2DHKA

Solution structure of the ph domain of tbc1 domain family member 2 protein from human
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKKLCGYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMKRWEFHNSPPAPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TBC1 domain family member 2
publication title Solution structure of the PH domain of TBC1 domain family member 2 protein from human
rcsb
source organism Homo sapiens
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhkA01
3QWMA 2DX5A 1GC7A 1WGUA 2K2UA 4L6EA 1WI1A 2J59M 1UPQA 4CHMA 1MAIA 1V5PA 1X11A 1IRSA 3ZVRA 3SO6A 1X05A 1U27A 3TO1A 5L81A 2E2XA 3FM8C 2YVCA 2IYBA 3MDBC 5D3YA 3ULCA 2H7DA 2ADZA 4F7UP 2D2QA 2AL6A 2CODA 3LJUX 1LB1A 2YSZA 1NI2A 1WVHA 1FAOA 4CYEA 2MDXA 4HAXB 4DXAB 2FJLA 1MIZB 1X1FA 5CLQB 2KCJA 5DHAB 1BTKA 1FHWA 5JHGA 4HDOA 4A6FB 3BJIA 4HAVB 3SUZA 5C5BA 2KUPA 5KQ4A 4MK0A 2H7EA 2COFA 3TVVA 3PSCA 2L1CA 3N7CA 2GCLA 2X18A 3T06A 1V61A 2DLWA 1K5GB 1AWEA 3V5WA 3WYFB 1V88A 2P0HA 3ODXA 1WGQA 2CY5A 4GZUA 3AU5A 4YL8A 5C16A 4WJ7A 2EC1A 2G35A 1UNQA 1W1HA 1J0WA 1DROA 2PZ1A 5FI1A 1EGXA 1EAZA 3SNHA 2RNRB 5D3WA 1DYNA 2Y8FA 1BAKA 5LOPB 2GS0A 5GOWB 2MWNB 1BTNA 2ELBA 2YT1A 2K00A 4WSFA 1UEFA 4K2PA 2DYQA 2MFQA 4K81A 3D8DA 3KSYA 3A8PA 2DX1A 2COAA 2Z0PA 4HAUB 1PFJA 5CLLB 1Y5OA 3CIKA 1U29A 4Z2NA 3CXBB 1N3HA 1H4RA 1XCGA 2J0JA 3DXEA 1RRPB 5C5BB 5DI9B 1ZC3B 3D8EA 1OMWA 1MPHA 1PLSA 4CHJA 1KZGA 3SV1A 2N23A 4H8SA 4Y94A 5J3QA 2D11A 2IFSA 2JP2A 3RCPA 2D4QA 2ROZB 1Z87A 2R0DA 2Z0QA 3FEHA 4HDQA 3VOQA 2LOZA 3ULBA 2EMSA 2QKLA 4DX8A 4DX90 1UNPA 1MK9B 1XR0B 1Q67A 4EJNA 2VRWB 4NY0A 5D3XA 1GC6A 2DHKA 2ROVA 4A6HA 2I1JA 1V5UA 2Z0OA 2DKQA 4HAYB 2GCJA 4B6HA 2ZPYA 2W2XC 1GG3A 4HATB 2K2JA 3PEGA 3PG7A 2D9WA 2J0MA 3QBVB 1WJMA 3KRXA 1W1GA 1B55A 1TXDA 4KAXB 2NMBA 1M7RA 3G9WA 2XQNM 2YS1A 2GJYA 1U2BA 4NSWA 5HE3A 1OY2A 2DTCA 2Y8GA 2YF0A 4BBKA 2N0YA 3A98B 1WG7A 5HE2A 2CRFA 2ELAA 4Z2MB 1ZC4B 4WVFB 4HB3B 3PVUA 3F5RA 4HB0B 2HTHB 1KI1B 3PZDA 2RLOA 5J3TA 1DDVA 4PQ0A 1FHOA 4GXBA 3OANA 3HQCA 1MK7B 2DYNA 1FOEA 2EJ8A 1NU2A 2YS5A 2MKRA 3HW2B 1XKEA 4MY6A 2W2WA 5HE1A 2J0KA 2QKMA 4ZRKA 1NTYA 2YS3A 5JLJB 2UVMA 3HK0A 2HE7A 2RUKB 2DKPA 1P6SA 2P0FA 4D0NB 4MT7A 5EFXA 4GPTB 2R09A 1U5DA 3P6AA 1ZM0A 1I2HA 3GYOA 1UNRA 1Y19B 1DDMA 3MPXA 2NZ8B 2DHJA 1V5MA 2M38A 2EMTA 2LULA 2VSZA 3NSUA 3P7ZA 4KHOA 3UZTA 2UZRA 1ZVRA 3PP2A 5LONB 2W2XD 3PVWA 5DIFB 5D3VA 1MIXA 1U5EA 1U5FA 1W1DA 2UZSA 3QIJA 1X86A 3ODOA 4TKNA 3SYXA 4F7GA 1U5GA 2CY4A 3F0WA 3TW1A 2COCA 4K2OA 2L2IA 5JP4A 5C6RA 3A8QA 4GMVA 2D10A 2DHIA 2OTXA 3ML4A 5D27A 2LG1A 4GMXB 2I5FA 3AJ4A 3TFMA 2LYDA 2KGXB 5J3YA 5KQ1A 4P7IA 1FHXA 4ZRIA 1AQCA 4KHBB 2BCJA 2D9VA 2YRYA 3DXDA 4A6KA 4XWXA 1M7EA 2CAYA 1FGYA 3U8ZA 5FI0A 1P3RA 1KZ7A 3PVLA 2YT0A 1ISNA 1H10A 1LW3A 1SGHA 3KRWA 4HB4B 3ODWA 4DBBA 3AU4A 3WA0A 4EMOA 4PNKA 2I1KA 1J19A 3M1IB 5DH9B 1K5DB 1X1GA 2D9ZA 4YONA 5DHFB 3DXCA 1XODA 2RVBB 5HE0A 3IVFA 2P8VA 1NTVA 1FGZA 3BINA 3KY9A 2RSGA 3KZ1A 2AEHA 4GN1A 2Q13A 1TQZA 1DBHA 2DFKA 2OQBA 1BWNA 2LKOA 2LOXA 1PMSA 4C0AA 1EVHA 2DN6A 4A5KA 1RJ2A 5C79A 2M14A 2I5CA 2P0DA 4KVGB 1V89A 1QQGA 1XX0A 5JHHA 4HAWB 5KCVA 4F7HA 4IAPA 4IOYX 3X23A 2RGNB 2Y7BA 3VIAA 1SHCA 1EF1A 1I7AA 1UPRA 1WJ1A 4HAZB 1OQNA 2D9YA 3O96A 4EKUA 4K17A 2V76A 2D9XA 3D8FA 4A6FA 1MKEA 4ZRJA 1FB8A 1ZSQA 2VKIA 3U7DA 4HB2B 1TJ6A 4IFSA 3FSSA 2DA0A 3ZDTA 1XD4A 1P5TA 1DDWA 1E5WA 3TCAA 4TYZA 3GYPA 1QC6A 4KHAA 4HHVA
chains in the Genus database with same CATH superfamily
3QWMA 2DX5A 1GC7A 1WGUA 2K2UA 2Z59A 4L6EA 1WI1A 2J59M 1UPQA 4CHMA 1MAIA 1V5PA 1X11A 1IRSA 3ZVRA 3SO6A 1X05A 1U27A 3TO1A 5L81A 2E2XA 3FM8C 2YVCA 2IYBA 3MDBC 5D3YA 2KIGA 3ULCA 2H7DA 2ADZA 4F7UP 2D2QA 2AL6A 2CODA 3LJUX 1LB1A 2YSZA 1NI2A 1WVHA 1FAOA 4CYEA 2MDXA 4HAXB 4DXAB 2FJLA 1MIZB 1X1FA 5CLQB 2KCJA 5DHAB 1BTKA 1FHWA 5JHGA 4HDOA 2NBVA 3BJIA 4A6FB 4HAVB 3SUZA 5C5BA 2KUPA 5I2MA 5KQ4A 4OT1A 4MK0A 2H7EA 2COFA 3TVVA 3PSCA 2L1CA 3N7CA 2GCLA 2X18A 3T06A 1V61A 2DLWA 1K5GB 1AWEA 3V5WA 3WYFB 1V88A 2P0HA 3ODXA 1WGQA 2CY5A 4GZUA 3AU5A 4YL8A 5C16A 4WJ7A 2EC1A 2G35A 1UNQA 1W1HA 1J0WA 1DROA 2PZ1A 5FI1A 1EGXA 1EAZA 3SNHA 2RNRB 5D3WA 1DYNA 2Y8FA 1BAKA 2KIEA 5LOPB 2GS0A 5GOWB 2MWNB 2Z13A 1BTNA 2ELBA 2YT1A 4OSNA 2K00A 4WSFA 1UEFA 3HSAA 4K2PA 2DYQA 3NW8A 2MFQA 4K81A 3D8DA 3KSYA 3A8PA 2DX1A 2COAA 2Z0PA 4HAUB 1PFJA 5CLLB 1Y5OA 3CIKA 1U29A 4Z2NA 3CXBB 1N3HA 3NWDA 1H4RA 1XCGA 2J0JA 3DXEA 1RRPB 5C5BB 2K8EA 2FJUB 3FVCA 5DI9B 1ZC3B 2YT2A 3D8EA 1OMWA 1MPHA 3A58A 1PLSA 4CHJA 1KZGA 3SV1A 2N23A 4H8SA 4Y94A 5J3QA 2D11A 2IFSA 3NWFA 2JP2A 4QXAB 3RCPA 2D4QA 2ROZB 1Z87A 2R0DA 2KUQA 2Z0QA 3FEHA 4HDQA 3VOQA 4HSIA 2LOZA 3ULBA 2EMSA 2QKLA 4DX8A 5IRSA 4DIXA 4DX90 1UNPA 1MK9B 1XR0B 1Q67A 4EJNA 2VRWB 4NY0A 5D3XA 1GC6A 2DHKA 2ROVA 4A6HA 2I1JA 1V5UA 2Z0OA 2DKQA 4HAYB 2GCJA 4B6HA 2ZPYA 2W2XC 2K49A 1GG3A 4HATB 2K2JA 4GOUA 3PEGA 2Z4DA 3PG7A 2D9WA 2J0MA 3QBVB 3NWAA 1WJMA 3KRXA 1W1GA 1B55A 1TXDA 4KAXB 2NMBA 1M7RA 3G9WA 2R2YA 2XQNM 2YS1A 2GJYA 1U2BA 4NSWA 5HE3A 1OY2A 2DTCA 2Y8GA 2YF0A 1ZYIA 4BBKA 2N0YA 3A98B 1WG7A 4D6WA 5HE2A 2CRFA 2ELAA 4Z2MB 1ZC4B 4WVFB 4HB3B 3PVUA 3F5RA 4QJ5B 4HB0B 2HTHB 1KI1B 3PZDA 2RLOA 5J3TA 1DDVA 4PQ0A 4KHBA 1FHOA 4GXBA 5M4YB 3OANA 2KR0A 3HQCA 1MK7B 2DYNA 1FOEA 2EJ8A 1NU2A 2YS5A 2MKRA 3HW2B 1MI1A 1XKEA 4MY6A 2W2WA 5HE1A 2J0KA 2QKMA 4ZRKA 1NTYA 2YS3A 5JLJB 3HIEA 2UVMA 3HK0A 2HE7A 2RUKB 2DKPA 1P6SA 2P0FA 4D0NB 4MT7A 5EFXA 4GPTB 2R09A 1U5DA 3DCXA 3P6AA 1ZM0A 1I2HA 3GYOA 1UNRA 1Y19B 1DDMA 3MPXA 2NZ8B 2DHJA 1V5MA 2M38A 2EMTA 2LULA 2VSZA 3NSUA 3P7ZA 4KHOA 3UZTA 2UZRA 1ZVRA 3PP2A 5LONB 2W2XD 3PVWA 5DIFB 5D3VA 1MIXA 1U5EA 1U5FA 1W1DA 2UZSA 3QIJA 1X86A 3ODOA 4TKNA 2ZKMX 3SYXA 4F7GA 1U5GA 2CY4A 3F0WA 3TW1A 2COCA 4K2OA 2L2IA 5JP4A 5C6RA 3A8QA 4GMVA 2D10A 2DHIA 2OTXA 3ML4A 5D27A 2LG1A 4GMXB 2I5FA 3AJ4A 4QJ3B 3TFMA 2LYDA 2KGXB 5LG4B 5J3YA 5KQ1A 4P7IA 1FHXA 4ZRIA 1AQCA 4KHBB 2BCJA 2D9VA 3DXDA 2YRYA 4A6KA 4XWXA 1M7EA 2CAYA 1FGYA 3U8ZA 5FI0A 1P3RA 1KZ7A 3PVLA 2YT0A 1ISNA 1H10A 1LW3A 1SGHA 3KRWA 4HB4B 3ODWA 4DBBA 3AU4A 3WA0A 4EMOA 4PNKA 2I1KA 1J19A 3OHMB 3M1IB 2Z14A 5DH9B 1K5DB 1X1GA 2D9ZA 4YONA 5DHFB 3DXCA 1XODA 2RVBB 5HE0A 4L1RA 3IVFA 5I2SA 2P8VA 1NTVA 1FGZA 3BINA 3KY9A 2RSGA 3KZ1A 2AEHA 4GN1A 2Q13A 1TQZA 1DBHA 2DFKA 2OQBA 1BWNA 2LKOA 2LOXA 1PMSA 4C0AA 1EVHA 2DN6A 4A5KA 1RJ2A 2GUMA 5C79A 2M14A 2I5CA 2P0DA 4KVGB 1V89A 1QQGA 1XX0A 5JHHA 3U12A 4HAWB 5KCVA 4F7HA 4IAPA 4IOYX 3X23A 2RGNB 2Y7BA 3VIAA 1SHCA 1EF1A 1I7AA 1UPRA 1WJ1A 4QJ4B 4HAZB 1OQNA 2D9YA 3O96A 4EKUA 4K17A 2V76A 2D9XA 3D8FA 4A6FA 1MKEA 4ZRJA 1FB8A 1ZSQA 4GNKB 2VKIA 3U7DA 4HB2B 1TJ6A 4IFSA 3FSSA 2DA0A 3ZDTA 1T77A 1XD4A 3B77A 1P5TA 1DDWA 1E5WA 2RRFA 3TCAA 4TYZA 3GYPA 4CSQA 1QC6A 4KHAA 4HHVA
chains in the Genus database with same CATH topology
3QWMA 2DX5A 1GC7A 1WGUA 2K2UA 4L6EA 1WI1A 2J59M 1UPQA 4CHMA 1MAIA 1V5PA 1X11A 1IRSA 3ZVRA 3SO6A 1X05A 1U27A 3TO1A 5L81A 2E2XA 3FM8C 2YVCA 2IYBA 3MDBC 5D3YA 3ULCA 2H7DA 2ADZA 4F7UP 2D2QA 2AL6A 2CODA 3LJUX 1LB1A 2YSZA 1NI2A 1WVHA 1FAOA 4CYEA 2MDXA 4HAXB 4DXAB 2FJLA 1MIZB 1X1FA 5CLQB 2KCJA 5DHAB 1BTKA 1FHWA 5JHGA 4HDOA 4A6FB 3BJIA 4HAVB 3SUZA 5C5BA 2KUPA 5KQ4A 4MK0A 2H7EA 2COFA 3TVVA 3PSCA 2L1CA 3N7CA 2GCLA 2X18A 3T06A 1V61A 2DLWA 1K5GB 1AWEA 3V5WA 3WYFB 1V88A 2P0HA 3ODXA 1WGQA 2CY5A 4GZUA 3AU5A 4YL8A 5C16A 4WJ7A 2EC1A 2G35A 1UNQA 1W1HA 1J0WA 1DROA 2PZ1A 5FI1A 1EGXA 1EAZA 3SNHA 2RNRB 5D3WA 1DYNA 2Y8FA 1BAKA 5LOPB 2GS0A 5GOWB 2MWNB 1BTNA 2ELBA 2YT1A 2K00A 4WSFA 1UEFA 4K2PA 2DYQA 2MFQA 4K81A 3D8DA 3KSYA 3A8PA 2DX1A 2COAA 2Z0PA 4HAUB 1PFJA 5CLLB 1Y5OA 3CIKA 1U29A 4Z2NA 3CXBB 1N3HA 1H4RA 1XCGA 2J0JA 3DXEA 1RRPB 5C5BB 5DI9B 1ZC3B 3D8EA 1OMWA 1MPHA 1PLSA 4CHJA 1KZGA 3SV1A 2N23A 4H8SA 4Y94A 5J3QA 2D11A 2IFSA 2JP2A 3RCPA 2D4QA 2ROZB 1Z87A 2R0DA 2Z0QA 3FEHA 4HDQA 3VOQA 2LOZA 3ULBA 2EMSA 2QKLA 4DX8A 4DX90 1UNPA 1MK9B 1XR0B 1Q67A 4EJNA 2VRWB 4NY0A 5D3XA 1GC6A 2DHKA 2ROVA 4A6HA 2I1JA 1V5UA 2Z0OA 2DKQA 4HAYB 2GCJA 4B6HA 2ZPYA 2W2XC 1GG3A 4HATB 2K2JA 3PEGA 3PG7A 2D9WA 2J0MA 3QBVB 1WJMA 3KRXA 1W1GA 1B55A 1TXDA 4KAXB 2NMBA 1M7RA 3G9WA 2XQNM 2YS1A 2GJYA 1U2BA 4NSWA 5HE3A 1OY2A 2DTCA 2Y8GA 2YF0A 4BBKA 2N0YA 3A98B 1WG7A 5HE2A 2CRFA 2ELAA 4Z2MB 1ZC4B 4WVFB 4HB3B 3PVUA 3F5RA 4HB0B 2HTHB 1KI1B 3PZDA 2RLOA 5J3TA 1DDVA 4PQ0A 1FHOA 4GXBA 3OANA 3HQCA 1MK7B 2DYNA 1FOEA 2EJ8A 1NU2A 2YS5A 2MKRA 3HW2B 1XKEA 4MY6A 2W2WA 5HE1A 2J0KA 2QKMA 4ZRKA 1NTYA 2YS3A 5JLJB 2UVMA 3HK0A 2HE7A 2RUKB 2DKPA 1P6SA 2P0FA 4D0NB 4MT7A 5EFXA 4GPTB 2R09A 1U5DA 3P6AA 1ZM0A 1I2HA 3GYOA 1UNRA 1Y19B 1DDMA 3MPXA 2NZ8B 2DHJA 1V5MA 2M38A 2EMTA 2LULA 2VSZA 3NSUA 3P7ZA 4KHOA 3UZTA 2UZRA 1ZVRA 3PP2A 5LONB 2W2XD 3PVWA 5DIFB 5D3VA 1MIXA 1U5EA 1U5FA 1W1DA 2UZSA 3QIJA 1X86A 3ODOA 4TKNA 3SYXA 4F7GA 1U5GA 2CY4A 3F0WA 3TW1A 2COCA 4K2OA 2L2IA 5JP4A 5C6RA 3A8QA 4GMVA 2D10A 2DHIA 2OTXA 3ML4A 5D27A 2LG1A 4GMXB 2I5FA 3AJ4A 3TFMA 2LYDA 2KGXB 5J3YA 5KQ1A 4P7IA 1FHXA 4ZRIA 1AQCA 4KHBB 2BCJA 2D9VA 2YRYA 3DXDA 4A6KA 4XWXA 1M7EA 2CAYA 1FGYA 3U8ZA 5FI0A 1P3RA 1KZ7A 3PVLA 2YT0A 1ISNA 1H10A 1LW3A 1SGHA 3KRWA 4HB4B 3ODWA 4DBBA 3AU4A 3WA0A 4EMOA 4PNKA 2I1KA 1J19A 3M1IB 5DH9B 1K5DB 1X1GA 2D9ZA 4YONA 5DHFB 3DXCA 1XODA 2RVBB 5HE0A 3IVFA 2P8VA 1NTVA 1FGZA 3BINA 3KY9A 2RSGA 3KZ1A 2AEHA 4GN1A 2Q13A 1TQZA 1DBHA 2DFKA 2OQBA 1BWNA 2LKOA 2LOXA 1PMSA 4C0AA 1EVHA 2DN6A 4A5KA 1RJ2A 5C79A 2M14A 2I5CA 2P0DA 4KVGB 1V89A 1QQGA 1XX0A 5JHHA 4HAWB 5KCVA 4F7HA 4IAPA 4IOYX 3X23A 2RGNB 2Y7BA 3VIAA 1SHCA 1EF1A 1I7AA 1UPRA 1WJ1A 4HAZB 1OQNA 2D9YA 3O96A 4EKUA 4K17A 2V76A 2D9XA 3D8FA 4A6FA 1MKEA 4ZRJA 1FB8A 1ZSQA 2VKIA 3U7DA 4HB2B 1TJ6A 4IFSA 3FSSA 2DA0A 3ZDTA 1XD4A 1P5TA 1DDWA 1E5WA 3TCAA 4TYZA 3GYPA 1QC6A 4KHAA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWM A;  2DX5 A;  1GC7 A;  1WGU A;  2K2U A;  4L6E A;  1WI1 A;  2J59 M;  1UPQ A;  4CHM A;  1MAI A;  1V5P A;  1X11 A;  1IRS A;  3ZVR A;  3SO6 A;  1X05 A;  1U27 A;  3TO1 A;  5L81 A;  2E2X A;  3FM8 C;  2YVC A;  2IYB A;  3MDB C;  5D3Y A;  3ULC A;  2H7D A;  2ADZ A;  4F7U P;  2D2Q A;  2AL6 A;  2COD A;  3LJU X;  1LB1 A;  2YSZ A;  1NI2 A;  1WVH A;  1FAO A;  4CYE A;  2MDX A;  4HAX B;  4DXA B;  2FJL A;  1MIZ B;  1X1F A;  5CLQ B;  2KCJ A;  5DHA B;  1BTK A;  1FHW A;  5JHG A;  4HDO A;  4A6F B;  3BJI A;  4HAV B;  3SUZ A;  5C5B A;  2KUP A;  5KQ4 A;  4MK0 A;  2H7E A;  2COF A;  3TVV A;  3PSC A;  2L1C A;  3N7C A;  2GCL A;  2X18 A;  3T06 A;  1V61 A;  2DLW A;  1K5G B;  1AWE A;  3V5W A;  3WYF B;  1V88 A;  2P0H A;  3ODX A;  1WGQ A;  2CY5 A;  4GZU A;  3AU5 A;  4YL8 A;  5C16 A;  4WJ7 A;  2EC1 A;  2G35 A;  1UNQ A;  1W1H A;  1J0W A;  1DRO A;  2PZ1 A;  5FI1 A;  1EGX A;  1EAZ A;  3SNH A;  2RNR B;  5D3W A;  1DYN A;  2Y8F A;  1BAK A;  5LOP B;  2GS0 A;  5GOW B;  2MWN B;  1BTN A;  2ELB A;  2YT1 A;  2K00 A;  4WSF A;  1UEF A;  4K2P A;  2DYQ A;  2MFQ A;  4K81 A;  3D8D A;  3KSY A;  3A8P A;  2DX1 A;  2COA A;  2Z0P A;  4HAU B;  1PFJ A;  5CLL B;  1Y5O A;  3CIK A;  1U29 A;  4Z2N A;  3CXB B;  1N3H A;  1H4R A;  1XCG A;  2J0J A;  3DXE A;  1RRP B;  5C5B B;  5DI9 B;  1ZC3 B;  3D8E A;  1OMW A;  1MPH A;  1PLS A;  4CHJ A;  1KZG A;  3SV1 A;  2N23 A;  4H8S A;  4Y94 A;  5J3Q A;  2D11 A;  2IFS A;  2JP2 A;  3RCP A;  2D4Q A;  2ROZ B;  1Z87 A;  2R0D A;  2Z0Q A;  3FEH A;  4HDQ A;  3VOQ A;  2LOZ A;  3ULB A;  2EMS A;  2QKL A;  4DX8 A;  4DX9 0;  1UNP A;  1MK9 B;  1XR0 B;  1Q67 A;  4EJN A;  2VRW B;  4NY0 A;  5D3X A;  1GC6 A;  2DHK A;  2ROV A;  4A6H A;  2I1J A;  1V5U A;  2Z0O A;  2DKQ A;  4HAY B;  2GCJ A;  4B6H A;  2ZPY A;  2W2X C;  1GG3 A;  4HAT B;  2K2J A;  3PEG A;  3PG7 A;  2D9W A;  2J0M A;  3QBV B;  1WJM A;  3KRX A;  1W1G A;  1B55 A;  1TXD A;  4KAX B;  2NMB A;  1M7R A;  3G9W A;  2XQN M;  2YS1 A;  2GJY A;  1U2B A;  4NSW A;  5HE3 A;  1OY2 A;  2DTC A;  2Y8G A;  2YF0 A;  4BBK A;  2N0Y A;  3A98 B;  1WG7 A;  5HE2 A;  2CRF A;  2ELA A;  4Z2M B;  1ZC4 B;  4WVF B;  4HB3 B;  3PVU A;  3F5R A;  4HB0 B;  2HTH B;  1KI1 B;  3PZD A;  2RLO A;  5J3T A;  1DDV A;  4PQ0 A;  1FHO A;  4GXB A;  3OAN A;  3HQC A;  1MK7 B;  2DYN A;  1FOE A;  2EJ8 A;  1NU2 A;  2YS5 A;  2MKR A;  3HW2 B;  1XKE A;  4MY6 A;  2W2W A;  5HE1 A;  2J0K A;  2QKM A;  4ZRK A;  1NTY A;  2YS3 A;  5JLJ B;  2UVM A;  3HK0 A;  2HE7 A;  2RUK B;  2DKP A;  1P6S A;  2P0F A;  4D0N B;  4MT7 A;  5EFX A;  4GPT B;  2R09 A;  1U5D A;  3P6A A;  1ZM0 A;  1I2H A;  3GYO A;  1UNR A;  1Y19 B;  1DDM A;  3MPX A;  2NZ8 B;  2DHJ A;  1V5M A;  2M38 A;  2EMT A;  2LUL A;  2VSZ A;  3NSU A;  3P7Z A;  4KHO A;  3UZT A;  2UZR A;  1ZVR A;  3PP2 A;  5LON B;  2W2X D;  3PVW A;  5DIF B;  5D3V A;  1MIX A;  1U5E A;  1U5F A;  1W1D A;  2UZS A;  3QIJ A;  1X86 A;  3ODO A;  4TKN A;  3SYX A;  4F7G A;  1U5G A;  2CY4 A;  3F0W A;  3TW1 A;  2COC A;  4K2O A;  2L2I A;  5JP4 A;  5C6R A;  3A8Q A;  4GMV A;  2D10 A;  2DHI A;  2OTX A;  3ML4 A;  5D27 A;  2LG1 A;  4GMX B;  2I5F A;  3AJ4 A;  3TFM A;  2LYD A;  2KGX B;  5J3Y A;  5KQ1 A;  4P7I A;  1FHX A;  4ZRI A;  1AQC A;  4KHB B;  2BCJ A;  2D9V A;  2YRY A;  3DXD A;  4A6K A;  4XWX A;  1M7E A;  2CAY A;  1FGY A;  3U8Z A;  5FI0 A;  1P3R A;  1KZ7 A;  3PVL A;  2YT0 A;  1ISN A;  1H10 A;  1LW3 A;  1SGH A;  3KRW A;  4HB4 B;  3ODW A;  4DBB A;  3AU4 A;  3WA0 A;  4EMO A;  4PNK A;  2I1K A;  1J19 A;  3M1I B;  5DH9 B;  1K5D B;  1X1G A;  2D9Z A;  4YON A;  5DHF B;  3DXC A;  1XOD A;  2RVB B;  5HE0 A;  3IVF A;  2P8V A;  1NTV A;  1FGZ A;  3BIN A;  3KY9 A;  2RSG A;  3KZ1 A;  2AEH A;  4GN1 A;  2Q13 A;  1TQZ A;  1DBH A;  2DFK A;  2OQB A;  1BWN A;  2LKO A;  2LOX A;  1PMS A;  4C0A A;  1EVH A;  2DN6 A;  4A5K A;  1RJ2 A;  5C79 A;  2M14 A;  2I5C A;  2P0D A;  4KVG B;  1V89 A;  1QQG A;  1XX0 A;  5JHH A;  4HAW B;  5KCV A;  4F7H A;  4IAP A;  4IOY X;  3X23 A;  2RGN B;  2Y7B A;  3VIA A;  1SHC A;  1EF1 A;  1I7A A;  1UPR A;  1WJ1 A;  4HAZ B;  1OQN A;  2D9Y A;  3O96 A;  4EKU A;  4K17 A;  2V76 A;  2D9X A;  3D8F A;  4A6F A;  1MKE A;  4ZRJ A;  1FB8 A;  1ZSQ A;  2VKI A;  3U7D A;  4HB2 B;  1TJ6 A;  4IFS A;  3FSS A;  2DA0 A;  3ZDT A;  1XD4 A;  1P5T A;  1DDW A;  1E5W A;  3TCA A;  4TYZ A;  3GYP A;  1QC6 A;  4KHA A;  4HHV A; 
#chains in the Genus database with same CATH topology
 3QWM A;  2DX5 A;  1GC7 A;  1WGU A;  2K2U A;  2Z59 A;  4L6E A;  1WI1 A;  2J59 M;  1UPQ A;  4CHM A;  1MAI A;  1V5P A;  1X11 A;  1IRS A;  3ZVR A;  3SO6 A;  1X05 A;  1U27 A;  3TO1 A;  5L81 A;  2E2X A;  3FM8 C;  2YVC A;  2IYB A;  3MDB C;  5D3Y A;  2KIG A;  3ULC A;  2H7D A;  2ADZ A;  4F7U P;  2D2Q A;  2AL6 A;  2COD A;  3LJU X;  1LB1 A;  2YSZ A;  1NI2 A;  1WVH A;  1FAO A;  4CYE A;  2MDX A;  4HAX B;  4DXA B;  2FJL A;  1MIZ B;  1X1F A;  5CLQ B;  2KCJ A;  5DHA B;  1BTK A;  1FHW A;  5JHG A;  4HDO A;  2NBV A;  3BJI A;  4A6F B;  4HAV B;  3SUZ A;  5C5B A;  2KUP A;  5I2M A;  5KQ4 A;  4OT1 A;  4MK0 A;  2H7E A;  2COF A;  3TVV A;  3PSC A;  2L1C A;  3N7C A;  2GCL A;  2X18 A;  3T06 A;  1V61 A;  2DLW A;  1K5G B;  1AWE A;  3V5W A;  3WYF B;  1V88 A;  2P0H A;  3ODX A;  1WGQ A;  2CY5 A;  4GZU A;  3AU5 A;  4YL8 A;  5C16 A;  4WJ7 A;  2EC1 A;  2G35 A;  1UNQ A;  1W1H A;  1J0W A;  1DRO A;  2PZ1 A;  5FI1 A;  1EGX A;  1EAZ A;  3SNH A;  2RNR B;  5D3W A;  1DYN A;  2Y8F A;  1BAK A;  2KIE A;  5LOP B;  2GS0 A;  5GOW B;  2MWN B;  2Z13 A;  1BTN A;  2ELB A;  2YT1 A;  4OSN A;  2K00 A;  4WSF A;  1UEF A;  3HSA A;  4K2P A;  2DYQ A;  3NW8 A;  2MFQ A;  4K81 A;  3D8D A;  3KSY A;  3A8P A;  2DX1 A;  2COA A;  2Z0P A;  4HAU B;  1PFJ A;  5CLL B;  1Y5O A;  3CIK A;  1U29 A;  4Z2N A;  3CXB B;  1N3H A;  3NWD A;  1H4R A;  1XCG A;  2J0J A;  3DXE A;  1RRP B;  5C5B B;  2K8E A;  2FJU B;  3FVC A;  5DI9 B;  1ZC3 B;  2YT2 A;  3D8E A;  1OMW A;  1MPH A;  3A58 A;  1PLS A;  4CHJ A;  1KZG A;  3SV1 A;  2N23 A;  4H8S A;  4Y94 A;  5J3Q A;  2D11 A;  2IFS A;  3NWF A;  2JP2 A;  4QXA B;  3RCP A;  2D4Q A;  2ROZ B;  1Z87 A;  2R0D A;  2KUQ A;  2Z0Q A;  3FEH A;  4HDQ A;  3VOQ A;  4HSI A;  2LOZ A;  3ULB A;  2EMS A;  2QKL A;  4DX8 A;  5IRS A;  4DIX A;  4DX9 0;  1UNP A;  1MK9 B;  1XR0 B;  1Q67 A;  4EJN A;  2VRW B;  4NY0 A;  5D3X A;  1GC6 A;  2DHK A;  2ROV A;  4A6H A;  2I1J A;  1V5U A;  2Z0O A;  2DKQ A;  4HAY B;  2GCJ A;  4B6H A;  2ZPY A;  2W2X C;  2K49 A;  1GG3 A;  4HAT B;  2K2J A;  4GOU A;  3PEG A;  2Z4D A;  3PG7 A;  2D9W A;  2J0M A;  3QBV B;  3NWA A;  1WJM A;  3KRX A;  1W1G A;  1B55 A;  1TXD A;  4KAX B;  2NMB A;  1M7R A;  3G9W A;  2R2Y A;  2XQN M;  2YS1 A;  2GJY A;  1U2B A;  4NSW A;  5HE3 A;  1OY2 A;  2DTC A;  2Y8G A;  2YF0 A;  1ZYI A;  4BBK A;  2N0Y A;  3A98 B;  1WG7 A;  4D6W A;  5HE2 A;  2CRF A;  2ELA A;  4Z2M B;  1ZC4 B;  4WVF B;  4HB3 B;  3PVU A;  3F5R A;  4QJ5 B;  4HB0 B;  2HTH B;  1KI1 B;  3PZD A;  2RLO A;  5J3T A;  1DDV A;  4PQ0 A;  4KHB A;  1FHO A;  4GXB A;  5M4Y B;  3OAN A;  2KR0 A;  3HQC A;  1MK7 B;  2DYN A;  1FOE A;  2EJ8 A;  1NU2 A;  2YS5 A;  2MKR A;  3HW2 B;  1MI1 A;  1XKE A;  4MY6 A;  2W2W A;  5HE1 A;  2J0K A;  2QKM A;  4ZRK A;  1NTY A;  2YS3 A;  5JLJ B;  3HIE A;  2UVM A;  3HK0 A;  2HE7 A;  2RUK B;  2DKP A;  1P6S A;  2P0F A;  4D0N B;  4MT7 A;  5EFX A;  4GPT B;  2R09 A;  1U5D A;  3DCX A;  3P6A A;  1ZM0 A;  1I2H A;  3GYO A;  1UNR A;  1Y19 B;  1DDM A;  3MPX A;  2NZ8 B;  2DHJ A;  1V5M A;  2M38 A;  2EMT A;  2LUL A;  2VSZ A;  3NSU A;  3P7Z A;  4KHO A;  3UZT A;  2UZR A;  1ZVR A;  3PP2 A;  5LON B;  2W2X D;  3PVW A;  5DIF B;  5D3V A;  1MIX A;  1U5E A;  1U5F A;  1W1D A;  2UZS A;  3QIJ A;  1X86 A;  3ODO A;  4TKN A;  2ZKM X;  3SYX A;  4F7G A;  1U5G A;  2CY4 A;  3F0W A;  3TW1 A;  2COC A;  4K2O A;  2L2I A;  5JP4 A;  5C6R A;  3A8Q A;  4GMV A;  2D10 A;  2DHI A;  2OTX A;  3ML4 A;  5D27 A;  2LG1 A;  4GMX B;  2I5F A;  3AJ4 A;  4QJ3 B;  3TFM A;  2LYD A;  2KGX B;  5LG4 B;  5J3Y A;  5KQ1 A;  4P7I A;  1FHX A;  4ZRI A;  1AQC A;  4KHB B;  2BCJ A;  2D9V A;  3DXD A;  2YRY A;  4A6K A;  4XWX A;  1M7E A;  2CAY A;  1FGY A;  3U8Z A;  5FI0 A;  1P3R A;  1KZ7 A;  3PVL A;  2YT0 A;  1ISN A;  1H10 A;  1LW3 A;  1SGH A;  3KRW A;  4HB4 B;  3ODW A;  4DBB A;  3AU4 A;  3WA0 A;  4EMO A;  4PNK A;  2I1K A;  1J19 A;  3OHM B;  3M1I B;  2Z14 A;  5DH9 B;  1K5D B;  1X1G A;  2D9Z A;  4YON A;  5DHF B;  3DXC A;  1XOD A;  2RVB B;  5HE0 A;  4L1R A;  3IVF A;  5I2S A;  2P8V A;  1NTV A;  1FGZ A;  3BIN A;  3KY9 A;  2RSG A;  3KZ1 A;  2AEH A;  4GN1 A;  2Q13 A;  1TQZ A;  1DBH A;  2DFK A;  2OQB A;  1BWN A;  2LKO A;  2LOX A;  1PMS A;  4C0A A;  1EVH A;  2DN6 A;  4A5K A;  1RJ2 A;  2GUM A;  5C79 A;  2M14 A;  2I5C A;  2P0D A;  4KVG B;  1V89 A;  1QQG A;  1XX0 A;  5JHH A;  3U12 A;  4HAW B;  5KCV A;  4F7H A;  4IAP A;  4IOY X;  3X23 A;  2RGN B;  2Y7B A;  3VIA A;  1SHC A;  1EF1 A;  1I7A A;  1UPR A;  1WJ1 A;  4QJ4 B;  4HAZ B;  1OQN A;  2D9Y A;  3O96 A;  4EKU A;  4K17 A;  2V76 A;  2D9X A;  3D8F A;  4A6F A;  1MKE A;  4ZRJ A;  1FB8 A;  1ZSQ A;  4GNK B;  2VKI A;  3U7D A;  4HB2 B;  1TJ6 A;  4IFS A;  3FSS A;  2DA0 A;  3ZDT A;  1T77 A;  1XD4 A;  3B77 A;  1P5T A;  1DDW A;  1E5W A;  2RRF A;  3TCA A;  4TYZ A;  3GYP A;  4CSQ A;  1QC6 A;  4KHA A;  4HHV A; 
#chains in the Genus database with same CATH homology
 3QWM A;  2DX5 A;  1GC7 A;  1WGU A;  2K2U A;  4L6E A;  1WI1 A;  2J59 M;  1UPQ A;  4CHM A;  1MAI A;  1V5P A;  1X11 A;  1IRS A;  3ZVR A;  3SO6 A;  1X05 A;  1U27 A;  3TO1 A;  5L81 A;  2E2X A;  3FM8 C;  2YVC A;  2IYB A;  3MDB C;  5D3Y A;  3ULC A;  2H7D A;  2ADZ A;  4F7U P;  2D2Q A;  2AL6 A;  2COD A;  3LJU X;  1LB1 A;  2YSZ A;  1NI2 A;  1WVH A;  1FAO A;  4CYE A;  2MDX A;  4HAX B;  4DXA B;  2FJL A;  1MIZ B;  1X1F A;  5CLQ B;  2KCJ A;  5DHA B;  1BTK A;  1FHW A;  5JHG A;  4HDO A;  4A6F B;  3BJI A;  4HAV B;  3SUZ A;  5C5B A;  2KUP A;  5KQ4 A;  4MK0 A;  2H7E A;  2COF A;  3TVV A;  3PSC A;  2L1C A;  3N7C A;  2GCL A;  2X18 A;  3T06 A;  1V61 A;  2DLW A;  1K5G B;  1AWE A;  3V5W A;  3WYF B;  1V88 A;  2P0H A;  3ODX A;  1WGQ A;  2CY5 A;  4GZU A;  3AU5 A;  4YL8 A;  5C16 A;  4WJ7 A;  2EC1 A;  2G35 A;  1UNQ A;  1W1H A;  1J0W A;  1DRO A;  2PZ1 A;  5FI1 A;  1EGX A;  1EAZ A;  3SNH A;  2RNR B;  5D3W A;  1DYN A;  2Y8F A;  1BAK A;  5LOP B;  2GS0 A;  5GOW B;  2MWN B;  1BTN A;  2ELB A;  2YT1 A;  2K00 A;  4WSF A;  1UEF A;  4K2P A;  2DYQ A;  2MFQ A;  4K81 A;  3D8D A;  3KSY A;  3A8P A;  2DX1 A;  2COA A;  2Z0P A;  4HAU B;  1PFJ A;  5CLL B;  1Y5O A;  3CIK A;  1U29 A;  4Z2N A;  3CXB B;  1N3H A;  1H4R A;  1XCG A;  2J0J A;  3DXE A;  1RRP B;  5C5B B;  5DI9 B;  1ZC3 B;  3D8E A;  1OMW A;  1MPH A;  1PLS A;  4CHJ A;  1KZG A;  3SV1 A;  2N23 A;  4H8S A;  4Y94 A;  5J3Q A;  2D11 A;  2IFS A;  2JP2 A;  3RCP A;  2D4Q A;  2ROZ B;  1Z87 A;  2R0D A;  2Z0Q A;  3FEH A;  4HDQ A;  3VOQ A;  2LOZ A;  3ULB A;  2EMS A;  2QKL A;  4DX8 A;  4DX9 0;  1UNP A;  1MK9 B;  1XR0 B;  1Q67 A;  4EJN A;  2VRW B;  4NY0 A;  5D3X A;  1GC6 A;  2DHK A;  2ROV A;  4A6H A;  2I1J A;  1V5U A;  2Z0O A;  2DKQ A;  4HAY B;  2GCJ A;  4B6H A;  2ZPY A;  2W2X C;  1GG3 A;  4HAT B;  2K2J A;  3PEG A;  3PG7 A;  2D9W A;  2J0M A;  3QBV B;  1WJM A;  3KRX A;  1W1G A;  1B55 A;  1TXD A;  4KAX B;  2NMB A;  1M7R A;  3G9W A;  2XQN M;  2YS1 A;  2GJY A;  1U2B A;  4NSW A;  5HE3 A;  1OY2 A;  2DTC A;  2Y8G A;  2YF0 A;  4BBK A;  2N0Y A;  3A98 B;  1WG7 A;  5HE2 A;  2CRF A;  2ELA A;  4Z2M B;  1ZC4 B;  4WVF B;  4HB3 B;  3PVU A;  3F5R A;  4HB0 B;  2HTH B;  1KI1 B;  3PZD A;  2RLO A;  5J3T A;  1DDV A;  4PQ0 A;  1FHO A;  4GXB A;  3OAN A;  3HQC A;  1MK7 B;  2DYN A;  1FOE A;  2EJ8 A;  1NU2 A;  2YS5 A;  2MKR A;  3HW2 B;  1XKE A;  4MY6 A;  2W2W A;  5HE1 A;  2J0K A;  2QKM A;  4ZRK A;  1NTY A;  2YS3 A;  5JLJ B;  2UVM A;  3HK0 A;  2HE7 A;  2RUK B;  2DKP A;  1P6S A;  2P0F A;  4D0N B;  4MT7 A;  5EFX A;  4GPT B;  2R09 A;  1U5D A;  3P6A A;  1ZM0 A;  1I2H A;  3GYO A;  1UNR A;  1Y19 B;  1DDM A;  3MPX A;  2NZ8 B;  2DHJ A;  1V5M A;  2M38 A;  2EMT A;  2LUL A;  2VSZ A;  3NSU A;  3P7Z A;  4KHO A;  3UZT A;  2UZR A;  1ZVR A;  3PP2 A;  5LON B;  2W2X D;  3PVW A;  5DIF B;  5D3V A;  1MIX A;  1U5E A;  1U5F A;  1W1D A;  2UZS A;  3QIJ A;  1X86 A;  3ODO A;  4TKN A;  3SYX A;  4F7G A;  1U5G A;  2CY4 A;  3F0W A;  3TW1 A;  2COC A;  4K2O A;  2L2I A;  5JP4 A;  5C6R A;  3A8Q A;  4GMV A;  2D10 A;  2DHI A;  2OTX A;  3ML4 A;  5D27 A;  2LG1 A;  4GMX B;  2I5F A;  3AJ4 A;  3TFM A;  2LYD A;  2KGX B;  5J3Y A;  5KQ1 A;  4P7I A;  1FHX A;  4ZRI A;  1AQC A;  4KHB B;  2BCJ A;  2D9V A;  2YRY A;  3DXD A;  4A6K A;  4XWX A;  1M7E A;  2CAY A;  1FGY A;  3U8Z A;  5FI0 A;  1P3R A;  1KZ7 A;  3PVL A;  2YT0 A;  1ISN A;  1H10 A;  1LW3 A;  1SGH A;  3KRW A;  4HB4 B;  3ODW A;  4DBB A;  3AU4 A;  3WA0 A;  4EMO A;  4PNK A;  2I1K A;  1J19 A;  3M1I B;  5DH9 B;  1K5D B;  1X1G A;  2D9Z A;  4YON A;  5DHF B;  3DXC A;  1XOD A;  2RVB B;  5HE0 A;  3IVF A;  2P8V A;  1NTV A;  1FGZ A;  3BIN A;  3KY9 A;  2RSG A;  3KZ1 A;  2AEH A;  4GN1 A;  2Q13 A;  1TQZ A;  1DBH A;  2DFK A;  2OQB A;  1BWN A;  2LKO A;  2LOX A;  1PMS A;  4C0A A;  1EVH A;  2DN6 A;  4A5K A;  1RJ2 A;  5C79 A;  2M14 A;  2I5C A;  2P0D A;  4KVG B;  1V89 A;  1QQG A;  1XX0 A;  5JHH A;  4HAW B;  5KCV A;  4F7H A;  4IAP A;  4IOY X;  3X23 A;  2RGN B;  2Y7B A;  3VIA A;  1SHC A;  1EF1 A;  1I7A A;  1UPR A;  1WJ1 A;  4HAZ B;  1OQN A;  2D9Y A;  3O96 A;  4EKU A;  4K17 A;  2V76 A;  2D9X A;  3D8F A;  4A6F A;  1MKE A;  4ZRJ A;  1FB8 A;  1ZSQ A;  2VKI A;  3U7D A;  4HB2 B;  1TJ6 A;  4IFS A;  3FSS A;  2DA0 A;  3ZDT A;  1XD4 A;  1P5T A;  1DDW A;  1E5W A;  3TCA A;  4TYZ A;  3GYP A;  1QC6 A;  4KHA A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...