1NTVA

Crystal structure of the disabled-1 (dab1) ptb domain-apoer2 peptide complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Disabled homolog 1
publication title Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ntvA00
2M38A 2FJLA 3PSCA 2P0DA 5JHGA 5J3QA 1J0WA 2EC1A 3IVFA 1EAZA 2HTHB 4WSFA 1M7RA 2HE7A 2CY5A 2GJYA 1TJ6A 3FM8C 3TW1A 1W1DA 1XODA 2CAYA 1FB8A 2AL6A 3AJ4A 5JHHA 3DXEA 4HAUB 3BINA 4HHVA 2ROVA 1H10A 1ZM0A 2L2IA 2DLWA 1DROA 4GXBA 1XD4A 2CRFA 5J3TA 2DKPA 1PMSA 1AWEA 1FOEA 3SUZA 1FGZA 1NU2A 3HK0A 2ZPYA 1U5EA 1V61A 2OTXA 4WVFB 4EJNA 3RCPA 1FHXA 4MY6A 4A5KA 2DX5A 1DDMA 1TXDA 3PG7A 1AQCA 1KI1B 4K81A 2DKQA 2IFSA 2MKRA 1UNRA 1X1FA 3DXDA 3PZDA 3ULCA 2EMTA 2AEHA 1H4RA 2COCA 2DX1A 4A6FA 2W2WA 3CXBB 4Z2MB 3SV1A 1U5FA 2KUPA 2R09A 2DA0A 2Y7BA 4K2PA 5D27A 3SNHA 1U2BA 3X23A 2J0JA 4GMVA 1OY2A 3SYXA 1Y5OA 5KQ1A 2DN6A 3KZ1A 3P7ZA 4EKUA 3MDBC 4HB2B 4WJ7A 4GN1A 2LYDA 4HB0B 1NI2A 4HATB 3F5RA 2D9ZA 2V76A 4IAPA 4GMXB 5DH9B 3FEHA 4XWXA 2I5CA 2P0FA 1UNPA 2Z0OA 4IFSA 3V5WA 2RUKB 1FHOA 2COAA 5KCVA 2RVBB 1V5PA 4L6EA 1U27A 1WI1A 5L81A 5C5BB 5FI0A 2Q13A 4D0NB 3KSYA 1BWNA 2J59M 2YS5A 3T06A 2D9YA 1K5GB 5CLQB 2NZ8B 1MPHA 2OQBA 4DXAB 2CODA 2DHKA 1X1GA 3DXCA 2D11A 3HW2B 2D9VA 1W1GA 3PP2A 4A6HA 1I7AA 2K2JA 2RGNB 1P5TA 1WJ1A 1DBHA 2D4QA 5DIFB 2YT1A 2DYNA 2QKMA 1EVHA 3PVLA 3KRWA 4DX90 4F7UP 2MDXA 5LONB 2RNRB 2IYBA 2LOZA 4H8SA 4HB3B 2G35A 1UNQA 1V5MA 2PZ1A 1DDWA 1Z87A 2LKOA 1NTYA 1OMWA 2R0DA 2MWNB 3KRXA 3PVWA 5DI9B 3U8ZA 3CIKA 3TVVA 2QKLA 1RRPB 1MKEA 1WGQA 4C0AA 4PNKA 1NTVA 5JP4A 2GCJA 2LULA 3ODWA 1B55A 1SHCA 4KHAA 2KGXB 1P3RA 1Y19B 2UZRA 2GS0A 2ELBA 5GOWB 4EMOA 3WA0A 5JLJB 4A6KA 2J0KA 2DFKA 3OANA 4ZRIA 2ROZB 2NMBA 2YF0A 5CLLB 2MFQA 2W2XD 1UPQA 3ULBA 2LOXA 3WYFB 1X86A 4HAVB 1MK9B 1ZSQA 4MT7A 2YVCA 1XX0A 1MIXA 1BTKA 3PVUA 3M1IB 1GC7A 4TYZA 2X18A 1J19A 2P8VA 4K2OA 5EFXA 5D3VA 2BCJA 3D8DA 5LOPB 3UZTA 2COFA 2N0YA 1DDVA 2H7EA 1ZC3B 1RJ2A 2GCLA 2K00A 3ODOA 3O96A 1P6SA 5D3YA 4PQ0A 1MAIA 1ZC4B 3G9WA 2ELAA 5FI1A 1V89A 5HE0A 1WG7A 2Y8FA 4KVGB 4HAZB 1ZVRA 3VOQA 3ML4A 1DYNA 4F7GA 1MK7B 5HE1A 3SO6A 2Z0PA 2L1CA 4HAYB 1U5GA 3NSUA 5D3WA 3FSSA 1GC6A 3HQCA 1KZGA 1Q67A 4DX8A 5J3YA 4ZRJA 3A8QA 5HE3A 4IOYX 2E2XA 4P7IA 3AU4A 4CHMA 3QWMA 1BTNA 1V88A 4HAWB 5C5BA 4GPTB 4CYEA 1OQNA 1EGXA 3ZDTA 2EJ8A 2H7DA 1E5WA 3A98B 3TO1A 2VRWB 2ADZA 1WGUA 4KAXB 4YONA 1I2HA 2YS1A 2UVMA 2P0HA 3GYPA 4GZUA 5KQ4A 2J0MA 1MIZB 1PFJA 4F7HA 1UEFA 1N3HA 1XKEA 4Y94A 4BBKA 4HB4B 1KZ7A 2DYQA 2W2XC 5DHFB 2VKIA 1UPRA 1EF1A 4A6FB 3A8PA 3QBVB 1GG3A 5C79A 2UZSA 2YRYA 4HAXB 3BJIA 1BAKA 3PEGA 2DTCA 3GYOA 3N7CA 4CHJA 4MK0A 4Z2NA 2D9WA 1PLSA 2M14A 5HE2A 2D2QA 4KHOA 1WJMA 3D8EA 2CY4A 3KY9A 3TFMA 3U7DA 2K2UA 3QIJA 1SGHA 1IRSA 1LW3A 1WVHA 2YT0A 2Z0QA 2VSZA 4TKNA 4YL8A 4NY0A 3P6AA 1K5DB 3AU5A 2DHIA 3ODXA 2LG1A 2D10A 5D3XA 2I5FA 2YSZA 4DBBA 3D8FA 1FAOA 2Y8GA 1LB1A 3VIAA 2RSGA 5C16A 1QQGA 2KCJA 1XR0B 1W1HA 2D9XA 2YS3A 3LJUX 2DHJA 3ZVRA 1FGYA 2RLOA 1U5DA 3F0WA 1U29A 1V5UA 4HDQA 4KHBB 2XQNM 1M7EA 1FHWA 1X05A 2N23A 4HDOA 4K17A 2JP2A 4NSWA 1QC6A 2I1JA 4ZRKA 3TCAA 1X11A 5DHAB 2I1KA 1ISNA 4B6HA 1XCGA 3MPXA 2EMSA 1TQZA 5C6RA
chains in the Genus database with same CATH superfamily
4QJ3B 2YT2A 2M38A 2FJLA 4DIXA 3PSCA 2P0DA 5JHGA 5J3QA 1J0WA 2EC1A 3IVFA 1EAZA 2KIGA 4HSIA 2HTHB 4WSFA 1M7RA 2HE7A 4CSQA 2CY5A 2GJYA 1TJ6A 3FM8C 3TW1A 1W1DA 1XODA 2CAYA 2KIEA 1FB8A 2AL6A 3AJ4A 5JHHA 3DXEA 4HAUB 3BINA 4HHVA 2ROVA 1H10A 1ZM0A 2GUMA 2L2IA 2DLWA 1DROA 4GXBA 1XD4A 5IRSA 2CRFA 2Z13A 5J3TA 2DKPA 1PMSA 1AWEA 1FOEA 3SUZA 1FGZA 1NU2A 3HK0A 2ZPYA 3HIEA 1U5EA 1V61A 2OTXA 4WVFB 4EJNA 3RCPA 1FHXA 4MY6A 4A5KA 5I2SA 2DX5A 1DDMA 1TXDA 3PG7A 1MI1A 1AQCA 1KI1B 4K81A 2DKQA 2IFSA 2MKRA 1UNRA 1X1FA 1T77A 3DXDA 3PZDA 3ULCA 2EMTA 2AEHA 1H4RA 2COCA 2DX1A 4A6FA 2W2WA 3CXBB 4Z2MB 3SV1A 1U5FA 2KUPA 2R09A 2DA0A 2Y7BA 4K2PA 5D27A 3SNHA 1U2BA 3X23A 2J0JA 4GMVA 3NWDA 1OY2A 3SYXA 1Y5OA 5KQ1A 2DN6A 4QJ4B 2FJUB 3KZ1A 3P7ZA 4EKUA 2KR0A 3MDBC 4HB2B 4WJ7A 1ZYIA 4GN1A 2LYDA 4HB0B 1NI2A 4HATB 3F5RA 2D9ZA 2V76A 4IAPA 2KUQA 4GMXB 5DH9B 3FEHA 4XWXA 2I5CA 2P0FA 1UNPA 2Z0OA 4IFSA 3V5WA 2RUKB 3OHMB 1FHOA 2COAA 2Z4DA 5KCVA 2RVBB 1V5PA 4L6EA 1U27A 1WI1A 5L81A 5C5BB 5FI0A 2Q13A 4D0NB 3KSYA 1BWNA 2J59M 2YS5A 3T06A 2D9YA 1K5GB 5CLQB 2NZ8B 1MPHA 2OQBA 4DXAB 2CODA 2DHKA 1X1GA 3DXCA 2D11A 3HW2B 2D9VA 1W1GA 3PP2A 4KHBA 4A6HA 1I7AA 2K2JA 2RGNB 1P5TA 1WJ1A 1DBHA 3HSAA 2K49A 2D4QA 5DIFB 2YT1A 2DYNA 2QKMA 1EVHA 3PVLA 3KRWA 4DX90 4F7UP 2MDXA 5LONB 2RNRB 2IYBA 2LOZA 4H8SA 4HB3B 2G35A 1UNQA 1V5MA 2PZ1A 1DDWA 1Z87A 2LKOA 1NTYA 1OMWA 2R0DA 2MWNB 3KRXA 3PVWA 5DI9B 3U8ZA 3CIKA 3TVVA 3FVCA 4L1RA 2QKLA 1RRPB 1MKEA 1WGQA 4C0AA 4D6WA 4PNKA 1NTVA 5JP4A 2GCJA 2LULA 2NBVA 1B55A 1SHCA 3ODWA 4KHAA 2KGXB 1P3RA 1Y19B 2UZRA 2GS0A 2ELBA 5GOWB 4EMOA 3WA0A 5JLJB 4A6KA 2J0KA 2DFKA 3OANA 4ZRIA 2ROZB 2NMBA 2YF0A 5CLLB 2MFQA 2W2XD 1UPQA 3ULBA 2LOXA 3WYFB 1X86A 4HAVB 1MK9B 1ZSQA 4MT7A 2YVCA 1XX0A 1MIXA 1BTKA 3PVUA 5M4YB 3M1IB 1GC7A 4TYZA 2X18A 1J19A 2P8VA 4K2OA 5EFXA 5D3VA 2BCJA 3D8DA 5LOPB 3UZTA 2COFA 2N0YA 1DDVA 2H7EA 1ZC3B 4GOUA 1RJ2A 2GCLA 2K00A 3ODOA 3O96A 2ZKMX 1P6SA 5D3YA 4PQ0A 1MAIA 1ZC4B 3G9WA 2ELAA 5FI1A 1V89A 5HE0A 1WG7A 2Y8FA 4KVGB 4HAZB 1ZVRA 2Z59A 3VOQA 3ML4A 1DYNA 4F7GA 1MK7B 4QXAB 5HE1A 3SO6A 2Z0PA 2K8EA 2L1CA 4HAYB 1U5GA 3NSUA 5D3WA 4OT1A 3FSSA 1GC6A 3HQCA 3B77A 1KZGA 1Q67A 4DX8A 5J3YA 4ZRJA 3A8QA 5HE3A 4IOYX 2E2XA 4P7IA 3AU4A 4CHMA 3QWMA 1BTNA 1V88A 4HAWB 5C5BA 4GPTB 4CYEA 1OQNA 1EGXA 3ZDTA 2EJ8A 2H7DA 1E5WA 3A98B 3TO1A 2VRWB 2ADZA 1WGUA 4KAXB 4YONA 2YS1A 1I2HA 2UVMA 2P0HA 3GYPA 4GZUA 5KQ4A 2J0MA 1MIZB 1PFJA 4F7HA 1UEFA 1N3HA 1XKEA 4Y94A 4BBKA 4HB4B 1KZ7A 3NW8A 2DYQA 2W2XC 5DHFB 2VKIA 1UPRA 1EF1A 4A6FB 3A8PA 3QBVB 1GG3A 5C79A 3DCXA 2UZSA 2YRYA 4HAXB 3BJIA 1BAKA 3PEGA 2DTCA 3GYOA 3N7CA 5LG4B 4CHJA 4MK0A 4Z2NA 2D9WA 1PLSA 2M14A 2RRFA 5HE2A 2D2QA 2Z14A 4KHOA 1WJMA 3D8EA 2CY4A 3KY9A 3TFMA 3U7DA 2K2UA 3QIJA 1SGHA 1IRSA 1LW3A 1WVHA 2YT0A 2Z0QA 2VSZA 4TKNA 4YL8A 4OSNA 4GNKB 4NY0A 3P6AA 1K5DB 3AU5A 2DHIA 5I2MA 3ODXA 2LG1A 2D10A 5D3XA 2I5FA 2YSZA 4DBBA 3D8FA 4QJ5B 1FAOA 2Y8GA 1LB1A 2R2YA 3VIAA 2RSGA 5C16A 1QQGA 2KCJA 1XR0B 3NWFA 1W1HA 2D9XA 2YS3A 3LJUX 2DHJA 3ZVRA 1FGYA 2RLOA 1U5DA 3F0WA 1U29A 1V5UA 4HDQA 4KHBB 2XQNM 1M7EA 1FHWA 1X05A 2N23A 4HDOA 4K17A 2JP2A 4NSWA 1QC6A 2I1JA 4ZRKA 3TCAA 3U12A 1X11A 5DHAB 2I1KA 3A58A 1ISNA 4B6HA 3NWAA 1XCGA 3MPXA 2EMSA 1TQZA 5C6RA
chains in the Genus database with same CATH topology
2M38A 2FJLA 3PSCA 2P0DA 5JHGA 5J3QA 1J0WA 2EC1A 3IVFA 1EAZA 2HTHB 4WSFA 1M7RA 2HE7A 2CY5A 2GJYA 1TJ6A 3FM8C 3TW1A 1W1DA 1XODA 2CAYA 1FB8A 2AL6A 3AJ4A 5JHHA 3DXEA 4HAUB 3BINA 4HHVA 2ROVA 1H10A 1ZM0A 2L2IA 2DLWA 1DROA 4GXBA 1XD4A 2CRFA 5J3TA 2DKPA 1PMSA 1AWEA 1FOEA 3SUZA 1FGZA 1NU2A 3HK0A 2ZPYA 1U5EA 1V61A 2OTXA 4WVFB 4EJNA 3RCPA 1FHXA 4MY6A 4A5KA 2DX5A 1DDMA 1TXDA 3PG7A 1AQCA 1KI1B 4K81A 2DKQA 2IFSA 2MKRA 1UNRA 1X1FA 3DXDA 3PZDA 3ULCA 2EMTA 2AEHA 1H4RA 2COCA 2DX1A 4A6FA 2W2WA 3CXBB 4Z2MB 3SV1A 1U5FA 2KUPA 2R09A 2DA0A 2Y7BA 4K2PA 5D27A 3SNHA 1U2BA 3X23A 2J0JA 4GMVA 1OY2A 3SYXA 1Y5OA 5KQ1A 2DN6A 3KZ1A 3P7ZA 4EKUA 3MDBC 4HB2B 4WJ7A 4GN1A 2LYDA 4HB0B 1NI2A 4HATB 3F5RA 2D9ZA 2V76A 4IAPA 4GMXB 5DH9B 3FEHA 4XWXA 2I5CA 2P0FA 1UNPA 2Z0OA 4IFSA 3V5WA 2RUKB 1FHOA 2COAA 5KCVA 2RVBB 1V5PA 4L6EA 1U27A 1WI1A 5L81A 5C5BB 5FI0A 2Q13A 4D0NB 3KSYA 1BWNA 2J59M 2YS5A 3T06A 2D9YA 1K5GB 5CLQB 2NZ8B 1MPHA 2OQBA 4DXAB 2CODA 2DHKA 1X1GA 3DXCA 2D11A 3HW2B 2D9VA 1W1GA 3PP2A 4A6HA 1I7AA 2K2JA 2RGNB 1P5TA 1WJ1A 1DBHA 2D4QA 5DIFB 2YT1A 2DYNA 2QKMA 1EVHA 3PVLA 3KRWA 4DX90 4F7UP 2MDXA 5LONB 2RNRB 2IYBA 2LOZA 4H8SA 4HB3B 2G35A 1UNQA 1V5MA 2PZ1A 1DDWA 1Z87A 2LKOA 1NTYA 1OMWA 2R0DA 2MWNB 3KRXA 3PVWA 5DI9B 3U8ZA 3CIKA 3TVVA 2QKLA 1RRPB 1MKEA 1WGQA 4C0AA 4PNKA 1NTVA 5JP4A 2GCJA 2LULA 3ODWA 1B55A 1SHCA 4KHAA 2KGXB 1P3RA 1Y19B 2UZRA 2GS0A 2ELBA 5GOWB 4EMOA 3WA0A 5JLJB 4A6KA 2J0KA 2DFKA 3OANA 4ZRIA 2ROZB 2NMBA 2YF0A 5CLLB 2MFQA 2W2XD 1UPQA 3ULBA 2LOXA 3WYFB 1X86A 4HAVB 1MK9B 1ZSQA 4MT7A 2YVCA 1XX0A 1MIXA 1BTKA 3PVUA 3M1IB 1GC7A 4TYZA 2X18A 1J19A 2P8VA 4K2OA 5EFXA 5D3VA 2BCJA 3D8DA 5LOPB 3UZTA 2COFA 2N0YA 1DDVA 2H7EA 1ZC3B 1RJ2A 2GCLA 2K00A 3ODOA 3O96A 1P6SA 5D3YA 4PQ0A 1MAIA 1ZC4B 3G9WA 2ELAA 5FI1A 1V89A 5HE0A 1WG7A 2Y8FA 4KVGB 4HAZB 1ZVRA 3VOQA 3ML4A 1DYNA 4F7GA 1MK7B 5HE1A 3SO6A 2Z0PA 2L1CA 4HAYB 1U5GA 3NSUA 5D3WA 3FSSA 1GC6A 3HQCA 1KZGA 1Q67A 4DX8A 5J3YA 4ZRJA 3A8QA 5HE3A 4IOYX 2E2XA 4P7IA 3AU4A 4CHMA 3QWMA 1BTNA 1V88A 4HAWB 5C5BA 4GPTB 4CYEA 1OQNA 1EGXA 3ZDTA 2EJ8A 2H7DA 1E5WA 3A98B 3TO1A 2VRWB 2ADZA 1WGUA 4KAXB 4YONA 1I2HA 2YS1A 2UVMA 2P0HA 3GYPA 4GZUA 5KQ4A 2J0MA 1MIZB 1PFJA 4F7HA 1UEFA 1N3HA 1XKEA 4Y94A 4BBKA 4HB4B 1KZ7A 2DYQA 2W2XC 5DHFB 2VKIA 1UPRA 1EF1A 4A6FB 3A8PA 3QBVB 1GG3A 5C79A 2UZSA 2YRYA 4HAXB 3BJIA 1BAKA 3PEGA 2DTCA 3GYOA 3N7CA 4CHJA 4MK0A 4Z2NA 2D9WA 1PLSA 2M14A 5HE2A 2D2QA 4KHOA 1WJMA 3D8EA 2CY4A 3KY9A 3TFMA 3U7DA 2K2UA 3QIJA 1SGHA 1IRSA 1LW3A 1WVHA 2YT0A 2Z0QA 2VSZA 4TKNA 4YL8A 4NY0A 3P6AA 1K5DB 3AU5A 2DHIA 3ODXA 2LG1A 2D10A 5D3XA 2I5FA 2YSZA 4DBBA 3D8FA 1FAOA 2Y8GA 1LB1A 3VIAA 2RSGA 5C16A 1QQGA 2KCJA 1XR0B 1W1HA 2D9XA 2YS3A 3LJUX 2DHJA 3ZVRA 1FGYA 2RLOA 1U5DA 3F0WA 1U29A 1V5UA 4HDQA 4KHBB 2XQNM 1M7EA 1FHWA 1X05A 2N23A 4HDOA 4K17A 2JP2A 4NSWA 1QC6A 2I1JA 4ZRKA 3TCAA 1X11A 5DHAB 2I1KA 1ISNA 4B6HA 1XCGA 3MPXA 2EMSA 1TQZA 5C6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M38 A;  2FJL A;  3PSC A;  2P0D A;  5JHG A;  5J3Q A;  1J0W A;  2EC1 A;  3IVF A;  1EAZ A;  2HTH B;  4WSF A;  1M7R A;  2HE7 A;  2CY5 A;  2GJY A;  1TJ6 A;  3FM8 C;  3TW1 A;  1W1D A;  1XOD A;  2CAY A;  1FB8 A;  2AL6 A;  3AJ4 A;  5JHH A;  3DXE A;  4HAU B;  3BIN A;  4HHV A;  2ROV A;  1H10 A;  1ZM0 A;  2L2I A;  2DLW A;  1DRO A;  4GXB A;  1XD4 A;  2CRF A;  5J3T A;  2DKP A;  1PMS A;  1AWE A;  1FOE A;  3SUZ A;  1FGZ A;  1NU2 A;  3HK0 A;  2ZPY A;  1U5E A;  1V61 A;  2OTX A;  4WVF B;  4EJN A;  3RCP A;  1FHX A;  4MY6 A;  4A5K A;  2DX5 A;  1DDM A;  1TXD A;  3PG7 A;  1AQC A;  1KI1 B;  4K81 A;  2DKQ A;  2IFS A;  2MKR A;  1UNR A;  1X1F A;  3DXD A;  3PZD A;  3ULC A;  2EMT A;  2AEH A;  1H4R A;  2COC A;  2DX1 A;  4A6F A;  2W2W A;  3CXB B;  4Z2M B;  3SV1 A;  1U5F A;  2KUP A;  2R09 A;  2DA0 A;  2Y7B A;  4K2P A;  5D27 A;  3SNH A;  1U2B A;  3X23 A;  2J0J A;  4GMV A;  1OY2 A;  3SYX A;  1Y5O A;  5KQ1 A;  2DN6 A;  3KZ1 A;  3P7Z A;  4EKU A;  3MDB C;  4HB2 B;  4WJ7 A;  4GN1 A;  2LYD A;  4HB0 B;  1NI2 A;  4HAT B;  3F5R A;  2D9Z A;  2V76 A;  4IAP A;  4GMX B;  5DH9 B;  3FEH A;  4XWX A;  2I5C A;  2P0F A;  1UNP A;  2Z0O A;  4IFS A;  3V5W A;  2RUK B;  1FHO A;  2COA A;  5KCV A;  2RVB B;  1V5P A;  4L6E A;  1U27 A;  1WI1 A;  5L81 A;  5C5B B;  5FI0 A;  2Q13 A;  4D0N B;  3KSY A;  1BWN A;  2J59 M;  2YS5 A;  3T06 A;  2D9Y A;  1K5G B;  5CLQ B;  2NZ8 B;  1MPH A;  2OQB A;  4DXA B;  2COD A;  2DHK A;  1X1G A;  3DXC A;  2D11 A;  3HW2 B;  2D9V A;  1W1G A;  3PP2 A;  4A6H A;  1I7A A;  2K2J A;  2RGN B;  1P5T A;  1WJ1 A;  1DBH A;  2D4Q A;  5DIF B;  2YT1 A;  2DYN A;  2QKM A;  1EVH A;  3PVL A;  3KRW A;  4DX9 0;  4F7U P;  2MDX A;  5LON B;  2RNR B;  2IYB A;  2LOZ A;  4H8S A;  4HB3 B;  2G35 A;  1UNQ A;  1V5M A;  2PZ1 A;  1DDW A;  1Z87 A;  2LKO A;  1NTY A;  1OMW A;  2R0D A;  2MWN B;  3KRX A;  3PVW A;  5DI9 B;  3U8Z A;  3CIK A;  3TVV A;  2QKL A;  1RRP B;  1MKE A;  1WGQ A;  4C0A A;  4PNK A;  1NTV A;  5JP4 A;  2GCJ A;  2LUL A;  3ODW A;  1B55 A;  1SHC A;  4KHA A;  2KGX B;  1P3R A;  1Y19 B;  2UZR A;  2GS0 A;  2ELB A;  5GOW B;  4EMO A;  3WA0 A;  5JLJ B;  4A6K A;  2J0K A;  2DFK A;  3OAN A;  4ZRI A;  2ROZ B;  2NMB A;  2YF0 A;  5CLL B;  2MFQ A;  2W2X D;  1UPQ A;  3ULB A;  2LOX A;  3WYF B;  1X86 A;  4HAV B;  1MK9 B;  1ZSQ A;  4MT7 A;  2YVC A;  1XX0 A;  1MIX A;  1BTK A;  3PVU A;  3M1I B;  1GC7 A;  4TYZ A;  2X18 A;  1J19 A;  2P8V A;  4K2O A;  5EFX A;  5D3V A;  2BCJ A;  3D8D A;  5LOP B;  3UZT A;  2COF A;  2N0Y A;  1DDV A;  2H7E A;  1ZC3 B;  1RJ2 A;  2GCL A;  2K00 A;  3ODO A;  3O96 A;  1P6S A;  5D3Y A;  4PQ0 A;  1MAI A;  1ZC4 B;  3G9W A;  2ELA A;  5FI1 A;  1V89 A;  5HE0 A;  1WG7 A;  2Y8F A;  4KVG B;  4HAZ B;  1ZVR A;  3VOQ A;  3ML4 A;  1DYN A;  4F7G A;  1MK7 B;  5HE1 A;  3SO6 A;  2Z0P A;  2L1C A;  4HAY B;  1U5G A;  3NSU A;  5D3W A;  3FSS A;  1GC6 A;  3HQC A;  1KZG A;  1Q67 A;  4DX8 A;  5J3Y A;  4ZRJ A;  3A8Q A;  5HE3 A;  4IOY X;  2E2X A;  4P7I A;  3AU4 A;  4CHM A;  3QWM A;  1BTN A;  1V88 A;  4HAW B;  5C5B A;  4GPT B;  4CYE A;  1OQN A;  1EGX A;  3ZDT A;  2EJ8 A;  2H7D A;  1E5W A;  3A98 B;  3TO1 A;  2VRW B;  2ADZ A;  1WGU A;  4KAX B;  4YON A;  1I2H A;  2YS1 A;  2UVM A;  2P0H A;  3GYP A;  4GZU A;  5KQ4 A;  2J0M A;  1MIZ B;  1PFJ A;  4F7H A;  1UEF A;  1N3H A;  1XKE A;  4Y94 A;  4BBK A;  4HB4 B;  1KZ7 A;  2DYQ A;  2W2X C;  5DHF B;  2VKI A;  1UPR A;  1EF1 A;  4A6F B;  3A8P A;  3QBV B;  1GG3 A;  5C79 A;  2UZS A;  2YRY A;  4HAX B;  3BJI A;  1BAK A;  3PEG A;  2DTC A;  3GYO A;  3N7C A;  4CHJ A;  4MK0 A;  4Z2N A;  2D9W A;  1PLS A;  2M14 A;  5HE2 A;  2D2Q A;  4KHO A;  1WJM A;  3D8E A;  2CY4 A;  3KY9 A;  3TFM A;  3U7D A;  2K2U A;  3QIJ A;  1SGH A;  1IRS A;  1LW3 A;  1WVH A;  2YT0 A;  2Z0Q A;  2VSZ A;  4TKN A;  4YL8 A;  4NY0 A;  3P6A A;  1K5D B;  3AU5 A;  2DHI A;  3ODX A;  2LG1 A;  2D10 A;  5D3X A;  2I5F A;  2YSZ A;  4DBB A;  3D8F A;  1FAO A;  2Y8G A;  1LB1 A;  3VIA A;  2RSG A;  5C16 A;  1QQG A;  2KCJ A;  1XR0 B;  1W1H A;  2D9X A;  2YS3 A;  3LJU X;  2DHJ A;  3ZVR A;  1FGY A;  2RLO A;  1U5D A;  3F0W A;  1U29 A;  1V5U A;  4HDQ A;  4KHB B;  2XQN M;  1M7E A;  1FHW A;  1X05 A;  2N23 A;  4HDO A;  4K17 A;  2JP2 A;  4NSW A;  1QC6 A;  2I1J A;  4ZRK A;  3TCA A;  1X11 A;  5DHA B;  2I1K A;  1ISN A;  4B6H A;  1XCG A;  3MPX A;  2EMS A;  1TQZ A;  5C6R A; 
#chains in the Genus database with same CATH topology
 4QJ3 B;  2YT2 A;  2M38 A;  2FJL A;  4DIX A;  3PSC A;  2P0D A;  5JHG A;  5J3Q A;  1J0W A;  2EC1 A;  3IVF A;  1EAZ A;  2KIG A;  4HSI A;  2HTH B;  4WSF A;  1M7R A;  2HE7 A;  4CSQ A;  2CY5 A;  2GJY A;  1TJ6 A;  3FM8 C;  3TW1 A;  1W1D A;  1XOD A;  2CAY A;  2KIE A;  1FB8 A;  2AL6 A;  3AJ4 A;  5JHH A;  3DXE A;  4HAU B;  3BIN A;  4HHV A;  2ROV A;  1H10 A;  1ZM0 A;  2GUM A;  2L2I A;  2DLW A;  1DRO A;  4GXB A;  1XD4 A;  5IRS A;  2CRF A;  2Z13 A;  5J3T A;  2DKP A;  1PMS A;  1AWE A;  1FOE A;  3SUZ A;  1FGZ A;  1NU2 A;  3HK0 A;  2ZPY A;  3HIE A;  1U5E A;  1V61 A;  2OTX A;  4WVF B;  4EJN A;  3RCP A;  1FHX A;  4MY6 A;  4A5K A;  5I2S A;  2DX5 A;  1DDM A;  1TXD A;  3PG7 A;  1MI1 A;  1AQC A;  1KI1 B;  4K81 A;  2DKQ A;  2IFS A;  2MKR A;  1UNR A;  1X1F A;  1T77 A;  3DXD A;  3PZD A;  3ULC A;  2EMT A;  2AEH A;  1H4R A;  2COC A;  2DX1 A;  4A6F A;  2W2W A;  3CXB B;  4Z2M B;  3SV1 A;  1U5F A;  2KUP A;  2R09 A;  2DA0 A;  2Y7B A;  4K2P A;  5D27 A;  3SNH A;  1U2B A;  3X23 A;  2J0J A;  4GMV A;  3NWD A;  1OY2 A;  3SYX A;  1Y5O A;  5KQ1 A;  2DN6 A;  4QJ4 B;  2FJU B;  3KZ1 A;  3P7Z A;  4EKU A;  2KR0 A;  3MDB C;  4HB2 B;  4WJ7 A;  1ZYI A;  4GN1 A;  2LYD A;  4HB0 B;  1NI2 A;  4HAT B;  3F5R A;  2D9Z A;  2V76 A;  4IAP A;  2KUQ A;  4GMX B;  5DH9 B;  3FEH A;  4XWX A;  2I5C A;  2P0F A;  1UNP A;  2Z0O A;  4IFS A;  3V5W A;  2RUK B;  3OHM B;  1FHO A;  2COA A;  2Z4D A;  5KCV A;  2RVB B;  1V5P A;  4L6E A;  1U27 A;  1WI1 A;  5L81 A;  5C5B B;  5FI0 A;  2Q13 A;  4D0N B;  3KSY A;  1BWN A;  2J59 M;  2YS5 A;  3T06 A;  2D9Y A;  1K5G B;  5CLQ B;  2NZ8 B;  1MPH A;  2OQB A;  4DXA B;  2COD A;  2DHK A;  1X1G A;  3DXC A;  2D11 A;  3HW2 B;  2D9V A;  1W1G A;  3PP2 A;  4KHB A;  4A6H A;  1I7A A;  2K2J A;  2RGN B;  1P5T A;  1WJ1 A;  1DBH A;  3HSA A;  2K49 A;  2D4Q A;  5DIF B;  2YT1 A;  2DYN A;  2QKM A;  1EVH A;  3PVL A;  3KRW A;  4DX9 0;  4F7U P;  2MDX A;  5LON B;  2RNR B;  2IYB A;  2LOZ A;  4H8S A;  4HB3 B;  2G35 A;  1UNQ A;  1V5M A;  2PZ1 A;  1DDW A;  1Z87 A;  2LKO A;  1NTY A;  1OMW A;  2R0D A;  2MWN B;  3KRX A;  3PVW A;  5DI9 B;  3U8Z A;  3CIK A;  3TVV A;  3FVC A;  4L1R A;  2QKL A;  1RRP B;  1MKE A;  1WGQ A;  4C0A A;  4D6W A;  4PNK A;  1NTV A;  5JP4 A;  2GCJ A;  2LUL A;  2NBV A;  1B55 A;  1SHC A;  3ODW A;  4KHA A;  2KGX B;  1P3R A;  1Y19 B;  2UZR A;  2GS0 A;  2ELB A;  5GOW B;  4EMO A;  3WA0 A;  5JLJ B;  4A6K A;  2J0K A;  2DFK A;  3OAN A;  4ZRI A;  2ROZ B;  2NMB A;  2YF0 A;  5CLL B;  2MFQ A;  2W2X D;  1UPQ A;  3ULB A;  2LOX A;  3WYF B;  1X86 A;  4HAV B;  1MK9 B;  1ZSQ A;  4MT7 A;  2YVC A;  1XX0 A;  1MIX A;  1BTK A;  3PVU A;  5M4Y B;  3M1I B;  1GC7 A;  4TYZ A;  2X18 A;  1J19 A;  2P8V A;  4K2O A;  5EFX A;  5D3V A;  2BCJ A;  3D8D A;  5LOP B;  3UZT A;  2COF A;  2N0Y A;  1DDV A;  2H7E A;  1ZC3 B;  4GOU A;  1RJ2 A;  2GCL A;  2K00 A;  3ODO A;  3O96 A;  2ZKM X;  1P6S A;  5D3Y A;  4PQ0 A;  1MAI A;  1ZC4 B;  3G9W A;  2ELA A;  5FI1 A;  1V89 A;  5HE0 A;  1WG7 A;  2Y8F A;  4KVG B;  4HAZ B;  1ZVR A;  2Z59 A;  3VOQ A;  3ML4 A;  1DYN A;  4F7G A;  1MK7 B;  4QXA B;  5HE1 A;  3SO6 A;  2Z0P A;  2K8E A;  2L1C A;  4HAY B;  1U5G A;  3NSU A;  5D3W A;  4OT1 A;  3FSS A;  1GC6 A;  3HQC A;  3B77 A;  1KZG A;  1Q67 A;  4DX8 A;  5J3Y A;  4ZRJ A;  3A8Q A;  5HE3 A;  4IOY X;  2E2X A;  4P7I A;  3AU4 A;  4CHM A;  3QWM A;  1BTN A;  1V88 A;  4HAW B;  5C5B A;  4GPT B;  4CYE A;  1OQN A;  1EGX A;  3ZDT A;  2EJ8 A;  2H7D A;  1E5W A;  3A98 B;  3TO1 A;  2VRW B;  2ADZ A;  1WGU A;  4KAX B;  4YON A;  2YS1 A;  1I2H A;  2UVM A;  2P0H A;  3GYP A;  4GZU A;  5KQ4 A;  2J0M A;  1MIZ B;  1PFJ A;  4F7H A;  1UEF A;  1N3H A;  1XKE A;  4Y94 A;  4BBK A;  4HB4 B;  1KZ7 A;  3NW8 A;  2DYQ A;  2W2X C;  5DHF B;  2VKI A;  1UPR A;  1EF1 A;  4A6F B;  3A8P A;  3QBV B;  1GG3 A;  5C79 A;  3DCX A;  2UZS A;  2YRY A;  4HAX B;  3BJI A;  1BAK A;  3PEG A;  2DTC A;  3GYO A;  3N7C A;  5LG4 B;  4CHJ A;  4MK0 A;  4Z2N A;  2D9W A;  1PLS A;  2M14 A;  2RRF A;  5HE2 A;  2D2Q A;  2Z14 A;  4KHO A;  1WJM A;  3D8E A;  2CY4 A;  3KY9 A;  3TFM A;  3U7D A;  2K2U A;  3QIJ A;  1SGH A;  1IRS A;  1LW3 A;  1WVH A;  2YT0 A;  2Z0Q A;  2VSZ A;  4TKN A;  4YL8 A;  4OSN A;  4GNK B;  4NY0 A;  3P6A A;  1K5D B;  3AU5 A;  2DHI A;  5I2M A;  3ODX A;  2LG1 A;  2D10 A;  5D3X A;  2I5F A;  2YSZ A;  4DBB A;  3D8F A;  4QJ5 B;  1FAO A;  2Y8G A;  1LB1 A;  2R2Y A;  3VIA A;  2RSG A;  5C16 A;  1QQG A;  2KCJ A;  1XR0 B;  3NWF A;  1W1H A;  2D9X A;  2YS3 A;  3LJU X;  2DHJ A;  3ZVR A;  1FGY A;  2RLO A;  1U5D A;  3F0W A;  1U29 A;  1V5U A;  4HDQ A;  4KHB B;  2XQN M;  1M7E A;  1FHW A;  1X05 A;  2N23 A;  4HDO A;  4K17 A;  2JP2 A;  4NSW A;  1QC6 A;  2I1J A;  4ZRK A;  3TCA A;  3U12 A;  1X11 A;  5DHA B;  2I1K A;  3A58 A;  1ISN A;  4B6H A;  3NWA A;  1XCG A;  3MPX A;  2EMS A;  1TQZ A;  5C6R A; 
#chains in the Genus database with same CATH homology
 2M38 A;  2FJL A;  3PSC A;  2P0D A;  5JHG A;  5J3Q A;  1J0W A;  2EC1 A;  3IVF A;  1EAZ A;  2HTH B;  4WSF A;  1M7R A;  2HE7 A;  2CY5 A;  2GJY A;  1TJ6 A;  3FM8 C;  3TW1 A;  1W1D A;  1XOD A;  2CAY A;  1FB8 A;  2AL6 A;  3AJ4 A;  5JHH A;  3DXE A;  4HAU B;  3BIN A;  4HHV A;  2ROV A;  1H10 A;  1ZM0 A;  2L2I A;  2DLW A;  1DRO A;  4GXB A;  1XD4 A;  2CRF A;  5J3T A;  2DKP A;  1PMS A;  1AWE A;  1FOE A;  3SUZ A;  1FGZ A;  1NU2 A;  3HK0 A;  2ZPY A;  1U5E A;  1V61 A;  2OTX A;  4WVF B;  4EJN A;  3RCP A;  1FHX A;  4MY6 A;  4A5K A;  2DX5 A;  1DDM A;  1TXD A;  3PG7 A;  1AQC A;  1KI1 B;  4K81 A;  2DKQ A;  2IFS A;  2MKR A;  1UNR A;  1X1F A;  3DXD A;  3PZD A;  3ULC A;  2EMT A;  2AEH A;  1H4R A;  2COC A;  2DX1 A;  4A6F A;  2W2W A;  3CXB B;  4Z2M B;  3SV1 A;  1U5F A;  2KUP A;  2R09 A;  2DA0 A;  2Y7B A;  4K2P A;  5D27 A;  3SNH A;  1U2B A;  3X23 A;  2J0J A;  4GMV A;  1OY2 A;  3SYX A;  1Y5O A;  5KQ1 A;  2DN6 A;  3KZ1 A;  3P7Z A;  4EKU A;  3MDB C;  4HB2 B;  4WJ7 A;  4GN1 A;  2LYD A;  4HB0 B;  1NI2 A;  4HAT B;  3F5R A;  2D9Z A;  2V76 A;  4IAP A;  4GMX B;  5DH9 B;  3FEH A;  4XWX A;  2I5C A;  2P0F A;  1UNP A;  2Z0O A;  4IFS A;  3V5W A;  2RUK B;  1FHO A;  2COA A;  5KCV A;  2RVB B;  1V5P A;  4L6E A;  1U27 A;  1WI1 A;  5L81 A;  5C5B B;  5FI0 A;  2Q13 A;  4D0N B;  3KSY A;  1BWN A;  2J59 M;  2YS5 A;  3T06 A;  2D9Y A;  1K5G B;  5CLQ B;  2NZ8 B;  1MPH A;  2OQB A;  4DXA B;  2COD A;  2DHK A;  1X1G A;  3DXC A;  2D11 A;  3HW2 B;  2D9V A;  1W1G A;  3PP2 A;  4A6H A;  1I7A A;  2K2J A;  2RGN B;  1P5T A;  1WJ1 A;  1DBH A;  2D4Q A;  5DIF B;  2YT1 A;  2DYN A;  2QKM A;  1EVH A;  3PVL A;  3KRW A;  4DX9 0;  4F7U P;  2MDX A;  5LON B;  2RNR B;  2IYB A;  2LOZ A;  4H8S A;  4HB3 B;  2G35 A;  1UNQ A;  1V5M A;  2PZ1 A;  1DDW A;  1Z87 A;  2LKO A;  1NTY A;  1OMW A;  2R0D A;  2MWN B;  3KRX A;  3PVW A;  5DI9 B;  3U8Z A;  3CIK A;  3TVV A;  2QKL A;  1RRP B;  1MKE A;  1WGQ A;  4C0A A;  4PNK A;  1NTV A;  5JP4 A;  2GCJ A;  2LUL A;  3ODW A;  1B55 A;  1SHC A;  4KHA A;  2KGX B;  1P3R A;  1Y19 B;  2UZR A;  2GS0 A;  2ELB A;  5GOW B;  4EMO A;  3WA0 A;  5JLJ B;  4A6K A;  2J0K A;  2DFK A;  3OAN A;  4ZRI A;  2ROZ B;  2NMB A;  2YF0 A;  5CLL B;  2MFQ A;  2W2X D;  1UPQ A;  3ULB A;  2LOX A;  3WYF B;  1X86 A;  4HAV B;  1MK9 B;  1ZSQ A;  4MT7 A;  2YVC A;  1XX0 A;  1MIX A;  1BTK A;  3PVU A;  3M1I B;  1GC7 A;  4TYZ A;  2X18 A;  1J19 A;  2P8V A;  4K2O A;  5EFX A;  5D3V A;  2BCJ A;  3D8D A;  5LOP B;  3UZT A;  2COF A;  2N0Y A;  1DDV A;  2H7E A;  1ZC3 B;  1RJ2 A;  2GCL A;  2K00 A;  3ODO A;  3O96 A;  1P6S A;  5D3Y A;  4PQ0 A;  1MAI A;  1ZC4 B;  3G9W A;  2ELA A;  5FI1 A;  1V89 A;  5HE0 A;  1WG7 A;  2Y8F A;  4KVG B;  4HAZ B;  1ZVR A;  3VOQ A;  3ML4 A;  1DYN A;  4F7G A;  1MK7 B;  5HE1 A;  3SO6 A;  2Z0P A;  2L1C A;  4HAY B;  1U5G A;  3NSU A;  5D3W A;  3FSS A;  1GC6 A;  3HQC A;  1KZG A;  1Q67 A;  4DX8 A;  5J3Y A;  4ZRJ A;  3A8Q A;  5HE3 A;  4IOY X;  2E2X A;  4P7I A;  3AU4 A;  4CHM A;  3QWM A;  1BTN A;  1V88 A;  4HAW B;  5C5B A;  4GPT B;  4CYE A;  1OQN A;  1EGX A;  3ZDT A;  2EJ8 A;  2H7D A;  1E5W A;  3A98 B;  3TO1 A;  2VRW B;  2ADZ A;  1WGU A;  4KAX B;  4YON A;  1I2H A;  2YS1 A;  2UVM A;  2P0H A;  3GYP A;  4GZU A;  5KQ4 A;  2J0M A;  1MIZ B;  1PFJ A;  4F7H A;  1UEF A;  1N3H A;  1XKE A;  4Y94 A;  4BBK A;  4HB4 B;  1KZ7 A;  2DYQ A;  2W2X C;  5DHF B;  2VKI A;  1UPR A;  1EF1 A;  4A6F B;  3A8P A;  3QBV B;  1GG3 A;  5C79 A;  2UZS A;  2YRY A;  4HAX B;  3BJI A;  1BAK A;  3PEG A;  2DTC A;  3GYO A;  3N7C A;  4CHJ A;  4MK0 A;  4Z2N A;  2D9W A;  1PLS A;  2M14 A;  5HE2 A;  2D2Q A;  4KHO A;  1WJM A;  3D8E A;  2CY4 A;  3KY9 A;  3TFM A;  3U7D A;  2K2U A;  3QIJ A;  1SGH A;  1IRS A;  1LW3 A;  1WVH A;  2YT0 A;  2Z0Q A;  2VSZ A;  4TKN A;  4YL8 A;  4NY0 A;  3P6A A;  1K5D B;  3AU5 A;  2DHI A;  3ODX A;  2LG1 A;  2D10 A;  5D3X A;  2I5F A;  2YSZ A;  4DBB A;  3D8F A;  1FAO A;  2Y8G A;  1LB1 A;  3VIA A;  2RSG A;  5C16 A;  1QQG A;  2KCJ A;  1XR0 B;  1W1H A;  2D9X A;  2YS3 A;  3LJU X;  2DHJ A;  3ZVR A;  1FGY A;  2RLO A;  1U5D A;  3F0W A;  1U29 A;  1V5U A;  4HDQ A;  4KHB B;  2XQN M;  1M7E A;  1FHW A;  1X05 A;  2N23 A;  4HDO A;  4K17 A;  2JP2 A;  4NSW A;  1QC6 A;  2I1J A;  4ZRK A;  3TCA A;  1X11 A;  5DHA B;  2I1K A;  1ISN A;  4B6H A;  1XCG A;  3MPX A;  2EMS A;  1TQZ A;  5C6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...