1NTVA

Crystal structure of the disabled-1 (dab1) ptb domain-apoer2 peptide complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Disabled homolog 1
total genus 49
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntvA00
1WGQA 1KZ7A 5GOWB 2Z0PA 2CODA 3N7CA 5D27A 1K5DB 2H7DA 1X05A 1Z87A 2I5FA 2RSGA 4MT7A 2P0DA 1FOEA 2LYDA 5FI1A 3A8QA 3SUZA 3FEHA 1OMWA 1UPQA 1U29A 2M14A 1GC7A 5J3YA 1ZSQA 1W1HA 3RCPA 1DYNA 5C6RA 1MIZB 1OY2A 5JHGA 4HDOA 3PG7A 5HE2A 2Q13A 5D3XA 4KHAA 1K5GB 4EMOA 2G35A 1ZC4B 4KVGB 5KQ4A 1P5TA 2DX1A 2MWNB 1FGZA 3VOQA 3TVVA 4DX8A 5DH9B 3PVUA 2YRYA 3F5RA 2YS1A 1ZM0A 1MKEA 4C0AA 2Y8FA 2W2XC 5KCVA 5LONB 4GZUA 4A6KA 2YT1A 2W2WA 2W2XD 4A6HA 2XQNM 1V89A 2DHIA 5JHHA 3AJ4A 4A5KA 3KZ1A 4Y94A 2K2JA 3ULBA 1FB8A 2KGXB 1XD4A 2N23A 3VIAA 4CYEA 5D3VA 2D9VA 2H7EA 2DHKA 5JLJB 4CHJA 2P0HA 2YS3A 2NMBA 2DKPA 3D8FA 4GXBA 4L6EA 1XKEA 1WGUA 2CY5A 2V76A 3TW1A 1MK9B 2DN6A 2RVBB 1GG3A 3KRXA 2EC1A 3AU4A 1J19A 1EGXA 3P7ZA 4GPTB 2FJLA 1V5MA 2LOXA 4F7GA 3ZDTA 1ZC3B 5DHFB 4PQ0A 2BCJA 2Y8GA 2RLOA 1V5PA 3SYXA 1P3RA 2YF0A 1NTVA 4HAZB 1PFJA 3KY9A 1BTKA 1U5DA 3M1IB 4WJ7A 2D9YA 5KQ1A 5C5BA 3NSUA 4Z2NA 1I7AA 1V61A 1RJ2A 5FI0A 1DDMA 3KSYA 4HAYB 2J59M 2D4QA 4BBKA 3DXEA 1Y19B 1WJ1A 3HK0A 2JP2A 3OANA 2AEHA 1NTYA 2D9ZA 3G9WA 2I1KA 1FHWA 3D8EA 2D9WA 1N3HA 2DTCA 2M38A 2EMSA 1XODA 3PVWA 3A8PA 3ODWA 1WG7A 5HE0A 2DFKA 2ELAA 3HQCA 3X23A 2VSZA 3U8ZA 1GC6A 2COFA 2HE7A 2PZ1A 2J0MA 3PVLA 1EVHA 2GCJA 3GYPA 2X18A 1RRPB 2I1JA 3PSCA 5C79A 3BJIA 1MK7B 3U7DA 1WI1A 3SO6A 2VKIA 1B55A 2J0JA 1U5EA 3BINA 4GN1A 2MKRA 1WVHA 1BAKA 2K00A 4HATB 2YSZA 3QWMA 3FSSA 4PNKA 1QQGA 2RGNB 5J3TA 3UZTA 4NY0A 4K2OA 4K81A 1P6SA 1W1DA 2DHJA 2GCLA 3ULCA 2QKLA 4MY6A 1FHXA 5C5BB 2DYNA 4TKNA 2IYBA 2YT0A 1E5WA 2EMTA 4EJNA 4H8SA 4CHMA 2L1CA 4HAUB 2ELBA 1V88A 5HE3A 2DA0A 1UNRA 2MFQA 2GS0A 1FAOA 2L2IA 1SGHA 1V5UA 1XX0A 2YVCA 1BWNA 2VRWB 4NSWA 4HDQA 2KUPA 2LG1A 2OQBA 3A98B 5D3YA 1M7RA 1MPHA 5JP4A 3MDBC 1W1GA 1H4RA 2DKQA 2IFSA 1M7EA 1UPRA 1U27A 4TYZA 2I5CA 1ISNA 4HB2B 1H10A 2AL6A 2D2QA 3CIKA 5C16A 3WA0A 5L81A 1AQCA 2YS5A 1PLSA 2RUKB 1UEFA 2ROZB 5DHAB 4WSFA 1NU2A 5J3QA 3V5WA 1X11A 2D10A 4HB4B 3DXCA 2LULA 1IRSA 3PZDA 3ZVRA 3P6AA 2LOZA 5D3WA 4YONA 3PEGA 4EKUA 4KHBB 1MAIA 5LOPB 4ZRIA 3TCAA 2J0KA 1SHCA 1U5GA 1Y5OA 4IAPA 4HAWB 4YL8A 2CAYA 2UZRA 4XWXA 1U2BA 2P0FA 4MK0A 1KI1B 2EJ8A 1UNPA 3PP2A 4IOYX 3DXDA 1EAZA 1OQNA 4HHVA 3FM8C 5CLLB 2OTXA 1Q67A 1QC6A 4P7IA 1DDVA 2COCA 2COAA 3F0WA 5DI9B 1DDWA 3GYOA 3TFMA 4DXAB 2MDXA 1KZGA 1XR0B 5DIFB 3LJUX 4Z2MB 2P8VA 2R09A 4DBBA 3QBVB 2R0DA 4GMXB 1WJMA 2CRFA 1DBHA 2ADZA 4DX90 3IVFA 1LW3A 4HB0B 4KAXB 1X1GA 4D0NB 4A6FA 1X1FA 1LB1A 2Z0OA 2E2XA 3D8DA 4ZRJA 2CY4A 1FGYA 2NZ8B 2RNRB 3HW2B 1MIXA 1J0WA 2Z0QA 2GJYA 4F7UP 1AWEA 3WYFB 3T06A 4B6HA 2KCJA 1BTNA 3MPXA 3O96A 1UNQA 3ML4A 3KRWA 4HAXB 4K2PA 3ODXA 4KHOA 5CLQB 3AU5A 4HAVB 1TJ6A 4GMVA 1U5FA 1FHOA 2N0YA 2DYQA 1X86A 2QKMA 5HE1A 1EF1A 1NI2A 3CXBB 4F7HA 2Y7BA 4ZRKA 3SNHA 5EFXA 2UVMA 1TXDA 4K17A 2LKOA 4HB3B 2DX5A 4IFSA 3TO1A 1XCGA 3QIJA 1I2HA 4A6FB 1DROA 2HTHB 2K2UA 2ROVA 1ZVRA 2UZSA 2D9XA 3ODOA 3SV1A 2D11A 2ZPYA 1TQZA 1PMSA 4WVFB 2DLWA
chains in the Genus database with same CATH superfamily
1WGQA 1KZ7A 2GUMA 5GOWB 2Z0PA 2CODA 3N7CA 5D27A 1K5DB 2H7DA 1X05A 1Z87A 2I5FA 2RSGA 4MT7A 2P0DA 5I2MA 1FOEA 2LYDA 5FI1A 3A8QA 3SUZA 3FEHA 1OMWA 1UPQA 1U29A 2M14A 4DIXA 1GC7A 5J3YA 4D6WA 1ZSQA 1W1HA 3RCPA 1DYNA 5C6RA 1MIZB 1OY2A 3NWFA 5JHGA 4HDOA 3PG7A 5HE2A 4HSIA 2Q13A 5D3XA 4KHAA 1K5GB 4EMOA 2G35A 1ZC4B 4KVGB 5KQ4A 4OSNA 1P5TA 2DX1A 2MWNB 1FGZA 3VOQA 3TVVA 4DX8A 5DH9B 3PVUA 2YRYA 3F5RA 2YS1A 1ZM0A 1MKEA 4C0AA 2Y8FA 2W2XC 5KCVA 5LONB 4GZUA 3HIEA 4A6KA 2YT1A 2W2WA 2W2XD 4A6HA 2XQNM 1V89A 2DHIA 5JHHA 3AJ4A 4A5KA 3KZ1A 4Y94A 2K2JA 3ULBA 1FB8A 2KGXB 1XD4A 2N23A 3VIAA 4CYEA 5D3VA 2D9VA 2H7EA 2DHKA 5JLJB 4CHJA 2P0HA 2YS3A 5M4YB 2NMBA 2DKPA 3D8FA 4GXBA 4L6EA 1XKEA 3NW8A 1WGUA 2CY5A 2V76A 3TW1A 1MK9B 2DN6A 2RVBB 1GG3A 3KRXA 2EC1A 4QXAB 3AU4A 1J19A 1EGXA 3P7ZA 4GPTB 2FJLA 1V5MA 2LOXA 3NWDA 3ZDTA 1ZC3B 5DHFB 4F7GA 3U12A 4PQ0A 2BCJA 2Y8GA 2RLOA 1V5PA 3SYXA 1P3RA 2YF0A 1NTVA 4HAZB 1PFJA 3KY9A 3B77A 1BTKA 1U5DA 3M1IB 4WJ7A 2D9YA 5KQ1A 5C5BA 3NSUA 4Z2NA 1I7AA 1V61A 2K49A 1RJ2A 5FI0A 1DDMA 3KSYA 4HAYB 2J59M 2YT2A 2D4QA 4BBKA 3DXEA 2Z59A 1Y19B 1WJ1A 3HK0A 2JP2A 3NWAA 3OANA 2AEHA 1NTYA 2D9ZA 3G9WA 2I1KA 1FHWA 3D8EA 2D9WA 1N3HA 5LG4B 2DTCA 2M38A 2RRFA 4QJ3B 2EMSA 1XODA 3PVWA 3A8PA 3ODWA 1WG7A 5HE0A 2DFKA 2ELAA 3HQCA 3X23A 2VSZA 3U8ZA 4L1RA 1GC6A 2COFA 2HE7A 2PZ1A 2J0MA 3PVLA 5IRSA 1EVHA 2GCJA 3GYPA 2X18A 1RRPB 2I1JA 3PSCA 5C79A 3BJIA 1MK7B 3U7DA 1WI1A 3SO6A 2VKIA 1B55A 2J0JA 1U5EA 3BINA 4GN1A 2MKRA 1WVHA 1BAKA 3A58A 2K00A 2ZKMX 4HATB 2YSZA 3QWMA 3FSSA 4PNKA 1QQGA 2RGNB 5J3TA 3UZTA 2KUQA 4NY0A 4K2OA 4K81A 1P6SA 1W1DA 2DHJA 2GCLA 3ULCA 2QKLA 4MY6A 1FHXA 5C5BB 2DYNA 4TKNA 2IYBA 2YT0A 1E5WA 3HSAA 2EMTA 4EJNA 4H8SA 4CHMA 2L1CA 4HAUB 2ELBA 1V88A 5HE3A 2DA0A 1UNRA 2MFQA 2GS0A 1FAOA 2Z4DA 2L2IA 1SGHA 1V5UA 1XX0A 2YVCA 1BWNA 2VRWB 4NSWA 4HDQA 2KUPA 2LG1A 2OQBA 3A98B 5D3YA 1M7RA 4GNKB 1MPHA 5JP4A 3MDBC 1W1GA 1H4RA 1MI1A 2DKQA 2IFSA 1M7EA 1UPRA 1U27A 4TYZA 2I5CA 1ISNA 4HB2B 1H10A 2AL6A 2D2QA 3CIKA 4KHBA 5C16A 3WA0A 5L81A 1AQCA 2YS5A 1PLSA 2RUKB 1UEFA 2ROZB 5DHAB 4WSFA 1NU2A 5J3QA 3V5WA 1X11A 2D10A 4HB4B 3DXCA 2LULA 1IRSA 2K8EA 3PZDA 3ZVRA 3P6AA 2FJUB 2LOZA 5D3WA 4YONA 3PEGA 4EKUA 4KHBB 1MAIA 5LOPB 4ZRIA 3TCAA 2J0KA 1SHCA 1U5GA 1Y5OA 4IAPA 4HAWB 4YL8A 2CAYA 2UZRA 4XWXA 1U2BA 2P0FA 4MK0A 1KI1B 4GOUA 2EJ8A 1UNPA 3PP2A 4IOYX 2Z14A 2KR0A 4OT1A 3DXDA 5I2SA 1EAZA 2KIEA 1OQNA 4HHVA 3FM8C 2R2YA 5CLLB 2OTXA 1Q67A 1QC6A 4P7IA 1DDVA 2COCA 2COAA 3F0WA 5DI9B 1DDWA 3GYOA 3TFMA 4DXAB 2MDXA 1KZGA 1XR0B 5DIFB 3LJUX 4Z2MB 1ZYIA 2P8VA 2R09A 4DBBA 3QBVB 2R0DA 4GMXB 1WJMA 2NBVA 2CRFA 1DBHA 2ADZA 4DX90 3IVFA 1LW3A 4HB0B 4KAXB 1X1GA 4D0NB 4A6FA 1X1FA 1LB1A 4QJ5B 2Z0OA 2E2XA 3D8DA 4ZRJA 2CY4A 1FGYA 2NZ8B 2RNRB 3HW2B 1MIXA 1J0WA 2Z0QA 2GJYA 4F7UP 2Z13A 1AWEA 3WYFB 3T06A 4B6HA 2KCJA 1BTNA 3MPXA 3O96A 1UNQA 3ML4A 3KRWA 4HAXB 4K2PA 3ODXA 4KHOA 5CLQB 3AU5A 4HAVB 2KIGA 1TJ6A 4GMVA 1U5FA 1FHOA 2N0YA 2DYQA 1X86A 2QKMA 5HE1A 4CSQA 3OHMB 1EF1A 1NI2A 3CXBB 4F7HA 2Y7BA 4ZRKA 3SNHA 5EFXA 2UVMA 1TXDA 4K17A 2LKOA 4QJ4B 4HB3B 2DX5A 4IFSA 3TO1A 1XCGA 3DCXA 3QIJA 1I2HA 4A6FB 1DROA 2HTHB 2K2UA 3FVCA 2ROVA 1ZVRA 2UZSA 2D9XA 3ODOA 3SV1A 2D11A 2ZPYA 1T77A 1TQZA 1PMSA 4WVFB 2DLWA
chains in the Genus database with same CATH topology
1WGQA 1KZ7A 5GOWB 2Z0PA 2CODA 3N7CA 5D27A 1K5DB 2H7DA 1X05A 1Z87A 2I5FA 2RSGA 4MT7A 2P0DA 1FOEA 2LYDA 5FI1A 3A8QA 3SUZA 3FEHA 1OMWA 1UPQA 1U29A 2M14A 1GC7A 5J3YA 1ZSQA 1W1HA 3RCPA 1DYNA 5C6RA 1MIZB 1OY2A 5JHGA 4HDOA 3PG7A 5HE2A 2Q13A 5D3XA 4KHAA 1K5GB 4EMOA 2G35A 1ZC4B 4KVGB 5KQ4A 1P5TA 2DX1A 2MWNB 1FGZA 3VOQA 3TVVA 4DX8A 5DH9B 3PVUA 2YRYA 3F5RA 2YS1A 1ZM0A 1MKEA 4C0AA 2Y8FA 2W2XC 5KCVA 5LONB 4GZUA 4A6KA 2YT1A 2W2WA 2W2XD 4A6HA 2XQNM 1V89A 2DHIA 5JHHA 3AJ4A 4A5KA 3KZ1A 4Y94A 2K2JA 3ULBA 1FB8A 2KGXB 1XD4A 2N23A 3VIAA 4CYEA 5D3VA 2D9VA 2H7EA 2DHKA 5JLJB 4CHJA 2P0HA 2YS3A 2NMBA 2DKPA 3D8FA 4GXBA 4L6EA 1XKEA 1WGUA 2CY5A 2V76A 3TW1A 1MK9B 2DN6A 2RVBB 1GG3A 3KRXA 2EC1A 3AU4A 1J19A 1EGXA 3P7ZA 4GPTB 2FJLA 1V5MA 2LOXA 4F7GA 3ZDTA 1ZC3B 5DHFB 4PQ0A 2BCJA 2Y8GA 2RLOA 1V5PA 3SYXA 1P3RA 2YF0A 1NTVA 4HAZB 1PFJA 3KY9A 1BTKA 1U5DA 3M1IB 4WJ7A 2D9YA 5KQ1A 5C5BA 3NSUA 4Z2NA 1I7AA 1V61A 1RJ2A 5FI0A 1DDMA 3KSYA 4HAYB 2J59M 2D4QA 4BBKA 3DXEA 1Y19B 1WJ1A 3HK0A 2JP2A 3OANA 2AEHA 1NTYA 2D9ZA 3G9WA 2I1KA 1FHWA 3D8EA 2D9WA 1N3HA 2DTCA 2M38A 2EMSA 1XODA 3PVWA 3A8PA 3ODWA 1WG7A 5HE0A 2DFKA 2ELAA 3HQCA 3X23A 2VSZA 3U8ZA 1GC6A 2COFA 2HE7A 2PZ1A 2J0MA 3PVLA 1EVHA 2GCJA 3GYPA 2X18A 1RRPB 2I1JA 3PSCA 5C79A 3BJIA 1MK7B 3U7DA 1WI1A 3SO6A 2VKIA 1B55A 2J0JA 1U5EA 3BINA 4GN1A 2MKRA 1WVHA 1BAKA 2K00A 4HATB 2YSZA 3QWMA 3FSSA 4PNKA 1QQGA 2RGNB 5J3TA 3UZTA 4NY0A 4K2OA 4K81A 1P6SA 1W1DA 2DHJA 2GCLA 3ULCA 2QKLA 4MY6A 1FHXA 5C5BB 2DYNA 4TKNA 2IYBA 2YT0A 1E5WA 2EMTA 4EJNA 4H8SA 4CHMA 2L1CA 4HAUB 2ELBA 1V88A 5HE3A 2DA0A 1UNRA 2MFQA 2GS0A 1FAOA 2L2IA 1SGHA 1V5UA 1XX0A 2YVCA 1BWNA 2VRWB 4NSWA 4HDQA 2KUPA 2LG1A 2OQBA 3A98B 5D3YA 1M7RA 1MPHA 5JP4A 3MDBC 1W1GA 1H4RA 2DKQA 2IFSA 1M7EA 1UPRA 1U27A 4TYZA 2I5CA 1ISNA 4HB2B 1H10A 2AL6A 2D2QA 3CIKA 5C16A 3WA0A 5L81A 1AQCA 2YS5A 1PLSA 2RUKB 1UEFA 2ROZB 5DHAB 4WSFA 1NU2A 5J3QA 3V5WA 1X11A 2D10A 4HB4B 3DXCA 2LULA 1IRSA 3PZDA 3ZVRA 3P6AA 2LOZA 5D3WA 4YONA 3PEGA 4EKUA 4KHBB 1MAIA 5LOPB 4ZRIA 3TCAA 2J0KA 1SHCA 1U5GA 1Y5OA 4IAPA 4HAWB 4YL8A 2CAYA 2UZRA 4XWXA 1U2BA 2P0FA 4MK0A 1KI1B 2EJ8A 1UNPA 3PP2A 4IOYX 3DXDA 1EAZA 1OQNA 4HHVA 3FM8C 5CLLB 2OTXA 1Q67A 1QC6A 4P7IA 1DDVA 2COCA 2COAA 3F0WA 5DI9B 1DDWA 3GYOA 3TFMA 4DXAB 2MDXA 1KZGA 1XR0B 5DIFB 3LJUX 4Z2MB 2P8VA 2R09A 4DBBA 3QBVB 2R0DA 4GMXB 1WJMA 2CRFA 1DBHA 2ADZA 4DX90 3IVFA 1LW3A 4HB0B 4KAXB 1X1GA 4D0NB 4A6FA 1X1FA 1LB1A 2Z0OA 2E2XA 3D8DA 4ZRJA 2CY4A 1FGYA 2NZ8B 2RNRB 3HW2B 1MIXA 1J0WA 2Z0QA 2GJYA 4F7UP 1AWEA 3WYFB 3T06A 4B6HA 2KCJA 1BTNA 3MPXA 3O96A 1UNQA 3ML4A 3KRWA 4HAXB 4K2PA 3ODXA 4KHOA 5CLQB 3AU5A 4HAVB 1TJ6A 4GMVA 1U5FA 1FHOA 2N0YA 2DYQA 1X86A 2QKMA 5HE1A 1EF1A 1NI2A 3CXBB 4F7HA 2Y7BA 4ZRKA 3SNHA 5EFXA 2UVMA 1TXDA 4K17A 2LKOA 4HB3B 2DX5A 4IFSA 3TO1A 1XCGA 3QIJA 1I2HA 4A6FB 1DROA 2HTHB 2K2UA 2ROVA 1ZVRA 2UZSA 2D9XA 3ODOA 3SV1A 2D11A 2ZPYA 1TQZA 1PMSA 4WVFB 2DLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGQ A;  1KZ7 A;  5GOW B;  2Z0P A;  2COD A;  3N7C A;  5D27 A;  1K5D B;  2H7D A;  1X05 A;  1Z87 A;  2I5F A;  2RSG A;  4MT7 A;  2P0D A;  1FOE A;  2LYD A;  5FI1 A;  3A8Q A;  3SUZ A;  3FEH A;  1OMW A;  1UPQ A;  1U29 A;  2M14 A;  1GC7 A;  5J3Y A;  1ZSQ A;  1W1H A;  3RCP A;  1DYN A;  5C6R A;  1MIZ B;  1OY2 A;  5JHG A;  4HDO A;  3PG7 A;  5HE2 A;  2Q13 A;  5D3X A;  4KHA A;  1K5G B;  4EMO A;  2G35 A;  1ZC4 B;  4KVG B;  5KQ4 A;  1P5T A;  2DX1 A;  2MWN B;  1FGZ A;  3VOQ A;  3TVV A;  4DX8 A;  5DH9 B;  3PVU A;  2YRY A;  3F5R A;  2YS1 A;  1ZM0 A;  1MKE A;  4C0A A;  2Y8F A;  2W2X C;  5KCV A;  5LON B;  4GZU A;  4A6K A;  2YT1 A;  2W2W A;  2W2X D;  4A6H A;  2XQN M;  1V89 A;  2DHI A;  5JHH A;  3AJ4 A;  4A5K A;  3KZ1 A;  4Y94 A;  2K2J A;  3ULB A;  1FB8 A;  2KGX B;  1XD4 A;  2N23 A;  3VIA A;  4CYE A;  5D3V A;  2D9V A;  2H7E A;  2DHK A;  5JLJ B;  4CHJ A;  2P0H A;  2YS3 A;  2NMB A;  2DKP A;  3D8F A;  4GXB A;  4L6E A;  1XKE A;  1WGU A;  2CY5 A;  2V76 A;  3TW1 A;  1MK9 B;  2DN6 A;  2RVB B;  1GG3 A;  3KRX A;  2EC1 A;  3AU4 A;  1J19 A;  1EGX A;  3P7Z A;  4GPT B;  2FJL A;  1V5M A;  2LOX A;  4F7G A;  3ZDT A;  1ZC3 B;  5DHF B;  4PQ0 A;  2BCJ A;  2Y8G A;  2RLO A;  1V5P A;  3SYX A;  1P3R A;  2YF0 A;  1NTV A;  4HAZ B;  1PFJ A;  3KY9 A;  1BTK A;  1U5D A;  3M1I B;  4WJ7 A;  2D9Y A;  5KQ1 A;  5C5B A;  3NSU A;  4Z2N A;  1I7A A;  1V61 A;  1RJ2 A;  5FI0 A;  1DDM A;  3KSY A;  4HAY B;  2J59 M;  2D4Q A;  4BBK A;  3DXE A;  1Y19 B;  1WJ1 A;  3HK0 A;  2JP2 A;  3OAN A;  2AEH A;  1NTY A;  2D9Z A;  3G9W A;  2I1K A;  1FHW A;  3D8E A;  2D9W A;  1N3H A;  2DTC A;  2M38 A;  2EMS A;  1XOD A;  3PVW A;  3A8P A;  3ODW A;  1WG7 A;  5HE0 A;  2DFK A;  2ELA A;  3HQC A;  3X23 A;  2VSZ A;  3U8Z A;  1GC6 A;  2COF A;  2HE7 A;  2PZ1 A;  2J0M A;  3PVL A;  1EVH A;  2GCJ A;  3GYP A;  2X18 A;  1RRP B;  2I1J A;  3PSC A;  5C79 A;  3BJI A;  1MK7 B;  3U7D A;  1WI1 A;  3SO6 A;  2VKI A;  1B55 A;  2J0J A;  1U5E A;  3BIN A;  4GN1 A;  2MKR A;  1WVH A;  1BAK A;  2K00 A;  4HAT B;  2YSZ A;  3QWM A;  3FSS A;  4PNK A;  1QQG A;  2RGN B;  5J3T A;  3UZT A;  4NY0 A;  4K2O A;  4K81 A;  1P6S A;  1W1D A;  2DHJ A;  2GCL A;  3ULC A;  2QKL A;  4MY6 A;  1FHX A;  5C5B B;  2DYN A;  4TKN A;  2IYB A;  2YT0 A;  1E5W A;  2EMT A;  4EJN A;  4H8S A;  4CHM A;  2L1C A;  4HAU B;  2ELB A;  1V88 A;  5HE3 A;  2DA0 A;  1UNR A;  2MFQ A;  2GS0 A;  1FAO A;  2L2I A;  1SGH A;  1V5U A;  1XX0 A;  2YVC A;  1BWN A;  2VRW B;  4NSW A;  4HDQ A;  2KUP A;  2LG1 A;  2OQB A;  3A98 B;  5D3Y A;  1M7R A;  1MPH A;  5JP4 A;  3MDB C;  1W1G A;  1H4R A;  2DKQ A;  2IFS A;  1M7E A;  1UPR A;  1U27 A;  4TYZ A;  2I5C A;  1ISN A;  4HB2 B;  1H10 A;  2AL6 A;  2D2Q A;  3CIK A;  5C16 A;  3WA0 A;  5L81 A;  1AQC A;  2YS5 A;  1PLS A;  2RUK B;  1UEF A;  2ROZ B;  5DHA B;  4WSF A;  1NU2 A;  5J3Q A;  3V5W A;  1X11 A;  2D10 A;  4HB4 B;  3DXC A;  2LUL A;  1IRS A;  3PZD A;  3ZVR A;  3P6A A;  2LOZ A;  5D3W A;  4YON A;  3PEG A;  4EKU A;  4KHB B;  1MAI A;  5LOP B;  4ZRI A;  3TCA A;  2J0K A;  1SHC A;  1U5G A;  1Y5O A;  4IAP A;  4HAW B;  4YL8 A;  2CAY A;  2UZR A;  4XWX A;  1U2B A;  2P0F A;  4MK0 A;  1KI1 B;  2EJ8 A;  1UNP A;  3PP2 A;  4IOY X;  3DXD A;  1EAZ A;  1OQN A;  4HHV A;  3FM8 C;  5CLL B;  2OTX A;  1Q67 A;  1QC6 A;  4P7I A;  1DDV A;  2COC A;  2COA A;  3F0W A;  5DI9 B;  1DDW A;  3GYO A;  3TFM A;  4DXA B;  2MDX A;  1KZG A;  1XR0 B;  5DIF B;  3LJU X;  4Z2M B;  2P8V A;  2R09 A;  4DBB A;  3QBV B;  2R0D A;  4GMX B;  1WJM A;  2CRF A;  1DBH A;  2ADZ A;  4DX9 0;  3IVF A;  1LW3 A;  4HB0 B;  4KAX B;  1X1G A;  4D0N B;  4A6F A;  1X1F A;  1LB1 A;  2Z0O A;  2E2X A;  3D8D A;  4ZRJ A;  2CY4 A;  1FGY A;  2NZ8 B;  2RNR B;  3HW2 B;  1MIX A;  1J0W A;  2Z0Q A;  2GJY A;  4F7U P;  1AWE A;  3WYF B;  3T06 A;  4B6H A;  2KCJ A;  1BTN A;  3MPX A;  3O96 A;  1UNQ A;  3ML4 A;  3KRW A;  4HAX B;  4K2P A;  3ODX A;  4KHO A;  5CLQ B;  3AU5 A;  4HAV B;  1TJ6 A;  4GMV A;  1U5F A;  1FHO A;  2N0Y A;  2DYQ A;  1X86 A;  2QKM A;  5HE1 A;  1EF1 A;  1NI2 A;  3CXB B;  4F7H A;  2Y7B A;  4ZRK A;  3SNH A;  5EFX A;  2UVM A;  1TXD A;  4K17 A;  2LKO A;  4HB3 B;  2DX5 A;  4IFS A;  3TO1 A;  1XCG A;  3QIJ A;  1I2H A;  4A6F B;  1DRO A;  2HTH B;  2K2U A;  2ROV A;  1ZVR A;  2UZS A;  2D9X A;  3ODO A;  3SV1 A;  2D11 A;  2ZPY A;  1TQZ A;  1PMS A;  4WVF B;  2DLW A; 
#chains in the Genus database with same CATH topology
 1WGQ A;  1KZ7 A;  2GUM A;  5GOW B;  2Z0P A;  2COD A;  3N7C A;  5D27 A;  1K5D B;  2H7D A;  1X05 A;  1Z87 A;  2I5F A;  2RSG A;  4MT7 A;  2P0D A;  5I2M A;  1FOE A;  2LYD A;  5FI1 A;  3A8Q A;  3SUZ A;  3FEH A;  1OMW A;  1UPQ A;  1U29 A;  2M14 A;  4DIX A;  1GC7 A;  5J3Y A;  4D6W A;  1ZSQ A;  1W1H A;  3RCP A;  1DYN A;  5C6R A;  1MIZ B;  1OY2 A;  3NWF A;  5JHG A;  4HDO A;  3PG7 A;  5HE2 A;  4HSI A;  2Q13 A;  5D3X A;  4KHA A;  1K5G B;  4EMO A;  2G35 A;  1ZC4 B;  4KVG B;  5KQ4 A;  4OSN A;  1P5T A;  2DX1 A;  2MWN B;  1FGZ A;  3VOQ A;  3TVV A;  4DX8 A;  5DH9 B;  3PVU A;  2YRY A;  3F5R A;  2YS1 A;  1ZM0 A;  1MKE A;  4C0A A;  2Y8F A;  2W2X C;  5KCV A;  5LON B;  4GZU A;  3HIE A;  4A6K A;  2YT1 A;  2W2W A;  2W2X D;  4A6H A;  2XQN M;  1V89 A;  2DHI A;  5JHH A;  3AJ4 A;  4A5K A;  3KZ1 A;  4Y94 A;  2K2J A;  3ULB A;  1FB8 A;  2KGX B;  1XD4 A;  2N23 A;  3VIA A;  4CYE A;  5D3V A;  2D9V A;  2H7E A;  2DHK A;  5JLJ B;  4CHJ A;  2P0H A;  2YS3 A;  5M4Y B;  2NMB A;  2DKP A;  3D8F A;  4GXB A;  4L6E A;  1XKE A;  3NW8 A;  1WGU A;  2CY5 A;  2V76 A;  3TW1 A;  1MK9 B;  2DN6 A;  2RVB B;  1GG3 A;  3KRX A;  2EC1 A;  4QXA B;  3AU4 A;  1J19 A;  1EGX A;  3P7Z A;  4GPT B;  2FJL A;  1V5M A;  2LOX A;  3NWD A;  3ZDT A;  1ZC3 B;  5DHF B;  4F7G A;  3U12 A;  4PQ0 A;  2BCJ A;  2Y8G A;  2RLO A;  1V5P A;  3SYX A;  1P3R A;  2YF0 A;  1NTV A;  4HAZ B;  1PFJ A;  3KY9 A;  3B77 A;  1BTK A;  1U5D A;  3M1I B;  4WJ7 A;  2D9Y A;  5KQ1 A;  5C5B A;  3NSU A;  4Z2N A;  1I7A A;  1V61 A;  2K49 A;  1RJ2 A;  5FI0 A;  1DDM A;  3KSY A;  4HAY B;  2J59 M;  2YT2 A;  2D4Q A;  4BBK A;  3DXE A;  2Z59 A;  1Y19 B;  1WJ1 A;  3HK0 A;  2JP2 A;  3NWA A;  3OAN A;  2AEH A;  1NTY A;  2D9Z A;  3G9W A;  2I1K A;  1FHW A;  3D8E A;  2D9W A;  1N3H A;  5LG4 B;  2DTC A;  2M38 A;  2RRF A;  4QJ3 B;  2EMS A;  1XOD A;  3PVW A;  3A8P A;  3ODW A;  1WG7 A;  5HE0 A;  2DFK A;  2ELA A;  3HQC A;  3X23 A;  2VSZ A;  3U8Z A;  4L1R A;  1GC6 A;  2COF A;  2HE7 A;  2PZ1 A;  2J0M A;  3PVL A;  5IRS A;  1EVH A;  2GCJ A;  3GYP A;  2X18 A;  1RRP B;  2I1J A;  3PSC A;  5C79 A;  3BJI A;  1MK7 B;  3U7D A;  1WI1 A;  3SO6 A;  2VKI A;  1B55 A;  2J0J A;  1U5E A;  3BIN A;  4GN1 A;  2MKR A;  1WVH A;  1BAK A;  3A58 A;  2K00 A;  2ZKM X;  4HAT B;  2YSZ A;  3QWM A;  3FSS A;  4PNK A;  1QQG A;  2RGN B;  5J3T A;  3UZT A;  2KUQ A;  4NY0 A;  4K2O A;  4K81 A;  1P6S A;  1W1D A;  2DHJ A;  2GCL A;  3ULC A;  2QKL A;  4MY6 A;  1FHX A;  5C5B B;  2DYN A;  4TKN A;  2IYB A;  2YT0 A;  1E5W A;  3HSA A;  2EMT A;  4EJN A;  4H8S A;  4CHM A;  2L1C A;  4HAU B;  2ELB A;  1V88 A;  5HE3 A;  2DA0 A;  1UNR A;  2MFQ A;  2GS0 A;  1FAO A;  2Z4D A;  2L2I A;  1SGH A;  1V5U A;  1XX0 A;  2YVC A;  1BWN A;  2VRW B;  4NSW A;  4HDQ A;  2KUP A;  2LG1 A;  2OQB A;  3A98 B;  5D3Y A;  1M7R A;  4GNK B;  1MPH A;  5JP4 A;  3MDB C;  1W1G A;  1H4R A;  1MI1 A;  2DKQ A;  2IFS A;  1M7E A;  1UPR A;  1U27 A;  4TYZ A;  2I5C A;  1ISN A;  4HB2 B;  1H10 A;  2AL6 A;  2D2Q A;  3CIK A;  4KHB A;  5C16 A;  3WA0 A;  5L81 A;  1AQC A;  2YS5 A;  1PLS A;  2RUK B;  1UEF A;  2ROZ B;  5DHA B;  4WSF A;  1NU2 A;  5J3Q A;  3V5W A;  1X11 A;  2D10 A;  4HB4 B;  3DXC A;  2LUL A;  1IRS A;  2K8E A;  3PZD A;  3ZVR A;  3P6A A;  2FJU B;  2LOZ A;  5D3W A;  4YON A;  3PEG A;  4EKU A;  4KHB B;  1MAI A;  5LOP B;  4ZRI A;  3TCA A;  2J0K A;  1SHC A;  1U5G A;  1Y5O A;  4IAP A;  4HAW B;  4YL8 A;  2CAY A;  2UZR A;  4XWX A;  1U2B A;  2P0F A;  4MK0 A;  1KI1 B;  4GOU A;  2EJ8 A;  1UNP A;  3PP2 A;  4IOY X;  2Z14 A;  2KR0 A;  4OT1 A;  3DXD A;  5I2S A;  1EAZ A;  2KIE A;  1OQN A;  4HHV A;  3FM8 C;  2R2Y A;  5CLL B;  2OTX A;  1Q67 A;  1QC6 A;  4P7I A;  1DDV A;  2COC A;  2COA A;  3F0W A;  5DI9 B;  1DDW A;  3GYO A;  3TFM A;  4DXA B;  2MDX A;  1KZG A;  1XR0 B;  5DIF B;  3LJU X;  4Z2M B;  1ZYI A;  2P8V A;  2R09 A;  4DBB A;  3QBV B;  2R0D A;  4GMX B;  1WJM A;  2NBV A;  2CRF A;  1DBH A;  2ADZ A;  4DX9 0;  3IVF A;  1LW3 A;  4HB0 B;  4KAX B;  1X1G A;  4D0N B;  4A6F A;  1X1F A;  1LB1 A;  4QJ5 B;  2Z0O A;  2E2X A;  3D8D A;  4ZRJ A;  2CY4 A;  1FGY A;  2NZ8 B;  2RNR B;  3HW2 B;  1MIX A;  1J0W A;  2Z0Q A;  2GJY A;  4F7U P;  2Z13 A;  1AWE A;  3WYF B;  3T06 A;  4B6H A;  2KCJ A;  1BTN A;  3MPX A;  3O96 A;  1UNQ A;  3ML4 A;  3KRW A;  4HAX B;  4K2P A;  3ODX A;  4KHO A;  5CLQ B;  3AU5 A;  4HAV B;  2KIG A;  1TJ6 A;  4GMV A;  1U5F A;  1FHO A;  2N0Y A;  2DYQ A;  1X86 A;  2QKM A;  5HE1 A;  4CSQ A;  3OHM B;  1EF1 A;  1NI2 A;  3CXB B;  4F7H A;  2Y7B A;  4ZRK A;  3SNH A;  5EFX A;  2UVM A;  1TXD A;  4K17 A;  2LKO A;  4QJ4 B;  4HB3 B;  2DX5 A;  4IFS A;  3TO1 A;  1XCG A;  3DCX A;  3QIJ A;  1I2H A;  4A6F B;  1DRO A;  2HTH B;  2K2U A;  3FVC A;  2ROV A;  1ZVR A;  2UZS A;  2D9X A;  3ODO A;  3SV1 A;  2D11 A;  2ZPY A;  1T77 A;  1TQZ A;  1PMS A;  4WVF B;  2DLW A; 
#chains in the Genus database with same CATH homology
 1WGQ A;  1KZ7 A;  5GOW B;  2Z0P A;  2COD A;  3N7C A;  5D27 A;  1K5D B;  2H7D A;  1X05 A;  1Z87 A;  2I5F A;  2RSG A;  4MT7 A;  2P0D A;  1FOE A;  2LYD A;  5FI1 A;  3A8Q A;  3SUZ A;  3FEH A;  1OMW A;  1UPQ A;  1U29 A;  2M14 A;  1GC7 A;  5J3Y A;  1ZSQ A;  1W1H A;  3RCP A;  1DYN A;  5C6R A;  1MIZ B;  1OY2 A;  5JHG A;  4HDO A;  3PG7 A;  5HE2 A;  2Q13 A;  5D3X A;  4KHA A;  1K5G B;  4EMO A;  2G35 A;  1ZC4 B;  4KVG B;  5KQ4 A;  1P5T A;  2DX1 A;  2MWN B;  1FGZ A;  3VOQ A;  3TVV A;  4DX8 A;  5DH9 B;  3PVU A;  2YRY A;  3F5R A;  2YS1 A;  1ZM0 A;  1MKE A;  4C0A A;  2Y8F A;  2W2X C;  5KCV A;  5LON B;  4GZU A;  4A6K A;  2YT1 A;  2W2W A;  2W2X D;  4A6H A;  2XQN M;  1V89 A;  2DHI A;  5JHH A;  3AJ4 A;  4A5K A;  3KZ1 A;  4Y94 A;  2K2J A;  3ULB A;  1FB8 A;  2KGX B;  1XD4 A;  2N23 A;  3VIA A;  4CYE A;  5D3V A;  2D9V A;  2H7E A;  2DHK A;  5JLJ B;  4CHJ A;  2P0H A;  2YS3 A;  2NMB A;  2DKP A;  3D8F A;  4GXB A;  4L6E A;  1XKE A;  1WGU A;  2CY5 A;  2V76 A;  3TW1 A;  1MK9 B;  2DN6 A;  2RVB B;  1GG3 A;  3KRX A;  2EC1 A;  3AU4 A;  1J19 A;  1EGX A;  3P7Z A;  4GPT B;  2FJL A;  1V5M A;  2LOX A;  4F7G A;  3ZDT A;  1ZC3 B;  5DHF B;  4PQ0 A;  2BCJ A;  2Y8G A;  2RLO A;  1V5P A;  3SYX A;  1P3R A;  2YF0 A;  1NTV A;  4HAZ B;  1PFJ A;  3KY9 A;  1BTK A;  1U5D A;  3M1I B;  4WJ7 A;  2D9Y A;  5KQ1 A;  5C5B A;  3NSU A;  4Z2N A;  1I7A A;  1V61 A;  1RJ2 A;  5FI0 A;  1DDM A;  3KSY A;  4HAY B;  2J59 M;  2D4Q A;  4BBK A;  3DXE A;  1Y19 B;  1WJ1 A;  3HK0 A;  2JP2 A;  3OAN A;  2AEH A;  1NTY A;  2D9Z A;  3G9W A;  2I1K A;  1FHW A;  3D8E A;  2D9W A;  1N3H A;  2DTC A;  2M38 A;  2EMS A;  1XOD A;  3PVW A;  3A8P A;  3ODW A;  1WG7 A;  5HE0 A;  2DFK A;  2ELA A;  3HQC A;  3X23 A;  2VSZ A;  3U8Z A;  1GC6 A;  2COF A;  2HE7 A;  2PZ1 A;  2J0M A;  3PVL A;  1EVH A;  2GCJ A;  3GYP A;  2X18 A;  1RRP B;  2I1J A;  3PSC A;  5C79 A;  3BJI A;  1MK7 B;  3U7D A;  1WI1 A;  3SO6 A;  2VKI A;  1B55 A;  2J0J A;  1U5E A;  3BIN A;  4GN1 A;  2MKR A;  1WVH A;  1BAK A;  2K00 A;  4HAT B;  2YSZ A;  3QWM A;  3FSS A;  4PNK A;  1QQG A;  2RGN B;  5J3T A;  3UZT A;  4NY0 A;  4K2O A;  4K81 A;  1P6S A;  1W1D A;  2DHJ A;  2GCL A;  3ULC A;  2QKL A;  4MY6 A;  1FHX A;  5C5B B;  2DYN A;  4TKN A;  2IYB A;  2YT0 A;  1E5W A;  2EMT A;  4EJN A;  4H8S A;  4CHM A;  2L1C A;  4HAU B;  2ELB A;  1V88 A;  5HE3 A;  2DA0 A;  1UNR A;  2MFQ A;  2GS0 A;  1FAO A;  2L2I A;  1SGH A;  1V5U A;  1XX0 A;  2YVC A;  1BWN A;  2VRW B;  4NSW A;  4HDQ A;  2KUP A;  2LG1 A;  2OQB A;  3A98 B;  5D3Y A;  1M7R A;  1MPH A;  5JP4 A;  3MDB C;  1W1G A;  1H4R A;  2DKQ A;  2IFS A;  1M7E A;  1UPR A;  1U27 A;  4TYZ A;  2I5C A;  1ISN A;  4HB2 B;  1H10 A;  2AL6 A;  2D2Q A;  3CIK A;  5C16 A;  3WA0 A;  5L81 A;  1AQC A;  2YS5 A;  1PLS A;  2RUK B;  1UEF A;  2ROZ B;  5DHA B;  4WSF A;  1NU2 A;  5J3Q A;  3V5W A;  1X11 A;  2D10 A;  4HB4 B;  3DXC A;  2LUL A;  1IRS A;  3PZD A;  3ZVR A;  3P6A A;  2LOZ A;  5D3W A;  4YON A;  3PEG A;  4EKU A;  4KHB B;  1MAI A;  5LOP B;  4ZRI A;  3TCA A;  2J0K A;  1SHC A;  1U5G A;  1Y5O A;  4IAP A;  4HAW B;  4YL8 A;  2CAY A;  2UZR A;  4XWX A;  1U2B A;  2P0F A;  4MK0 A;  1KI1 B;  2EJ8 A;  1UNP A;  3PP2 A;  4IOY X;  3DXD A;  1EAZ A;  1OQN A;  4HHV A;  3FM8 C;  5CLL B;  2OTX A;  1Q67 A;  1QC6 A;  4P7I A;  1DDV A;  2COC A;  2COA A;  3F0W A;  5DI9 B;  1DDW A;  3GYO A;  3TFM A;  4DXA B;  2MDX A;  1KZG A;  1XR0 B;  5DIF B;  3LJU X;  4Z2M B;  2P8V A;  2R09 A;  4DBB A;  3QBV B;  2R0D A;  4GMX B;  1WJM A;  2CRF A;  1DBH A;  2ADZ A;  4DX9 0;  3IVF A;  1LW3 A;  4HB0 B;  4KAX B;  1X1G A;  4D0N B;  4A6F A;  1X1F A;  1LB1 A;  2Z0O A;  2E2X A;  3D8D A;  4ZRJ A;  2CY4 A;  1FGY A;  2NZ8 B;  2RNR B;  3HW2 B;  1MIX A;  1J0W A;  2Z0Q A;  2GJY A;  4F7U P;  1AWE A;  3WYF B;  3T06 A;  4B6H A;  2KCJ A;  1BTN A;  3MPX A;  3O96 A;  1UNQ A;  3ML4 A;  3KRW A;  4HAX B;  4K2P A;  3ODX A;  4KHO A;  5CLQ B;  3AU5 A;  4HAV B;  1TJ6 A;  4GMV A;  1U5F A;  1FHO A;  2N0Y A;  2DYQ A;  1X86 A;  2QKM A;  5HE1 A;  1EF1 A;  1NI2 A;  3CXB B;  4F7H A;  2Y7B A;  4ZRK A;  3SNH A;  5EFX A;  2UVM A;  1TXD A;  4K17 A;  2LKO A;  4HB3 B;  2DX5 A;  4IFS A;  3TO1 A;  1XCG A;  3QIJ A;  1I2H A;  4A6F B;  1DRO A;  2HTH B;  2K2U A;  2ROV A;  1ZVR A;  2UZS A;  2D9X A;  3ODO A;  3SV1 A;  2D11 A;  2ZPY A;  1TQZ A;  1PMS A;  4WVF B;  2DLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...