2DHKA

Solution structure of the ph domain of tbc1 domain family member 2 protein from human
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKKLCGYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMKRWEFHNSPPAPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of TBC1 domain family member 2 protein from human
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TBC1 domain family member 2
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhkA01
4K81A 2MWNB 1H4RA 2DKPA 4CHMA 2VRWB 5C79A 1DDWA 3GYOA 4KHOA 1RJ2A 1K5GB 2Q13A 2D4QA 1I2HA 5L81A 5D27A 4B6HA 1V5UA 3ML4A 1NU2A 1GG3A 5D3XA 4HATB 2HTHB 2CAYA 2DYNA 4EJNA 2MKRA 1Q67A 1LB1A 1DDVA 4IAPA 2LOZA 2FJLA 2MFQA 3WYFB 2Y8FA 1UPQA 4P7IA 5JLJB 4WJ7A 2K2UA 3A8PA 3ODWA 3TVVA 1J0WA 2VSZA 3VOQA 2AL6A 4KVGB 1U5DA 1WI1A 3AU5A 3FM8C 1ZSQA 5KQ1A 4DBBA 4GPTB 1WGQA 2EMTA 1FB8A 3UZTA 3PVUA 2D2QA 2DYQA 4A6FA 4F7GA 2DX5A 2W2XD 2I1KA 1V5PA 2Y8GA 4HAUB 2LKOA 3HK0A 2P0HA 3SO6A 5FI0A 3KZ1A 5D3VA 1KI1B 1UNPA 3CXBB 5D3YA 2N23A 1W1HA 2P8VA 5HE0A 3TCAA 1FGYA 1FAOA 3QWMA 1U5EA 5J3QA 1X05A 3D8DA 4TYZA 4HB2B 4WVFB 5C16A 5C5BB 1WGUA 2P0DA 4WSFA 2W2WA 1OY2A 1TXDA 1NTYA 2P0FA 2I5FA 2E2XA 1MK7B 1XD4A 3KSYA 4BBKA 1UPRA 4GMXB 4NSWA 2MDXA 3O96A 4CYEA 4HAYB 1Y19B 5DHFB 3CIKA 2YT1A 5J3TA 5HE1A 1K5DB 2M14A 3SV1A 1GC6A 1OMWA 2W2XC 5JHHA 1FGZA 4HHVA 4NY0A 2KUPA 1M7RA 5DHAB 1UEFA 1AWEA 4KHBB 3SNHA 4ZRIA 4TKNA 1QC6A 3PP2A 3QBVB 4HB3B 1X1GA 5CLQB 1X1FA 4D0NB 2UVMA 1U27A 2IFSA 2YS1A 2ROVA 2KGXB 2DHKA 2ELBA 3MDBC 2Z0OA 3TW1A 1FHWA 2LYDA 5JHGA 1BAKA 4F7UP 4DX8A 2D11A 4KAXB 1PLSA 1P3RA 1N3HA 1V61A 1E5WA 1SHCA 1Y5OA 3PVLA 3TFMA 1U2BA 1ZM0A 5D3WA 2XQNM 5HE3A 1H10A 2Z0PA 2DLWA 2CY4A 3ZDTA 4MY6A 4ZRKA 1WVHA 2EC1A 1P5TA 2RNRB 4HDQA 1TQZA 2Y7BA 3ODOA 3RCPA 5DI9B 2D9XA 2EMSA 2RLOA 4IOYX 1V88A 2EJ8A 4KHAA 3D8EA 3FEHA 2YSZA 3U7DA 4HB0B 3ZVRA 4Z2NA 3BJIA 1UNRA 3P7ZA 3ODXA 1X11A 1FHOA 4C0AA 1IRSA 1W1GA 2LG1A 3AJ4A 1MPHA 1RRPB 1ZVRA 4DXAB 5EFXA 2YT0A 2L2IA 1ZC4B 5GOWB 3PZDA 1QQGA 2QKMA 5KQ4A 2V76A 2OQBA 2OTXA 2YS5A 3SYXA 3TO1A 1X86A 1SGHA 1U29A 3HW2B 4F7HA 4YL8A 1U5GA 4IFSA 2GJYA 3SUZA 1KZGA 3OANA 1NI2A 2UZRA 5DH9B 4HAXB 1V5MA 2CRFA 3F5RA 2JP2A 1EGXA 2J0KA 3T06A 2YF0A 1PFJA 2H7EA 3M1IB 3N7CA 1GC7A 3NSUA 3KRWA 2UZSA 3PVWA 2D9YA 2VKIA 4MK0A 1WJ1A 3BINA 5C5BA 4H8SA 4K2OA 1B55A 2QKLA 1MIXA 1FOEA 1Z87A 2K2JA 2K00A 3G9WA 4XWXA 1ZC3B 1XODA 2D9WA 2GCJA 1MIZB 1EAZA 2D9ZA 2M38A 3F0WA 2DN6A 3MPXA 2COCA 1EF1A 3DXDA 2DKQA 3WA0A 4HAWB 4YONA 1P6SA 1MK9B 3V5WA 5FI1A 3FSSA 3PSCA 2BCJA 2DTCA 2NMBA 1LW3A 5JP4A 1TJ6A 2COFA 5LONB 4PNKA 2IYBA 1EVHA 4HDOA 2J59M 1J19A 3IVFA 4GZUA 2KCJA 5HE2A 2YS3A 2AEHA 4GXBA 1UNQA 2X18A 1XCGA 5C6RA 2CY5A 1M7EA 2ELAA 3QIJA 2COAA 2I5CA 2G35A 1W1DA 1AQCA 1OQNA 2LULA 3PEGA 5CLLB 2DFKA 2GCLA 2LOXA 3ULBA 4Y94A 1XKEA 2DHJA 2J0MA 4CHJA 2RUKB 3AU4A 2DX1A 1I7AA 2CODA 3DXCA 1NTVA 4EKUA 2H7DA 3VIAA 2RVBB 4HAVB 4A6KA 4HAZB 2NZ8B 2YVCA 1DDMA 3A8QA 1XX0A 4MT7A 3D8FA 1MAIA 1DROA 3PG7A 1DYNA 2PZ1A 2YRYA 3HQCA 3P6AA 4A6HA 3ULCA 2Z0QA 3KY9A 2ROZB 4DX90 2RSGA 4A5KA 1ISNA 3A98B 4L6EA 4A6FB 5LOPB 1MKEA 2D10A 2J0JA 1U5FA 2DHIA 1WJMA 2DA0A 5J3YA 3X23A 4EMOA 1DBHA 1BWNA 1BTNA 2ZPYA 1V89A 1PMSA 4K2PA 3GYPA 2RGNB 1XR0B 1KZ7A 3DXEA 2R09A 2N0YA 2R0DA 4PQ0A 4Z2MB 4GN1A 5DIFB 4ZRJA 5KCVA 2L1CA 2GS0A 2HE7A 4K17A 2D9VA 2I1JA 3KRXA 1FHXA 4GMVA 3U8ZA 1WG7A 1BTKA 3LJUX 4HB4B 2ADZA
chains in the Genus database with same CATH superfamily
4K81A 2MWNB 1H4RA 2DKPA 4CHMA 2VRWB 5C79A 1DDWA 3GYOA 4KHOA 1RJ2A 1K5GB 2Q13A 2D4QA 4DIXA 3U12A 4CSQA 1I2HA 5L81A 5D27A 4B6HA 1V5UA 3ML4A 1NU2A 1GG3A 2NBVA 5D3XA 4HATB 2HTHB 2CAYA 2Z4DA 2DYNA 4EJNA 2MKRA 1Q67A 1LB1A 1DDVA 4IAPA 2LOZA 2FJLA 2MFQA 3WYFB 2Y8FA 2Z13A 2Z59A 1UPQA 4P7IA 5JLJB 4WJ7A 2K2UA 3A8PA 3ODWA 3TVVA 5LG4B 1J0WA 2VSZA 3VOQA 2AL6A 4KVGB 1U5DA 1WI1A 3AU5A 3FM8C 1ZSQA 4KHBA 5KQ1A 4DBBA 4GPTB 1WGQA 2EMTA 1FB8A 3UZTA 4OT1A 3PVUA 2D2QA 2DYQA 4A6FA 4F7GA 2DX5A 2W2XD 2I1KA 1V5PA 2Y8GA 4HAUB 2K8EA 3NWFA 2LKOA 2RRFA 2YT2A 3HK0A 2P0HA 3SO6A 5FI0A 3KZ1A 5D3VA 1KI1B 1UNPA 3CXBB 5D3YA 2N23A 1W1HA 2P8VA 5HE0A 3NWDA 3TCAA 1FGYA 1FAOA 3QWMA 2KR0A 1U5EA 5J3QA 1X05A 3D8DA 3NW8A 4TYZA 4HB2B 4WVFB 5C16A 5C5BB 1WGUA 2P0DA 4WSFA 2W2WA 1OY2A 1TXDA 1NTYA 2P0FA 2I5FA 2E2XA 1MK7B 2KUQA 1XD4A 3KSYA 5I2MA 4BBKA 1UPRA 4GMXB 4NSWA 2MDXA 3O96A 4CYEA 4HAYB 1Y19B 5DHFB 3CIKA 2YT1A 5J3TA 5HE1A 1K5DB 2M14A 3SV1A 1GC6A 1OMWA 2W2XC 5JHHA 3FVCA 1FGZA 4HHVA 4NY0A 2KUPA 4GOUA 1M7RA 5DHAB 1UEFA 1AWEA 3DCXA 4QJ3B 4KHBB 3SNHA 5IRSA 4ZRIA 4TKNA 1QC6A 3PP2A 3QBVB 4HB3B 1X1GA 5CLQB 1X1FA 4D0NB 2UVMA 1U27A 2IFSA 2YS1A 2ROVA 2KGXB 2DHKA 2ELBA 3MDBC 2Z0OA 3TW1A 4QJ4B 1FHWA 2LYDA 5JHGA 1BAKA 4F7UP 4DX8A 2D11A 4KAXB 1PLSA 1P3RA 1N3HA 1V61A 1E5WA 1SHCA 2Z14A 1Y5OA 3PVLA 3TFMA 2FJUB 1U2BA 1ZM0A 5D3WA 2XQNM 5HE3A 1H10A 2Z0PA 2DLWA 2CY4A 3ZDTA 4MY6A 4ZRKA 1WVHA 2EC1A 1P5TA 3NWAA 2RNRB 2ZKMX 4HDQA 1TQZA 2Y7BA 3ODOA 3RCPA 5DI9B 2D9XA 2EMSA 2RLOA 4IOYX 1V88A 2EJ8A 4KHAA 3D8EA 2KIEA 3FEHA 2YSZA 3HSAA 4HB0B 3U7DA 3ZVRA 4Z2NA 3BJIA 1UNRA 3P7ZA 3ODXA 1X11A 1FHOA 4C0AA 1IRSA 1W1GA 2LG1A 3AJ4A 1MPHA 1RRPB 1ZVRA 4DXAB 5EFXA 2YT0A 2L2IA 1ZC4B 5GOWB 3PZDA 1QQGA 2QKMA 5KQ4A 2V76A 2OQBA 5M4YB 5I2SA 2OTXA 2YS5A 3SYXA 3TO1A 1X86A 1SGHA 1U29A 3HW2B 4F7HA 4YL8A 1U5GA 4IFSA 2GJYA 3SUZA 1KZGA 3OANA 1NI2A 2UZRA 5DH9B 4HAXB 1V5MA 2CRFA 3F5RA 2JP2A 1EGXA 2J0KA 3T06A 2YF0A 1PFJA 2H7EA 3M1IB 3N7CA 1GC7A 3NSUA 3KRWA 2UZSA 3PVWA 2D9YA 2VKIA 4MK0A 1WJ1A 3BINA 5C5BA 4H8SA 4K2OA 1B55A 2QKLA 1MIXA 1FOEA 1Z87A 2K2JA 2K00A 3G9WA 4XWXA 1ZC3B 1XODA 2KIGA 2D9WA 2GCJA 1MIZB 1EAZA 2D9ZA 2M38A 3F0WA 3B77A 2DN6A 3MPXA 4QXAB 2COCA 1EF1A 3DXDA 2DKQA 3WA0A 4HAWB 4YONA 1P6SA 1MK9B 3V5WA 4OSNA 3OHMB 5FI1A 3FSSA 3PSCA 2BCJA 2DTCA 2NMBA 1LW3A 5JP4A 1TJ6A 2COFA 5LONB 4PNKA 2IYBA 1EVHA 4HDOA 2J59M 1J19A 3IVFA 4GZUA 2KCJA 5HE2A 2YS3A 2AEHA 4GXBA 1UNQA 2X18A 1XCGA 5C6RA 1ZYIA 2CY5A 3HIEA 1M7EA 2ELAA 3QIJA 2COAA 2I5CA 2G35A 1W1DA 2R2YA 1AQCA 1MI1A 1OQNA 2LULA 3PEGA 5CLLB 4HSIA 2DFKA 2GCLA 2LOXA 3ULBA 4Y94A 1XKEA 2DHJA 2J0MA 4CHJA 2RUKB 3AU4A 2DX1A 1I7AA 2CODA 3DXCA 1NTVA 4EKUA 2H7DA 3VIAA 2RVBB 4HAVB 4A6KA 4HAZB 2NZ8B 2YVCA 1DDMA 3A8QA 1XX0A 4MT7A 3D8FA 1MAIA 1T77A 3PG7A 4QJ5B 1DROA 3A58A 1DYNA 2PZ1A 2YRYA 3HQCA 3P6AA 4A6HA 3ULCA 2Z0QA 3KY9A 2ROZB 4DX90 2RSGA 4A5KA 4D6WA 1ISNA 3A98B 4L6EA 4A6FB 5LOPB 1MKEA 2D10A 4GNKB 2J0JA 1U5FA 2DHIA 1WJMA 2DA0A 5J3YA 2GUMA 3X23A 4EMOA 1DBHA 1BWNA 1BTNA 2ZPYA 2K49A 1V89A 1PMSA 4K2PA 3GYPA 2RGNB 1XR0B 1KZ7A 3DXEA 2R09A 2N0YA 2R0DA 4PQ0A 4Z2MB 4GN1A 5DIFB 4ZRJA 5KCVA 2L1CA 2GS0A 2HE7A 4K17A 2D9VA 2I1JA 3KRXA 4L1RA 1FHXA 4GMVA 3U8ZA 1WG7A 1BTKA 3LJUX 4HB4B 2ADZA
chains in the Genus database with same CATH topology
4K81A 2MWNB 1H4RA 2DKPA 4CHMA 2VRWB 5C79A 1DDWA 3GYOA 4KHOA 1RJ2A 1K5GB 2Q13A 2D4QA 1I2HA 5L81A 5D27A 4B6HA 1V5UA 3ML4A 1NU2A 1GG3A 5D3XA 4HATB 2HTHB 2CAYA 2DYNA 4EJNA 2MKRA 1Q67A 1LB1A 1DDVA 4IAPA 2LOZA 2FJLA 2MFQA 3WYFB 2Y8FA 1UPQA 4P7IA 5JLJB 4WJ7A 2K2UA 3A8PA 3ODWA 3TVVA 1J0WA 2VSZA 3VOQA 2AL6A 4KVGB 1U5DA 1WI1A 3AU5A 3FM8C 1ZSQA 5KQ1A 4DBBA 4GPTB 1WGQA 2EMTA 1FB8A 3UZTA 3PVUA 2D2QA 2DYQA 4A6FA 4F7GA 2DX5A 2W2XD 2I1KA 1V5PA 2Y8GA 4HAUB 2LKOA 3HK0A 2P0HA 3SO6A 5FI0A 3KZ1A 5D3VA 1KI1B 1UNPA 3CXBB 5D3YA 2N23A 1W1HA 2P8VA 5HE0A 3TCAA 1FGYA 1FAOA 3QWMA 1U5EA 5J3QA 1X05A 3D8DA 4TYZA 4HB2B 4WVFB 5C16A 5C5BB 1WGUA 2P0DA 4WSFA 2W2WA 1OY2A 1TXDA 1NTYA 2P0FA 2I5FA 2E2XA 1MK7B 1XD4A 3KSYA 4BBKA 1UPRA 4GMXB 4NSWA 2MDXA 3O96A 4CYEA 4HAYB 1Y19B 5DHFB 3CIKA 2YT1A 5J3TA 5HE1A 1K5DB 2M14A 3SV1A 1GC6A 1OMWA 2W2XC 5JHHA 1FGZA 4HHVA 4NY0A 2KUPA 1M7RA 5DHAB 1UEFA 1AWEA 4KHBB 3SNHA 4ZRIA 4TKNA 1QC6A 3PP2A 3QBVB 4HB3B 1X1GA 5CLQB 1X1FA 4D0NB 2UVMA 1U27A 2IFSA 2YS1A 2ROVA 2KGXB 2DHKA 2ELBA 3MDBC 2Z0OA 3TW1A 1FHWA 2LYDA 5JHGA 1BAKA 4F7UP 4DX8A 2D11A 4KAXB 1PLSA 1P3RA 1N3HA 1V61A 1E5WA 1SHCA 1Y5OA 3PVLA 3TFMA 1U2BA 1ZM0A 5D3WA 2XQNM 5HE3A 1H10A 2Z0PA 2DLWA 2CY4A 3ZDTA 4MY6A 4ZRKA 1WVHA 2EC1A 1P5TA 2RNRB 4HDQA 1TQZA 2Y7BA 3ODOA 3RCPA 5DI9B 2D9XA 2EMSA 2RLOA 4IOYX 1V88A 2EJ8A 4KHAA 3D8EA 3FEHA 2YSZA 3U7DA 4HB0B 3ZVRA 4Z2NA 3BJIA 1UNRA 3P7ZA 3ODXA 1X11A 1FHOA 4C0AA 1IRSA 1W1GA 2LG1A 3AJ4A 1MPHA 1RRPB 1ZVRA 4DXAB 5EFXA 2YT0A 2L2IA 1ZC4B 5GOWB 3PZDA 1QQGA 2QKMA 5KQ4A 2V76A 2OQBA 2OTXA 2YS5A 3SYXA 3TO1A 1X86A 1SGHA 1U29A 3HW2B 4F7HA 4YL8A 1U5GA 4IFSA 2GJYA 3SUZA 1KZGA 3OANA 1NI2A 2UZRA 5DH9B 4HAXB 1V5MA 2CRFA 3F5RA 2JP2A 1EGXA 2J0KA 3T06A 2YF0A 1PFJA 2H7EA 3M1IB 3N7CA 1GC7A 3NSUA 3KRWA 2UZSA 3PVWA 2D9YA 2VKIA 4MK0A 1WJ1A 3BINA 5C5BA 4H8SA 4K2OA 1B55A 2QKLA 1MIXA 1FOEA 1Z87A 2K2JA 2K00A 3G9WA 4XWXA 1ZC3B 1XODA 2D9WA 2GCJA 1MIZB 1EAZA 2D9ZA 2M38A 3F0WA 2DN6A 3MPXA 2COCA 1EF1A 3DXDA 2DKQA 3WA0A 4HAWB 4YONA 1P6SA 1MK9B 3V5WA 5FI1A 3FSSA 3PSCA 2BCJA 2DTCA 2NMBA 1LW3A 5JP4A 1TJ6A 2COFA 5LONB 4PNKA 2IYBA 1EVHA 4HDOA 2J59M 1J19A 3IVFA 4GZUA 2KCJA 5HE2A 2YS3A 2AEHA 4GXBA 1UNQA 2X18A 1XCGA 5C6RA 2CY5A 1M7EA 2ELAA 3QIJA 2COAA 2I5CA 2G35A 1W1DA 1AQCA 1OQNA 2LULA 3PEGA 5CLLB 2DFKA 2GCLA 2LOXA 3ULBA 4Y94A 1XKEA 2DHJA 2J0MA 4CHJA 2RUKB 3AU4A 2DX1A 1I7AA 2CODA 3DXCA 1NTVA 4EKUA 2H7DA 3VIAA 2RVBB 4HAVB 4A6KA 4HAZB 2NZ8B 2YVCA 1DDMA 3A8QA 1XX0A 4MT7A 3D8FA 1MAIA 1DROA 3PG7A 1DYNA 2PZ1A 2YRYA 3HQCA 3P6AA 4A6HA 3ULCA 2Z0QA 3KY9A 2ROZB 4DX90 2RSGA 4A5KA 1ISNA 3A98B 4L6EA 4A6FB 5LOPB 1MKEA 2D10A 2J0JA 1U5FA 2DHIA 1WJMA 2DA0A 5J3YA 3X23A 4EMOA 1DBHA 1BWNA 1BTNA 2ZPYA 1V89A 1PMSA 4K2PA 3GYPA 2RGNB 1XR0B 1KZ7A 3DXEA 2R09A 2N0YA 2R0DA 4PQ0A 4Z2MB 4GN1A 5DIFB 4ZRJA 5KCVA 2L1CA 2GS0A 2HE7A 4K17A 2D9VA 2I1JA 3KRXA 1FHXA 4GMVA 3U8ZA 1WG7A 1BTKA 3LJUX 4HB4B 2ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K81 A;  2MWN B;  1H4R A;  2DKP A;  4CHM A;  2VRW B;  5C79 A;  1DDW A;  3GYO A;  4KHO A;  1RJ2 A;  1K5G B;  2Q13 A;  2D4Q A;  1I2H A;  5L81 A;  5D27 A;  4B6H A;  1V5U A;  3ML4 A;  1NU2 A;  1GG3 A;  5D3X A;  4HAT B;  2HTH B;  2CAY A;  2DYN A;  4EJN A;  2MKR A;  1Q67 A;  1LB1 A;  1DDV A;  4IAP A;  2LOZ A;  2FJL A;  2MFQ A;  3WYF B;  2Y8F A;  1UPQ A;  4P7I A;  5JLJ B;  4WJ7 A;  2K2U A;  3A8P A;  3ODW A;  3TVV A;  1J0W A;  2VSZ A;  3VOQ A;  2AL6 A;  4KVG B;  1U5D A;  1WI1 A;  3AU5 A;  3FM8 C;  1ZSQ A;  5KQ1 A;  4DBB A;  4GPT B;  1WGQ A;  2EMT A;  1FB8 A;  3UZT A;  3PVU A;  2D2Q A;  2DYQ A;  4A6F A;  4F7G A;  2DX5 A;  2W2X D;  2I1K A;  1V5P A;  2Y8G A;  4HAU B;  2LKO A;  3HK0 A;  2P0H A;  3SO6 A;  5FI0 A;  3KZ1 A;  5D3V A;  1KI1 B;  1UNP A;  3CXB B;  5D3Y A;  2N23 A;  1W1H A;  2P8V A;  5HE0 A;  3TCA A;  1FGY A;  1FAO A;  3QWM A;  1U5E A;  5J3Q A;  1X05 A;  3D8D A;  4TYZ A;  4HB2 B;  4WVF B;  5C16 A;  5C5B B;  1WGU A;  2P0D A;  4WSF A;  2W2W A;  1OY2 A;  1TXD A;  1NTY A;  2P0F A;  2I5F A;  2E2X A;  1MK7 B;  1XD4 A;  3KSY A;  4BBK A;  1UPR A;  4GMX B;  4NSW A;  2MDX A;  3O96 A;  4CYE A;  4HAY B;  1Y19 B;  5DHF B;  3CIK A;  2YT1 A;  5J3T A;  5HE1 A;  1K5D B;  2M14 A;  3SV1 A;  1GC6 A;  1OMW A;  2W2X C;  5JHH A;  1FGZ A;  4HHV A;  4NY0 A;  2KUP A;  1M7R A;  5DHA B;  1UEF A;  1AWE A;  4KHB B;  3SNH A;  4ZRI A;  4TKN A;  1QC6 A;  3PP2 A;  3QBV B;  4HB3 B;  1X1G A;  5CLQ B;  1X1F A;  4D0N B;  2UVM A;  1U27 A;  2IFS A;  2YS1 A;  2ROV A;  2KGX B;  2DHK A;  2ELB A;  3MDB C;  2Z0O A;  3TW1 A;  1FHW A;  2LYD A;  5JHG A;  1BAK A;  4F7U P;  4DX8 A;  2D11 A;  4KAX B;  1PLS A;  1P3R A;  1N3H A;  1V61 A;  1E5W A;  1SHC A;  1Y5O A;  3PVL A;  3TFM A;  1U2B A;  1ZM0 A;  5D3W A;  2XQN M;  5HE3 A;  1H10 A;  2Z0P A;  2DLW A;  2CY4 A;  3ZDT A;  4MY6 A;  4ZRK A;  1WVH A;  2EC1 A;  1P5T A;  2RNR B;  4HDQ A;  1TQZ A;  2Y7B A;  3ODO A;  3RCP A;  5DI9 B;  2D9X A;  2EMS A;  2RLO A;  4IOY X;  1V88 A;  2EJ8 A;  4KHA A;  3D8E A;  3FEH A;  2YSZ A;  3U7D A;  4HB0 B;  3ZVR A;  4Z2N A;  3BJI A;  1UNR A;  3P7Z A;  3ODX A;  1X11 A;  1FHO A;  4C0A A;  1IRS A;  1W1G A;  2LG1 A;  3AJ4 A;  1MPH A;  1RRP B;  1ZVR A;  4DXA B;  5EFX A;  2YT0 A;  2L2I A;  1ZC4 B;  5GOW B;  3PZD A;  1QQG A;  2QKM A;  5KQ4 A;  2V76 A;  2OQB A;  2OTX A;  2YS5 A;  3SYX A;  3TO1 A;  1X86 A;  1SGH A;  1U29 A;  3HW2 B;  4F7H A;  4YL8 A;  1U5G A;  4IFS A;  2GJY A;  3SUZ A;  1KZG A;  3OAN A;  1NI2 A;  2UZR A;  5DH9 B;  4HAX B;  1V5M A;  2CRF A;  3F5R A;  2JP2 A;  1EGX A;  2J0K A;  3T06 A;  2YF0 A;  1PFJ A;  2H7E A;  3M1I B;  3N7C A;  1GC7 A;  3NSU A;  3KRW A;  2UZS A;  3PVW A;  2D9Y A;  2VKI A;  4MK0 A;  1WJ1 A;  3BIN A;  5C5B A;  4H8S A;  4K2O A;  1B55 A;  2QKL A;  1MIX A;  1FOE A;  1Z87 A;  2K2J A;  2K00 A;  3G9W A;  4XWX A;  1ZC3 B;  1XOD A;  2D9W A;  2GCJ A;  1MIZ B;  1EAZ A;  2D9Z A;  2M38 A;  3F0W A;  2DN6 A;  3MPX A;  2COC A;  1EF1 A;  3DXD A;  2DKQ A;  3WA0 A;  4HAW B;  4YON A;  1P6S A;  1MK9 B;  3V5W A;  5FI1 A;  3FSS A;  3PSC A;  2BCJ A;  2DTC A;  2NMB A;  1LW3 A;  5JP4 A;  1TJ6 A;  2COF A;  5LON B;  4PNK A;  2IYB A;  1EVH A;  4HDO A;  2J59 M;  1J19 A;  3IVF A;  4GZU A;  2KCJ A;  5HE2 A;  2YS3 A;  2AEH A;  4GXB A;  1UNQ A;  2X18 A;  1XCG A;  5C6R A;  2CY5 A;  1M7E A;  2ELA A;  3QIJ A;  2COA A;  2I5C A;  2G35 A;  1W1D A;  1AQC A;  1OQN A;  2LUL A;  3PEG A;  5CLL B;  2DFK A;  2GCL A;  2LOX A;  3ULB A;  4Y94 A;  1XKE A;  2DHJ A;  2J0M A;  4CHJ A;  2RUK B;  3AU4 A;  2DX1 A;  1I7A A;  2COD A;  3DXC A;  1NTV A;  4EKU A;  2H7D A;  3VIA A;  2RVB B;  4HAV B;  4A6K A;  4HAZ B;  2NZ8 B;  2YVC A;  1DDM A;  3A8Q A;  1XX0 A;  4MT7 A;  3D8F A;  1MAI A;  1DRO A;  3PG7 A;  1DYN A;  2PZ1 A;  2YRY A;  3HQC A;  3P6A A;  4A6H A;  3ULC A;  2Z0Q A;  3KY9 A;  2ROZ B;  4DX9 0;  2RSG A;  4A5K A;  1ISN A;  3A98 B;  4L6E A;  4A6F B;  5LOP B;  1MKE A;  2D10 A;  2J0J A;  1U5F A;  2DHI A;  1WJM A;  2DA0 A;  5J3Y A;  3X23 A;  4EMO A;  1DBH A;  1BWN A;  1BTN A;  2ZPY A;  1V89 A;  1PMS A;  4K2P A;  3GYP A;  2RGN B;  1XR0 B;  1KZ7 A;  3DXE A;  2R09 A;  2N0Y A;  2R0D A;  4PQ0 A;  4Z2M B;  4GN1 A;  5DIF B;  4ZRJ A;  5KCV A;  2L1C A;  2GS0 A;  2HE7 A;  4K17 A;  2D9V A;  2I1J A;  3KRX A;  1FHX A;  4GMV A;  3U8Z A;  1WG7 A;  1BTK A;  3LJU X;  4HB4 B;  2ADZ A; 
#chains in the Genus database with same CATH topology
 4K81 A;  2MWN B;  1H4R A;  2DKP A;  4CHM A;  2VRW B;  5C79 A;  1DDW A;  3GYO A;  4KHO A;  1RJ2 A;  1K5G B;  2Q13 A;  2D4Q A;  4DIX A;  3U12 A;  4CSQ A;  1I2H A;  5L81 A;  5D27 A;  4B6H A;  1V5U A;  3ML4 A;  1NU2 A;  1GG3 A;  2NBV A;  5D3X A;  4HAT B;  2HTH B;  2CAY A;  2Z4D A;  2DYN A;  4EJN A;  2MKR A;  1Q67 A;  1LB1 A;  1DDV A;  4IAP A;  2LOZ A;  2FJL A;  2MFQ A;  3WYF B;  2Y8F A;  2Z13 A;  2Z59 A;  1UPQ A;  4P7I A;  5JLJ B;  4WJ7 A;  2K2U A;  3A8P A;  3ODW A;  3TVV A;  5LG4 B;  1J0W A;  2VSZ A;  3VOQ A;  2AL6 A;  4KVG B;  1U5D A;  1WI1 A;  3AU5 A;  3FM8 C;  1ZSQ A;  4KHB A;  5KQ1 A;  4DBB A;  4GPT B;  1WGQ A;  2EMT A;  1FB8 A;  3UZT A;  4OT1 A;  3PVU A;  2D2Q A;  2DYQ A;  4A6F A;  4F7G A;  2DX5 A;  2W2X D;  2I1K A;  1V5P A;  2Y8G A;  4HAU B;  2K8E A;  3NWF A;  2LKO A;  2RRF A;  2YT2 A;  3HK0 A;  2P0H A;  3SO6 A;  5FI0 A;  3KZ1 A;  5D3V A;  1KI1 B;  1UNP A;  3CXB B;  5D3Y A;  2N23 A;  1W1H A;  2P8V A;  5HE0 A;  3NWD A;  3TCA A;  1FGY A;  1FAO A;  3QWM A;  2KR0 A;  1U5E A;  5J3Q A;  1X05 A;  3D8D A;  3NW8 A;  4TYZ A;  4HB2 B;  4WVF B;  5C16 A;  5C5B B;  1WGU A;  2P0D A;  4WSF A;  2W2W A;  1OY2 A;  1TXD A;  1NTY A;  2P0F A;  2I5F A;  2E2X A;  1MK7 B;  2KUQ A;  1XD4 A;  3KSY A;  5I2M A;  4BBK A;  1UPR A;  4GMX B;  4NSW A;  2MDX A;  3O96 A;  4CYE A;  4HAY B;  1Y19 B;  5DHF B;  3CIK A;  2YT1 A;  5J3T A;  5HE1 A;  1K5D B;  2M14 A;  3SV1 A;  1GC6 A;  1OMW A;  2W2X C;  5JHH A;  3FVC A;  1FGZ A;  4HHV A;  4NY0 A;  2KUP A;  4GOU A;  1M7R A;  5DHA B;  1UEF A;  1AWE A;  3DCX A;  4QJ3 B;  4KHB B;  3SNH A;  5IRS A;  4ZRI A;  4TKN A;  1QC6 A;  3PP2 A;  3QBV B;  4HB3 B;  1X1G A;  5CLQ B;  1X1F A;  4D0N B;  2UVM A;  1U27 A;  2IFS A;  2YS1 A;  2ROV A;  2KGX B;  2DHK A;  2ELB A;  3MDB C;  2Z0O A;  3TW1 A;  4QJ4 B;  1FHW A;  2LYD A;  5JHG A;  1BAK A;  4F7U P;  4DX8 A;  2D11 A;  4KAX B;  1PLS A;  1P3R A;  1N3H A;  1V61 A;  1E5W A;  1SHC A;  2Z14 A;  1Y5O A;  3PVL A;  3TFM A;  2FJU B;  1U2B A;  1ZM0 A;  5D3W A;  2XQN M;  5HE3 A;  1H10 A;  2Z0P A;  2DLW A;  2CY4 A;  3ZDT A;  4MY6 A;  4ZRK A;  1WVH A;  2EC1 A;  1P5T A;  3NWA A;  2RNR B;  2ZKM X;  4HDQ A;  1TQZ A;  2Y7B A;  3ODO A;  3RCP A;  5DI9 B;  2D9X A;  2EMS A;  2RLO A;  4IOY X;  1V88 A;  2EJ8 A;  4KHA A;  3D8E A;  2KIE A;  3FEH A;  2YSZ A;  3HSA A;  4HB0 B;  3U7D A;  3ZVR A;  4Z2N A;  3BJI A;  1UNR A;  3P7Z A;  3ODX A;  1X11 A;  1FHO A;  4C0A A;  1IRS A;  1W1G A;  2LG1 A;  3AJ4 A;  1MPH A;  1RRP B;  1ZVR A;  4DXA B;  5EFX A;  2YT0 A;  2L2I A;  1ZC4 B;  5GOW B;  3PZD A;  1QQG A;  2QKM A;  5KQ4 A;  2V76 A;  2OQB A;  5M4Y B;  5I2S A;  2OTX A;  2YS5 A;  3SYX A;  3TO1 A;  1X86 A;  1SGH A;  1U29 A;  3HW2 B;  4F7H A;  4YL8 A;  1U5G A;  4IFS A;  2GJY A;  3SUZ A;  1KZG A;  3OAN A;  1NI2 A;  2UZR A;  5DH9 B;  4HAX B;  1V5M A;  2CRF A;  3F5R A;  2JP2 A;  1EGX A;  2J0K A;  3T06 A;  2YF0 A;  1PFJ A;  2H7E A;  3M1I B;  3N7C A;  1GC7 A;  3NSU A;  3KRW A;  2UZS A;  3PVW A;  2D9Y A;  2VKI A;  4MK0 A;  1WJ1 A;  3BIN A;  5C5B A;  4H8S A;  4K2O A;  1B55 A;  2QKL A;  1MIX A;  1FOE A;  1Z87 A;  2K2J A;  2K00 A;  3G9W A;  4XWX A;  1ZC3 B;  1XOD A;  2KIG A;  2D9W A;  2GCJ A;  1MIZ B;  1EAZ A;  2D9Z A;  2M38 A;  3F0W A;  3B77 A;  2DN6 A;  3MPX A;  4QXA B;  2COC A;  1EF1 A;  3DXD A;  2DKQ A;  3WA0 A;  4HAW B;  4YON A;  1P6S A;  1MK9 B;  3V5W A;  4OSN A;  3OHM B;  5FI1 A;  3FSS A;  3PSC A;  2BCJ A;  2DTC A;  2NMB A;  1LW3 A;  5JP4 A;  1TJ6 A;  2COF A;  5LON B;  4PNK A;  2IYB A;  1EVH A;  4HDO A;  2J59 M;  1J19 A;  3IVF A;  4GZU A;  2KCJ A;  5HE2 A;  2YS3 A;  2AEH A;  4GXB A;  1UNQ A;  2X18 A;  1XCG A;  5C6R A;  1ZYI A;  2CY5 A;  3HIE A;  1M7E A;  2ELA A;  3QIJ A;  2COA A;  2I5C A;  2G35 A;  1W1D A;  2R2Y A;  1AQC A;  1MI1 A;  1OQN A;  2LUL A;  3PEG A;  5CLL B;  4HSI A;  2DFK A;  2GCL A;  2LOX A;  3ULB A;  4Y94 A;  1XKE A;  2DHJ A;  2J0M A;  4CHJ A;  2RUK B;  3AU4 A;  2DX1 A;  1I7A A;  2COD A;  3DXC A;  1NTV A;  4EKU A;  2H7D A;  3VIA A;  2RVB B;  4HAV B;  4A6K A;  4HAZ B;  2NZ8 B;  2YVC A;  1DDM A;  3A8Q A;  1XX0 A;  4MT7 A;  3D8F A;  1MAI A;  1T77 A;  3PG7 A;  4QJ5 B;  1DRO A;  3A58 A;  1DYN A;  2PZ1 A;  2YRY A;  3HQC A;  3P6A A;  4A6H A;  3ULC A;  2Z0Q A;  3KY9 A;  2ROZ B;  4DX9 0;  2RSG A;  4A5K A;  4D6W A;  1ISN A;  3A98 B;  4L6E A;  4A6F B;  5LOP B;  1MKE A;  2D10 A;  4GNK B;  2J0J A;  1U5F A;  2DHI A;  1WJM A;  2DA0 A;  5J3Y A;  2GUM A;  3X23 A;  4EMO A;  1DBH A;  1BWN A;  1BTN A;  2ZPY A;  2K49 A;  1V89 A;  1PMS A;  4K2P A;  3GYP A;  2RGN B;  1XR0 B;  1KZ7 A;  3DXE A;  2R09 A;  2N0Y A;  2R0D A;  4PQ0 A;  4Z2M B;  4GN1 A;  5DIF B;  4ZRJ A;  5KCV A;  2L1C A;  2GS0 A;  2HE7 A;  4K17 A;  2D9V A;  2I1J A;  3KRX A;  4L1R A;  1FHX A;  4GMV A;  3U8Z A;  1WG7 A;  1BTK A;  3LJU X;  4HB4 B;  2ADZ A; 
#chains in the Genus database with same CATH homology
 4K81 A;  2MWN B;  1H4R A;  2DKP A;  4CHM A;  2VRW B;  5C79 A;  1DDW A;  3GYO A;  4KHO A;  1RJ2 A;  1K5G B;  2Q13 A;  2D4Q A;  1I2H A;  5L81 A;  5D27 A;  4B6H A;  1V5U A;  3ML4 A;  1NU2 A;  1GG3 A;  5D3X A;  4HAT B;  2HTH B;  2CAY A;  2DYN A;  4EJN A;  2MKR A;  1Q67 A;  1LB1 A;  1DDV A;  4IAP A;  2LOZ A;  2FJL A;  2MFQ A;  3WYF B;  2Y8F A;  1UPQ A;  4P7I A;  5JLJ B;  4WJ7 A;  2K2U A;  3A8P A;  3ODW A;  3TVV A;  1J0W A;  2VSZ A;  3VOQ A;  2AL6 A;  4KVG B;  1U5D A;  1WI1 A;  3AU5 A;  3FM8 C;  1ZSQ A;  5KQ1 A;  4DBB A;  4GPT B;  1WGQ A;  2EMT A;  1FB8 A;  3UZT A;  3PVU A;  2D2Q A;  2DYQ A;  4A6F A;  4F7G A;  2DX5 A;  2W2X D;  2I1K A;  1V5P A;  2Y8G A;  4HAU B;  2LKO A;  3HK0 A;  2P0H A;  3SO6 A;  5FI0 A;  3KZ1 A;  5D3V A;  1KI1 B;  1UNP A;  3CXB B;  5D3Y A;  2N23 A;  1W1H A;  2P8V A;  5HE0 A;  3TCA A;  1FGY A;  1FAO A;  3QWM A;  1U5E A;  5J3Q A;  1X05 A;  3D8D A;  4TYZ A;  4HB2 B;  4WVF B;  5C16 A;  5C5B B;  1WGU A;  2P0D A;  4WSF A;  2W2W A;  1OY2 A;  1TXD A;  1NTY A;  2P0F A;  2I5F A;  2E2X A;  1MK7 B;  1XD4 A;  3KSY A;  4BBK A;  1UPR A;  4GMX B;  4NSW A;  2MDX A;  3O96 A;  4CYE A;  4HAY B;  1Y19 B;  5DHF B;  3CIK A;  2YT1 A;  5J3T A;  5HE1 A;  1K5D B;  2M14 A;  3SV1 A;  1GC6 A;  1OMW A;  2W2X C;  5JHH A;  1FGZ A;  4HHV A;  4NY0 A;  2KUP A;  1M7R A;  5DHA B;  1UEF A;  1AWE A;  4KHB B;  3SNH A;  4ZRI A;  4TKN A;  1QC6 A;  3PP2 A;  3QBV B;  4HB3 B;  1X1G A;  5CLQ B;  1X1F A;  4D0N B;  2UVM A;  1U27 A;  2IFS A;  2YS1 A;  2ROV A;  2KGX B;  2DHK A;  2ELB A;  3MDB C;  2Z0O A;  3TW1 A;  1FHW A;  2LYD A;  5JHG A;  1BAK A;  4F7U P;  4DX8 A;  2D11 A;  4KAX B;  1PLS A;  1P3R A;  1N3H A;  1V61 A;  1E5W A;  1SHC A;  1Y5O A;  3PVL A;  3TFM A;  1U2B A;  1ZM0 A;  5D3W A;  2XQN M;  5HE3 A;  1H10 A;  2Z0P A;  2DLW A;  2CY4 A;  3ZDT A;  4MY6 A;  4ZRK A;  1WVH A;  2EC1 A;  1P5T A;  2RNR B;  4HDQ A;  1TQZ A;  2Y7B A;  3ODO A;  3RCP A;  5DI9 B;  2D9X A;  2EMS A;  2RLO A;  4IOY X;  1V88 A;  2EJ8 A;  4KHA A;  3D8E A;  3FEH A;  2YSZ A;  3U7D A;  4HB0 B;  3ZVR A;  4Z2N A;  3BJI A;  1UNR A;  3P7Z A;  3ODX A;  1X11 A;  1FHO A;  4C0A A;  1IRS A;  1W1G A;  2LG1 A;  3AJ4 A;  1MPH A;  1RRP B;  1ZVR A;  4DXA B;  5EFX A;  2YT0 A;  2L2I A;  1ZC4 B;  5GOW B;  3PZD A;  1QQG A;  2QKM A;  5KQ4 A;  2V76 A;  2OQB A;  2OTX A;  2YS5 A;  3SYX A;  3TO1 A;  1X86 A;  1SGH A;  1U29 A;  3HW2 B;  4F7H A;  4YL8 A;  1U5G A;  4IFS A;  2GJY A;  3SUZ A;  1KZG A;  3OAN A;  1NI2 A;  2UZR A;  5DH9 B;  4HAX B;  1V5M A;  2CRF A;  3F5R A;  2JP2 A;  1EGX A;  2J0K A;  3T06 A;  2YF0 A;  1PFJ A;  2H7E A;  3M1I B;  3N7C A;  1GC7 A;  3NSU A;  3KRW A;  2UZS A;  3PVW A;  2D9Y A;  2VKI A;  4MK0 A;  1WJ1 A;  3BIN A;  5C5B A;  4H8S A;  4K2O A;  1B55 A;  2QKL A;  1MIX A;  1FOE A;  1Z87 A;  2K2J A;  2K00 A;  3G9W A;  4XWX A;  1ZC3 B;  1XOD A;  2D9W A;  2GCJ A;  1MIZ B;  1EAZ A;  2D9Z A;  2M38 A;  3F0W A;  2DN6 A;  3MPX A;  2COC A;  1EF1 A;  3DXD A;  2DKQ A;  3WA0 A;  4HAW B;  4YON A;  1P6S A;  1MK9 B;  3V5W A;  5FI1 A;  3FSS A;  3PSC A;  2BCJ A;  2DTC A;  2NMB A;  1LW3 A;  5JP4 A;  1TJ6 A;  2COF A;  5LON B;  4PNK A;  2IYB A;  1EVH A;  4HDO A;  2J59 M;  1J19 A;  3IVF A;  4GZU A;  2KCJ A;  5HE2 A;  2YS3 A;  2AEH A;  4GXB A;  1UNQ A;  2X18 A;  1XCG A;  5C6R A;  2CY5 A;  1M7E A;  2ELA A;  3QIJ A;  2COA A;  2I5C A;  2G35 A;  1W1D A;  1AQC A;  1OQN A;  2LUL A;  3PEG A;  5CLL B;  2DFK A;  2GCL A;  2LOX A;  3ULB A;  4Y94 A;  1XKE A;  2DHJ A;  2J0M A;  4CHJ A;  2RUK B;  3AU4 A;  2DX1 A;  1I7A A;  2COD A;  3DXC A;  1NTV A;  4EKU A;  2H7D A;  3VIA A;  2RVB B;  4HAV B;  4A6K A;  4HAZ B;  2NZ8 B;  2YVC A;  1DDM A;  3A8Q A;  1XX0 A;  4MT7 A;  3D8F A;  1MAI A;  1DRO A;  3PG7 A;  1DYN A;  2PZ1 A;  2YRY A;  3HQC A;  3P6A A;  4A6H A;  3ULC A;  2Z0Q A;  3KY9 A;  2ROZ B;  4DX9 0;  2RSG A;  4A5K A;  1ISN A;  3A98 B;  4L6E A;  4A6F B;  5LOP B;  1MKE A;  2D10 A;  2J0J A;  1U5F A;  2DHI A;  1WJM A;  2DA0 A;  5J3Y A;  3X23 A;  4EMO A;  1DBH A;  1BWN A;  1BTN A;  2ZPY A;  1V89 A;  1PMS A;  4K2P A;  3GYP A;  2RGN B;  1XR0 B;  1KZ7 A;  3DXE A;  2R09 A;  2N0Y A;  2R0D A;  4PQ0 A;  4Z2M B;  4GN1 A;  5DIF B;  4ZRJ A;  5KCV A;  2L1C A;  2GS0 A;  2HE7 A;  4K17 A;  2D9V A;  2I1J A;  3KRX A;  1FHX A;  4GMV A;  3U8Z A;  1WG7 A;  1BTK A;  3LJU X;  4HB4 B;  2ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...