2DHKA

Solution structure of the ph domain of tbc1 domain family member 2 protein from human
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGKKLCGYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMKRWEFHNSPPAPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 2
publication title Solution structure of the PH domain of TBC1 domain family member 2 protein from human
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhkA01
2K2JA 1X1FA 4YONA 1AQCA 2Z0QA 3IVFA 4HB0B 4ZRIA 3GYPA 2CY4A 4Y94A 2KGXB 5GOWB 1PFJA 3KZ1A 3A8QA 4EMOA 1FOEA 1KZGA 2X18A 2ADZA 4PQ0A 4HAUB 1WVHA 2LOZA 1U29A 2MKRA 1NTVA 5KQ1A 1N3HA 2M14A 3VIAA 1BTKA 4HAVB 3F0WA 2DTCA 3ODXA 2UZRA 4TYZA 4F7GA 1P5TA 2AL6A 4K81A 2P0HA 5FI0A 3A8PA 4A5KA 1Y5OA 4Z2NA 2N23A 3PG7A 2YT0A 1XD4A 3ODWA 2OQBA 2GCLA 3PVUA 2OTXA 1IRSA 2R09A 3KRWA 4BBKA 2IYBA 2FJLA 3TCAA 1EVHA 1RJ2A 2RSGA 4GPTB 4WJ7A 4XWXA 4HAZB 3PP2A 4F7HA 4C0AA 4F7UP 2G35A 4CYEA 1H10A 1RRPB 5DIFB 2E2XA 4KHOA 1OMWA 1NI2A 1MIXA 2J0MA 1Y19B 1V61A 4YL8A 4A6HA 5DHAB 2LOXA 3SV1A 2DFKA 2J59M 2L1CA 5CLLB 1M7EA 5FI1A 1I2HA 3UZTA 2DX1A 2IFSA 2D9YA 3SNHA 2DKQA 1XODA 2GJYA 3DXEA 3KSYA 5J3YA 2H7DA 2COAA 3V5WA 1XCGA 1W1GA 2JP2A 2Z0PA 2D9XA 4HATB 1M7RA 3QBVB 3HQCA 1NU2A 5HE3A 4WVFB 1Z87A 3ZDTA 1V89A 5DHFB 2VSZA 2I5CA 1EF1A 3O96A 4KVGB 4ZRKA 1PMSA 1W1HA 1XR0B 1DDVA 2CAYA 4IOYX 1U5GA 3FSSA 3NSUA 1KZ7A 2I1JA 3N7CA 4NY0A 3U7DA 4HAWB 1UPRA 2K2UA 1DROA 2GS0A 2RVBB 1KI1B 5HE2A 1OQNA 3VOQA 1DDMA 1B55A 4DXAB 2Q13A 2EMSA 3G9WA 3PEGA 1BAKA 5LONB 2D2QA 4GN1A 4HB4B 2EMTA 1XKEA 2DHKA 1DYNA 5D3WA 2P0DA 3KY9A 3TFMA 3BJIA 4MT7A 1MK7B 3MPXA 1X05A 3RCPA 2YF0A 4P7IA 1TJ6A 2J0JA 1ZC3B 2YS5A 1WG7A 2Z0OA 2D9VA 3ULBA 2Y8GA 3U8ZA 2V76A 1FGYA 5C79A 4HAXB 1U27A 2DYQA 3P7ZA 3M1IB 3PVWA 1FAOA 2AEHA 5JHGA 5D3VA 2YS1A 3X23A 2DLWA 4CHMA 2DN6A 4HB2B 5DH9B 1UNRA 3ODOA 2PZ1A 4CHJA 2EJ8A 2MDXA 1FHOA 3BINA 3D8EA 3DXDA 2ELAA 5EFXA 2D10A 1TXDA 5HE1A 1U5DA 3QIJA 4K17A 5C6RA 2LULA 4TKNA 5J3QA 2MWNB 4DX90 2UVMA 3HW2B 1ZC4B 2RUKB 4IFSA 2RGNB 1U5EA 3QWMA 2W2WA 4NSWA 3TVVA 3D8FA 3FEHA 2I5FA 1MIZB 1PLSA 2HE7A 2LYDA 1GC7A 3F5RA 2R0DA 1BWNA 1OY2A 2KUPA 3KRXA 5L81A 2DHJA 3AU4A 4KHAA 4HDQA 4L6EA 2NZ8B 2DKPA 2D4QA 2YS3A 4H8SA 1V88A 3SO6A 4HHVA 5KCVA 2HTHB 3T06A 2P8VA 3GYOA 2D9WA 2ROVA 2DX5A 5C5BB 3TO1A 1QQGA 4HB3B 1I7AA 5J3TA 2COFA 2YRYA 1DBHA 1U5FA 1MK9B 3ULCA 5CLQB 5JP4A 1J0WA 3A98B 1XX0A 1X86A 1QC6A 3PSCA 1UEFA 4HAYB 1V5PA 5C16A 1UPQA 1U2BA 1WJ1A 4HDOA 2DA0A 1K5DB 1LW3A 5C5BA 1FHWA 1MPHA 5JHHA 2MFQA 1WI1A 2DHIA 4Z2MB 4EKUA 2Y8FA 1NTYA 1MAIA 2H7EA 1ISNA 2UZSA 1FB8A 2CRFA 3PVLA 1J19A 2CY5A 3D8DA 2LG1A 3CXBB 3TW1A 4GMXB 1W1DA 5HE0A 2M38A 1GC6A 1P6SA 4IAPA 2J0KA 3LJUX 2RNRB 2D9ZA 2YVCA 1UNQA 5DI9B 2KCJA 2Y7BA 4A6KA 3AJ4A 4ZRJA 2RLOA 1WGQA 2W2XD 3OANA 2ZPYA 4A6FB 2D11A 1X1GA 2DYNA 2LKOA 3MDBC 3ZVRA 3WYFB 2L2IA 2ELBA 1WJMA 1DDWA 2COCA 5LOPB 2YT1A 1Q67A 5D27A 1K5GB 5KQ4A 2YSZA 4DX8A 2W2XC 2QKMA 3SYXA 1E5WA 3WA0A 4WSFA 3ML4A 2NMBA 4KHBB 2EC1A 4EJNA 1AWEA 1UNPA 3SUZA 1WGUA 2VKIA 1EGXA 5JLJB 2XQNM 3HK0A 4A6FA 2CODA 1V5MA 1ZVRA 2GCJA 1TQZA 1EAZA 4GXBA 1MKEA 1H4RA 4MK0A 4MY6A 4GMVA 2I1KA 2BCJA 3P6AA 2ROZB 4K2OA 4KAXB 4B6HA 1ZM0A 1FHXA 1X11A 4GZUA 1FGZA 3AU5A 3DXCA 1LB1A 2VRWB 3PZDA 4K2PA 5D3XA 2P0FA 5D3YA 3FM8C 1GG3A 2K00A 1BTNA 1SHCA 2QKLA 1V5UA 2N0YA 1P3RA 4D0NB 4PNKA 1SGHA 4DBBA 1ZSQA 3CIKA
chains in the Genus database with same CATH superfamily
2K2JA 1X1FA 4YONA 1AQCA 2Z0QA 3IVFA 4HB0B 4ZRIA 3GYPA 2CY4A 4Y94A 2Z4DA 2KGXB 5GOWB 1PFJA 3KZ1A 3A8QA 4EMOA 1FOEA 1KZGA 2X18A 2ADZA 4PQ0A 4HAUB 1WVHA 2LOZA 1U29A 2MKRA 1NTVA 5KQ1A 1N3HA 2M14A 3VIAA 1BTKA 2K49A 4HAVB 3F0WA 2DTCA 3ODXA 2UZRA 4L1RA 4TYZA 4F7GA 1P5TA 2AL6A 4K81A 2P0HA 5FI0A 3A8PA 4A5KA 1Y5OA 4Z2NA 2N23A 3PG7A 2YT0A 1XD4A 3ODWA 2OQBA 2GCLA 3PVUA 2OTXA 1IRSA 2R09A 3KRWA 4BBKA 2IYBA 2FJLA 3TCAA 1EVHA 1RJ2A 2RSGA 4GPTB 4WJ7A 4XWXA 2Z14A 4HAZB 3PP2A 4F7HA 4C0AA 4F7UP 2G35A 4CYEA 1H10A 1RRPB 5DIFB 2E2XA 4KHOA 1OMWA 1NI2A 1MIXA 2FJUB 2J0MA 1Y19B 4GOUA 1V61A 4YL8A 4A6HA 5DHAB 2LOXA 3SV1A 2DFKA 2J59M 2L1CA 5CLLB 1M7EA 2KIEA 5FI1A 1I2HA 3UZTA 2DX1A 2IFSA 2D9YA 3SNHA 2DKQA 1XODA 2GJYA 3DXEA 3KSYA 5J3YA 2H7DA 2COAA 3V5WA 1XCGA 1W1GA 2JP2A 2Z0PA 2D9XA 4HATB 1M7RA 3QBVB 3HQCA 1NU2A 5HE3A 2KIGA 4WVFB 1Z87A 3ZDTA 1V89A 5DHFB 2VSZA 2I5CA 1EF1A 3O96A 4KVGB 4ZRKA 1PMSA 1W1HA 1XR0B 1DDVA 2CAYA 4IOYX 1U5GA 3FSSA 3NSUA 1KZ7A 2I1JA 3N7CA 4NY0A 3U7DA 4HAWB 1UPRA 2K2UA 1DROA 2GS0A 2RVBB 1KI1B 5HE2A 1OQNA 3VOQA 1DDMA 1B55A 4DXAB 2Q13A 2EMSA 3G9WA 3PEGA 1BAKA 2NBVA 3NWDA 5LONB 2D2QA 4GN1A 4HB4B 2EMTA 4CSQA 1XKEA 2DHKA 1DYNA 5D3WA 2P0DA 3KY9A 3TFMA 3BJIA 5IRSA 4MT7A 1MK7B 3MPXA 1X05A 3RCPA 2YF0A 4P7IA 1TJ6A 2J0JA 1ZC3B 3HSAA 2YS5A 1WG7A 2Z0OA 1T77A 2D9VA 3ULBA 2Y8GA 3DCXA 3U8ZA 2V76A 2R2YA 1FGYA 5C79A 4HAXB 1U27A 2DYQA 3P7ZA 3M1IB 3PVWA 1FAOA 2GUMA 2AEHA 5JHGA 5D3VA 2YS1A 3X23A 2DLWA 4CHMA 2DN6A 4HB2B 5DH9B 1UNRA 3ODOA 2PZ1A 4CHJA 2EJ8A 2MDXA 1FHOA 3BINA 3D8EA 3DXDA 3NWAA 2ELAA 5EFXA 2D10A 2YT2A 1TXDA 5HE1A 1U5DA 3QIJA 4K17A 5C6RA 2LULA 4TKNA 5J3QA 2MWNB 4DX90 2UVMA 3HW2B 5LG4B 1ZC4B 2RUKB 4IFSA 2RGNB 1U5EA 3QWMA 2W2WA 4NSWA 3TVVA 3D8FA 3FEHA 2I5FA 4QXAB 1MIZB 1PLSA 2HE7A 2LYDA 3U12A 1GC7A 3F5RA 2R0DA 1BWNA 1OY2A 2KUPA 4HSIA 3KRXA 4D6WA 5L81A 2DHJA 3AU4A 4KHAA 4HDQA 4L6EA 5I2SA 2NZ8B 2DKPA 2D4QA 2YS3A 4H8SA 1V88A 3SO6A 4HHVA 5KCVA 2HTHB 3T06A 2P8VA 3GYOA 2D9WA 2ROVA 2DX5A 5C5BB 2Z13A 3TO1A 1QQGA 4HB3B 1I7AA 5J3TA 2COFA 2YRYA 1ZYIA 1DBHA 1U5FA 1MK9B 2RRFA 3ULCA 5CLQB 5JP4A 1J0WA 3A98B 1XX0A 1X86A 1QC6A 3PSCA 1UEFA 4HAYB 1V5PA 5C16A 1UPQA 1U2BA 1WJ1A 4HDOA 2DA0A 1K5DB 1LW3A 5C5BA 1FHWA 2Z59A 1MPHA 5JHHA 2MFQA 3A58A 1WI1A 2DHIA 4OSNA 4Z2MB 4EKUA 2Y8FA 3OHMB 1NTYA 1MAIA 2H7EA 1ISNA 4QJ5B 2UZSA 1FB8A 2CRFA 3PVLA 3FVCA 3NWFA 1J19A 2CY5A 3D8DA 1MI1A 2LG1A 3CXBB 3TW1A 4GMXB 1W1DA 5HE0A 2M38A 2KUQA 1GC6A 1P6SA 4IAPA 5I2MA 2J0KA 3LJUX 2RNRB 2D9ZA 2YVCA 1UNQA 5DI9B 2KCJA 4QJ4B 2Y7BA 4A6KA 3AJ4A 4ZRJA 2RLOA 1WGQA 2W2XD 3OANA 2ZPYA 4A6FB 2D11A 1X1GA 2DYNA 2LKOA 3MDBC 3ZVRA 3WYFB 4DIXA 2L2IA 2ELBA 1WJMA 1DDWA 2COCA 3B77A 5LOPB 2YT1A 1Q67A 5D27A 1K5GB 5KQ4A 2YSZA 4DX8A 2W2XC 2QKMA 3SYXA 1E5WA 4OT1A 3WA0A 4WSFA 3ML4A 2NMBA 4KHBB 2EC1A 4EJNA 1AWEA 1UNPA 3SUZA 1WGUA 2VKIA 1EGXA 5JLJB 2XQNM 3HK0A 4A6FA 2CODA 3HIEA 1V5MA 1ZVRA 5M4YB 2GCJA 1TQZA 1EAZA 4GXBA 1MKEA 1H4RA 4MK0A 4MY6A 3NW8A 4GMVA 4GNKB 2I1KA 4QJ3B 2BCJA 2K8EA 3P6AA 2ROZB 4K2OA 4KAXB 4B6HA 1ZM0A 1FHXA 1X11A 4GZUA 4KHBA 2ZKMX 1FGZA 3AU5A 3DXCA 1LB1A 2VRWB 3PZDA 4K2PA 5D3XA 2P0FA 5D3YA 3FM8C 1GG3A 2K00A 2KR0A 1BTNA 1SHCA 2QKLA 1V5UA 2N0YA 1P3RA 4D0NB 4PNKA 1SGHA 4DBBA 1ZSQA 3CIKA
chains in the Genus database with same CATH topology
2K2JA 1X1FA 4YONA 1AQCA 2Z0QA 3IVFA 4HB0B 4ZRIA 3GYPA 2CY4A 4Y94A 2KGXB 5GOWB 1PFJA 3KZ1A 3A8QA 4EMOA 1FOEA 1KZGA 2X18A 2ADZA 4PQ0A 4HAUB 1WVHA 2LOZA 1U29A 2MKRA 1NTVA 5KQ1A 1N3HA 2M14A 3VIAA 1BTKA 4HAVB 3F0WA 2DTCA 3ODXA 2UZRA 4TYZA 4F7GA 1P5TA 2AL6A 4K81A 2P0HA 5FI0A 3A8PA 4A5KA 1Y5OA 4Z2NA 2N23A 3PG7A 2YT0A 1XD4A 3ODWA 2OQBA 2GCLA 3PVUA 2OTXA 1IRSA 2R09A 3KRWA 4BBKA 2IYBA 2FJLA 3TCAA 1EVHA 1RJ2A 2RSGA 4GPTB 4WJ7A 4XWXA 4HAZB 3PP2A 4F7HA 4C0AA 4F7UP 2G35A 4CYEA 1H10A 1RRPB 5DIFB 2E2XA 4KHOA 1OMWA 1NI2A 1MIXA 2J0MA 1Y19B 1V61A 4YL8A 4A6HA 5DHAB 2LOXA 3SV1A 2DFKA 2J59M 2L1CA 5CLLB 1M7EA 5FI1A 1I2HA 3UZTA 2DX1A 2IFSA 2D9YA 3SNHA 2DKQA 1XODA 2GJYA 3DXEA 3KSYA 5J3YA 2H7DA 2COAA 3V5WA 1XCGA 1W1GA 2JP2A 2Z0PA 2D9XA 4HATB 1M7RA 3QBVB 3HQCA 1NU2A 5HE3A 4WVFB 1Z87A 3ZDTA 1V89A 5DHFB 2VSZA 2I5CA 1EF1A 3O96A 4KVGB 4ZRKA 1PMSA 1W1HA 1XR0B 1DDVA 2CAYA 4IOYX 1U5GA 3FSSA 3NSUA 1KZ7A 2I1JA 3N7CA 4NY0A 3U7DA 4HAWB 1UPRA 2K2UA 1DROA 2GS0A 2RVBB 1KI1B 5HE2A 1OQNA 3VOQA 1DDMA 1B55A 4DXAB 2Q13A 2EMSA 3G9WA 3PEGA 1BAKA 5LONB 2D2QA 4GN1A 4HB4B 2EMTA 1XKEA 2DHKA 1DYNA 5D3WA 2P0DA 3KY9A 3TFMA 3BJIA 4MT7A 1MK7B 3MPXA 1X05A 3RCPA 2YF0A 4P7IA 1TJ6A 2J0JA 1ZC3B 2YS5A 1WG7A 2Z0OA 2D9VA 3ULBA 2Y8GA 3U8ZA 2V76A 1FGYA 5C79A 4HAXB 1U27A 2DYQA 3P7ZA 3M1IB 3PVWA 1FAOA 2AEHA 5JHGA 5D3VA 2YS1A 3X23A 2DLWA 4CHMA 2DN6A 4HB2B 5DH9B 1UNRA 3ODOA 2PZ1A 4CHJA 2EJ8A 2MDXA 1FHOA 3BINA 3D8EA 3DXDA 2ELAA 5EFXA 2D10A 1TXDA 5HE1A 1U5DA 3QIJA 4K17A 5C6RA 2LULA 4TKNA 5J3QA 2MWNB 4DX90 2UVMA 3HW2B 1ZC4B 2RUKB 4IFSA 2RGNB 1U5EA 3QWMA 2W2WA 4NSWA 3TVVA 3D8FA 3FEHA 2I5FA 1MIZB 1PLSA 2HE7A 2LYDA 1GC7A 3F5RA 2R0DA 1BWNA 1OY2A 2KUPA 3KRXA 5L81A 2DHJA 3AU4A 4KHAA 4HDQA 4L6EA 2NZ8B 2DKPA 2D4QA 2YS3A 4H8SA 1V88A 3SO6A 4HHVA 5KCVA 2HTHB 3T06A 2P8VA 3GYOA 2D9WA 2ROVA 2DX5A 5C5BB 3TO1A 1QQGA 4HB3B 1I7AA 5J3TA 2COFA 2YRYA 1DBHA 1U5FA 1MK9B 3ULCA 5CLQB 5JP4A 1J0WA 3A98B 1XX0A 1X86A 1QC6A 3PSCA 1UEFA 4HAYB 1V5PA 5C16A 1UPQA 1U2BA 1WJ1A 4HDOA 2DA0A 1K5DB 1LW3A 5C5BA 1FHWA 1MPHA 5JHHA 2MFQA 1WI1A 2DHIA 4Z2MB 4EKUA 2Y8FA 1NTYA 1MAIA 2H7EA 1ISNA 2UZSA 1FB8A 2CRFA 3PVLA 1J19A 2CY5A 3D8DA 2LG1A 3CXBB 3TW1A 4GMXB 1W1DA 5HE0A 2M38A 1GC6A 1P6SA 4IAPA 2J0KA 3LJUX 2RNRB 2D9ZA 2YVCA 1UNQA 5DI9B 2KCJA 2Y7BA 4A6KA 3AJ4A 4ZRJA 2RLOA 1WGQA 2W2XD 3OANA 2ZPYA 4A6FB 2D11A 1X1GA 2DYNA 2LKOA 3MDBC 3ZVRA 3WYFB 2L2IA 2ELBA 1WJMA 1DDWA 2COCA 5LOPB 2YT1A 1Q67A 5D27A 1K5GB 5KQ4A 2YSZA 4DX8A 2W2XC 2QKMA 3SYXA 1E5WA 3WA0A 4WSFA 3ML4A 2NMBA 4KHBB 2EC1A 4EJNA 1AWEA 1UNPA 3SUZA 1WGUA 2VKIA 1EGXA 5JLJB 2XQNM 3HK0A 4A6FA 2CODA 1V5MA 1ZVRA 2GCJA 1TQZA 1EAZA 4GXBA 1MKEA 1H4RA 4MK0A 4MY6A 4GMVA 2I1KA 2BCJA 3P6AA 2ROZB 4K2OA 4KAXB 4B6HA 1ZM0A 1FHXA 1X11A 4GZUA 1FGZA 3AU5A 3DXCA 1LB1A 2VRWB 3PZDA 4K2PA 5D3XA 2P0FA 5D3YA 3FM8C 1GG3A 2K00A 1BTNA 1SHCA 2QKLA 1V5UA 2N0YA 1P3RA 4D0NB 4PNKA 1SGHA 4DBBA 1ZSQA 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2J A;  1X1F A;  4YON A;  1AQC A;  2Z0Q A;  3IVF A;  4HB0 B;  4ZRI A;  3GYP A;  2CY4 A;  4Y94 A;  2KGX B;  5GOW B;  1PFJ A;  3KZ1 A;  3A8Q A;  4EMO A;  1FOE A;  1KZG A;  2X18 A;  2ADZ A;  4PQ0 A;  4HAU B;  1WVH A;  2LOZ A;  1U29 A;  2MKR A;  1NTV A;  5KQ1 A;  1N3H A;  2M14 A;  3VIA A;  1BTK A;  4HAV B;  3F0W A;  2DTC A;  3ODX A;  2UZR A;  4TYZ A;  4F7G A;  1P5T A;  2AL6 A;  4K81 A;  2P0H A;  5FI0 A;  3A8P A;  4A5K A;  1Y5O A;  4Z2N A;  2N23 A;  3PG7 A;  2YT0 A;  1XD4 A;  3ODW A;  2OQB A;  2GCL A;  3PVU A;  2OTX A;  1IRS A;  2R09 A;  3KRW A;  4BBK A;  2IYB A;  2FJL A;  3TCA A;  1EVH A;  1RJ2 A;  2RSG A;  4GPT B;  4WJ7 A;  4XWX A;  4HAZ B;  3PP2 A;  4F7H A;  4C0A A;  4F7U P;  2G35 A;  4CYE A;  1H10 A;  1RRP B;  5DIF B;  2E2X A;  4KHO A;  1OMW A;  1NI2 A;  1MIX A;  2J0M A;  1Y19 B;  1V61 A;  4YL8 A;  4A6H A;  5DHA B;  2LOX A;  3SV1 A;  2DFK A;  2J59 M;  2L1C A;  5CLL B;  1M7E A;  5FI1 A;  1I2H A;  3UZT A;  2DX1 A;  2IFS A;  2D9Y A;  3SNH A;  2DKQ A;  1XOD A;  2GJY A;  3DXE A;  3KSY A;  5J3Y A;  2H7D A;  2COA A;  3V5W A;  1XCG A;  1W1G A;  2JP2 A;  2Z0P A;  2D9X A;  4HAT B;  1M7R A;  3QBV B;  3HQC A;  1NU2 A;  5HE3 A;  4WVF B;  1Z87 A;  3ZDT A;  1V89 A;  5DHF B;  2VSZ A;  2I5C A;  1EF1 A;  3O96 A;  4KVG B;  4ZRK A;  1PMS A;  1W1H A;  1XR0 B;  1DDV A;  2CAY A;  4IOY X;  1U5G A;  3FSS A;  3NSU A;  1KZ7 A;  2I1J A;  3N7C A;  4NY0 A;  3U7D A;  4HAW B;  1UPR A;  2K2U A;  1DRO A;  2GS0 A;  2RVB B;  1KI1 B;  5HE2 A;  1OQN A;  3VOQ A;  1DDM A;  1B55 A;  4DXA B;  2Q13 A;  2EMS A;  3G9W A;  3PEG A;  1BAK A;  5LON B;  2D2Q A;  4GN1 A;  4HB4 B;  2EMT A;  1XKE A;  2DHK A;  1DYN A;  5D3W A;  2P0D A;  3KY9 A;  3TFM A;  3BJI A;  4MT7 A;  1MK7 B;  3MPX A;  1X05 A;  3RCP A;  2YF0 A;  4P7I A;  1TJ6 A;  2J0J A;  1ZC3 B;  2YS5 A;  1WG7 A;  2Z0O A;  2D9V A;  3ULB A;  2Y8G A;  3U8Z A;  2V76 A;  1FGY A;  5C79 A;  4HAX B;  1U27 A;  2DYQ A;  3P7Z A;  3M1I B;  3PVW A;  1FAO A;  2AEH A;  5JHG A;  5D3V A;  2YS1 A;  3X23 A;  2DLW A;  4CHM A;  2DN6 A;  4HB2 B;  5DH9 B;  1UNR A;  3ODO A;  2PZ1 A;  4CHJ A;  2EJ8 A;  2MDX A;  1FHO A;  3BIN A;  3D8E A;  3DXD A;  2ELA A;  5EFX A;  2D10 A;  1TXD A;  5HE1 A;  1U5D A;  3QIJ A;  4K17 A;  5C6R A;  2LUL A;  4TKN A;  5J3Q A;  2MWN B;  4DX9 0;  2UVM A;  3HW2 B;  1ZC4 B;  2RUK B;  4IFS A;  2RGN B;  1U5E A;  3QWM A;  2W2W A;  4NSW A;  3TVV A;  3D8F A;  3FEH A;  2I5F A;  1MIZ B;  1PLS A;  2HE7 A;  2LYD A;  1GC7 A;  3F5R A;  2R0D A;  1BWN A;  1OY2 A;  2KUP A;  3KRX A;  5L81 A;  2DHJ A;  3AU4 A;  4KHA A;  4HDQ A;  4L6E A;  2NZ8 B;  2DKP A;  2D4Q A;  2YS3 A;  4H8S A;  1V88 A;  3SO6 A;  4HHV A;  5KCV A;  2HTH B;  3T06 A;  2P8V A;  3GYO A;  2D9W A;  2ROV A;  2DX5 A;  5C5B B;  3TO1 A;  1QQG A;  4HB3 B;  1I7A A;  5J3T A;  2COF A;  2YRY A;  1DBH A;  1U5F A;  1MK9 B;  3ULC A;  5CLQ B;  5JP4 A;  1J0W A;  3A98 B;  1XX0 A;  1X86 A;  1QC6 A;  3PSC A;  1UEF A;  4HAY B;  1V5P A;  5C16 A;  1UPQ A;  1U2B A;  1WJ1 A;  4HDO A;  2DA0 A;  1K5D B;  1LW3 A;  5C5B A;  1FHW A;  1MPH A;  5JHH A;  2MFQ A;  1WI1 A;  2DHI A;  4Z2M B;  4EKU A;  2Y8F A;  1NTY A;  1MAI A;  2H7E A;  1ISN A;  2UZS A;  1FB8 A;  2CRF A;  3PVL A;  1J19 A;  2CY5 A;  3D8D A;  2LG1 A;  3CXB B;  3TW1 A;  4GMX B;  1W1D A;  5HE0 A;  2M38 A;  1GC6 A;  1P6S A;  4IAP A;  2J0K A;  3LJU X;  2RNR B;  2D9Z A;  2YVC A;  1UNQ A;  5DI9 B;  2KCJ A;  2Y7B A;  4A6K A;  3AJ4 A;  4ZRJ A;  2RLO A;  1WGQ A;  2W2X D;  3OAN A;  2ZPY A;  4A6F B;  2D11 A;  1X1G A;  2DYN A;  2LKO A;  3MDB C;  3ZVR A;  3WYF B;  2L2I A;  2ELB A;  1WJM A;  1DDW A;  2COC A;  5LOP B;  2YT1 A;  1Q67 A;  5D27 A;  1K5G B;  5KQ4 A;  2YSZ A;  4DX8 A;  2W2X C;  2QKM A;  3SYX A;  1E5W A;  3WA0 A;  4WSF A;  3ML4 A;  2NMB A;  4KHB B;  2EC1 A;  4EJN A;  1AWE A;  1UNP A;  3SUZ A;  1WGU A;  2VKI A;  1EGX A;  5JLJ B;  2XQN M;  3HK0 A;  4A6F A;  2COD A;  1V5M A;  1ZVR A;  2GCJ A;  1TQZ A;  1EAZ A;  4GXB A;  1MKE A;  1H4R A;  4MK0 A;  4MY6 A;  4GMV A;  2I1K A;  2BCJ A;  3P6A A;  2ROZ B;  4K2O A;  4KAX B;  4B6H A;  1ZM0 A;  1FHX A;  1X11 A;  4GZU A;  1FGZ A;  3AU5 A;  3DXC A;  1LB1 A;  2VRW B;  3PZD A;  4K2P A;  5D3X A;  2P0F A;  5D3Y A;  3FM8 C;  1GG3 A;  2K00 A;  1BTN A;  1SHC A;  2QKL A;  1V5U A;  2N0Y A;  1P3R A;  4D0N B;  4PNK A;  1SGH A;  4DBB A;  1ZSQ A;  3CIK A; 
#chains in the Genus database with same CATH topology
 2K2J A;  1X1F A;  4YON A;  1AQC A;  2Z0Q A;  3IVF A;  4HB0 B;  4ZRI A;  3GYP A;  2CY4 A;  4Y94 A;  2Z4D A;  2KGX B;  5GOW B;  1PFJ A;  3KZ1 A;  3A8Q A;  4EMO A;  1FOE A;  1KZG A;  2X18 A;  2ADZ A;  4PQ0 A;  4HAU B;  1WVH A;  2LOZ A;  1U29 A;  2MKR A;  1NTV A;  5KQ1 A;  1N3H A;  2M14 A;  3VIA A;  1BTK A;  2K49 A;  4HAV B;  3F0W A;  2DTC A;  3ODX A;  2UZR A;  4L1R A;  4TYZ A;  4F7G A;  1P5T A;  2AL6 A;  4K81 A;  2P0H A;  5FI0 A;  3A8P A;  4A5K A;  1Y5O A;  4Z2N A;  2N23 A;  3PG7 A;  2YT0 A;  1XD4 A;  3ODW A;  2OQB A;  2GCL A;  3PVU A;  2OTX A;  1IRS A;  2R09 A;  3KRW A;  4BBK A;  2IYB A;  2FJL A;  3TCA A;  1EVH A;  1RJ2 A;  2RSG A;  4GPT B;  4WJ7 A;  4XWX A;  2Z14 A;  4HAZ B;  3PP2 A;  4F7H A;  4C0A A;  4F7U P;  2G35 A;  4CYE A;  1H10 A;  1RRP B;  5DIF B;  2E2X A;  4KHO A;  1OMW A;  1NI2 A;  1MIX A;  2FJU B;  2J0M A;  1Y19 B;  4GOU A;  1V61 A;  4YL8 A;  4A6H A;  5DHA B;  2LOX A;  3SV1 A;  2DFK A;  2J59 M;  2L1C A;  5CLL B;  1M7E A;  2KIE A;  5FI1 A;  1I2H A;  3UZT A;  2DX1 A;  2IFS A;  2D9Y A;  3SNH A;  2DKQ A;  1XOD A;  2GJY A;  3DXE A;  3KSY A;  5J3Y A;  2H7D A;  2COA A;  3V5W A;  1XCG A;  1W1G A;  2JP2 A;  2Z0P A;  2D9X A;  4HAT B;  1M7R A;  3QBV B;  3HQC A;  1NU2 A;  5HE3 A;  2KIG A;  4WVF B;  1Z87 A;  3ZDT A;  1V89 A;  5DHF B;  2VSZ A;  2I5C A;  1EF1 A;  3O96 A;  4KVG B;  4ZRK A;  1PMS A;  1W1H A;  1XR0 B;  1DDV A;  2CAY A;  4IOY X;  1U5G A;  3FSS A;  3NSU A;  1KZ7 A;  2I1J A;  3N7C A;  4NY0 A;  3U7D A;  4HAW B;  1UPR A;  2K2U A;  1DRO A;  2GS0 A;  2RVB B;  1KI1 B;  5HE2 A;  1OQN A;  3VOQ A;  1DDM A;  1B55 A;  4DXA B;  2Q13 A;  2EMS A;  3G9W A;  3PEG A;  1BAK A;  2NBV A;  3NWD A;  5LON B;  2D2Q A;  4GN1 A;  4HB4 B;  2EMT A;  4CSQ A;  1XKE A;  2DHK A;  1DYN A;  5D3W A;  2P0D A;  3KY9 A;  3TFM A;  3BJI A;  5IRS A;  4MT7 A;  1MK7 B;  3MPX A;  1X05 A;  3RCP A;  2YF0 A;  4P7I A;  1TJ6 A;  2J0J A;  1ZC3 B;  3HSA A;  2YS5 A;  1WG7 A;  2Z0O A;  1T77 A;  2D9V A;  3ULB A;  2Y8G A;  3DCX A;  3U8Z A;  2V76 A;  2R2Y A;  1FGY A;  5C79 A;  4HAX B;  1U27 A;  2DYQ A;  3P7Z A;  3M1I B;  3PVW A;  1FAO A;  2GUM A;  2AEH A;  5JHG A;  5D3V A;  2YS1 A;  3X23 A;  2DLW A;  4CHM A;  2DN6 A;  4HB2 B;  5DH9 B;  1UNR A;  3ODO A;  2PZ1 A;  4CHJ A;  2EJ8 A;  2MDX A;  1FHO A;  3BIN A;  3D8E A;  3DXD A;  3NWA A;  2ELA A;  5EFX A;  2D10 A;  2YT2 A;  1TXD A;  5HE1 A;  1U5D A;  3QIJ A;  4K17 A;  5C6R A;  2LUL A;  4TKN A;  5J3Q A;  2MWN B;  4DX9 0;  2UVM A;  3HW2 B;  5LG4 B;  1ZC4 B;  2RUK B;  4IFS A;  2RGN B;  1U5E A;  3QWM A;  2W2W A;  4NSW A;  3TVV A;  3D8F A;  3FEH A;  2I5F A;  4QXA B;  1MIZ B;  1PLS A;  2HE7 A;  2LYD A;  3U12 A;  1GC7 A;  3F5R A;  2R0D A;  1BWN A;  1OY2 A;  2KUP A;  4HSI A;  3KRX A;  4D6W A;  5L81 A;  2DHJ A;  3AU4 A;  4KHA A;  4HDQ A;  4L6E A;  5I2S A;  2NZ8 B;  2DKP A;  2D4Q A;  2YS3 A;  4H8S A;  1V88 A;  3SO6 A;  4HHV A;  5KCV A;  2HTH B;  3T06 A;  2P8V A;  3GYO A;  2D9W A;  2ROV A;  2DX5 A;  5C5B B;  2Z13 A;  3TO1 A;  1QQG A;  4HB3 B;  1I7A A;  5J3T A;  2COF A;  2YRY A;  1ZYI A;  1DBH A;  1U5F A;  1MK9 B;  2RRF A;  3ULC A;  5CLQ B;  5JP4 A;  1J0W A;  3A98 B;  1XX0 A;  1X86 A;  1QC6 A;  3PSC A;  1UEF A;  4HAY B;  1V5P A;  5C16 A;  1UPQ A;  1U2B A;  1WJ1 A;  4HDO A;  2DA0 A;  1K5D B;  1LW3 A;  5C5B A;  1FHW A;  2Z59 A;  1MPH A;  5JHH A;  2MFQ A;  3A58 A;  1WI1 A;  2DHI A;  4OSN A;  4Z2M B;  4EKU A;  2Y8F A;  3OHM B;  1NTY A;  1MAI A;  2H7E A;  1ISN A;  4QJ5 B;  2UZS A;  1FB8 A;  2CRF A;  3PVL A;  3FVC A;  3NWF A;  1J19 A;  2CY5 A;  3D8D A;  1MI1 A;  2LG1 A;  3CXB B;  3TW1 A;  4GMX B;  1W1D A;  5HE0 A;  2M38 A;  2KUQ A;  1GC6 A;  1P6S A;  4IAP A;  5I2M A;  2J0K A;  3LJU X;  2RNR B;  2D9Z A;  2YVC A;  1UNQ A;  5DI9 B;  2KCJ A;  4QJ4 B;  2Y7B A;  4A6K A;  3AJ4 A;  4ZRJ A;  2RLO A;  1WGQ A;  2W2X D;  3OAN A;  2ZPY A;  4A6F B;  2D11 A;  1X1G A;  2DYN A;  2LKO A;  3MDB C;  3ZVR A;  3WYF B;  4DIX A;  2L2I A;  2ELB A;  1WJM A;  1DDW A;  2COC A;  3B77 A;  5LOP B;  2YT1 A;  1Q67 A;  5D27 A;  1K5G B;  5KQ4 A;  2YSZ A;  4DX8 A;  2W2X C;  2QKM A;  3SYX A;  1E5W A;  4OT1 A;  3WA0 A;  4WSF A;  3ML4 A;  2NMB A;  4KHB B;  2EC1 A;  4EJN A;  1AWE A;  1UNP A;  3SUZ A;  1WGU A;  2VKI A;  1EGX A;  5JLJ B;  2XQN M;  3HK0 A;  4A6F A;  2COD A;  3HIE A;  1V5M A;  1ZVR A;  5M4Y B;  2GCJ A;  1TQZ A;  1EAZ A;  4GXB A;  1MKE A;  1H4R A;  4MK0 A;  4MY6 A;  3NW8 A;  4GMV A;  4GNK B;  2I1K A;  4QJ3 B;  2BCJ A;  2K8E A;  3P6A A;  2ROZ B;  4K2O A;  4KAX B;  4B6H A;  1ZM0 A;  1FHX A;  1X11 A;  4GZU A;  4KHB A;  2ZKM X;  1FGZ A;  3AU5 A;  3DXC A;  1LB1 A;  2VRW B;  3PZD A;  4K2P A;  5D3X A;  2P0F A;  5D3Y A;  3FM8 C;  1GG3 A;  2K00 A;  2KR0 A;  1BTN A;  1SHC A;  2QKL A;  1V5U A;  2N0Y A;  1P3R A;  4D0N B;  4PNK A;  1SGH A;  4DBB A;  1ZSQ A;  3CIK A; 
#chains in the Genus database with same CATH homology
 2K2J A;  1X1F A;  4YON A;  1AQC A;  2Z0Q A;  3IVF A;  4HB0 B;  4ZRI A;  3GYP A;  2CY4 A;  4Y94 A;  2KGX B;  5GOW B;  1PFJ A;  3KZ1 A;  3A8Q A;  4EMO A;  1FOE A;  1KZG A;  2X18 A;  2ADZ A;  4PQ0 A;  4HAU B;  1WVH A;  2LOZ A;  1U29 A;  2MKR A;  1NTV A;  5KQ1 A;  1N3H A;  2M14 A;  3VIA A;  1BTK A;  4HAV B;  3F0W A;  2DTC A;  3ODX A;  2UZR A;  4TYZ A;  4F7G A;  1P5T A;  2AL6 A;  4K81 A;  2P0H A;  5FI0 A;  3A8P A;  4A5K A;  1Y5O A;  4Z2N A;  2N23 A;  3PG7 A;  2YT0 A;  1XD4 A;  3ODW A;  2OQB A;  2GCL A;  3PVU A;  2OTX A;  1IRS A;  2R09 A;  3KRW A;  4BBK A;  2IYB A;  2FJL A;  3TCA A;  1EVH A;  1RJ2 A;  2RSG A;  4GPT B;  4WJ7 A;  4XWX A;  4HAZ B;  3PP2 A;  4F7H A;  4C0A A;  4F7U P;  2G35 A;  4CYE A;  1H10 A;  1RRP B;  5DIF B;  2E2X A;  4KHO A;  1OMW A;  1NI2 A;  1MIX A;  2J0M A;  1Y19 B;  1V61 A;  4YL8 A;  4A6H A;  5DHA B;  2LOX A;  3SV1 A;  2DFK A;  2J59 M;  2L1C A;  5CLL B;  1M7E A;  5FI1 A;  1I2H A;  3UZT A;  2DX1 A;  2IFS A;  2D9Y A;  3SNH A;  2DKQ A;  1XOD A;  2GJY A;  3DXE A;  3KSY A;  5J3Y A;  2H7D A;  2COA A;  3V5W A;  1XCG A;  1W1G A;  2JP2 A;  2Z0P A;  2D9X A;  4HAT B;  1M7R A;  3QBV B;  3HQC A;  1NU2 A;  5HE3 A;  4WVF B;  1Z87 A;  3ZDT A;  1V89 A;  5DHF B;  2VSZ A;  2I5C A;  1EF1 A;  3O96 A;  4KVG B;  4ZRK A;  1PMS A;  1W1H A;  1XR0 B;  1DDV A;  2CAY A;  4IOY X;  1U5G A;  3FSS A;  3NSU A;  1KZ7 A;  2I1J A;  3N7C A;  4NY0 A;  3U7D A;  4HAW B;  1UPR A;  2K2U A;  1DRO A;  2GS0 A;  2RVB B;  1KI1 B;  5HE2 A;  1OQN A;  3VOQ A;  1DDM A;  1B55 A;  4DXA B;  2Q13 A;  2EMS A;  3G9W A;  3PEG A;  1BAK A;  5LON B;  2D2Q A;  4GN1 A;  4HB4 B;  2EMT A;  1XKE A;  2DHK A;  1DYN A;  5D3W A;  2P0D A;  3KY9 A;  3TFM A;  3BJI A;  4MT7 A;  1MK7 B;  3MPX A;  1X05 A;  3RCP A;  2YF0 A;  4P7I A;  1TJ6 A;  2J0J A;  1ZC3 B;  2YS5 A;  1WG7 A;  2Z0O A;  2D9V A;  3ULB A;  2Y8G A;  3U8Z A;  2V76 A;  1FGY A;  5C79 A;  4HAX B;  1U27 A;  2DYQ A;  3P7Z A;  3M1I B;  3PVW A;  1FAO A;  2AEH A;  5JHG A;  5D3V A;  2YS1 A;  3X23 A;  2DLW A;  4CHM A;  2DN6 A;  4HB2 B;  5DH9 B;  1UNR A;  3ODO A;  2PZ1 A;  4CHJ A;  2EJ8 A;  2MDX A;  1FHO A;  3BIN A;  3D8E A;  3DXD A;  2ELA A;  5EFX A;  2D10 A;  1TXD A;  5HE1 A;  1U5D A;  3QIJ A;  4K17 A;  5C6R A;  2LUL A;  4TKN A;  5J3Q A;  2MWN B;  4DX9 0;  2UVM A;  3HW2 B;  1ZC4 B;  2RUK B;  4IFS A;  2RGN B;  1U5E A;  3QWM A;  2W2W A;  4NSW A;  3TVV A;  3D8F A;  3FEH A;  2I5F A;  1MIZ B;  1PLS A;  2HE7 A;  2LYD A;  1GC7 A;  3F5R A;  2R0D A;  1BWN A;  1OY2 A;  2KUP A;  3KRX A;  5L81 A;  2DHJ A;  3AU4 A;  4KHA A;  4HDQ A;  4L6E A;  2NZ8 B;  2DKP A;  2D4Q A;  2YS3 A;  4H8S A;  1V88 A;  3SO6 A;  4HHV A;  5KCV A;  2HTH B;  3T06 A;  2P8V A;  3GYO A;  2D9W A;  2ROV A;  2DX5 A;  5C5B B;  3TO1 A;  1QQG A;  4HB3 B;  1I7A A;  5J3T A;  2COF A;  2YRY A;  1DBH A;  1U5F A;  1MK9 B;  3ULC A;  5CLQ B;  5JP4 A;  1J0W A;  3A98 B;  1XX0 A;  1X86 A;  1QC6 A;  3PSC A;  1UEF A;  4HAY B;  1V5P A;  5C16 A;  1UPQ A;  1U2B A;  1WJ1 A;  4HDO A;  2DA0 A;  1K5D B;  1LW3 A;  5C5B A;  1FHW A;  1MPH A;  5JHH A;  2MFQ A;  1WI1 A;  2DHI A;  4Z2M B;  4EKU A;  2Y8F A;  1NTY A;  1MAI A;  2H7E A;  1ISN A;  2UZS A;  1FB8 A;  2CRF A;  3PVL A;  1J19 A;  2CY5 A;  3D8D A;  2LG1 A;  3CXB B;  3TW1 A;  4GMX B;  1W1D A;  5HE0 A;  2M38 A;  1GC6 A;  1P6S A;  4IAP A;  2J0K A;  3LJU X;  2RNR B;  2D9Z A;  2YVC A;  1UNQ A;  5DI9 B;  2KCJ A;  2Y7B A;  4A6K A;  3AJ4 A;  4ZRJ A;  2RLO A;  1WGQ A;  2W2X D;  3OAN A;  2ZPY A;  4A6F B;  2D11 A;  1X1G A;  2DYN A;  2LKO A;  3MDB C;  3ZVR A;  3WYF B;  2L2I A;  2ELB A;  1WJM A;  1DDW A;  2COC A;  5LOP B;  2YT1 A;  1Q67 A;  5D27 A;  1K5G B;  5KQ4 A;  2YSZ A;  4DX8 A;  2W2X C;  2QKM A;  3SYX A;  1E5W A;  3WA0 A;  4WSF A;  3ML4 A;  2NMB A;  4KHB B;  2EC1 A;  4EJN A;  1AWE A;  1UNP A;  3SUZ A;  1WGU A;  2VKI A;  1EGX A;  5JLJ B;  2XQN M;  3HK0 A;  4A6F A;  2COD A;  1V5M A;  1ZVR A;  2GCJ A;  1TQZ A;  1EAZ A;  4GXB A;  1MKE A;  1H4R A;  4MK0 A;  4MY6 A;  4GMV A;  2I1K A;  2BCJ A;  3P6A A;  2ROZ B;  4K2O A;  4KAX B;  4B6H A;  1ZM0 A;  1FHX A;  1X11 A;  4GZU A;  1FGZ A;  3AU5 A;  3DXC A;  1LB1 A;  2VRW B;  3PZD A;  4K2P A;  5D3X A;  2P0F A;  5D3Y A;  3FM8 C;  1GG3 A;  2K00 A;  1BTN A;  1SHC A;  2QKL A;  1V5U A;  2N0Y A;  1P3R A;  4D0N B;  4PNK A;  1SGH A;  4DBB A;  1ZSQ A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...