1NTVA

Crystal structure of the disabled-1 (dab1) ptb domain-apoer2 peptide complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 1
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 49
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntvA00
5FI1A 1EVHA 2COFA 5DI9B 1W1DA 1DDMA 3PEGA 1MAIA 5C16A 1SGHA 5LONB 4YONA 1XR0B 4TKNA 1WGUA 2JP2A 5JHGA 2J0JA 2GS0A 2DA0A 3PVWA 4HHVA 5EFXA 4DXAB 1H4RA 2DYNA 5KQ4A 3AU4A 3FSSA 4KVGB 2COAA 4GXBA 4A6FA 3SYXA 2D4QA 4WSFA 2I1JA 1UNPA 3V5WA 2L2IA 5J3QA 1BTNA 4HAXB 2UZRA 2VSZA 1QC6A 2DYQA 4K2PA 2Z0OA 5LOPB 2K00A 3NSUA 4EKUA 4DX90 1OMWA 1Z87A 1NTYA 1MIXA 3GYPA 1PMSA 1X11A 2IYBA 1ZC4B 1XCGA 2D9ZA 2R0DA 4HATB 3GYOA 2Z0PA 5L81A 1E5WA 3QWMA 1W1HA 3AU5A 2YVCA 3F5RA 4B6HA 2R09A 2UVMA 2YT0A 2I1KA 1M7RA 2P0DA 3KRXA 5FI0A 4HAVB 3SUZA 3U7DA 1FAOA 4HAWB 1PLSA 3F0WA 3MDBC 1SHCA 2J59M 4A6HA 3VIAA 3FEHA 2ELBA 3A8QA 1PFJA 3TO1A 5D27A 3X23A 5C6RA 2MKRA 2KUPA 2LG1A 1MPHA 1ZC3B 3WA0A 5JLJB 1LW3A 2EMSA 4GZUA 1K5GB 1NU2A 4MT7A 4TYZA 1FHXA 1UNRA 1DDVA 4MK0A 2M38A 2G35A 3G9WA 2ROZB 5C79A 2LYDA 3ZVRA 2DTCA 1MK9B 4EJNA 1GC6A 3ODOA 1FGZA 3HQCA 4DX8A 1FHWA 3HW2B 1GG3A 2OQBA 4HAZB 1LB1A 2XQNM 3TCAA 2EMTA 2GJYA 2DHIA 4F7UP 2D9VA 1KZ7A 2YS1A 5D3VA 2CODA 3M1IB 4GMXB 3PVLA 4NSWA 1EF1A 2RSGA 3ULCA 1UNQA 1ZM0A 3HK0A 3TFMA 1V89A 1AQCA 3ULBA 4WJ7A 3RCPA 1K5DB 2PZ1A 3KZ1A 3N7CA 2D10A 2ROVA 2UZSA 5GOWB 4A5KA 4GN1A 1XX0A 1KI1B 3SV1A 2HTHB 3CIKA 2IFSA 2DX1A 2DHKA 1MIZB 2Z0QA 2DKPA 1U5EA 1NI2A 4PNKA 1WJMA 1RRPB 3DXCA 1WG7A 2ZPYA 2GCJA 3OANA 2I5FA 5D3XA 1TXDA 4CYEA 2W2XD 1EAZA 2CY5A 2YSZA 4HDOA 2LOXA 4YL8A 3A8PA 1IRSA 3PVUA 2VRWB 5HE0A 1P3RA 2N0YA 4HB2B 1U29A 3CXBB 1I7AA 1KZGA 2GCLA 1X86A 4NY0A 1Q67A 1MKEA 3DXDA 4C0AA 4GPTB 3TW1A 3KRWA 1NTVA 2Y8FA 2I5CA 5DHAB 2DX5A 3D8FA 2YT1A 5HE3A 4IOYX 4CHMA 1FGYA 1XKEA 2N23A 5J3YA 3P6AA 1UPRA 1XODA 2MWNB 1GC7A 4F7HA 1V88A 1DDWA 3DXEA 1N3HA 3PG7A 2NZ8B 3QBVB 4HB0B 2W2WA 3O96A 3A98B 3ML4A 2K2UA 2NMBA 1W1GA 4PQ0A 3QIJA 2LULA 2VKIA 1QQGA 5D3WA 4KHBB 3TVVA 2YS5A 1XD4A 1Y5OA 2P0FA 3D8DA 2HE7A 4Z2MB 1AWEA 3LJUX 1V5UA 2LOZA 2K2JA 3KY9A 5KCVA 2DN6A 5CLQB 2V76A 3PP2A 3VOQA 4L6EA 2DLWA 1ISNA 3SNHA 3IVFA 4HB3B 2YS3A 2KGXB 1DROA 2CY4A 1Y19B 5J3TA 4DBBA 4K81A 1OY2A 1RJ2A 5DHFB 2DHJA 2MDXA 5HE2A 3D8EA 1OQNA 1WI1A 2RNRB 1WGQA 2LKOA 1BTKA 3PSCA 2D11A 4ZRKA 5KQ1A 1UPQA 2KCJA 1MK7B 2Q13A 3ODWA 2CRFA 4ZRJA 3PZDA 2ADZA 4KAXB 2RLOA 4Y94A 1BWNA 2H7EA 1H10A 1TQZA 3BJIA 4IAPA 2FJLA 2RGNB 1V61A 4BBKA 1ZVRA 4P7IA 3T06A 4KHOA 4WVFB 4F7GA 4HB4B 4D0NB 4KHAA 1U5GA 5DH9B 4XWXA 2ELAA 1M7EA 1J19A 4MY6A 5CLLB 2RUKB 1DYNA 1EGXA 4Z2NA 2AL6A 2DKQA 5D3YA 1V5MA 2D9XA 2D2QA 5HE1A 1DBHA 1U27A 1U5FA 2D9WA 2COCA 5C5BB 3UZTA 2E2XA 2BCJA 4K2OA 2MFQA 2QKLA 1P5TA 3SO6A 1B55A 1X05A 3ZDTA 1WJ1A 2YF0A 2J0KA 3MPXA 3BINA 4HAUB 1ZSQA 4EMOA 2Y7BA 2YRYA 1UEFA 1FOEA 1U5DA 1X1GA 3P7ZA 4ZRIA 3U8ZA 3WYFB 2AEHA 4K17A 2X18A 1WVHA 2OTXA 1TJ6A 2D9YA 3AJ4A 1FB8A 1V5PA 2Y8GA 2DFKA 2RVBB 4IFSA 2J0MA 2M14A 3FM8C 1BAKA 1P6SA 2QKMA 5JP4A 2P8VA 5JHHA 3KSYA 1I2HA 5C5BA 1U2BA 1FHOA 2H7DA 2EJ8A 4HDQA 4H8SA 4A6FB 3ODXA 4HAYB 2CAYA 1J0WA 4CHJA 2W2XC 2EC1A 5DIFB 1X1FA 4GMVA 4A6KA 2L1CA 2P0HA
chains in the Genus database with same CATH superfamily
5FI1A 1EVHA 2COFA 5DI9B 1W1DA 1DDMA 3PEGA 1MAIA 5C16A 1SGHA 5LONB 4YONA 1XR0B 4TKNA 1WGUA 2JP2A 2Z14A 5JHGA 2J0JA 4OSNA 2GS0A 2DA0A 3PVWA 4HHVA 5EFXA 4DXAB 1H4RA 2DYNA 5I2MA 5KQ4A 2NBVA 3AU4A 1MI1A 1T77A 3FSSA 2KIEA 4KVGB 2COAA 4GXBA 3NWFA 4A6FA 3SYXA 2D4QA 4WSFA 2I1JA 1UNPA 3V5WA 2L2IA 5J3QA 3NWDA 1BTNA 4HAXB 2UZRA 2VSZA 2FJUB 1QC6A 2DYQA 4K2PA 2Z0OA 5LOPB 2K00A 3NSUA 4EKUA 4DX90 1OMWA 1Z87A 1NTYA 1MIXA 3GYPA 1PMSA 1X11A 2IYBA 1ZC4B 1XCGA 2D9ZA 2R0DA 4HATB 3GYOA 2Z0PA 5L81A 1E5WA 3QWMA 3B77A 1W1HA 3AU5A 2YVCA 3F5RA 4B6HA 2R09A 2UVMA 2YT0A 2I1KA 1M7RA 2P0DA 3KRXA 5FI0A 4HAVB 3SUZA 3U7DA 1FAOA 4HAWB 1PLSA 3F0WA 4OT1A 3MDBC 1SHCA 2J59M 2KR0A 4A6HA 3VIAA 3FEHA 2ELBA 3A8QA 1PFJA 3HIEA 3TO1A 5D27A 3X23A 5C6RA 2Z13A 4DIXA 2MKRA 2KUPA 2KUQA 2LG1A 1MPHA 1ZC3B 3WA0A 5JLJB 1LW3A 2EMSA 4GZUA 1K5GB 2KIGA 1NU2A 4MT7A 4TYZA 1FHXA 1UNRA 1DDVA 4MK0A 2M38A 2G35A 4GNKB 3G9WA 2ROZB 5C79A 2LYDA 4QJ3B 3ZVRA 2DTCA 1MK9B 4EJNA 1GC6A 3ODOA 1FGZA 3HQCA 4L1RA 4DX8A 1FHWA 3HW2B 1GG3A 2OQBA 4HAZB 1LB1A 2XQNM 3TCAA 2EMTA 2GJYA 2DHIA 4F7UP 2D9VA 2RRFA 1KZ7A 2YS1A 5D3VA 2CODA 3M1IB 4GMXB 3PVLA 2YT2A 4NSWA 1EF1A 2RSGA 3ULCA 1UNQA 1ZM0A 3HK0A 3A58A 3TFMA 1V89A 1AQCA 3ULBA 4WJ7A 3RCPA 1K5DB 3HSAA 2PZ1A 3KZ1A 3N7CA 2D10A 2ROVA 2UZSA 5GOWB 4A5KA 2GUMA 4GN1A 1XX0A 1KI1B 3SV1A 4QXAB 2HTHB 3CIKA 2K8EA 2IFSA 2DX1A 2DHKA 1MIZB 2Z0QA 5M4YB 2DKPA 1U5EA 1NI2A 4PNKA 4QJ4B 1WJMA 1RRPB 3DXCA 1WG7A 2ZPYA 2GCJA 3OANA 2I5FA 5D3XA 1TXDA 4CYEA 2W2XD 3DCXA 1EAZA 2CY5A 2YSZA 4HDOA 2LOXA 4YL8A 3A8PA 1IRSA 3PVUA 2VRWB 5HE0A 1P3RA 2N0YA 4HB2B 4CSQA 5LG4B 1U29A 3CXBB 1I7AA 1KZGA 2GCLA 1X86A 4NY0A 1Q67A 1MKEA 3DXDA 4C0AA 4GPTB 3TW1A 3KRWA 1NTVA 2Y8FA 2I5CA 5DHAB 2DX5A 3D8FA 2YT1A 5HE3A 4D6WA 2R2YA 4IOYX 4CHMA 1FGYA 1XKEA 2N23A 5J3YA 3P6AA 1UPRA 1XODA 2MWNB 1GC7A 4F7HA 1V88A 1DDWA 3DXEA 1N3HA 3PG7A 2NZ8B 3QBVB 4HB0B 1ZYIA 4QJ5B 2W2WA 3O96A 3A98B 5IRSA 3ML4A 2K2UA 2NMBA 1W1GA 4PQ0A 3QIJA 2LULA 2VKIA 1QQGA 5D3WA 4KHBB 3TVVA 2YS5A 1XD4A 1Y5OA 2P0FA 3D8DA 2HE7A 4Z2MB 1AWEA 1V5UA 2LOZA 3LJUX 2K2JA 3KY9A 5KCVA 2DN6A 5CLQB 2V76A 3PP2A 3VOQA 4L6EA 2DLWA 1ISNA 3SNHA 3IVFA 4HB3B 2YS3A 2KGXB 1DROA 2CY4A 2Z4DA 1Y19B 5J3TA 4DBBA 4K81A 1OY2A 1RJ2A 5DHFB 2DHJA 2MDXA 5HE2A 3D8EA 1OQNA 1WI1A 2RNRB 1WGQA 2LKOA 1BTKA 4KHBA 3PSCA 2D11A 4ZRKA 5KQ1A 1UPQA 2KCJA 1MK7B 2Q13A 3ODWA 2CRFA 4ZRJA 3PZDA 2ADZA 4KAXB 2RLOA 4Y94A 1BWNA 2H7EA 1H10A 1TQZA 3BJIA 4IAPA 2FJLA 2RGNB 1V61A 2K49A 4BBKA 1ZVRA 4P7IA 3T06A 4KHOA 4WVFB 4F7GA 4HB4B 4D0NB 4KHAA 1U5GA 5DH9B 4XWXA 2ELAA 1M7EA 1J19A 4MY6A 5CLLB 2RUKB 1DYNA 3FVCA 1EGXA 4Z2NA 2AL6A 2DKQA 5D3YA 4HSIA 1V5MA 2D9XA 3NW8A 2D2QA 5HE1A 1DBHA 1U27A 1U5FA 2D9WA 2Z59A 2COCA 5C5BB 3UZTA 2E2XA 2BCJA 4K2OA 2MFQA 2QKLA 1P5TA 3SO6A 1B55A 1X05A 3OHMB 3ZDTA 1WJ1A 2YF0A 2J0KA 3MPXA 3BINA 4HAUB 1ZSQA 4EMOA 2Y7BA 2YRYA 5I2SA 1UEFA 1FOEA 1U5DA 1X1GA 3P7ZA 4ZRIA 3U8ZA 3WYFB 2AEHA 4K17A 2X18A 1WVHA 3NWAA 2OTXA 1TJ6A 2D9YA 3AJ4A 4GOUA 1FB8A 1V5PA 2Y8GA 2DFKA 2RVBB 4IFSA 2J0MA 2M14A 3FM8C 1BAKA 1P6SA 2QKMA 5JP4A 2P8VA 5JHHA 3KSYA 1I2HA 5C5BA 1U2BA 1FHOA 2H7DA 2EJ8A 4HDQA 4H8SA 4A6FB 3ODXA 4HAYB 2CAYA 3U12A 1J0WA 4CHJA 2W2XC 2EC1A 5DIFB 2ZKMX 1X1FA 4GMVA 4A6KA 2L1CA 2P0HA
chains in the Genus database with same CATH topology
5FI1A 1EVHA 2COFA 5DI9B 1W1DA 1DDMA 3PEGA 1MAIA 5C16A 1SGHA 5LONB 4YONA 1XR0B 4TKNA 1WGUA 2JP2A 5JHGA 2J0JA 2GS0A 2DA0A 3PVWA 4HHVA 5EFXA 4DXAB 1H4RA 2DYNA 5KQ4A 3AU4A 3FSSA 4KVGB 2COAA 4GXBA 4A6FA 3SYXA 2D4QA 4WSFA 2I1JA 1UNPA 3V5WA 2L2IA 5J3QA 1BTNA 4HAXB 2UZRA 2VSZA 1QC6A 2DYQA 4K2PA 2Z0OA 5LOPB 2K00A 3NSUA 4EKUA 4DX90 1OMWA 1Z87A 1NTYA 1MIXA 3GYPA 1PMSA 1X11A 2IYBA 1ZC4B 1XCGA 2D9ZA 2R0DA 4HATB 3GYOA 2Z0PA 5L81A 1E5WA 3QWMA 1W1HA 3AU5A 2YVCA 3F5RA 4B6HA 2R09A 2UVMA 2YT0A 2I1KA 1M7RA 2P0DA 3KRXA 5FI0A 4HAVB 3SUZA 3U7DA 1FAOA 4HAWB 1PLSA 3F0WA 3MDBC 1SHCA 2J59M 4A6HA 3VIAA 3FEHA 2ELBA 3A8QA 1PFJA 3TO1A 5D27A 3X23A 5C6RA 2MKRA 2KUPA 2LG1A 1MPHA 1ZC3B 3WA0A 5JLJB 1LW3A 2EMSA 4GZUA 1K5GB 1NU2A 4MT7A 4TYZA 1FHXA 1UNRA 1DDVA 4MK0A 2M38A 2G35A 3G9WA 2ROZB 5C79A 2LYDA 3ZVRA 2DTCA 1MK9B 4EJNA 1GC6A 3ODOA 1FGZA 3HQCA 4DX8A 1FHWA 3HW2B 1GG3A 2OQBA 4HAZB 1LB1A 2XQNM 3TCAA 2EMTA 2GJYA 2DHIA 4F7UP 2D9VA 1KZ7A 2YS1A 5D3VA 2CODA 3M1IB 4GMXB 3PVLA 4NSWA 1EF1A 2RSGA 3ULCA 1UNQA 1ZM0A 3HK0A 3TFMA 1V89A 1AQCA 3ULBA 4WJ7A 3RCPA 1K5DB 2PZ1A 3KZ1A 3N7CA 2D10A 2ROVA 2UZSA 5GOWB 4A5KA 4GN1A 1XX0A 1KI1B 3SV1A 2HTHB 3CIKA 2IFSA 2DX1A 2DHKA 1MIZB 2Z0QA 2DKPA 1U5EA 1NI2A 4PNKA 1WJMA 1RRPB 3DXCA 1WG7A 2ZPYA 2GCJA 3OANA 2I5FA 5D3XA 1TXDA 4CYEA 2W2XD 1EAZA 2CY5A 2YSZA 4HDOA 2LOXA 4YL8A 3A8PA 1IRSA 3PVUA 2VRWB 5HE0A 1P3RA 2N0YA 4HB2B 1U29A 3CXBB 1I7AA 1KZGA 2GCLA 1X86A 4NY0A 1Q67A 1MKEA 3DXDA 4C0AA 4GPTB 3TW1A 3KRWA 1NTVA 2Y8FA 2I5CA 5DHAB 2DX5A 3D8FA 2YT1A 5HE3A 4IOYX 4CHMA 1FGYA 1XKEA 2N23A 5J3YA 3P6AA 1UPRA 1XODA 2MWNB 1GC7A 4F7HA 1V88A 1DDWA 3DXEA 1N3HA 3PG7A 2NZ8B 3QBVB 4HB0B 2W2WA 3O96A 3A98B 3ML4A 2K2UA 2NMBA 1W1GA 4PQ0A 3QIJA 2LULA 2VKIA 1QQGA 5D3WA 4KHBB 3TVVA 2YS5A 1XD4A 1Y5OA 2P0FA 3D8DA 2HE7A 4Z2MB 1AWEA 3LJUX 1V5UA 2LOZA 2K2JA 3KY9A 5KCVA 2DN6A 5CLQB 2V76A 3PP2A 3VOQA 4L6EA 2DLWA 1ISNA 3SNHA 3IVFA 4HB3B 2YS3A 2KGXB 1DROA 2CY4A 1Y19B 5J3TA 4DBBA 4K81A 1OY2A 1RJ2A 5DHFB 2DHJA 2MDXA 5HE2A 3D8EA 1OQNA 1WI1A 2RNRB 1WGQA 2LKOA 1BTKA 3PSCA 2D11A 4ZRKA 5KQ1A 1UPQA 2KCJA 1MK7B 2Q13A 3ODWA 2CRFA 4ZRJA 3PZDA 2ADZA 4KAXB 2RLOA 4Y94A 1BWNA 2H7EA 1H10A 1TQZA 3BJIA 4IAPA 2FJLA 2RGNB 1V61A 4BBKA 1ZVRA 4P7IA 3T06A 4KHOA 4WVFB 4F7GA 4HB4B 4D0NB 4KHAA 1U5GA 5DH9B 4XWXA 2ELAA 1M7EA 1J19A 4MY6A 5CLLB 2RUKB 1DYNA 1EGXA 4Z2NA 2AL6A 2DKQA 5D3YA 1V5MA 2D9XA 2D2QA 5HE1A 1DBHA 1U27A 1U5FA 2D9WA 2COCA 5C5BB 3UZTA 2E2XA 2BCJA 4K2OA 2MFQA 2QKLA 1P5TA 3SO6A 1B55A 1X05A 3ZDTA 1WJ1A 2YF0A 2J0KA 3MPXA 3BINA 4HAUB 1ZSQA 4EMOA 2Y7BA 2YRYA 1UEFA 1FOEA 1U5DA 1X1GA 3P7ZA 4ZRIA 3U8ZA 3WYFB 2AEHA 4K17A 2X18A 1WVHA 2OTXA 1TJ6A 2D9YA 3AJ4A 1FB8A 1V5PA 2Y8GA 2DFKA 2RVBB 4IFSA 2J0MA 2M14A 3FM8C 1BAKA 1P6SA 2QKMA 5JP4A 2P8VA 5JHHA 3KSYA 1I2HA 5C5BA 1U2BA 1FHOA 2H7DA 2EJ8A 4HDQA 4H8SA 4A6FB 3ODXA 4HAYB 2CAYA 1J0WA 4CHJA 2W2XC 2EC1A 5DIFB 1X1FA 4GMVA 4A6KA 2L1CA 2P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI1 A;  1EVH A;  2COF A;  5DI9 B;  1W1D A;  1DDM A;  3PEG A;  1MAI A;  5C16 A;  1SGH A;  5LON B;  4YON A;  1XR0 B;  4TKN A;  1WGU A;  2JP2 A;  5JHG A;  2J0J A;  2GS0 A;  2DA0 A;  3PVW A;  4HHV A;  5EFX A;  4DXA B;  1H4R A;  2DYN A;  5KQ4 A;  3AU4 A;  3FSS A;  4KVG B;  2COA A;  4GXB A;  4A6F A;  3SYX A;  2D4Q A;  4WSF A;  2I1J A;  1UNP A;  3V5W A;  2L2I A;  5J3Q A;  1BTN A;  4HAX B;  2UZR A;  2VSZ A;  1QC6 A;  2DYQ A;  4K2P A;  2Z0O A;  5LOP B;  2K00 A;  3NSU A;  4EKU A;  4DX9 0;  1OMW A;  1Z87 A;  1NTY A;  1MIX A;  3GYP A;  1PMS A;  1X11 A;  2IYB A;  1ZC4 B;  1XCG A;  2D9Z A;  2R0D A;  4HAT B;  3GYO A;  2Z0P A;  5L81 A;  1E5W A;  3QWM A;  1W1H A;  3AU5 A;  2YVC A;  3F5R A;  4B6H A;  2R09 A;  2UVM A;  2YT0 A;  2I1K A;  1M7R A;  2P0D A;  3KRX A;  5FI0 A;  4HAV B;  3SUZ A;  3U7D A;  1FAO A;  4HAW B;  1PLS A;  3F0W A;  3MDB C;  1SHC A;  2J59 M;  4A6H A;  3VIA A;  3FEH A;  2ELB A;  3A8Q A;  1PFJ A;  3TO1 A;  5D27 A;  3X23 A;  5C6R A;  2MKR A;  2KUP A;  2LG1 A;  1MPH A;  1ZC3 B;  3WA0 A;  5JLJ B;  1LW3 A;  2EMS A;  4GZU A;  1K5G B;  1NU2 A;  4MT7 A;  4TYZ A;  1FHX A;  1UNR A;  1DDV A;  4MK0 A;  2M38 A;  2G35 A;  3G9W A;  2ROZ B;  5C79 A;  2LYD A;  3ZVR A;  2DTC A;  1MK9 B;  4EJN A;  1GC6 A;  3ODO A;  1FGZ A;  3HQC A;  4DX8 A;  1FHW A;  3HW2 B;  1GG3 A;  2OQB A;  4HAZ B;  1LB1 A;  2XQN M;  3TCA A;  2EMT A;  2GJY A;  2DHI A;  4F7U P;  2D9V A;  1KZ7 A;  2YS1 A;  5D3V A;  2COD A;  3M1I B;  4GMX B;  3PVL A;  4NSW A;  1EF1 A;  2RSG A;  3ULC A;  1UNQ A;  1ZM0 A;  3HK0 A;  3TFM A;  1V89 A;  1AQC A;  3ULB A;  4WJ7 A;  3RCP A;  1K5D B;  2PZ1 A;  3KZ1 A;  3N7C A;  2D10 A;  2ROV A;  2UZS A;  5GOW B;  4A5K A;  4GN1 A;  1XX0 A;  1KI1 B;  3SV1 A;  2HTH B;  3CIK A;  2IFS A;  2DX1 A;  2DHK A;  1MIZ B;  2Z0Q A;  2DKP A;  1U5E A;  1NI2 A;  4PNK A;  1WJM A;  1RRP B;  3DXC A;  1WG7 A;  2ZPY A;  2GCJ A;  3OAN A;  2I5F A;  5D3X A;  1TXD A;  4CYE A;  2W2X D;  1EAZ A;  2CY5 A;  2YSZ A;  4HDO A;  2LOX A;  4YL8 A;  3A8P A;  1IRS A;  3PVU A;  2VRW B;  5HE0 A;  1P3R A;  2N0Y A;  4HB2 B;  1U29 A;  3CXB B;  1I7A A;  1KZG A;  2GCL A;  1X86 A;  4NY0 A;  1Q67 A;  1MKE A;  3DXD A;  4C0A A;  4GPT B;  3TW1 A;  3KRW A;  1NTV A;  2Y8F A;  2I5C A;  5DHA B;  2DX5 A;  3D8F A;  2YT1 A;  5HE3 A;  4IOY X;  4CHM A;  1FGY A;  1XKE A;  2N23 A;  5J3Y A;  3P6A A;  1UPR A;  1XOD A;  2MWN B;  1GC7 A;  4F7H A;  1V88 A;  1DDW A;  3DXE A;  1N3H A;  3PG7 A;  2NZ8 B;  3QBV B;  4HB0 B;  2W2W A;  3O96 A;  3A98 B;  3ML4 A;  2K2U A;  2NMB A;  1W1G A;  4PQ0 A;  3QIJ A;  2LUL A;  2VKI A;  1QQG A;  5D3W A;  4KHB B;  3TVV A;  2YS5 A;  1XD4 A;  1Y5O A;  2P0F A;  3D8D A;  2HE7 A;  4Z2M B;  1AWE A;  3LJU X;  1V5U A;  2LOZ A;  2K2J A;  3KY9 A;  5KCV A;  2DN6 A;  5CLQ B;  2V76 A;  3PP2 A;  3VOQ A;  4L6E A;  2DLW A;  1ISN A;  3SNH A;  3IVF A;  4HB3 B;  2YS3 A;  2KGX B;  1DRO A;  2CY4 A;  1Y19 B;  5J3T A;  4DBB A;  4K81 A;  1OY2 A;  1RJ2 A;  5DHF B;  2DHJ A;  2MDX A;  5HE2 A;  3D8E A;  1OQN A;  1WI1 A;  2RNR B;  1WGQ A;  2LKO A;  1BTK A;  3PSC A;  2D11 A;  4ZRK A;  5KQ1 A;  1UPQ A;  2KCJ A;  1MK7 B;  2Q13 A;  3ODW A;  2CRF A;  4ZRJ A;  3PZD A;  2ADZ A;  4KAX B;  2RLO A;  4Y94 A;  1BWN A;  2H7E A;  1H10 A;  1TQZ A;  3BJI A;  4IAP A;  2FJL A;  2RGN B;  1V61 A;  4BBK A;  1ZVR A;  4P7I A;  3T06 A;  4KHO A;  4WVF B;  4F7G A;  4HB4 B;  4D0N B;  4KHA A;  1U5G A;  5DH9 B;  4XWX A;  2ELA A;  1M7E A;  1J19 A;  4MY6 A;  5CLL B;  2RUK B;  1DYN A;  1EGX A;  4Z2N A;  2AL6 A;  2DKQ A;  5D3Y A;  1V5M A;  2D9X A;  2D2Q A;  5HE1 A;  1DBH A;  1U27 A;  1U5F A;  2D9W A;  2COC A;  5C5B B;  3UZT A;  2E2X A;  2BCJ A;  4K2O A;  2MFQ A;  2QKL A;  1P5T A;  3SO6 A;  1B55 A;  1X05 A;  3ZDT A;  1WJ1 A;  2YF0 A;  2J0K A;  3MPX A;  3BIN A;  4HAU B;  1ZSQ A;  4EMO A;  2Y7B A;  2YRY A;  1UEF A;  1FOE A;  1U5D A;  1X1G A;  3P7Z A;  4ZRI A;  3U8Z A;  3WYF B;  2AEH A;  4K17 A;  2X18 A;  1WVH A;  2OTX A;  1TJ6 A;  2D9Y A;  3AJ4 A;  1FB8 A;  1V5P A;  2Y8G A;  2DFK A;  2RVB B;  4IFS A;  2J0M A;  2M14 A;  3FM8 C;  1BAK A;  1P6S A;  2QKM A;  5JP4 A;  2P8V A;  5JHH A;  3KSY A;  1I2H A;  5C5B A;  1U2B A;  1FHO A;  2H7D A;  2EJ8 A;  4HDQ A;  4H8S A;  4A6F B;  3ODX A;  4HAY B;  2CAY A;  1J0W A;  4CHJ A;  2W2X C;  2EC1 A;  5DIF B;  1X1F A;  4GMV A;  4A6K A;  2L1C A;  2P0H A; 
#chains in the Genus database with same CATH topology
 5FI1 A;  1EVH A;  2COF A;  5DI9 B;  1W1D A;  1DDM A;  3PEG A;  1MAI A;  5C16 A;  1SGH A;  5LON B;  4YON A;  1XR0 B;  4TKN A;  1WGU A;  2JP2 A;  2Z14 A;  5JHG A;  2J0J A;  4OSN A;  2GS0 A;  2DA0 A;  3PVW A;  4HHV A;  5EFX A;  4DXA B;  1H4R A;  2DYN A;  5I2M A;  5KQ4 A;  2NBV A;  3AU4 A;  1MI1 A;  1T77 A;  3FSS A;  2KIE A;  4KVG B;  2COA A;  4GXB A;  3NWF A;  4A6F A;  3SYX A;  2D4Q A;  4WSF A;  2I1J A;  1UNP A;  3V5W A;  2L2I A;  5J3Q A;  3NWD A;  1BTN A;  4HAX B;  2UZR A;  2VSZ A;  2FJU B;  1QC6 A;  2DYQ A;  4K2P A;  2Z0O A;  5LOP B;  2K00 A;  3NSU A;  4EKU A;  4DX9 0;  1OMW A;  1Z87 A;  1NTY A;  1MIX A;  3GYP A;  1PMS A;  1X11 A;  2IYB A;  1ZC4 B;  1XCG A;  2D9Z A;  2R0D A;  4HAT B;  3GYO A;  2Z0P A;  5L81 A;  1E5W A;  3QWM A;  3B77 A;  1W1H A;  3AU5 A;  2YVC A;  3F5R A;  4B6H A;  2R09 A;  2UVM A;  2YT0 A;  2I1K A;  1M7R A;  2P0D A;  3KRX A;  5FI0 A;  4HAV B;  3SUZ A;  3U7D A;  1FAO A;  4HAW B;  1PLS A;  3F0W A;  4OT1 A;  3MDB C;  1SHC A;  2J59 M;  2KR0 A;  4A6H A;  3VIA A;  3FEH A;  2ELB A;  3A8Q A;  1PFJ A;  3HIE A;  3TO1 A;  5D27 A;  3X23 A;  5C6R A;  2Z13 A;  4DIX A;  2MKR A;  2KUP A;  2KUQ A;  2LG1 A;  1MPH A;  1ZC3 B;  3WA0 A;  5JLJ B;  1LW3 A;  2EMS A;  4GZU A;  1K5G B;  2KIG A;  1NU2 A;  4MT7 A;  4TYZ A;  1FHX A;  1UNR A;  1DDV A;  4MK0 A;  2M38 A;  2G35 A;  4GNK B;  3G9W A;  2ROZ B;  5C79 A;  2LYD A;  4QJ3 B;  3ZVR A;  2DTC A;  1MK9 B;  4EJN A;  1GC6 A;  3ODO A;  1FGZ A;  3HQC A;  4L1R A;  4DX8 A;  1FHW A;  3HW2 B;  1GG3 A;  2OQB A;  4HAZ B;  1LB1 A;  2XQN M;  3TCA A;  2EMT A;  2GJY A;  2DHI A;  4F7U P;  2D9V A;  2RRF A;  1KZ7 A;  2YS1 A;  5D3V A;  2COD A;  3M1I B;  4GMX B;  3PVL A;  2YT2 A;  4NSW A;  1EF1 A;  2RSG A;  3ULC A;  1UNQ A;  1ZM0 A;  3HK0 A;  3A58 A;  3TFM A;  1V89 A;  1AQC A;  3ULB A;  4WJ7 A;  3RCP A;  1K5D B;  3HSA A;  2PZ1 A;  3KZ1 A;  3N7C A;  2D10 A;  2ROV A;  2UZS A;  5GOW B;  4A5K A;  2GUM A;  4GN1 A;  1XX0 A;  1KI1 B;  3SV1 A;  4QXA B;  2HTH B;  3CIK A;  2K8E A;  2IFS A;  2DX1 A;  2DHK A;  1MIZ B;  2Z0Q A;  5M4Y B;  2DKP A;  1U5E A;  1NI2 A;  4PNK A;  4QJ4 B;  1WJM A;  1RRP B;  3DXC A;  1WG7 A;  2ZPY A;  2GCJ A;  3OAN A;  2I5F A;  5D3X A;  1TXD A;  4CYE A;  2W2X D;  3DCX A;  1EAZ A;  2CY5 A;  2YSZ A;  4HDO A;  2LOX A;  4YL8 A;  3A8P A;  1IRS A;  3PVU A;  2VRW B;  5HE0 A;  1P3R A;  2N0Y A;  4HB2 B;  4CSQ A;  5LG4 B;  1U29 A;  3CXB B;  1I7A A;  1KZG A;  2GCL A;  1X86 A;  4NY0 A;  1Q67 A;  1MKE A;  3DXD A;  4C0A A;  4GPT B;  3TW1 A;  3KRW A;  1NTV A;  2Y8F A;  2I5C A;  5DHA B;  2DX5 A;  3D8F A;  2YT1 A;  5HE3 A;  4D6W A;  2R2Y A;  4IOY X;  4CHM A;  1FGY A;  1XKE A;  2N23 A;  5J3Y A;  3P6A A;  1UPR A;  1XOD A;  2MWN B;  1GC7 A;  4F7H A;  1V88 A;  1DDW A;  3DXE A;  1N3H A;  3PG7 A;  2NZ8 B;  3QBV B;  4HB0 B;  1ZYI A;  4QJ5 B;  2W2W A;  3O96 A;  3A98 B;  5IRS A;  3ML4 A;  2K2U A;  2NMB A;  1W1G A;  4PQ0 A;  3QIJ A;  2LUL A;  2VKI A;  1QQG A;  5D3W A;  4KHB B;  3TVV A;  2YS5 A;  1XD4 A;  1Y5O A;  2P0F A;  3D8D A;  2HE7 A;  4Z2M B;  1AWE A;  1V5U A;  2LOZ A;  3LJU X;  2K2J A;  3KY9 A;  5KCV A;  2DN6 A;  5CLQ B;  2V76 A;  3PP2 A;  3VOQ A;  4L6E A;  2DLW A;  1ISN A;  3SNH A;  3IVF A;  4HB3 B;  2YS3 A;  2KGX B;  1DRO A;  2CY4 A;  2Z4D A;  1Y19 B;  5J3T A;  4DBB A;  4K81 A;  1OY2 A;  1RJ2 A;  5DHF B;  2DHJ A;  2MDX A;  5HE2 A;  3D8E A;  1OQN A;  1WI1 A;  2RNR B;  1WGQ A;  2LKO A;  1BTK A;  4KHB A;  3PSC A;  2D11 A;  4ZRK A;  5KQ1 A;  1UPQ A;  2KCJ A;  1MK7 B;  2Q13 A;  3ODW A;  2CRF A;  4ZRJ A;  3PZD A;  2ADZ A;  4KAX B;  2RLO A;  4Y94 A;  1BWN A;  2H7E A;  1H10 A;  1TQZ A;  3BJI A;  4IAP A;  2FJL A;  2RGN B;  1V61 A;  2K49 A;  4BBK A;  1ZVR A;  4P7I A;  3T06 A;  4KHO A;  4WVF B;  4F7G A;  4HB4 B;  4D0N B;  4KHA A;  1U5G A;  5DH9 B;  4XWX A;  2ELA A;  1M7E A;  1J19 A;  4MY6 A;  5CLL B;  2RUK B;  1DYN A;  3FVC A;  1EGX A;  4Z2N A;  2AL6 A;  2DKQ A;  5D3Y A;  4HSI A;  1V5M A;  2D9X A;  3NW8 A;  2D2Q A;  5HE1 A;  1DBH A;  1U27 A;  1U5F A;  2D9W A;  2Z59 A;  2COC A;  5C5B B;  3UZT A;  2E2X A;  2BCJ A;  4K2O A;  2MFQ A;  2QKL A;  1P5T A;  3SO6 A;  1B55 A;  1X05 A;  3OHM B;  3ZDT A;  1WJ1 A;  2YF0 A;  2J0K A;  3MPX A;  3BIN A;  4HAU B;  1ZSQ A;  4EMO A;  2Y7B A;  2YRY A;  5I2S A;  1UEF A;  1FOE A;  1U5D A;  1X1G A;  3P7Z A;  4ZRI A;  3U8Z A;  3WYF B;  2AEH A;  4K17 A;  2X18 A;  1WVH A;  3NWA A;  2OTX A;  1TJ6 A;  2D9Y A;  3AJ4 A;  4GOU A;  1FB8 A;  1V5P A;  2Y8G A;  2DFK A;  2RVB B;  4IFS A;  2J0M A;  2M14 A;  3FM8 C;  1BAK A;  1P6S A;  2QKM A;  5JP4 A;  2P8V A;  5JHH A;  3KSY A;  1I2H A;  5C5B A;  1U2B A;  1FHO A;  2H7D A;  2EJ8 A;  4HDQ A;  4H8S A;  4A6F B;  3ODX A;  4HAY B;  2CAY A;  3U12 A;  1J0W A;  4CHJ A;  2W2X C;  2EC1 A;  5DIF B;  2ZKM X;  1X1F A;  4GMV A;  4A6K A;  2L1C A;  2P0H A; 
#chains in the Genus database with same CATH homology
 5FI1 A;  1EVH A;  2COF A;  5DI9 B;  1W1D A;  1DDM A;  3PEG A;  1MAI A;  5C16 A;  1SGH A;  5LON B;  4YON A;  1XR0 B;  4TKN A;  1WGU A;  2JP2 A;  5JHG A;  2J0J A;  2GS0 A;  2DA0 A;  3PVW A;  4HHV A;  5EFX A;  4DXA B;  1H4R A;  2DYN A;  5KQ4 A;  3AU4 A;  3FSS A;  4KVG B;  2COA A;  4GXB A;  4A6F A;  3SYX A;  2D4Q A;  4WSF A;  2I1J A;  1UNP A;  3V5W A;  2L2I A;  5J3Q A;  1BTN A;  4HAX B;  2UZR A;  2VSZ A;  1QC6 A;  2DYQ A;  4K2P A;  2Z0O A;  5LOP B;  2K00 A;  3NSU A;  4EKU A;  4DX9 0;  1OMW A;  1Z87 A;  1NTY A;  1MIX A;  3GYP A;  1PMS A;  1X11 A;  2IYB A;  1ZC4 B;  1XCG A;  2D9Z A;  2R0D A;  4HAT B;  3GYO A;  2Z0P A;  5L81 A;  1E5W A;  3QWM A;  1W1H A;  3AU5 A;  2YVC A;  3F5R A;  4B6H A;  2R09 A;  2UVM A;  2YT0 A;  2I1K A;  1M7R A;  2P0D A;  3KRX A;  5FI0 A;  4HAV B;  3SUZ A;  3U7D A;  1FAO A;  4HAW B;  1PLS A;  3F0W A;  3MDB C;  1SHC A;  2J59 M;  4A6H A;  3VIA A;  3FEH A;  2ELB A;  3A8Q A;  1PFJ A;  3TO1 A;  5D27 A;  3X23 A;  5C6R A;  2MKR A;  2KUP A;  2LG1 A;  1MPH A;  1ZC3 B;  3WA0 A;  5JLJ B;  1LW3 A;  2EMS A;  4GZU A;  1K5G B;  1NU2 A;  4MT7 A;  4TYZ A;  1FHX A;  1UNR A;  1DDV A;  4MK0 A;  2M38 A;  2G35 A;  3G9W A;  2ROZ B;  5C79 A;  2LYD A;  3ZVR A;  2DTC A;  1MK9 B;  4EJN A;  1GC6 A;  3ODO A;  1FGZ A;  3HQC A;  4DX8 A;  1FHW A;  3HW2 B;  1GG3 A;  2OQB A;  4HAZ B;  1LB1 A;  2XQN M;  3TCA A;  2EMT A;  2GJY A;  2DHI A;  4F7U P;  2D9V A;  1KZ7 A;  2YS1 A;  5D3V A;  2COD A;  3M1I B;  4GMX B;  3PVL A;  4NSW A;  1EF1 A;  2RSG A;  3ULC A;  1UNQ A;  1ZM0 A;  3HK0 A;  3TFM A;  1V89 A;  1AQC A;  3ULB A;  4WJ7 A;  3RCP A;  1K5D B;  2PZ1 A;  3KZ1 A;  3N7C A;  2D10 A;  2ROV A;  2UZS A;  5GOW B;  4A5K A;  4GN1 A;  1XX0 A;  1KI1 B;  3SV1 A;  2HTH B;  3CIK A;  2IFS A;  2DX1 A;  2DHK A;  1MIZ B;  2Z0Q A;  2DKP A;  1U5E A;  1NI2 A;  4PNK A;  1WJM A;  1RRP B;  3DXC A;  1WG7 A;  2ZPY A;  2GCJ A;  3OAN A;  2I5F A;  5D3X A;  1TXD A;  4CYE A;  2W2X D;  1EAZ A;  2CY5 A;  2YSZ A;  4HDO A;  2LOX A;  4YL8 A;  3A8P A;  1IRS A;  3PVU A;  2VRW B;  5HE0 A;  1P3R A;  2N0Y A;  4HB2 B;  1U29 A;  3CXB B;  1I7A A;  1KZG A;  2GCL A;  1X86 A;  4NY0 A;  1Q67 A;  1MKE A;  3DXD A;  4C0A A;  4GPT B;  3TW1 A;  3KRW A;  1NTV A;  2Y8F A;  2I5C A;  5DHA B;  2DX5 A;  3D8F A;  2YT1 A;  5HE3 A;  4IOY X;  4CHM A;  1FGY A;  1XKE A;  2N23 A;  5J3Y A;  3P6A A;  1UPR A;  1XOD A;  2MWN B;  1GC7 A;  4F7H A;  1V88 A;  1DDW A;  3DXE A;  1N3H A;  3PG7 A;  2NZ8 B;  3QBV B;  4HB0 B;  2W2W A;  3O96 A;  3A98 B;  3ML4 A;  2K2U A;  2NMB A;  1W1G A;  4PQ0 A;  3QIJ A;  2LUL A;  2VKI A;  1QQG A;  5D3W A;  4KHB B;  3TVV A;  2YS5 A;  1XD4 A;  1Y5O A;  2P0F A;  3D8D A;  2HE7 A;  4Z2M B;  1AWE A;  3LJU X;  1V5U A;  2LOZ A;  2K2J A;  3KY9 A;  5KCV A;  2DN6 A;  5CLQ B;  2V76 A;  3PP2 A;  3VOQ A;  4L6E A;  2DLW A;  1ISN A;  3SNH A;  3IVF A;  4HB3 B;  2YS3 A;  2KGX B;  1DRO A;  2CY4 A;  1Y19 B;  5J3T A;  4DBB A;  4K81 A;  1OY2 A;  1RJ2 A;  5DHF B;  2DHJ A;  2MDX A;  5HE2 A;  3D8E A;  1OQN A;  1WI1 A;  2RNR B;  1WGQ A;  2LKO A;  1BTK A;  3PSC A;  2D11 A;  4ZRK A;  5KQ1 A;  1UPQ A;  2KCJ A;  1MK7 B;  2Q13 A;  3ODW A;  2CRF A;  4ZRJ A;  3PZD A;  2ADZ A;  4KAX B;  2RLO A;  4Y94 A;  1BWN A;  2H7E A;  1H10 A;  1TQZ A;  3BJI A;  4IAP A;  2FJL A;  2RGN B;  1V61 A;  4BBK A;  1ZVR A;  4P7I A;  3T06 A;  4KHO A;  4WVF B;  4F7G A;  4HB4 B;  4D0N B;  4KHA A;  1U5G A;  5DH9 B;  4XWX A;  2ELA A;  1M7E A;  1J19 A;  4MY6 A;  5CLL B;  2RUK B;  1DYN A;  1EGX A;  4Z2N A;  2AL6 A;  2DKQ A;  5D3Y A;  1V5M A;  2D9X A;  2D2Q A;  5HE1 A;  1DBH A;  1U27 A;  1U5F A;  2D9W A;  2COC A;  5C5B B;  3UZT A;  2E2X A;  2BCJ A;  4K2O A;  2MFQ A;  2QKL A;  1P5T A;  3SO6 A;  1B55 A;  1X05 A;  3ZDT A;  1WJ1 A;  2YF0 A;  2J0K A;  3MPX A;  3BIN A;  4HAU B;  1ZSQ A;  4EMO A;  2Y7B A;  2YRY A;  1UEF A;  1FOE A;  1U5D A;  1X1G A;  3P7Z A;  4ZRI A;  3U8Z A;  3WYF B;  2AEH A;  4K17 A;  2X18 A;  1WVH A;  2OTX A;  1TJ6 A;  2D9Y A;  3AJ4 A;  1FB8 A;  1V5P A;  2Y8G A;  2DFK A;  2RVB B;  4IFS A;  2J0M A;  2M14 A;  3FM8 C;  1BAK A;  1P6S A;  2QKM A;  5JP4 A;  2P8V A;  5JHH A;  3KSY A;  1I2H A;  5C5B A;  1U2B A;  1FHO A;  2H7D A;  2EJ8 A;  4HDQ A;  4H8S A;  4A6F B;  3ODX A;  4HAY B;  2CAY A;  1J0W A;  4CHJ A;  2W2X C;  2EC1 A;  5DIF B;  1X1F A;  4GMV A;  4A6K A;  2L1C A;  2P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...