2DHKA

Solution structure of the ph domain of tbc1 domain family member 2 protein from human
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKKLCGYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMKRWEFHNSPPAPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of TBC1 domain family member 2 protein from human
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TBC1 domain family member 2
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhkA01
2CAYA 3HW2B 1EGXA 2KCJA 4TYZA 2HTHB 4HDQA 2MDXA 1X05A 1WGUA 2YS1A 5KCVA 2W2WA 2P0DA 1ZC4B 1RRPB 2RNRB 3M1IB 5DHFB 2LULA 2COFA 2NMBA 4HAXB 1Y19B 3D8EA 1PLSA 1TJ6A 2J0MA 4GMXB 2J0JA 1DROA 3ML4A 1FHWA 5GOWB 2DHKA 1GC6A 3NSUA 2DX5A 1ISNA 3X23A 2MFQA 1QQGA 3AU4A 1NI2A 2LG1A 1MK9B 1NTYA 1EVHA 2CY5A 2YS5A 3U7DA 3QIJA 1P3RA 4BBKA 2KGXB 2Y8GA 2XQNM 2KUPA 5C16A 4C0AA 2DHJA 2I1JA 1AWEA 1B55A 1W1GA 3SNHA 2BCJA 2M38A 3PP2A 4EKUA 3G9WA 3FEHA 2LYDA 2OTXA 1W1HA 5JLJB 3P6AA 5CLLB 3T06A 1H10A 4ZRKA 2QKMA 2M14A 1KZ7A 2ADZA 3D8DA 4ZRJA 1LB1A 3OANA 3VOQA 2Y8FA 2D9WA 4NY0A 3HQCA 1QC6A 3ULCA 1OQNA 2EMSA 1SHCA 3BJIA 4WSFA 3O96A 1KZGA 2RUKB 2DA0A 4Z2NA 2VSZA 5LONB 3MDBC 3AJ4A 1MIXA 2YT0A 4KVGB 2H7DA 3V5WA 5FI0A 2CRFA 2D9VA 2PZ1A 1U2BA 5LOPB 1P6SA 2DKQA 2IYBA 1EAZA 3KRXA 1NU2A 3F5RA 1AQCA 1OY2A 2YSZA 2D2QA 3A8QA 5D3XA 3SUZA 5L81A 5CLQB 3CXBB 2N0YA 4CYEA 1WGQA 3PZDA 4F7HA 2DHIA 2ROVA 2DYQA 4HB0B 5J3YA 4IOYX 3PVUA 3PG7A 2R0DA 5HE3A 1KI1B 4CHJA 4MK0A 4K17A 3TFMA 1V5MA 4WJ7A 1DDWA 2DN6A 5DI9B 3PEGA 1FHXA 4Y94A 3SO6A 1GC7A 3IVFA 3QBVB 2YT1A 5KQ4A 3ODXA 4EJNA 3D8FA 2Z0OA 2P0HA 2GCLA 2LKOA 2N23A 4YL8A 2GCJA 2DFKA 2K2JA 5EFXA 1UNRA 1PFJA 5JHHA 2RVBB 4HAYB 3SV1A 2W2XC 3KRWA 2YF0A 1UNQA 4HAZB 1X86A 2R09A 3QWMA 1U27A 1FB8A 2COAA 3DXDA 2QKLA 3KSYA 2YS3A 4NSWA 2MWNB 3TCAA 5C5BA 2L2IA 1V88A 5C6RA 4K81A 1I2HA 1DDVA 4HAVB 5D3WA 1ZC3B 2L1CA 2GS0A 5DH9B 1N3HA 4GN1A 1FGZA 2UZRA 3WYFB 3GYOA 3U8ZA 5J3TA 3N7CA 1SGHA 5D3YA 2K00A 1MIZB 2RSGA 4K2OA 4HATB 1XCGA 3GYPA 2J59M 5JP4A 2AL6A 4GMVA 1EF1A 1NTVA 1FOEA 2ELBA 5C79A 2H7EA 5C5BB 3ZVRA 2D11A 1TXDA 4MY6A 2Z0PA 3VIAA 4F7UP 1UPQA 2RGNB 1U5DA 4HAWB 1UNPA 1DYNA 1BWNA 2W2XD 4HHVA 2IFSA 5KQ1A 2P8VA 1ZSQA 2DKPA 5HE1A 1U5EA 4HB3B 4YONA 4KHOA 5D27A 1MPHA 1DBHA 1U29A 4HB4B 1V61A 3P7ZA 1WJ1A 1IRSA 1LW3A 4WVFB 1X1GA 1UPRA 3A8PA 3PVWA 2EJ8A 3FM8C 4EMOA 4K2PA 2D9ZA 2Q13A 3ZDTA 5J3QA 2ROZB 1V5PA 4A6FA 2NZ8B 4GXBA 5JHGA 3TVVA 2X18A 2ZPYA 2LOZA 4A6HA 5DHAB 3CIKA 1FAOA 3TO1A 1I7AA 1U5FA 4XWXA 2YRYA 4HB2B 1Y5OA 1M7RA 2J0KA 3DXEA 4CHMA 2ELAA 4ZRIA 3TW1A 2CY4A 5HE2A 4PNKA 1M7EA 4B6HA 3FSSA 2YVCA 4TKNA 2VKIA 2UVMA 2JP2A 2P0FA 4H8SA 4A6FB 1BTNA 1FGYA 3UZTA 1DDMA 2D10A 4HAUB 4DX8A 2GJYA 4P7IA 1W1DA 2D9XA 4GZUA 1U5GA 4Z2MB 2I1KA 1WVHA 3RCPA 3WA0A 1XODA 2Y7BA 1WI1A 3ODOA 4IAPA 2G35A 3SYXA 3LJUX 4PQ0A 4KAXB 1Z87A 4D0NB 1X11A 2COCA 3MPXA 2OQBA 2EMTA 1XD4A 1J0WA 2UZSA 3DXCA 4HDOA 2E2XA 1WG7A 2DLWA 1X1FA 3KY9A 1ZM0A 1GG3A 1V89A 4KHBB 4IFSA 2LOXA 4A5KA 2Z0QA 1WJMA 1FHOA 1E5WA 1BTKA 1OMWA 5FI1A 2AEHA 1MAIA 2I5FA 4KHAA 4DBBA 1BAKA 2DTCA 1XR0B 2FJLA 1J19A 2DYNA 1Q67A 4DXAB 1P5TA 2VRWB 1PMSA 5HE0A 2D9YA 2K2UA 1MKEA 3HK0A 4GPTB 3KZ1A 1UEFA 2RLOA 3ULBA 5D3VA 1ZVRA 2DX1A 1RJ2A 3PVLA 4MT7A 2D4QA 1H4RA 2MKRA 1MK7B 3ODWA 1V5UA 3AU5A 3A98B 3F0WA 4A6KA 1K5GB 2I5CA 1XKEA 1TQZA 4DX90 2HE7A 3PSCA 4L6EA 1K5DB 2V76A 2EC1A 5DIFB 2CODA 3BINA 4F7GA 1XX0A
chains in the Genus database with same CATH superfamily
2CAYA 3HW2B 2FJUB 1EGXA 2KCJA 4TYZA 2HTHB 4HDQA 2MDXA 1X05A 1WGUA 2YS1A 5KCVA 2W2WA 2P0DA 1ZC4B 1RRPB 2RNRB 3M1IB 5DHFB 2LULA 2COFA 4HSIA 2NMBA 4HAXB 1Y19B 3D8EA 1PLSA 1TJ6A 2J0MA 2KUQA 3FVCA 4GMXB 2J0JA 3NWDA 3A58A 1DROA 3ML4A 1FHWA 5GOWB 2DHKA 1GC6A 3NSUA 2DX5A 1ISNA 3X23A 2MFQA 1QQGA 3AU4A 1NI2A 2LG1A 1MK9B 1NTYA 1EVHA 2CY5A 2RRFA 2YS5A 3U7DA 3QIJA 1P3RA 4BBKA 2KGXB 2Y8GA 2XQNM 2KUPA 5C16A 4C0AA 2DHJA 2I1JA 1AWEA 1B55A 1W1GA 3SNHA 2BCJA 2M38A 3PP2A 4QJ5B 4EKUA 3G9WA 4QJ4B 3FEHA 2LYDA 2OTXA 1W1HA 5JLJB 3P6AA 5CLLB 3T06A 1H10A 4ZRKA 2QKMA 2M14A 1KZ7A 2ADZA 3D8DA 4ZRJA 1LB1A 3OANA 3VOQA 2Y8FA 5I2MA 2D9WA 4D6WA 4NY0A 3HQCA 1QC6A 3ULCA 1OQNA 2KIGA 2EMSA 1SHCA 3BJIA 4WSFA 1ZYIA 3O96A 4OT1A 1KZGA 2RUKB 3NWFA 2DA0A 4Z2NA 2VSZA 5LONB 3MDBC 3AJ4A 1MIXA 2YT0A 4KVGB 2H7DA 3V5WA 5FI0A 2CRFA 2D9VA 2PZ1A 1U2BA 5LOPB 1P6SA 2DKQA 2IYBA 1EAZA 1T77A 1NU2A 3F5RA 3KRXA 1AQCA 1OY2A 2YSZA 2D2QA 3A8QA 5D3XA 4OSNA 3SUZA 5L81A 2K8EA 5CLQB 3CXBB 4QJ3B 2GUMA 2R2YA 2N0YA 4CYEA 1WGQA 3PZDA 4F7HA 2DHIA 2Z13A 2ROVA 2DYQA 4HB0B 5J3YA 4IOYX 3PVUA 3PG7A 2R0DA 2KR0A 5HE3A 1KI1B 4CHJA 4MK0A 4K17A 3TFMA 1V5MA 4WJ7A 1DDWA 2DN6A 4QXAB 5DI9B 4GNKB 3PEGA 1FHXA 4Y94A 3SO6A 1GC7A 3IVFA 3QBVB 1MI1A 2YT1A 5KQ4A 3ODXA 4EJNA 3D8FA 2Z0OA 2P0HA 2GCLA 2LKOA 2N23A 4YL8A 2GCJA 2DFKA 2K2JA 5EFXA 1UNRA 1PFJA 5JHHA 2RVBB 4HAYB 3SV1A 2W2XC 3KRWA 2YF0A 1UNQA 4HAZB 1X86A 2R09A 3QWMA 1U27A 1FB8A 2COAA 3DXDA 2QKLA 3KSYA 2YS3A 4NSWA 4L1RA 2MWNB 3TCAA 4DIXA 5C5BA 2L2IA 1V88A 4GOUA 4K81A 5C6RA 1I2HA 1DDVA 4HAVB 5D3WA 1ZC3B 2L1CA 2GS0A 2ZKMX 5DH9B 1N3HA 3OHMB 4GN1A 1FGZA 2UZRA 3WYFB 4CSQA 2Z4DA 3GYOA 3U8ZA 5J3TA 3N7CA 3NWAA 1SGHA 5D3YA 2K00A 1MIZB 2RSGA 4K2OA 4HATB 1XCGA 3GYPA 2J59M 5JP4A 2AL6A 4GMVA 1EF1A 1NTVA 2KIEA 1FOEA 2ELBA 5C79A 2H7EA 5C5BB 3ZVRA 2D11A 1TXDA 4MY6A 2Z0PA 3VIAA 4F7UP 1UPQA 2RGNB 1U5DA 4HAWB 1UNPA 1DYNA 1BWNA 2W2XD 4HHVA 2IFSA 5KQ1A 2P8VA 1ZSQA 2DKPA 5HE1A 1U5EA 4HB3B 4YONA 4KHOA 5D27A 2Z59A 1MPHA 1DBHA 1U29A 4HB4B 1V61A 3P7ZA 1WJ1A 1IRSA 1LW3A 4WVFB 1X1GA 1UPRA 3A8PA 3U12A 3PVWA 5IRSA 2EJ8A 3FM8C 4EMOA 4K2PA 2D9ZA 2Q13A 3ZDTA 5J3QA 2ROZB 1V5PA 4A6FA 2NZ8B 4GXBA 5JHGA 3TVVA 2X18A 2ZPYA 2LOZA 2K49A 4A6HA 5DHAB 3CIKA 1FAOA 3TO1A 1I7AA 1U5FA 4XWXA 2YRYA 4HB2B 2YT2A 1Y5OA 1M7RA 2J0KA 3DXEA 2Z14A 4CHMA 2ELAA 4ZRIA 5LG4B 3TW1A 2CY4A 5HE2A 3HSAA 4PNKA 1M7EA 4B6HA 3FSSA 3DCXA 3NW8A 2YVCA 4TKNA 2VKIA 2UVMA 2NBVA 2JP2A 2P0FA 4H8SA 4A6FB 1BTNA 1FGYA 3UZTA 1DDMA 2D10A 4HAUB 4DX8A 2GJYA 4P7IA 1W1DA 2D9XA 3B77A 3HIEA 4GZUA 1U5GA 4Z2MB 2I1KA 1WVHA 3RCPA 3WA0A 1XODA 2Y7BA 1WI1A 3ODOA 4IAPA 2G35A 3SYXA 3LJUX 4PQ0A 4KAXB 1Z87A 4D0NB 1X11A 2COCA 3MPXA 5I2SA 2OQBA 2EMTA 1XD4A 1J0WA 2UZSA 3DXCA 4HDOA 2E2XA 1WG7A 2DLWA 1X1FA 3KY9A 1ZM0A 1GG3A 1V89A 4KHBB 4IFSA 2LOXA 4A5KA 5M4YB 2Z0QA 1WJMA 1FHOA 1E5WA 1BTKA 1OMWA 5FI1A 2AEHA 1MAIA 2I5FA 4KHAA 4DBBA 1BAKA 2DTCA 1XR0B 2FJLA 1J19A 2DYNA 1Q67A 4DXAB 1P5TA 2VRWB 1PMSA 5HE0A 2D9YA 2K2UA 1MKEA 3HK0A 4GPTB 3KZ1A 1UEFA 2RLOA 3ULBA 5D3VA 1ZVRA 2DX1A 3PVLA 1RJ2A 4MT7A 2D4QA 1H4RA 2MKRA 1MK7B 3ODWA 4KHBA 1V5UA 3AU5A 3A98B 3F0WA 4A6KA 1K5GB 2I5CA 1XKEA 1TQZA 4DX90 2HE7A 3PSCA 4L6EA 1K5DB 2V76A 2EC1A 5DIFB 2CODA 3BINA 4F7GA 1XX0A
chains in the Genus database with same CATH topology
2CAYA 3HW2B 1EGXA 2KCJA 4TYZA 2HTHB 4HDQA 2MDXA 1X05A 1WGUA 2YS1A 5KCVA 2W2WA 2P0DA 1ZC4B 1RRPB 2RNRB 3M1IB 5DHFB 2LULA 2COFA 2NMBA 4HAXB 1Y19B 3D8EA 1PLSA 1TJ6A 2J0MA 4GMXB 2J0JA 1DROA 3ML4A 1FHWA 5GOWB 2DHKA 1GC6A 3NSUA 2DX5A 1ISNA 3X23A 2MFQA 1QQGA 3AU4A 1NI2A 2LG1A 1MK9B 1NTYA 1EVHA 2CY5A 2YS5A 3U7DA 3QIJA 1P3RA 4BBKA 2KGXB 2Y8GA 2XQNM 2KUPA 5C16A 4C0AA 2DHJA 2I1JA 1AWEA 1B55A 1W1GA 3SNHA 2BCJA 2M38A 3PP2A 4EKUA 3G9WA 3FEHA 2LYDA 2OTXA 1W1HA 5JLJB 3P6AA 5CLLB 3T06A 1H10A 4ZRKA 2QKMA 2M14A 1KZ7A 2ADZA 3D8DA 4ZRJA 1LB1A 3OANA 3VOQA 2Y8FA 2D9WA 4NY0A 3HQCA 1QC6A 3ULCA 1OQNA 2EMSA 1SHCA 3BJIA 4WSFA 3O96A 1KZGA 2RUKB 2DA0A 4Z2NA 2VSZA 5LONB 3MDBC 3AJ4A 1MIXA 2YT0A 4KVGB 2H7DA 3V5WA 5FI0A 2CRFA 2D9VA 2PZ1A 1U2BA 5LOPB 1P6SA 2DKQA 2IYBA 1EAZA 3KRXA 1NU2A 3F5RA 1AQCA 1OY2A 2YSZA 2D2QA 3A8QA 5D3XA 3SUZA 5L81A 5CLQB 3CXBB 2N0YA 4CYEA 1WGQA 3PZDA 4F7HA 2DHIA 2ROVA 2DYQA 4HB0B 5J3YA 4IOYX 3PVUA 3PG7A 2R0DA 5HE3A 1KI1B 4CHJA 4MK0A 4K17A 3TFMA 1V5MA 4WJ7A 1DDWA 2DN6A 5DI9B 3PEGA 1FHXA 4Y94A 3SO6A 1GC7A 3IVFA 3QBVB 2YT1A 5KQ4A 3ODXA 4EJNA 3D8FA 2Z0OA 2P0HA 2GCLA 2LKOA 2N23A 4YL8A 2GCJA 2DFKA 2K2JA 5EFXA 1UNRA 1PFJA 5JHHA 2RVBB 4HAYB 3SV1A 2W2XC 3KRWA 2YF0A 1UNQA 4HAZB 1X86A 2R09A 3QWMA 1U27A 1FB8A 2COAA 3DXDA 2QKLA 3KSYA 2YS3A 4NSWA 2MWNB 3TCAA 5C5BA 2L2IA 1V88A 5C6RA 4K81A 1I2HA 1DDVA 4HAVB 5D3WA 1ZC3B 2L1CA 2GS0A 5DH9B 1N3HA 4GN1A 1FGZA 2UZRA 3WYFB 3GYOA 3U8ZA 5J3TA 3N7CA 1SGHA 5D3YA 2K00A 1MIZB 2RSGA 4K2OA 4HATB 1XCGA 3GYPA 2J59M 5JP4A 2AL6A 4GMVA 1EF1A 1NTVA 1FOEA 2ELBA 5C79A 2H7EA 5C5BB 3ZVRA 2D11A 1TXDA 4MY6A 2Z0PA 3VIAA 4F7UP 1UPQA 2RGNB 1U5DA 4HAWB 1UNPA 1DYNA 1BWNA 2W2XD 4HHVA 2IFSA 5KQ1A 2P8VA 1ZSQA 2DKPA 5HE1A 1U5EA 4HB3B 4YONA 4KHOA 5D27A 1MPHA 1DBHA 1U29A 4HB4B 1V61A 3P7ZA 1WJ1A 1IRSA 1LW3A 4WVFB 1X1GA 1UPRA 3A8PA 3PVWA 2EJ8A 3FM8C 4EMOA 4K2PA 2D9ZA 2Q13A 3ZDTA 5J3QA 2ROZB 1V5PA 4A6FA 2NZ8B 4GXBA 5JHGA 3TVVA 2X18A 2ZPYA 2LOZA 4A6HA 5DHAB 3CIKA 1FAOA 3TO1A 1I7AA 1U5FA 4XWXA 2YRYA 4HB2B 1Y5OA 1M7RA 2J0KA 3DXEA 4CHMA 2ELAA 4ZRIA 3TW1A 2CY4A 5HE2A 4PNKA 1M7EA 4B6HA 3FSSA 2YVCA 4TKNA 2VKIA 2UVMA 2JP2A 2P0FA 4H8SA 4A6FB 1BTNA 1FGYA 3UZTA 1DDMA 2D10A 4HAUB 4DX8A 2GJYA 4P7IA 1W1DA 2D9XA 4GZUA 1U5GA 4Z2MB 2I1KA 1WVHA 3RCPA 3WA0A 1XODA 2Y7BA 1WI1A 3ODOA 4IAPA 2G35A 3SYXA 3LJUX 4PQ0A 4KAXB 1Z87A 4D0NB 1X11A 2COCA 3MPXA 2OQBA 2EMTA 1XD4A 1J0WA 2UZSA 3DXCA 4HDOA 2E2XA 1WG7A 2DLWA 1X1FA 3KY9A 1ZM0A 1GG3A 1V89A 4KHBB 4IFSA 2LOXA 4A5KA 2Z0QA 1WJMA 1FHOA 1E5WA 1BTKA 1OMWA 5FI1A 2AEHA 1MAIA 2I5FA 4KHAA 4DBBA 1BAKA 2DTCA 1XR0B 2FJLA 1J19A 2DYNA 1Q67A 4DXAB 1P5TA 2VRWB 1PMSA 5HE0A 2D9YA 2K2UA 1MKEA 3HK0A 4GPTB 3KZ1A 1UEFA 2RLOA 3ULBA 5D3VA 1ZVRA 2DX1A 1RJ2A 3PVLA 4MT7A 2D4QA 1H4RA 2MKRA 1MK7B 3ODWA 1V5UA 3AU5A 3A98B 3F0WA 4A6KA 1K5GB 2I5CA 1XKEA 1TQZA 4DX90 2HE7A 3PSCA 4L6EA 1K5DB 2V76A 2EC1A 5DIFB 2CODA 3BINA 4F7GA 1XX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAY A;  3HW2 B;  1EGX A;  2KCJ A;  4TYZ A;  2HTH B;  4HDQ A;  2MDX A;  1X05 A;  1WGU A;  2YS1 A;  5KCV A;  2W2W A;  2P0D A;  1ZC4 B;  1RRP B;  2RNR B;  3M1I B;  5DHF B;  2LUL A;  2COF A;  2NMB A;  4HAX B;  1Y19 B;  3D8E A;  1PLS A;  1TJ6 A;  2J0M A;  4GMX B;  2J0J A;  1DRO A;  3ML4 A;  1FHW A;  5GOW B;  2DHK A;  1GC6 A;  3NSU A;  2DX5 A;  1ISN A;  3X23 A;  2MFQ A;  1QQG A;  3AU4 A;  1NI2 A;  2LG1 A;  1MK9 B;  1NTY A;  1EVH A;  2CY5 A;  2YS5 A;  3U7D A;  3QIJ A;  1P3R A;  4BBK A;  2KGX B;  2Y8G A;  2XQN M;  2KUP A;  5C16 A;  4C0A A;  2DHJ A;  2I1J A;  1AWE A;  1B55 A;  1W1G A;  3SNH A;  2BCJ A;  2M38 A;  3PP2 A;  4EKU A;  3G9W A;  3FEH A;  2LYD A;  2OTX A;  1W1H A;  5JLJ B;  3P6A A;  5CLL B;  3T06 A;  1H10 A;  4ZRK A;  2QKM A;  2M14 A;  1KZ7 A;  2ADZ A;  3D8D A;  4ZRJ A;  1LB1 A;  3OAN A;  3VOQ A;  2Y8F A;  2D9W A;  4NY0 A;  3HQC A;  1QC6 A;  3ULC A;  1OQN A;  2EMS A;  1SHC A;  3BJI A;  4WSF A;  3O96 A;  1KZG A;  2RUK B;  2DA0 A;  4Z2N A;  2VSZ A;  5LON B;  3MDB C;  3AJ4 A;  1MIX A;  2YT0 A;  4KVG B;  2H7D A;  3V5W A;  5FI0 A;  2CRF A;  2D9V A;  2PZ1 A;  1U2B A;  5LOP B;  1P6S A;  2DKQ A;  2IYB A;  1EAZ A;  3KRX A;  1NU2 A;  3F5R A;  1AQC A;  1OY2 A;  2YSZ A;  2D2Q A;  3A8Q A;  5D3X A;  3SUZ A;  5L81 A;  5CLQ B;  3CXB B;  2N0Y A;  4CYE A;  1WGQ A;  3PZD A;  4F7H A;  2DHI A;  2ROV A;  2DYQ A;  4HB0 B;  5J3Y A;  4IOY X;  3PVU A;  3PG7 A;  2R0D A;  5HE3 A;  1KI1 B;  4CHJ A;  4MK0 A;  4K17 A;  3TFM A;  1V5M A;  4WJ7 A;  1DDW A;  2DN6 A;  5DI9 B;  3PEG A;  1FHX A;  4Y94 A;  3SO6 A;  1GC7 A;  3IVF A;  3QBV B;  2YT1 A;  5KQ4 A;  3ODX A;  4EJN A;  3D8F A;  2Z0O A;  2P0H A;  2GCL A;  2LKO A;  2N23 A;  4YL8 A;  2GCJ A;  2DFK A;  2K2J A;  5EFX A;  1UNR A;  1PFJ A;  5JHH A;  2RVB B;  4HAY B;  3SV1 A;  2W2X C;  3KRW A;  2YF0 A;  1UNQ A;  4HAZ B;  1X86 A;  2R09 A;  3QWM A;  1U27 A;  1FB8 A;  2COA A;  3DXD A;  2QKL A;  3KSY A;  2YS3 A;  4NSW A;  2MWN B;  3TCA A;  5C5B A;  2L2I A;  1V88 A;  5C6R A;  4K81 A;  1I2H A;  1DDV A;  4HAV B;  5D3W A;  1ZC3 B;  2L1C A;  2GS0 A;  5DH9 B;  1N3H A;  4GN1 A;  1FGZ A;  2UZR A;  3WYF B;  3GYO A;  3U8Z A;  5J3T A;  3N7C A;  1SGH A;  5D3Y A;  2K00 A;  1MIZ B;  2RSG A;  4K2O A;  4HAT B;  1XCG A;  3GYP A;  2J59 M;  5JP4 A;  2AL6 A;  4GMV A;  1EF1 A;  1NTV A;  1FOE A;  2ELB A;  5C79 A;  2H7E A;  5C5B B;  3ZVR A;  2D11 A;  1TXD A;  4MY6 A;  2Z0P A;  3VIA A;  4F7U P;  1UPQ A;  2RGN B;  1U5D A;  4HAW B;  1UNP A;  1DYN A;  1BWN A;  2W2X D;  4HHV A;  2IFS A;  5KQ1 A;  2P8V A;  1ZSQ A;  2DKP A;  5HE1 A;  1U5E A;  4HB3 B;  4YON A;  4KHO A;  5D27 A;  1MPH A;  1DBH A;  1U29 A;  4HB4 B;  1V61 A;  3P7Z A;  1WJ1 A;  1IRS A;  1LW3 A;  4WVF B;  1X1G A;  1UPR A;  3A8P A;  3PVW A;  2EJ8 A;  3FM8 C;  4EMO A;  4K2P A;  2D9Z A;  2Q13 A;  3ZDT A;  5J3Q A;  2ROZ B;  1V5P A;  4A6F A;  2NZ8 B;  4GXB A;  5JHG A;  3TVV A;  2X18 A;  2ZPY A;  2LOZ A;  4A6H A;  5DHA B;  3CIK A;  1FAO A;  3TO1 A;  1I7A A;  1U5F A;  4XWX A;  2YRY A;  4HB2 B;  1Y5O A;  1M7R A;  2J0K A;  3DXE A;  4CHM A;  2ELA A;  4ZRI A;  3TW1 A;  2CY4 A;  5HE2 A;  4PNK A;  1M7E A;  4B6H A;  3FSS A;  2YVC A;  4TKN A;  2VKI A;  2UVM A;  2JP2 A;  2P0F A;  4H8S A;  4A6F B;  1BTN A;  1FGY A;  3UZT A;  1DDM A;  2D10 A;  4HAU B;  4DX8 A;  2GJY A;  4P7I A;  1W1D A;  2D9X A;  4GZU A;  1U5G A;  4Z2M B;  2I1K A;  1WVH A;  3RCP A;  3WA0 A;  1XOD A;  2Y7B A;  1WI1 A;  3ODO A;  4IAP A;  2G35 A;  3SYX A;  3LJU X;  4PQ0 A;  4KAX B;  1Z87 A;  4D0N B;  1X11 A;  2COC A;  3MPX A;  2OQB A;  2EMT A;  1XD4 A;  1J0W A;  2UZS A;  3DXC A;  4HDO A;  2E2X A;  1WG7 A;  2DLW A;  1X1F A;  3KY9 A;  1ZM0 A;  1GG3 A;  1V89 A;  4KHB B;  4IFS A;  2LOX A;  4A5K A;  2Z0Q A;  1WJM A;  1FHO A;  1E5W A;  1BTK A;  1OMW A;  5FI1 A;  2AEH A;  1MAI A;  2I5F A;  4KHA A;  4DBB A;  1BAK A;  2DTC A;  1XR0 B;  2FJL A;  1J19 A;  2DYN A;  1Q67 A;  4DXA B;  1P5T A;  2VRW B;  1PMS A;  5HE0 A;  2D9Y A;  2K2U A;  1MKE A;  3HK0 A;  4GPT B;  3KZ1 A;  1UEF A;  2RLO A;  3ULB A;  5D3V A;  1ZVR A;  2DX1 A;  1RJ2 A;  3PVL A;  4MT7 A;  2D4Q A;  1H4R A;  2MKR A;  1MK7 B;  3ODW A;  1V5U A;  3AU5 A;  3A98 B;  3F0W A;  4A6K A;  1K5G B;  2I5C A;  1XKE A;  1TQZ A;  4DX9 0;  2HE7 A;  3PSC A;  4L6E A;  1K5D B;  2V76 A;  2EC1 A;  5DIF B;  2COD A;  3BIN A;  4F7G A;  1XX0 A; 
#chains in the Genus database with same CATH topology
 2CAY A;  3HW2 B;  2FJU B;  1EGX A;  2KCJ A;  4TYZ A;  2HTH B;  4HDQ A;  2MDX A;  1X05 A;  1WGU A;  2YS1 A;  5KCV A;  2W2W A;  2P0D A;  1ZC4 B;  1RRP B;  2RNR B;  3M1I B;  5DHF B;  2LUL A;  2COF A;  4HSI A;  2NMB A;  4HAX B;  1Y19 B;  3D8E A;  1PLS A;  1TJ6 A;  2J0M A;  2KUQ A;  3FVC A;  4GMX B;  2J0J A;  3NWD A;  3A58 A;  1DRO A;  3ML4 A;  1FHW A;  5GOW B;  2DHK A;  1GC6 A;  3NSU A;  2DX5 A;  1ISN A;  3X23 A;  2MFQ A;  1QQG A;  3AU4 A;  1NI2 A;  2LG1 A;  1MK9 B;  1NTY A;  1EVH A;  2CY5 A;  2RRF A;  2YS5 A;  3U7D A;  3QIJ A;  1P3R A;  4BBK A;  2KGX B;  2Y8G A;  2XQN M;  2KUP A;  5C16 A;  4C0A A;  2DHJ A;  2I1J A;  1AWE A;  1B55 A;  1W1G A;  3SNH A;  2BCJ A;  2M38 A;  3PP2 A;  4QJ5 B;  4EKU A;  3G9W A;  4QJ4 B;  3FEH A;  2LYD A;  2OTX A;  1W1H A;  5JLJ B;  3P6A A;  5CLL B;  3T06 A;  1H10 A;  4ZRK A;  2QKM A;  2M14 A;  1KZ7 A;  2ADZ A;  3D8D A;  4ZRJ A;  1LB1 A;  3OAN A;  3VOQ A;  2Y8F A;  5I2M A;  2D9W A;  4D6W A;  4NY0 A;  3HQC A;  1QC6 A;  3ULC A;  1OQN A;  2KIG A;  2EMS A;  1SHC A;  3BJI A;  4WSF A;  1ZYI A;  3O96 A;  4OT1 A;  1KZG A;  2RUK B;  3NWF A;  2DA0 A;  4Z2N A;  2VSZ A;  5LON B;  3MDB C;  3AJ4 A;  1MIX A;  2YT0 A;  4KVG B;  2H7D A;  3V5W A;  5FI0 A;  2CRF A;  2D9V A;  2PZ1 A;  1U2B A;  5LOP B;  1P6S A;  2DKQ A;  2IYB A;  1EAZ A;  1T77 A;  1NU2 A;  3F5R A;  3KRX A;  1AQC A;  1OY2 A;  2YSZ A;  2D2Q A;  3A8Q A;  5D3X A;  4OSN A;  3SUZ A;  5L81 A;  2K8E A;  5CLQ B;  3CXB B;  4QJ3 B;  2GUM A;  2R2Y A;  2N0Y A;  4CYE A;  1WGQ A;  3PZD A;  4F7H A;  2DHI A;  2Z13 A;  2ROV A;  2DYQ A;  4HB0 B;  5J3Y A;  4IOY X;  3PVU A;  3PG7 A;  2R0D A;  2KR0 A;  5HE3 A;  1KI1 B;  4CHJ A;  4MK0 A;  4K17 A;  3TFM A;  1V5M A;  4WJ7 A;  1DDW A;  2DN6 A;  4QXA B;  5DI9 B;  4GNK B;  3PEG A;  1FHX A;  4Y94 A;  3SO6 A;  1GC7 A;  3IVF A;  3QBV B;  1MI1 A;  2YT1 A;  5KQ4 A;  3ODX A;  4EJN A;  3D8F A;  2Z0O A;  2P0H A;  2GCL A;  2LKO A;  2N23 A;  4YL8 A;  2GCJ A;  2DFK A;  2K2J A;  5EFX A;  1UNR A;  1PFJ A;  5JHH A;  2RVB B;  4HAY B;  3SV1 A;  2W2X C;  3KRW A;  2YF0 A;  1UNQ A;  4HAZ B;  1X86 A;  2R09 A;  3QWM A;  1U27 A;  1FB8 A;  2COA A;  3DXD A;  2QKL A;  3KSY A;  2YS3 A;  4NSW A;  4L1R A;  2MWN B;  3TCA A;  4DIX A;  5C5B A;  2L2I A;  1V88 A;  4GOU A;  4K81 A;  5C6R A;  1I2H A;  1DDV A;  4HAV B;  5D3W A;  1ZC3 B;  2L1C A;  2GS0 A;  2ZKM X;  5DH9 B;  1N3H A;  3OHM B;  4GN1 A;  1FGZ A;  2UZR A;  3WYF B;  4CSQ A;  2Z4D A;  3GYO A;  3U8Z A;  5J3T A;  3N7C A;  3NWA A;  1SGH A;  5D3Y A;  2K00 A;  1MIZ B;  2RSG A;  4K2O A;  4HAT B;  1XCG A;  3GYP A;  2J59 M;  5JP4 A;  2AL6 A;  4GMV A;  1EF1 A;  1NTV A;  2KIE A;  1FOE A;  2ELB A;  5C79 A;  2H7E A;  5C5B B;  3ZVR A;  2D11 A;  1TXD A;  4MY6 A;  2Z0P A;  3VIA A;  4F7U P;  1UPQ A;  2RGN B;  1U5D A;  4HAW B;  1UNP A;  1DYN A;  1BWN A;  2W2X D;  4HHV A;  2IFS A;  5KQ1 A;  2P8V A;  1ZSQ A;  2DKP A;  5HE1 A;  1U5E A;  4HB3 B;  4YON A;  4KHO A;  5D27 A;  2Z59 A;  1MPH A;  1DBH A;  1U29 A;  4HB4 B;  1V61 A;  3P7Z A;  1WJ1 A;  1IRS A;  1LW3 A;  4WVF B;  1X1G A;  1UPR A;  3A8P A;  3U12 A;  3PVW A;  5IRS A;  2EJ8 A;  3FM8 C;  4EMO A;  4K2P A;  2D9Z A;  2Q13 A;  3ZDT A;  5J3Q A;  2ROZ B;  1V5P A;  4A6F A;  2NZ8 B;  4GXB A;  5JHG A;  3TVV A;  2X18 A;  2ZPY A;  2LOZ A;  2K49 A;  4A6H A;  5DHA B;  3CIK A;  1FAO A;  3TO1 A;  1I7A A;  1U5F A;  4XWX A;  2YRY A;  4HB2 B;  2YT2 A;  1Y5O A;  1M7R A;  2J0K A;  3DXE A;  2Z14 A;  4CHM A;  2ELA A;  4ZRI A;  5LG4 B;  3TW1 A;  2CY4 A;  5HE2 A;  3HSA A;  4PNK A;  1M7E A;  4B6H A;  3FSS A;  3DCX A;  3NW8 A;  2YVC A;  4TKN A;  2VKI A;  2UVM A;  2NBV A;  2JP2 A;  2P0F A;  4H8S A;  4A6F B;  1BTN A;  1FGY A;  3UZT A;  1DDM A;  2D10 A;  4HAU B;  4DX8 A;  2GJY A;  4P7I A;  1W1D A;  2D9X A;  3B77 A;  3HIE A;  4GZU A;  1U5G A;  4Z2M B;  2I1K A;  1WVH A;  3RCP A;  3WA0 A;  1XOD A;  2Y7B A;  1WI1 A;  3ODO A;  4IAP A;  2G35 A;  3SYX A;  3LJU X;  4PQ0 A;  4KAX B;  1Z87 A;  4D0N B;  1X11 A;  2COC A;  3MPX A;  5I2S A;  2OQB A;  2EMT A;  1XD4 A;  1J0W A;  2UZS A;  3DXC A;  4HDO A;  2E2X A;  1WG7 A;  2DLW A;  1X1F A;  3KY9 A;  1ZM0 A;  1GG3 A;  1V89 A;  4KHB B;  4IFS A;  2LOX A;  4A5K A;  5M4Y B;  2Z0Q A;  1WJM A;  1FHO A;  1E5W A;  1BTK A;  1OMW A;  5FI1 A;  2AEH A;  1MAI A;  2I5F A;  4KHA A;  4DBB A;  1BAK A;  2DTC A;  1XR0 B;  2FJL A;  1J19 A;  2DYN A;  1Q67 A;  4DXA B;  1P5T A;  2VRW B;  1PMS A;  5HE0 A;  2D9Y A;  2K2U A;  1MKE A;  3HK0 A;  4GPT B;  3KZ1 A;  1UEF A;  2RLO A;  3ULB A;  5D3V A;  1ZVR A;  2DX1 A;  3PVL A;  1RJ2 A;  4MT7 A;  2D4Q A;  1H4R A;  2MKR A;  1MK7 B;  3ODW A;  4KHB A;  1V5U A;  3AU5 A;  3A98 B;  3F0W A;  4A6K A;  1K5G B;  2I5C A;  1XKE A;  1TQZ A;  4DX9 0;  2HE7 A;  3PSC A;  4L6E A;  1K5D B;  2V76 A;  2EC1 A;  5DIF B;  2COD A;  3BIN A;  4F7G A;  1XX0 A; 
#chains in the Genus database with same CATH homology
 2CAY A;  3HW2 B;  1EGX A;  2KCJ A;  4TYZ A;  2HTH B;  4HDQ A;  2MDX A;  1X05 A;  1WGU A;  2YS1 A;  5KCV A;  2W2W A;  2P0D A;  1ZC4 B;  1RRP B;  2RNR B;  3M1I B;  5DHF B;  2LUL A;  2COF A;  2NMB A;  4HAX B;  1Y19 B;  3D8E A;  1PLS A;  1TJ6 A;  2J0M A;  4GMX B;  2J0J A;  1DRO A;  3ML4 A;  1FHW A;  5GOW B;  2DHK A;  1GC6 A;  3NSU A;  2DX5 A;  1ISN A;  3X23 A;  2MFQ A;  1QQG A;  3AU4 A;  1NI2 A;  2LG1 A;  1MK9 B;  1NTY A;  1EVH A;  2CY5 A;  2YS5 A;  3U7D A;  3QIJ A;  1P3R A;  4BBK A;  2KGX B;  2Y8G A;  2XQN M;  2KUP A;  5C16 A;  4C0A A;  2DHJ A;  2I1J A;  1AWE A;  1B55 A;  1W1G A;  3SNH A;  2BCJ A;  2M38 A;  3PP2 A;  4EKU A;  3G9W A;  3FEH A;  2LYD A;  2OTX A;  1W1H A;  5JLJ B;  3P6A A;  5CLL B;  3T06 A;  1H10 A;  4ZRK A;  2QKM A;  2M14 A;  1KZ7 A;  2ADZ A;  3D8D A;  4ZRJ A;  1LB1 A;  3OAN A;  3VOQ A;  2Y8F A;  2D9W A;  4NY0 A;  3HQC A;  1QC6 A;  3ULC A;  1OQN A;  2EMS A;  1SHC A;  3BJI A;  4WSF A;  3O96 A;  1KZG A;  2RUK B;  2DA0 A;  4Z2N A;  2VSZ A;  5LON B;  3MDB C;  3AJ4 A;  1MIX A;  2YT0 A;  4KVG B;  2H7D A;  3V5W A;  5FI0 A;  2CRF A;  2D9V A;  2PZ1 A;  1U2B A;  5LOP B;  1P6S A;  2DKQ A;  2IYB A;  1EAZ A;  3KRX A;  1NU2 A;  3F5R A;  1AQC A;  1OY2 A;  2YSZ A;  2D2Q A;  3A8Q A;  5D3X A;  3SUZ A;  5L81 A;  5CLQ B;  3CXB B;  2N0Y A;  4CYE A;  1WGQ A;  3PZD A;  4F7H A;  2DHI A;  2ROV A;  2DYQ A;  4HB0 B;  5J3Y A;  4IOY X;  3PVU A;  3PG7 A;  2R0D A;  5HE3 A;  1KI1 B;  4CHJ A;  4MK0 A;  4K17 A;  3TFM A;  1V5M A;  4WJ7 A;  1DDW A;  2DN6 A;  5DI9 B;  3PEG A;  1FHX A;  4Y94 A;  3SO6 A;  1GC7 A;  3IVF A;  3QBV B;  2YT1 A;  5KQ4 A;  3ODX A;  4EJN A;  3D8F A;  2Z0O A;  2P0H A;  2GCL A;  2LKO A;  2N23 A;  4YL8 A;  2GCJ A;  2DFK A;  2K2J A;  5EFX A;  1UNR A;  1PFJ A;  5JHH A;  2RVB B;  4HAY B;  3SV1 A;  2W2X C;  3KRW A;  2YF0 A;  1UNQ A;  4HAZ B;  1X86 A;  2R09 A;  3QWM A;  1U27 A;  1FB8 A;  2COA A;  3DXD A;  2QKL A;  3KSY A;  2YS3 A;  4NSW A;  2MWN B;  3TCA A;  5C5B A;  2L2I A;  1V88 A;  5C6R A;  4K81 A;  1I2H A;  1DDV A;  4HAV B;  5D3W A;  1ZC3 B;  2L1C A;  2GS0 A;  5DH9 B;  1N3H A;  4GN1 A;  1FGZ A;  2UZR A;  3WYF B;  3GYO A;  3U8Z A;  5J3T A;  3N7C A;  1SGH A;  5D3Y A;  2K00 A;  1MIZ B;  2RSG A;  4K2O A;  4HAT B;  1XCG A;  3GYP A;  2J59 M;  5JP4 A;  2AL6 A;  4GMV A;  1EF1 A;  1NTV A;  1FOE A;  2ELB A;  5C79 A;  2H7E A;  5C5B B;  3ZVR A;  2D11 A;  1TXD A;  4MY6 A;  2Z0P A;  3VIA A;  4F7U P;  1UPQ A;  2RGN B;  1U5D A;  4HAW B;  1UNP A;  1DYN A;  1BWN A;  2W2X D;  4HHV A;  2IFS A;  5KQ1 A;  2P8V A;  1ZSQ A;  2DKP A;  5HE1 A;  1U5E A;  4HB3 B;  4YON A;  4KHO A;  5D27 A;  1MPH A;  1DBH A;  1U29 A;  4HB4 B;  1V61 A;  3P7Z A;  1WJ1 A;  1IRS A;  1LW3 A;  4WVF B;  1X1G A;  1UPR A;  3A8P A;  3PVW A;  2EJ8 A;  3FM8 C;  4EMO A;  4K2P A;  2D9Z A;  2Q13 A;  3ZDT A;  5J3Q A;  2ROZ B;  1V5P A;  4A6F A;  2NZ8 B;  4GXB A;  5JHG A;  3TVV A;  2X18 A;  2ZPY A;  2LOZ A;  4A6H A;  5DHA B;  3CIK A;  1FAO A;  3TO1 A;  1I7A A;  1U5F A;  4XWX A;  2YRY A;  4HB2 B;  1Y5O A;  1M7R A;  2J0K A;  3DXE A;  4CHM A;  2ELA A;  4ZRI A;  3TW1 A;  2CY4 A;  5HE2 A;  4PNK A;  1M7E A;  4B6H A;  3FSS A;  2YVC A;  4TKN A;  2VKI A;  2UVM A;  2JP2 A;  2P0F A;  4H8S A;  4A6F B;  1BTN A;  1FGY A;  3UZT A;  1DDM A;  2D10 A;  4HAU B;  4DX8 A;  2GJY A;  4P7I A;  1W1D A;  2D9X A;  4GZU A;  1U5G A;  4Z2M B;  2I1K A;  1WVH A;  3RCP A;  3WA0 A;  1XOD A;  2Y7B A;  1WI1 A;  3ODO A;  4IAP A;  2G35 A;  3SYX A;  3LJU X;  4PQ0 A;  4KAX B;  1Z87 A;  4D0N B;  1X11 A;  2COC A;  3MPX A;  2OQB A;  2EMT A;  1XD4 A;  1J0W A;  2UZS A;  3DXC A;  4HDO A;  2E2X A;  1WG7 A;  2DLW A;  1X1F A;  3KY9 A;  1ZM0 A;  1GG3 A;  1V89 A;  4KHB B;  4IFS A;  2LOX A;  4A5K A;  2Z0Q A;  1WJM A;  1FHO A;  1E5W A;  1BTK A;  1OMW A;  5FI1 A;  2AEH A;  1MAI A;  2I5F A;  4KHA A;  4DBB A;  1BAK A;  2DTC A;  1XR0 B;  2FJL A;  1J19 A;  2DYN A;  1Q67 A;  4DXA B;  1P5T A;  2VRW B;  1PMS A;  5HE0 A;  2D9Y A;  2K2U A;  1MKE A;  3HK0 A;  4GPT B;  3KZ1 A;  1UEF A;  2RLO A;  3ULB A;  5D3V A;  1ZVR A;  2DX1 A;  1RJ2 A;  3PVL A;  4MT7 A;  2D4Q A;  1H4R A;  2MKR A;  1MK7 B;  3ODW A;  1V5U A;  3AU5 A;  3A98 B;  3F0W A;  4A6K A;  1K5G B;  2I5C A;  1XKE A;  1TQZ A;  4DX9 0;  2HE7 A;  3PSC A;  4L6E A;  1K5D B;  2V76 A;  2EC1 A;  5DIF B;  2COD A;  3BIN A;  4F7G A;  1XX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...