 4L6EA 4YONA 4KHBA 2D11A 2GCLA 2RSGA 2FJUB
chains in the Genus database with same CATH topology
4NSWA 3U8ZA 3NSUA 3G9WA 1TQZA 3VOQA 5HE3A 2LULA 2V76A 3TFMA 2YS1A 3HW2B 1NTYA 3ODWA 1H4RA 4MK0A 2DKQA 4HDOA 2Y8GA 2W2XD 3WA0A 2YF0A 2Z0OA 1DDVA 4P7IA 4TKNA 4GZUA 5GOWB 1XKEA 3A8PA 1EAZA 2R0DA 2P0FA 2PZ1A 2Z0QA 4EJNA 3D8FA 4K17A 3X23A 2OQBA 1M7RA 2Z0PA 5J3TA 5LONB 2BCJA 1FGZA 4CHJA 2DKPA 3T06A 2KUPA 5J3YA 2RGNB 1KI1B 1NTVA 5FI0A 3SV1A 2LYDA 4ZRIA 3ZVRA 5J3QA 2LOXA 4IAPA 2LG1A 1Y5OA 1MKEA 4EMOA 4GN1A 3ULBA 2VKIA 5C6RA 4EKUA 1V5MA 2NZ8B 3HQCA 1FHWA 1ZSQA 3D8EA 3TW1A 2Y7BA 2DFKA 3U7DA 2D2QA 5C16A 1KZGA 2YT0A 2DYNA 4NY0A 2L2IA 1MIXA 1X1GA 1SGHA 4Z2NA 2MDXA 3MPXA 1MPHA 2Y8FA 4WVFB 1XD4A 4HB3B 2DA0A 2EJ8A 2D9VA 1BTNA 3BJIA 4K2PA 1P3RA 1W1GA 5L81A 4CYEA 4F7UP 1X05A 3FEHA 1J19A 3RCPA 4BBKA 1GC7A 4HAXB 1U2BA 2H7EA 2MWNB 4HAVB 5JLJB 1FHXA 4HB4B 1ZC3B 1B55A 1MIZB 3PG7A 3KZ1A 1XX0A 2HE7A 2J0JA 1DDMA 2GJYA 1H10A 1N3HA 4WSFA 2JP2A 2NMBA 3AJ4A 4GPTB 2P0DA 2W2WA 4KHOA 2YRYA 3PZDA 1WG7A 5LOPB 1BTKA 1U5FA 5C5BA 1WI1A 1WGQA 3KRWA 1UPQA 1Q67A 2J0KA 4IOYX 3SNHA 2RNRB 1OQNA 2LKOA 1Z87A 1TJ6A 2RLOA 3DXCA 5DH9B 1QC6A 2I5CA 2ELAA 4KHAA 2I5FA 2L1CA 2VSZA 2CY4A 3PSCA 4KAXB 2DX5A 3ZDTA 4HAYB 1LB1A 1XCGA 2YS3A 4H8SA 2UVMA 3SUZA 3P7ZA 2D9XA 3P6AA 2EMTA 4GXBA 1ZM0A 1KZ7A 3QBVB 1X11A 2VRWB 4A5KA 4HATB 2RUKB 3CXBB 1UEFA 1K5DB 5D3WA 2DYQA 1DDWA 4GMXB 1PFJA 4XWXA 2COCA 4C0AA 1M7EA 5KCVA 2AEHA 2YS5A 4D0NB 2E2XA 2D9YA 1PLSA 1RRPB 1ZVRA 1IRSA 1MK7B 5CLQB 1WJ1A 5C79A 3PVLA 2MKRA 1UPRA 4B6HA 3ODOA 5DHAB 2ROVA 1WVHA 1X86A 2D9ZA 2KGXB 2M38A 2GS0A 2K2JA 5D3XA 3QIJA 1X1FA 5CLLB 1U27A 2P0HA 1Y19B 2DX1A 4A6FB 2N23A 3ML4A 1U5EA 2DHJA 2H7DA 4HAZB 4KVGB 4HAUB 4K81A 2I1KA 5DI9B 1FHOA 3PEGA 2D9WA 4GMVA 2CODA 2UZSA 3F0WA 1LW3A 1U5DA 2D4QA 2DHIA 5HE1A 1ISNA 1V61A 3FSSA 4DBBA 1UNRA 3HK0A 3PP2A 4HAWB 1W1HA 3KRXA 1FOEA 4A6FA 3KY9A 3DXDA 3TO1A 4KHBB 1WJMA 2DLWA 3KSYA 4IFSA 1DROA 1FB8A 1K5GB 1E5WA 4ZRJA 2X18A 1P6SA 5JP4A 2G35A 1GC6A 3ULCA 1WGUA 2ELBA 2DN6A 3GYOA 2RVBB 2ROZB 1AWEA 1BAKA 1DBHA 3N7CA 3WYFB 2OTXA 2YVCA 1SHCA 2W2XC 4PQ0A 1ZC4B 1OY2A 3V5WA 2DTCA 1PMSA 4WJ7A 2QKLA 3O96A 1UNQA 5D3YA 2K00A 1MK9B 4K2OA 1I7AA 3PVUA 4HHVA 1J0WA 5KQ4A 5HE2A 1U5GA 1GG3A 1NI2A 3AU5A 1I2HA 1XODA 3ODXA 3FM8C 3M1IB 4CHMA 3IVFA 3TVVA 4Y94A 5EFXA 2K2UA 1U29A 1W1DA 1EVHA 2QKMA 5HE0A 5D3VA 5JHGA 3CIKA 2AL6A 2YSZA 1DYNA 1FAOA 3LJUX 5D27A 4DX90 2FJLA 1EGXA 5KQ1A 2MFQA 2COAA 4YL8A 3UZTA 2EMSA 1AQCA 4HDQA 3D8DA 4DXAB 2D10A 1TXDA 4A6KA 4F7HA 1BWNA 2LOZA 4HB2B 2ADZA 2GCJA 4DX8A 3VIAA 3TCAA 1XR0B 1QQGA 3QWMA 4Z2MB 1V88A 4HB0B 2ZPYA 4MT7A 3SO6A 1OMWA 2CY5A 3A8QA 5DIFB 5FI1A 1P5TA 1V5PA 1MAIA 4PNKA 3MDBC 2CRFA 1NU2A 3GYPA 4ZRKA 2COFA 2N0YA 2KCJA 2HTHB 5JHHA 4A6HA 4F7GA 1V5UA 2Q13A 2UZRA 2DHKA 3PVWA 2IYBA 2EC1A 1RJ2A 5DHFB 2P8VA 2R09A 2I1JA 3AU4A 3A98B 5C5BB 1V89A 3BINA 2YT1A 4MY6A 4TYZA 2IFSA 3OANA 3DXEA 2J0MA 2XQNM 1FGYA 1EF1A 2J59M 1UNPA 2M14A 2CAYA 3SYXA 3F5RA 4L6EA 4YONA 2D11A 2GCLA 2RSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSW A;  3U8Z A;  3NSU A;  3G9W A;  1TQZ A;  3VOQ A;  5HE3 A;  2LUL A;  2V76 A;  3TFM A;  2YS1 A;  3HW2 B;  1NTY A;  3ODW A;  1H4R A;  4MK0 A;  2DKQ A;  4HDO A;  2Y8G A;  2W2X D;  3WA0 A;  2YF0 A;  2Z0O A;  1DDV A;  4P7I A;  4TKN A;  4GZU A;  5GOW B;  1XKE A;  3A8P A;  1EAZ A;  2R0D A;  2P0F A;  2PZ1 A;  2Z0Q A;  4EJN A;  3D8F A;  4K17 A;  3X23 A;  2OQB A;  1M7R A;  2Z0P A;  5J3T A;  5LON B;  2BCJ A;  1FGZ A;  4CHJ A;  2DKP A;  3T06 A;  2KUP A;  5J3Y A;  2RGN B;  1KI1 B;  1NTV A;  5FI0 A;  3SV1 A;  2LYD A;  4ZRI A;  3ZVR A;  5J3Q A;  2LOX A;  4IAP A;  2LG1 A;  1Y5O A;  1MKE A;  4EMO A;  4GN1 A;  3ULB A;  2VKI A;  5C6R A;  4EKU A;  1V5M A;  2NZ8 B;  3HQC A;  1FHW A;  1ZSQ A;  3D8E A;  3TW1 A;  2Y7B A;  2DFK A;  3U7D A;  2D2Q A;  5C16 A;  1KZG A;  2YT0 A;  2DYN A;  4NY0 A;  2L2I A;  1MIX A;  1X1G A;  1SGH A;  4Z2N A;  2MDX A;  3MPX A;  1MPH A;  2Y8F A;  4WVF B;  1XD4 A;  4HB3 B;  2DA0 A;  2EJ8 A;  2D9V A;  1BTN A;  3BJI A;  4K2P A;  1P3R A;  1W1G A;  5L81 A;  4CYE A;  4F7U P;  1X05 A;  3FEH A;  1J19 A;  3RCP A;  4BBK A;  1GC7 A;  4HAX B;  1U2B A;  2H7E A;  2MWN B;  4HAV B;  5JLJ B;  1FHX A;  4HB4 B;  1ZC3 B;  1B55 A;  1MIZ B;  3PG7 A;  3KZ1 A;  1XX0 A;  2HE7 A;  2J0J A;  1DDM A;  2GJY A;  1H10 A;  1N3H A;  4WSF A;  2JP2 A;  2NMB A;  3AJ4 A;  4GPT B;  2P0D A;  2W2W A;  4KHO A;  2YRY A;  3PZD A;  1WG7 A;  5LOP B;  1BTK A;  1U5F A;  5C5B A;  1WI1 A;  1WGQ A;  3KRW A;  1UPQ A;  1Q67 A;  2J0K A;  4IOY X;  3SNH A;  2RNR B;  1OQN A;  2LKO A;  1Z87 A;  1TJ6 A;  2RLO A;  3DXC A;  5DH9 B;  1QC6 A;  2I5C A;  2ELA A;  4KHA A;  2I5F A;  2L1C A;  2VSZ A;  2CY4 A;  3PSC A;  4KAX B;  2DX5 A;  3ZDT A;  4HAY B;  1LB1 A;  1XCG A;  2YS3 A;  4H8S A;  2UVM A;  3SUZ A;  3P7Z A;  2D9X A;  3P6A A;  2EMT A;  4GXB A;  1ZM0 A;  1KZ7 A;  3QBV B;  1X11 A;  2VRW B;  4A5K A;  4HAT B;  2RUK B;  3CXB B;  1UEF A;  1K5D B;  5D3W A;  2DYQ A;  1DDW A;  4GMX B;  1PFJ A;  4XWX A;  2COC A;  4C0A A;  1M7E A;  5KCV A;  2AEH A;  2YS5 A;  4D0N B;  2E2X A;  2D9Y A;  1PLS A;  1RRP B;  1ZVR A;  1IRS A;  1MK7 B;  5CLQ B;  1WJ1 A;  5C79 A;  3PVL A;  2MKR A;  1UPR A;  4B6H A;  3ODO A;  5DHA B;  2ROV A;  1WVH A;  1X86 A;  2D9Z A;  2KGX B;  2M38 A;  2GS0 A;  2K2J A;  5D3X A;  3QIJ A;  1X1F A;  5CLL B;  1U27 A;  2P0H A;  1Y19 B;  2DX1 A;  4A6F B;  2N23 A;  3ML4 A;  1U5E A;  2DHJ A;  2H7D A;  4HAZ B;  4KVG B;  4HAU B;  4K81 A;  2I1K A;  5DI9 B;  1FHO A;  3PEG A;  2D9W A;  4GMV A;  2COD A;  2UZS A;  3F0W A;  1LW3 A;  1U5D A;  2D4Q A;  2DHI A;  5HE1 A;  1ISN A;  1V61 A;  3FSS A;  4DBB A;  1UNR A;  3HK0 A;  3PP2 A;  4HAW B;  1W1H A;  3KRX A;  1FOE A;  4A6F A;  3KY9 A;  3DXD A;  3TO1 A;  4KHB B;  1WJM A;  2DLW A;  3KSY A;  4IFS A;  1DRO A;  1FB8 A;  1K5G B;  1E5W A;  4ZRJ A;  2X18 A;  1P6S A;  5JP4 A;  2G35 A;  1GC6 A;  3ULC A;  1WGU A;  2ELB A;  2DN6 A;  3GYO A;  2RVB B;  2ROZ B;  1AWE A;  1BAK A;  1DBH A;  3N7C A;  3WYF B;  2OTX A;  2YVC A;  1SHC A;  2W2X C;  4PQ0 A;  1ZC4 B;  1OY2 A;  3V5W A;  2DTC A;  1PMS A;  4WJ7 A;  2QKL A;  3O96 A;  1UNQ A;  5D3Y A;  2K00 A;  1MK9 B;  4K2O A;  1I7A A;  3PVU A;  4HHV A;  1J0W A;  5KQ4 A;  5HE2 A;  1U5G A;  1GG3 A;  1NI2 A;  3AU5 A;  1I2H A;  1XOD A;  3ODX A;  3FM8 C;  3M1I B;  4CHM A;  3IVF A;  3TVV A;  4Y94 A;  5EFX A;  2K2U A;  1U29 A;  1W1D A;  1EVH A;  2QKM A;  5HE0 A;  5D3V A;  5JHG A;  3CIK A;  2AL6 A;  2YSZ A;  1DYN A;  1FAO A;  3LJU X;  5D27 A;  4DX9 0;  2FJL A;  1EGX A;  5KQ1 A;  2MFQ A;  2COA A;  4YL8 A;  3UZT A;  2EMS A;  1AQC A;  4HDQ A;  3D8D A;  4DXA B;  2D10 A;  1TXD A;  4A6K A;  4F7H A;  1BWN A;  2LOZ A;  4HB2 B;  2ADZ A;  2GCJ A;  4DX8 A;  3VIA A;  3TCA A;  1XR0 B;  1QQG A;  3QWM A;  4Z2M B;  1V88 A;  4HB0 B;  2ZPY A;  4MT7 A;  3SO6 A;  1OMW A;  2CY5 A;  3A8Q A;  5DIF B;  5FI1 A;  1P5T A;  1V5P A;  1MAI A;  4PNK A;  3MDB C;  2CRF A;  1NU2 A;  3GYP A;  4ZRK A;  2COF A;  2N0Y A;  2KCJ A;  2HTH B;  5JHH A;  4A6H A;  4F7G A;  1V5U A;  2Q13 A;  2UZR A;  2DHK A;  3PVW A;  2IYB A;  2EC1 A;  1RJ2 A;  5DHF B;  2P8V A;  2R09 A;  2I1J A;  3AU4 A;  3A98 B;  5C5B B;  1V89 A;  3BIN A;  2YT1 A;  4MY6 A;  4TYZ A;  2IFS A;  3OAN A;  3DXE A;  2J0M A;  2XQN M;  1FGY A;  1EF1 A;  2J59 M;  1UNP A;  2M14 A;  2CAY A;  3SYX A;  3F5R A;  4L6E A;  4YON A;  2D11 A;  2GCL A;  2RSG A; 
#chains in the Genus database with same CATH topology
 4NSW A;  3U8Z A;  3NSU A;  3G9W A;  1TQZ A;  3VOQ A;  5HE3 A;  2LUL A;  2V76 A;  3TFM A;  2RRF A;  2YS1 A;  3HW2 B;  1NTY A;  4GOU A;  3ODW A;  1H4R A;  4MK0 A;  2DKQ A;  4HDO A;  3FVC A;  2Y8G A;  2W2X D;  3WA0 A;  2YF0 A;  2Z0O A;  1DDV A;  4P7I A;  3U12 A;  4TKN A;  4GZU A;  5GOW B;  1XKE A;  3A8P A;  1EAZ A;  2R0D A;  2P0F A;  2PZ1 A;  2Z0Q A;  4EJN A;  3D8F A;  4K17 A;  3X23 A;  2OQB A;  5LG4 B;  1M7R A;  2Z0P A;  5J3T A;  5LON B;  2BCJ A;  4QXA B;  1FGZ A;  4CHJ A;  2DKP A;  3T06 A;  2KUP A;  4OSN A;  5J3Y A;  5I2M A;  2RGN B;  1KI1 B;  1NTV A;  5FI0 A;  3SV1 A;  2LYD A;  4ZRI A;  3ZVR A;  5J3Q A;  2LOX A;  4IAP A;  3A58 A;  2LG1 A;  1Y5O A;  1MKE A;  4EMO A;  4GN1 A;  3ULB A;  2VKI A;  5C6R A;  4EKU A;  1V5M A;  2NZ8 B;  3HQC A;  1FHW A;  1ZSQ A;  3D8E A;  3TW1 A;  2Y7B A;  2DFK A;  3U7D A;  2D2Q A;  5C16 A;  1KZG A;  2YT0 A;  2DYN A;  4NY0 A;  2YT2 A;  2L2I A;  1MIX A;  1X1G A;  1SGH A;  4Z2N A;  2MDX A;  3MPX A;  1MPH A;  2Y8F A;  4WVF B;  1XD4 A;  1ZYI A;  4HB3 B;  2DA0 A;  2EJ8 A;  2D9V A;  1BTN A;  3BJI A;  4K2P A;  1P3R A;  1W1G A;  5L81 A;  4CYE A;  4F7U P;  1X05 A;  3FEH A;  1J19 A;  3RCP A;  4BBK A;  1GC7 A;  4HAX B;  1U2B A;  2H7E A;  2MWN B;  4HAV B;  5JLJ B;  1FHX A;  4HB4 B;  1ZC3 B;  1B55 A;  1MIZ B;  3PG7 A;  3KZ1 A;  1XX0 A;  2HE7 A;  2J0J A;  2Z4D A;  1DDM A;  2GJY A;  1H10 A;  1N3H A;  4WSF A;  2JP2 A;  2NMB A;  3AJ4 A;  4GPT B;  2P0D A;  2W2W A;  4KHO A;  2YRY A;  3PZD A;  1WG7 A;  5LOP B;  1BTK A;  1U5F A;  5C5B A;  4HSI A;  3B77 A;  1WI1 A;  3HIE A;  1WGQ A;  1T77 A;  3KRW A;  1UPQ A;  1Q67 A;  2J0K A;  4IOY X;  3SNH A;  2RNR B;  1OQN A;  2LKO A;  1Z87 A;  1TJ6 A;  2RLO A;  2ZKM X;  3DXC A;  2Z14 A;  5DH9 B;  1QC6 A;  2I5C A;  2ELA A;  4KHA A;  2I5F A;  2L1C A;  2VSZ A;  2CY4 A;  3PSC A;  4KAX B;  2DX5 A;  3ZDT A;  4D6W A;  4HAY B;  1LB1 A;  1XCG A;  2YS3 A;  4GNK B;  5IRS A;  4H8S A;  2UVM A;  3DCX A;  3SUZ A;  3P7Z A;  2D9X A;  3P6A A;  2EMT A;  4GXB A;  1ZM0 A;  1KZ7 A;  3QBV B;  1X11 A;  2VRW B;  4A5K A;  4HAT B;  3HSA A;  2RUK B;  3CXB B;  1UEF A;  1K5D B;  5D3W A;  2DYQ A;  1DDW A;  4GMX B;  1PFJ A;  4XWX A;  2COC A;  4C0A A;  1M7E A;  5KCV A;  2AEH A;  2YS5 A;  4D0N B;  2E2X A;  2D9Y A;  1PLS A;  1RRP B;  4DIX A;  1ZVR A;  1IRS A;  2GUM A;  1MK7 B;  5CLQ B;  1WJ1 A;  5C79 A;  3PVL A;  2MKR A;  1UPR A;  4B6H A;  3ODO A;  5DHA B;  2ROV A;  1WVH A;  1X86 A;  2D9Z A;  2KGX B;  2M38 A;  2GS0 A;  2K2J A;  5D3X A;  3QIJ A;  1X1F A;  5CLL B;  1U27 A;  2P0H A;  2Z13 A;  1Y19 B;  2DX1 A;  4A6F B;  2N23 A;  3NW8 A;  3ML4 A;  1U5E A;  4CSQ A;  2DHJ A;  2H7D A;  4HAZ B;  4KVG B;  4HAU B;  4K81 A;  2I1K A;  5DI9 B;  1FHO A;  3PEG A;  2D9W A;  4GMV A;  2COD A;  2UZS A;  3F0W A;  1LW3 A;  1U5D A;  2D4Q A;  2DHI A;  5HE1 A;  1ISN A;  1V61 A;  5I2S A;  3FSS A;  4DBB A;  1UNR A;  3HK0 A;  3PP2 A;  4HAW B;  1W1H A;  3KRX A;  1FOE A;  4A6F A;  3KY9 A;  3DXD A;  3TO1 A;  4KHB B;  4L1R A;  1WJM A;  2DLW A;  3KSY A;  4IFS A;  1DRO A;  1FB8 A;  1K5G B;  1E5W A;  4ZRJ A;  2X18 A;  1P6S A;  5JP4 A;  2G35 A;  1GC6 A;  3ULC A;  1WGU A;  2ELB A;  2DN6 A;  3GYO A;  2RVB B;  2ROZ B;  1AWE A;  1BAK A;  1DBH A;  3N7C A;  3WYF B;  2OTX A;  2YVC A;  1SHC A;  2W2X C;  4PQ0 A;  1ZC4 B;  1OY2 A;  3V5W A;  2DTC A;  1PMS A;  4WJ7 A;  2QKL A;  3O96 A;  1UNQ A;  5D3Y A;  2K00 A;  1MK9 B;  3NWA A;  4K2O A;  1I7A A;  3PVU A;  4HHV A;  1J0W A;  5KQ4 A;  5HE2 A;  1U5G A;  1GG3 A;  3AU5 A;  1NI2 A;  1I2H A;  1XOD A;  3ODX A;  3FM8 C;  3M1I B;  4CHM A;  3IVF A;  3TVV A;  4Y94 A;  5EFX A;  2K2U A;  1U29 A;  5M4Y B;  1W1D A;  1EVH A;  2QKM A;  5HE0 A;  5D3V A;  1MI1 A;  2R2Y A;  5JHG A;  3CIK A;  2AL6 A;  2YSZ A;  1DYN A;  1FAO A;  3LJU X;  5D27 A;  4DX9 0;  2FJL A;  1EGX A;  2NBV A;  5KQ1 A;  2KUQ A;  4QJ3 B;  2MFQ A;  2COA A;  4YL8 A;  3UZT A;  2EMS A;  1AQC A;  4HDQ A;  3D8D A;  4DXA B;  2D10 A;  1TXD A;  4A6K A;  4F7H A;  1BWN A;  2LOZ A;  4HB2 B;  2ADZ A;  2GCJ A;  4DX8 A;  3VIA A;  3TCA A;  1XR0 B;  1QQG A;  3QWM A;  4Z2M B;  1V88 A;  4HB0 B;  2ZPY A;  4MT7 A;  3SO6 A;  1OMW A;  2CY5 A;  3A8Q A;  5DIF B;  5FI1 A;  1P5T A;  1V5P A;  3NWF A;  1MAI A;  4PNK A;  3MDB C;  3NWD A;  2CRF A;  3OHM B;  1NU2 A;  3GYP A;  4ZRK A;  2COF A;  2N0Y A;  2KCJ A;  4QJ4 B;  2HTH B;  5JHH A;  2KIG A;  4A6H A;  4F7G A;  1V5U A;  2Q13 A;  2KR0 A;  2UZR A;  2DHK A;  3PVW A;  2IYB A;  2EC1 A;  1RJ2 A;  5DHF B;  2P8V A;  2R09 A;  2K8E A;  2I1J A;  2KIE A;  3AU4 A;  3A98 B;  5C5B B;  1V89 A;  4QJ5 B;  3BIN A;  4OT1 A;  2YT1 A;  4MY6 A;  4TYZ A;  2IFS A;  3OAN A;  3DXE A;  2J0M A;  2XQN M;  1FGY A;  2K49 A;  1EF1 A;  2J59 M;  2Z59 A;  1UNP A;  2M14 A;  2CAY A;  3SYX A;  3F5R A;  4L6E A;  4YON A;  4KHB A;  2D11 A;  2GCL A;  2RSG A;  2FJU B; 
#chains in the Genus database with same CATH homology
 4NSW A;  3U8Z A;  3NSU A;  3G9W A;  1TQZ A;  3VOQ A;  5HE3 A;  2LUL A;  2V76 A;  3TFM A;  2YS1 A;  3HW2 B;  1NTY A;  3ODW A;  1H4R A;  4MK0 A;  2DKQ A;  4HDO A;  2Y8G A;  2W2X D;  3WA0 A;  2YF0 A;  2Z0O A;  1DDV A;  4P7I A;  4TKN A;  4GZU A;  5GOW B;  1XKE A;  3A8P A;  1EAZ A;  2R0D A;  2P0F A;  2PZ1 A;  2Z0Q A;  4EJN A;  3D8F A;  4K17 A;  3X23 A;  2OQB A;  1M7R A;  2Z0P A;  5J3T A;  5LON B;  2BCJ A;  1FGZ A;  4CHJ A;  2DKP A;  3T06 A;  2KUP A;  5J3Y A;  2RGN B;  1KI1 B;  1NTV A;  5FI0 A;  3SV1 A;  2LYD A;  4ZRI A;  3ZVR A;  5J3Q A;  2LOX A;  4IAP A;  2LG1 A;  1Y5O A;  1MKE A;  4EMO A;  4GN1 A;  3ULB A;  2VKI A;  5C6R A;  4EKU A;  1V5M A;  2NZ8 B;  3HQC A;  1FHW A;  1ZSQ A;  3D8E A;  3TW1 A;  2Y7B A;  2DFK A;  3U7D A;  2D2Q A;  5C16 A;  1KZG A;  2YT0 A;  2DYN A;  4NY0 A;  2L2I A;  1MIX A;  1X1G A;  1SGH A;  4Z2N A;  2MDX A;  3MPX A;  1MPH A;  2Y8F A;  4WVF B;  1XD4 A;  4HB3 B;  2DA0 A;  2EJ8 A;  2D9V A;  1BTN A;  3BJI A;  4K2P A;  1P3R A;  1W1G A;  5L81 A;  4CYE A;  4F7U P;  1X05 A;  3FEH A;  1J19 A;  3RCP A;  4BBK A;  1GC7 A;  4HAX B;  1U2B A;  2H7E A;  2MWN B;  4HAV B;  5JLJ B;  1FHX A;  4HB4 B;  1ZC3 B;  1B55 A;  1MIZ B;  3PG7 A;  3KZ1 A;  1XX0 A;  2HE7 A;  2J0J A;  1DDM A;  2GJY A;  1H10 A;  1N3H A;  4WSF A;  2JP2 A;  2NMB A;  3AJ4 A;  4GPT B;  2P0D A;  2W2W A;  4KHO A;  2YRY A;  3PZD A;  1WG7 A;  5LOP B;  1BTK A;  1U5F A;  5C5B A;  1WI1 A;  1WGQ A;  3KRW A;  1UPQ A;  1Q67 A;  2J0K A;  4IOY X;  3SNH A;  2RNR B;  1OQN A;  2LKO A;  1Z87 A;  1TJ6 A;  2RLO A;  3DXC A;  5DH9 B;  1QC6 A;  2I5C A;  2ELA A;  4KHA A;  2I5F A;  2L1C A;  2VSZ A;  2CY4 A;  3PSC A;  4KAX B;  2DX5 A;  3ZDT A;  4HAY B;  1LB1 A;  1XCG A;  2YS3 A;  4H8S A;  2UVM A;  3SUZ A;  3P7Z A;  2D9X A;  3P6A A;  2EMT A;  4GXB A;  1ZM0 A;  1KZ7 A;  3QBV B;  1X11 A;  2VRW B;  4A5K A;  4HAT B;  2RUK B;  3CXB B;  1UEF A;  1K5D B;  5D3W A;  2DYQ A;  1DDW A;  4GMX B;  1PFJ A;  4XWX A;  2COC A;  4C0A A;  1M7E A;  5KCV A;  2AEH A;  2YS5 A;  4D0N B;  2E2X A;  2D9Y A;  1PLS A;  1RRP B;  1ZVR A;  1IRS A;  1MK7 B;  5CLQ B;  1WJ1 A;  5C79 A;  3PVL A;  2MKR A;  1UPR A;  4B6H A;  3ODO A;  5DHA B;  2ROV A;  1WVH A;  1X86 A;  2D9Z A;  2KGX B;  2M38 A;  2GS0 A;  2K2J A;  5D3X A;  3QIJ A;  1X1F A;  5CLL B;  1U27 A;  2P0H A;  1Y19 B;  2DX1 A;  4A6F B;  2N23 A;  3ML4 A;  1U5E A;  2DHJ A;  2H7D A;  4HAZ B;  4KVG B;  4HAU B;  4K81 A;  2I1K A;  5DI9 B;  1FHO A;  3PEG A;  2D9W A;  4GMV A;  2COD A;  2UZS A;  3F0W A;  1LW3 A;  1U5D A;  2D4Q A;  2DHI A;  5HE1 A;  1ISN A;  1V61 A;  3FSS A;  4DBB A;  1UNR A;  3HK0 A;  3PP2 A;  4HAW B;  1W1H A;  3KRX A;  1FOE A;  4A6F A;  3KY9 A;  3DXD A;  3TO1 A;  4KHB B;  1WJM A;  2DLW A;  3KSY A;  4IFS A;  1DRO A;  1FB8 A;  1K5G B;  1E5W A;  4ZRJ A;  2X18 A;  1P6S A;  5JP4 A;  2G35 A;  1GC6 A;  3ULC A;  1WGU A;  2ELB A;  2DN6 A;  3GYO A;  2RVB B;  2ROZ B;  1AWE A;  1BAK A;  1DBH A;  3N7C A;  3WYF B;  2OTX A;  2YVC A;  1SHC A;  2W2X C;  4PQ0 A;  1ZC4 B;  1OY2 A;  3V5W A;  2DTC A;  1PMS A;  4WJ7 A;  2QKL A;  3O96 A;  1UNQ A;  5D3Y A;  2K00 A;  1MK9 B;  4K2O A;  1I7A A;  3PVU A;  4HHV A;  1J0W A;  5KQ4 A;  5HE2 A;  1U5G A;  1GG3 A;  1NI2 A;  3AU5 A;  1I2H A;  1XOD A;  3ODX A;  3FM8 C;  3M1I B;  4CHM A;  3IVF A;  3TVV A;  4Y94 A;  5EFX A;  2K2U A;  1U29 A;  1W1D A;  1EVH A;  2QKM A;  5HE0 A;  5D3V A;  5JHG A;  3CIK A;  2AL6 A;  2YSZ A;  1DYN A;  1FAO A;  3LJU X;  5D27 A;  4DX9 0;  2FJL A;  1EGX A;  5KQ1 A;  2MFQ A;  2COA A;  4YL8 A;  3UZT A;  2EMS A;  1AQC A;  4HDQ A;  3D8D A;  4DXA B;  2D10 A;  1TXD A;  4A6K A;  4F7H A;  1BWN A;  2LOZ A;  4HB2 B;  2ADZ A;  2GCJ A;  4DX8 A;  3VIA A;  3TCA A;  1XR0 B;  1QQG A;  3QWM A;  4Z2M B;  1V88 A;  4HB0 B;  2ZPY A;  4MT7 A;  3SO6 A;  1OMW A;  2CY5 A;  3A8Q A;  5DIF B;  5FI1 A;  1P5T A;  1V5P A;  1MAI A;  4PNK A;  3MDB C;  2CRF A;  1NU2 A;  3GYP A;  4ZRK A;  2COF A;  2N0Y A;  2KCJ A;  2HTH B;  5JHH A;  4A6H A;  4F7G A;  1V5U A;  2Q13 A;  2UZR A;  2DHK A;  3PVW A;  2IYB A;  2EC1 A;  1RJ2 A;  5DHF B;  2P8V A;  2R09 A;  2I1J A;  3AU4 A;  3A98 B;  5C5B B;  1V89 A;  3BIN A;  2YT1 A;  4MY6 A;  4TYZ A;  2IFS A;  3OAN A;  3DXE A;  2J0M A;  2XQN M;  1FGY A;  1EF1 A;  2J59 M;  1UNP A;  2M14 A;  2CAY A;  3SYX A;  3F5R A;  4L6E A;  4YON A;  2D11 A;  2GCL A;  2RSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...