2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 7A
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
5HE2A 1RJ2A 1MK7B 4A6FB 1BTKA 1PFJA 2P8VA 1DBHA 1MIZB 1UPRA 1ZC4B 1MPHA 4GZUA 2YS3A 1AQCA 3A8PA 1OMWA 2Q13A 5HE0A 2LOZA 3D8EA 4BBKA 1NTYA 4TKNA 1FHOA 3A98B 5J3YA 1SHCA 3ODXA 4D0NB 5L81A 2D11A 4HAXB 1X11A 1XR0B 4KHAA 1X1GA 2YF0A 2GJYA 1FB8A 2H7EA 2EMTA 1NU2A 4C0AA 3GYPA 1EF1A 4HDQA 3FEHA 3X23A 1H10A 2E2XA 3HK0A 2ROVA 3SYXA 4GMXB 3BINA 3OANA 2N0YA 4Z2MB 2RUKB 2G35A 2I5CA 2ELAA 2ADZA 2UZSA 2K2JA 1DDMA 4F7UP 1M7RA 1XCGA 5HE3A 1GC7A 2KGXB 3SO6A 4KAXB 2KCJA 1MAIA 3GYOA 4PQ0A 5D27A 2P0FA 1WGUA 4B6HA 5J3QA 5DHAB 4PNKA 2RNRB 4HB4B 1P5TA 4TYZA 3CIKA 2DN6A 2DFKA 3TW1A 1N3HA 3SV1A 3MDBC 1V5PA 1U5GA 1XX0A 3PZDA 4GPTB 2KUPA 2Y8FA 4HDOA 2COFA 1NI2A 2H7DA 2VSZA 1FHXA 2DHIA 3PVLA 4A5KA 5D3YA 2I1KA 3A8QA 2ELBA 1TJ6A 2D9XA 3WA0A 1XODA 2MKRA 4K2OA 5CLLB 1P3RA 1RRPB 1P6SA 3KRXA 3MPXA 4GN1A 4HAZB 4YL8A 1FOEA 4P7IA 3NSUA 1WJ1A 2D4QA 2LULA 3D8FA 1W1HA 3KY9A 5JP4A 2RLOA 4KHBB 2Z0PA 2K00A 3KRWA 2MDXA 2L1CA 4A6HA 1Q67A 4EJNA 2EC1A 3P6AA 2AL6A 1Y19B 4IFSA 4KVGB 3PEGA 2YRYA 5DI9B 1GG3A 2ROZB 4CYEA 2DKQA 1DDWA 5HE1A 3O96A 1EGXA 2CAYA 1BWNA 1WI1A 2DA0A 2EJ8A 1IRSA 2W2WA 1NTVA 1WG7A 4WSFA 4GXBA 3AJ4A 1TQZA 3PG7A 4XWXA 2GCLA 2Y7BA 1UNQA 2QKMA 1WVHA 1V61A 2R0DA 1KZGA 1TXDA 3QBVB 3F0WA 3WYFB 3LJUX 2CRFA 2DHJA 2UZRA 1UNRA 3TO1A 3ULCA 2CY5A 1W1DA 2W2XD 3U8ZA 3BJIA 4CHJA 2P0DA 4HAWB 2DX1A 2M14A 2J59M 1WGQA 5C6RA 4WJ7A 1B55A 3FM8C 1EVHA 1AWEA 1PMSA 1QQGA 5FI1A 4DXAB 4MY6A 5J3TA 2YS5A 3QIJA 4ZRKA 5C5BA 2VKIA 4WVFB 3ODWA 3ZVRA 2HE7A 3CXBB 2BCJA 2L2IA 3T06A 2DLWA 1X1FA 2D9ZA 5C79A 4A6KA 2D2QA 2RSGA 1K5GB 4ZRJA 1V5MA 2D9VA 3D8DA 2I5FA 4F7HA 3ML4A 2NMBA 1J0WA 2YT1A 4HAUB 1MIXA 3U7DA 1ZM0A 5JHHA 1W1GA 1XKEA 1U29A 2D9YA 2DHKA 4K81A 2UVMA 2Z0QA 2OQBA 4MK0A 2DX5A 5EFXA 3IVFA 1FGZA 2R09A 2Z0OA 1Y5OA 3TFMA 4DX90 3DXCA 2MFQA 4HB2B 2ZPYA 1Z87A 1UPQA 4NY0A 3TVVA 3F5RA 1E5WA 4EMOA 3PSCA 3VOQA 2GCJA 3QWMA 5D3VA 1V88A 2OTXA 1U5EA 4DX8A 1KI1B 1DDVA 2Y8GA 3ODOA 1U27A 1FGYA 1WJMA 4ZRIA 2AEHA 3AU4A 3TCAA 2D10A 4DBBA 3KSYA 2DTCA 1MKEA 5KCVA 1BAKA 3KZ1A 1FHWA 4CHMA 2COAA 3G9WA 2CY4A 1ZSQA 2DYQA 1U5FA 2VRWB 2MWNB 1BTNA 2X18A 1X05A 2LKOA 5C5BB 4HATB 2W2XC 3VIAA 4YONA 4F7GA 4Z2NA 2M38A 4A6FA 2PZ1A 2FJLA 3UZTA 2J0KA 1H4RA 1I7AA 1ISNA 2JP2A 1LB1A 2IYBA 2D9WA 4H8SA 2NZ8B 1J19A 4Y94A 4K17A 5GOWB 4KHOA 2YT0A 5FI0A 3RCPA 1U5DA 4HAYB 5LOPB 4EKUA 2XQNM 1LW3A 1K5DB 3AU5A 4HB0B 2V76A 5D3WA 4K2PA 3HQCA 3V5WA 1I2HA 3ULBA 1M7EA 3FSSA 5JLJB 2CODA 2COCA 2YVCA 5C16A 1GC6A 5JHGA 2YS1A 2YSZA 3M1IB 1EAZA 1UEFA 4HHVA 1DYNA 2DYNA 4HAVB 2GS0A 3PVWA 1V89A 5DIFB 2DKPA 4HB3B 2LOXA 1FAOA 3N7CA 4IAPA 5KQ4A 5DHFB 1KZ7A 5LONB 4GMVA 3DXDA 3DXEA 4IOYX 2IFSA 2K2UA 2RVBB 5KQ1A 2P0HA 2N23A 5CLQB 1MK9B 3PP2A 1ZC3B 1U2BA 2RGNB 1V5UA 5D3XA 1X86A 4MT7A 3P7ZA 3ZDTA 1SGHA 2HTHB 5DH9B 2J0MA 2J0JA 2LYDA 1XD4A 3HW2B 2LG1A 3SUZA 2EMSA 1QC6A 4NSWA 1DROA 1OY2A 3PVUA 2QKLA 1ZVRA 1PLSA 1OQNA 3SNHA 2I1JA 4L6EA 1UNPA
chains in the Genus database with same CATH superfamily
5HE2A 1RJ2A 4CSQA 1MK7B 4A6FB 1BTKA 1PFJA 2P8VA 1DBHA 1MIZB 1UPRA 1ZC4B 1MPHA 4GZUA 2YS3A 1AQCA 3A8PA 1OMWA 2Q13A 1MI1A 5HE0A 2LOZA 3D8EA 4BBKA 1NTYA 4TKNA 1FHOA 3A98B 5J3YA 1SHCA 3ODXA 4D0NB 5L81A 2D11A 4HAXB 1X11A 1XR0B 4KHAA 1X1GA 2YF0A 4QJ4B 2GJYA 1FB8A 2H7EA 1T77A 3HIEA 2EMTA 1NU2A 4C0AA 3GYPA 1EF1A 4HDQA 3FEHA 3X23A 1H10A 2E2XA 3HK0A 2ROVA 3SYXA 4GMXB 3BINA 3OANA 2N0YA 4Z2MB 2RUKB 2G35A 2I5CA 2ELAA 2ADZA 4GOUA 2UZSA 2K2JA 1DDMA 4F7UP 1M7RA 1XCGA 5HE3A 1GC7A 2KGXB 3SO6A 4KAXB 2KCJA 1MAIA 3GYOA 4PQ0A 5D27A 2P0FA 1WGUA 3U12A 4B6HA 5J3QA 5DHAB 4PNKA 2RNRB 4HB4B 1P5TA 4TYZA 3CIKA 2DN6A 2DFKA 3TW1A 1N3HA 3DCXA 3SV1A 3MDBC 1V5PA 1U5GA 1XX0A 3PZDA 4GPTB 2KUPA 2Y8FA 4HDOA 2COFA 1NI2A 2H7DA 2VSZA 1FHXA 2DHIA 3PVLA 4A5KA 5D3YA 2I1KA 2YT2A 3A8QA 2ELBA 1TJ6A 2D9XA 3WA0A 1XODA 2MKRA 4K2OA 5CLLB 1P3RA 1RRPB 1P6SA 3KRXA 3MPXA 4GN1A 4HAZB 4YL8A 1FOEA 4P7IA 3NSUA 2KR0A 1WJ1A 3HSAA 2D4QA 2LULA 3D8FA 1W1HA 3KY9A 5JP4A 2RLOA 4KHBB 2Z0PA 2K00A 4OSNA 3KRWA 2MDXA 2L1CA 4A6HA 1Q67A 4EJNA 2EC1A 3B77A 2AL6A 1Y19B 3P6AA 4IFSA 4KVGB 2YRYA 3PEGA 5DI9B 1GG3A 2ROZB 4CYEA 2DKQA 1DDWA 5HE1A 3O96A 1EGXA 2ZKMX 5LG4B 4KHBA 2CAYA 1BWNA 1WI1A 2DA0A 2EJ8A 1IRSA 2W2WA 1NTVA 4GNKB 1WG7A 4WSFA 4GXBA 3AJ4A 1TQZA 3PG7A 4XWXA 2GCLA 2Y7BA 1UNQA 2QKMA 1WVHA 1V61A 2R0DA 1KZGA 1TXDA 3FVCA 3QBVB 3F0WA 3WYFB 3NWFA 3LJUX 2CRFA 2DHJA 2UZRA 1UNRA 3TO1A 3ULCA 2CY5A 5I2MA 1W1DA 2W2XD 2KIGA 3U8ZA 3BJIA 4CHJA 2P0DA 4HAWB 2DX1A 2M14A 2J59M 2Z13A 1WGQA 2NBVA 5C6RA 4WJ7A 1B55A 3FM8C 1EVHA 1AWEA 1PMSA 1QQGA 5FI1A 4DXAB 4MY6A 5J3TA 2YS5A 5I2SA 3QIJA 4ZRKA 5C5BA 2VKIA 4WVFB 3ODWA 3ZVRA 2HE7A 3CXBB 2BCJA 2L2IA 3T06A 2DLWA 1X1FA 2D9ZA 5C79A 4A6KA 2D2QA 2RSGA 1K5GB 4ZRJA 1V5MA 2D9VA 3D8DA 2I5FA 4F7HA 3ML4A 2NMBA 1J0WA 2YT1A 4HAUB 1MIXA 3U7DA 3NWAA 1ZM0A 5M4YB 5JHHA 2RRFA 1W1GA 1XKEA 1U29A 2D9YA 2DHKA 4K81A 2UVMA 2Z0QA 2OQBA 4MK0A 2DX5A 2Z59A 3NW8A 4QXAB 5EFXA 2R2YA 3IVFA 1FGZA 2R09A 2Z0OA 1Y5OA 3TFMA 4DX90 3DXCA 2MFQA 4HB2B 2ZPYA 4HSIA 1Z87A 4D6WA 1UPQA 4NY0A 3TVVA 3F5RA 1E5WA 4EMOA 3PSCA 3VOQA 4DIXA 3A58A 2GCJA 3QWMA 5D3VA 1V88A 2OTXA 1U5EA 4DX8A 1KI1B 4QJ3B 1DDVA 3OHMB 2Y8GA 3ODOA 1U27A 1FGYA 1WJMA 4ZRIA 2AEHA 3AU4A 3TCAA 2D10A 2KIEA 4DBBA 3KSYA 2DTCA 1MKEA 5KCVA 1BAKA 3KZ1A 1FHWA 4CHMA 2COAA 3G9WA 2CY4A 1ZSQA 2DYQA 1U5FA 2VRWB 2MWNB 1BTNA 2X18A 1X05A 2LKOA 5C5BB 3NWDA 4HATB 2W2XC 3VIAA 4YONA 4F7GA 4OT1A 4Z2NA 2M38A 4A6FA 2PZ1A 2FJLA 3UZTA 2J0KA 1H4RA 1I7AA 1ISNA 2JP2A 1LB1A 2Z4DA 2IYBA 2D9WA 4H8SA 2NZ8B 1J19A 4Y94A 4K17A 5GOWB 4KHOA 2YT0A 5FI0A 3RCPA 1U5DA 4HAYB 2Z14A 5LOPB 4EKUA 2XQNM 1LW3A 1K5DB 3AU5A 4HB0B 2V76A 5D3WA 4K2PA 3HQCA 3V5WA 1I2HA 3ULBA 1M7EA 3FSSA 5JLJB 2CODA 2COCA 2YVCA 5C16A 1GC6A 5JHGA 2YS1A 2YSZA 3M1IB 1EAZA 1UEFA 4HHVA 1DYNA 2DYNA 4HAVB 2KUQA 2GS0A 3PVWA 2FJUB 1V89A 5DIFB 2DKPA 4HB3B 2LOXA 1FAOA 3N7CA 4IAPA 5KQ4A 5DHFB 1KZ7A 5LONB 4GMVA 3DXDA 3DXEA 4IOYX 2IFSA 2K2UA 2RVBB 5KQ1A 2P0HA 2N23A 4L1RA 5CLQB 1MK9B 3PP2A 1ZC3B 1U2BA 2RGNB 1V5UA 5D3XA 1X86A 4MT7A 3P7ZA 3ZDTA 1SGHA 2HTHB 5DH9B 2J0MA 2J0JA 2LYDA 1XD4A 3HW2B 2LG1A 3SUZA 2EMSA 1QC6A 4NSWA 1DROA 1OY2A 5IRSA 3PVUA 2QKLA 1ZVRA 1PLSA 1OQNA 2GUMA 3SNHA 2K49A 2K8EA 2I1JA 4L6EA 4QJ5B 1ZYIA 1UNPA
chains in the Genus database with same CATH topology
5HE2A 1RJ2A 1MK7B 4A6FB 1BTKA 1PFJA 2P8VA 1DBHA 1MIZB 1UPRA 1ZC4B 1MPHA 4GZUA 2YS3A 1AQCA 3A8PA 1OMWA 2Q13A 5HE0A 2LOZA 3D8EA 4BBKA 1NTYA 4TKNA 1FHOA 3A98B 5J3YA 1SHCA 3ODXA 4D0NB 5L81A 2D11A 4HAXB 1X11A 1XR0B 4KHAA 1X1GA 2YF0A 2GJYA 1FB8A 2H7EA 2EMTA 1NU2A 4C0AA 3GYPA 1EF1A 4HDQA 3FEHA 3X23A 1H10A 2E2XA 3HK0A 2ROVA 3SYXA 4GMXB 3BINA 3OANA 2N0YA 4Z2MB 2RUKB 2G35A 2I5CA 2ELAA 2ADZA 2UZSA 2K2JA 1DDMA 4F7UP 1M7RA 1XCGA 5HE3A 1GC7A 2KGXB 3SO6A 4KAXB 2KCJA 1MAIA 3GYOA 4PQ0A 5D27A 2P0FA 1WGUA 4B6HA 5J3QA 5DHAB 4PNKA 2RNRB 4HB4B 1P5TA 4TYZA 3CIKA 2DN6A 2DFKA 3TW1A 1N3HA 3SV1A 3MDBC 1V5PA 1U5GA 1XX0A 3PZDA 4GPTB 2KUPA 2Y8FA 4HDOA 2COFA 1NI2A 2H7DA 2VSZA 1FHXA 2DHIA 3PVLA 4A5KA 5D3YA 2I1KA 3A8QA 2ELBA 1TJ6A 2D9XA 3WA0A 1XODA 2MKRA 4K2OA 5CLLB 1P3RA 1RRPB 1P6SA 3KRXA 3MPXA 4GN1A 4HAZB 4YL8A 1FOEA 4P7IA 3NSUA 1WJ1A 2D4QA 2LULA 3D8FA 1W1HA 3KY9A 5JP4A 2RLOA 4KHBB 2Z0PA 2K00A 3KRWA 2MDXA 2L1CA 4A6HA 1Q67A 4EJNA 2EC1A 3P6AA 2AL6A 1Y19B 4IFSA 4KVGB 3PEGA 2YRYA 5DI9B 1GG3A 2ROZB 4CYEA 2DKQA 1DDWA 5HE1A 3O96A 1EGXA 2CAYA 1BWNA 1WI1A 2DA0A 2EJ8A 1IRSA 2W2WA 1NTVA 1WG7A 4WSFA 4GXBA 3AJ4A 1TQZA 3PG7A 4XWXA 2GCLA 2Y7BA 1UNQA 2QKMA 1WVHA 1V61A 2R0DA 1KZGA 1TXDA 3QBVB 3F0WA 3WYFB 3LJUX 2CRFA 2DHJA 2UZRA 1UNRA 3TO1A 3ULCA 2CY5A 1W1DA 2W2XD 3U8ZA 3BJIA 4CHJA 2P0DA 4HAWB 2DX1A 2M14A 2J59M 1WGQA 5C6RA 4WJ7A 1B55A 3FM8C 1EVHA 1AWEA 1PMSA 1QQGA 5FI1A 4DXAB 4MY6A 5J3TA 2YS5A 3QIJA 4ZRKA 5C5BA 2VKIA 4WVFB 3ODWA 3ZVRA 2HE7A 3CXBB 2BCJA 2L2IA 3T06A 2DLWA 1X1FA 2D9ZA 5C79A 4A6KA 2D2QA 2RSGA 1K5GB 4ZRJA 1V5MA 2D9VA 3D8DA 2I5FA 4F7HA 3ML4A 2NMBA 1J0WA 2YT1A 4HAUB 1MIXA 3U7DA 1ZM0A 5JHHA 1W1GA 1XKEA 1U29A 2D9YA 2DHKA 4K81A 2UVMA 2Z0QA 2OQBA 4MK0A 2DX5A 5EFXA 3IVFA 1FGZA 2R09A 2Z0OA 1Y5OA 3TFMA 4DX90 3DXCA 2MFQA 4HB2B 2ZPYA 1Z87A 1UPQA 4NY0A 3TVVA 3F5RA 1E5WA 4EMOA 3PSCA 3VOQA 2GCJA 3QWMA 5D3VA 1V88A 2OTXA 1U5EA 4DX8A 1KI1B 1DDVA 2Y8GA 3ODOA 1U27A 1FGYA 1WJMA 4ZRIA 2AEHA 3AU4A 3TCAA 2D10A 4DBBA 3KSYA 2DTCA 1MKEA 5KCVA 1BAKA 3KZ1A 1FHWA 4CHMA 2COAA 3G9WA 2CY4A 1ZSQA 2DYQA 1U5FA 2VRWB 2MWNB 1BTNA 2X18A 1X05A 2LKOA 5C5BB 4HATB 2W2XC 3VIAA 4YONA 4F7GA 4Z2NA 2M38A 4A6FA 2PZ1A 2FJLA 3UZTA 2J0KA 1H4RA 1I7AA 1ISNA 2JP2A 1LB1A 2IYBA 2D9WA 4H8SA 2NZ8B 1J19A 4Y94A 4K17A 5GOWB 4KHOA 2YT0A 5FI0A 3RCPA 1U5DA 4HAYB 5LOPB 4EKUA 2XQNM 1LW3A 1K5DB 3AU5A 4HB0B 2V76A 5D3WA 4K2PA 3HQCA 3V5WA 1I2HA 3ULBA 1M7EA 3FSSA 5JLJB 2CODA 2COCA 2YVCA 5C16A 1GC6A 5JHGA 2YS1A 2YSZA 3M1IB 1EAZA 1UEFA 4HHVA 1DYNA 2DYNA 4HAVB 2GS0A 3PVWA 1V89A 5DIFB 2DKPA 4HB3B 2LOXA 1FAOA 3N7CA 4IAPA 5KQ4A 5DHFB 1KZ7A 5LONB 4GMVA 3DXDA 3DXEA 4IOYX 2IFSA 2K2UA 2RVBB 5KQ1A 2P0HA 2N23A 5CLQB 1MK9B 3PP2A 1ZC3B 1U2BA 2RGNB 1V5UA 5D3XA 1X86A 4MT7A 3P7ZA 3ZDTA 1SGHA 2HTHB 5DH9B 2J0MA 2J0JA 2LYDA 1XD4A 3HW2B 2LG1A 3SUZA 2EMSA 1QC6A 4NSWA 1DROA 1OY2A 3PVUA 2QKLA 1ZVRA 1PLSA 1OQNA 3SNHA 2I1JA 4L6EA 1UNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 A;  1RJ2 A;  1MK7 B;  4A6F B;  1BTK A;  1PFJ A;  2P8V A;  1DBH A;  1MIZ B;  1UPR A;  1ZC4 B;  1MPH A;  4GZU A;  2YS3 A;  1AQC A;  3A8P A;  1OMW A;  2Q13 A;  5HE0 A;  2LOZ A;  3D8E A;  4BBK A;  1NTY A;  4TKN A;  1FHO A;  3A98 B;  5J3Y A;  1SHC A;  3ODX A;  4D0N B;  5L81 A;  2D11 A;  4HAX B;  1X11 A;  1XR0 B;  4KHA A;  1X1G A;  2YF0 A;  2GJY A;  1FB8 A;  2H7E A;  2EMT A;  1NU2 A;  4C0A A;  3GYP A;  1EF1 A;  4HDQ A;  3FEH A;  3X23 A;  1H10 A;  2E2X A;  3HK0 A;  2ROV A;  3SYX A;  4GMX B;  3BIN A;  3OAN A;  2N0Y A;  4Z2M B;  2RUK B;  2G35 A;  2I5C A;  2ELA A;  2ADZ A;  2UZS A;  2K2J A;  1DDM A;  4F7U P;  1M7R A;  1XCG A;  5HE3 A;  1GC7 A;  2KGX B;  3SO6 A;  4KAX B;  2KCJ A;  1MAI A;  3GYO A;  4PQ0 A;  5D27 A;  2P0F A;  1WGU A;  4B6H A;  5J3Q A;  5DHA B;  4PNK A;  2RNR B;  4HB4 B;  1P5T A;  4TYZ A;  3CIK A;  2DN6 A;  2DFK A;  3TW1 A;  1N3H A;  3SV1 A;  3MDB C;  1V5P A;  1U5G A;  1XX0 A;  3PZD A;  4GPT B;  2KUP A;  2Y8F A;  4HDO A;  2COF A;  1NI2 A;  2H7D A;  2VSZ A;  1FHX A;  2DHI A;  3PVL A;  4A5K A;  5D3Y A;  2I1K A;  3A8Q A;  2ELB A;  1TJ6 A;  2D9X A;  3WA0 A;  1XOD A;  2MKR A;  4K2O A;  5CLL B;  1P3R A;  1RRP B;  1P6S A;  3KRX A;  3MPX A;  4GN1 A;  4HAZ B;  4YL8 A;  1FOE A;  4P7I A;  3NSU A;  1WJ1 A;  2D4Q A;  2LUL A;  3D8F A;  1W1H A;  3KY9 A;  5JP4 A;  2RLO A;  4KHB B;  2Z0P A;  2K00 A;  3KRW A;  2MDX A;  2L1C A;  4A6H A;  1Q67 A;  4EJN A;  2EC1 A;  3P6A A;  2AL6 A;  1Y19 B;  4IFS A;  4KVG B;  3PEG A;  2YRY A;  5DI9 B;  1GG3 A;  2ROZ B;  4CYE A;  2DKQ A;  1DDW A;  5HE1 A;  3O96 A;  1EGX A;  2CAY A;  1BWN A;  1WI1 A;  2DA0 A;  2EJ8 A;  1IRS A;  2W2W A;  1NTV A;  1WG7 A;  4WSF A;  4GXB A;  3AJ4 A;  1TQZ A;  3PG7 A;  4XWX A;  2GCL A;  2Y7B A;  1UNQ A;  2QKM A;  1WVH A;  1V61 A;  2R0D A;  1KZG A;  1TXD A;  3QBV B;  3F0W A;  3WYF B;  3LJU X;  2CRF A;  2DHJ A;  2UZR A;  1UNR A;  3TO1 A;  3ULC A;  2CY5 A;  1W1D A;  2W2X D;  3U8Z A;  3BJI A;  4CHJ A;  2P0D A;  4HAW B;  2DX1 A;  2M14 A;  2J59 M;  1WGQ A;  5C6R A;  4WJ7 A;  1B55 A;  3FM8 C;  1EVH A;  1AWE A;  1PMS A;  1QQG A;  5FI1 A;  4DXA B;  4MY6 A;  5J3T A;  2YS5 A;  3QIJ A;  4ZRK A;  5C5B A;  2VKI A;  4WVF B;  3ODW A;  3ZVR A;  2HE7 A;  3CXB B;  2BCJ A;  2L2I A;  3T06 A;  2DLW A;  1X1F A;  2D9Z A;  5C79 A;  4A6K A;  2D2Q A;  2RSG A;  1K5G B;  4ZRJ A;  1V5M A;  2D9V A;  3D8D A;  2I5F A;  4F7H A;  3ML4 A;  2NMB A;  1J0W A;  2YT1 A;  4HAU B;  1MIX A;  3U7D A;  1ZM0 A;  5JHH A;  1W1G A;  1XKE A;  1U29 A;  2D9Y A;  2DHK A;  4K81 A;  2UVM A;  2Z0Q A;  2OQB A;  4MK0 A;  2DX5 A;  5EFX A;  3IVF A;  1FGZ A;  2R09 A;  2Z0O A;  1Y5O A;  3TFM A;  4DX9 0;  3DXC A;  2MFQ A;  4HB2 B;  2ZPY A;  1Z87 A;  1UPQ A;  4NY0 A;  3TVV A;  3F5R A;  1E5W A;  4EMO A;  3PSC A;  3VOQ A;  2GCJ A;  3QWM A;  5D3V A;  1V88 A;  2OTX A;  1U5E A;  4DX8 A;  1KI1 B;  1DDV A;  2Y8G A;  3ODO A;  1U27 A;  1FGY A;  1WJM A;  4ZRI A;  2AEH A;  3AU4 A;  3TCA A;  2D10 A;  4DBB A;  3KSY A;  2DTC A;  1MKE A;  5KCV A;  1BAK A;  3KZ1 A;  1FHW A;  4CHM A;  2COA A;  3G9W A;  2CY4 A;  1ZSQ A;  2DYQ A;  1U5F A;  2VRW B;  2MWN B;  1BTN A;  2X18 A;  1X05 A;  2LKO A;  5C5B B;  4HAT B;  2W2X C;  3VIA A;  4YON A;  4F7G A;  4Z2N A;  2M38 A;  4A6F A;  2PZ1 A;  2FJL A;  3UZT A;  2J0K A;  1H4R A;  1I7A A;  1ISN A;  2JP2 A;  1LB1 A;  2IYB A;  2D9W A;  4H8S A;  2NZ8 B;  1J19 A;  4Y94 A;  4K17 A;  5GOW B;  4KHO A;  2YT0 A;  5FI0 A;  3RCP A;  1U5D A;  4HAY B;  5LOP B;  4EKU A;  2XQN M;  1LW3 A;  1K5D B;  3AU5 A;  4HB0 B;  2V76 A;  5D3W A;  4K2P A;  3HQC A;  3V5W A;  1I2H A;  3ULB A;  1M7E A;  3FSS A;  5JLJ B;  2COD A;  2COC A;  2YVC A;  5C16 A;  1GC6 A;  5JHG A;  2YS1 A;  2YSZ A;  3M1I B;  1EAZ A;  1UEF A;  4HHV A;  1DYN A;  2DYN A;  4HAV B;  2GS0 A;  3PVW A;  1V89 A;  5DIF B;  2DKP A;  4HB3 B;  2LOX A;  1FAO A;  3N7C A;  4IAP A;  5KQ4 A;  5DHF B;  1KZ7 A;  5LON B;  4GMV A;  3DXD A;  3DXE A;  4IOY X;  2IFS A;  2K2U A;  2RVB B;  5KQ1 A;  2P0H A;  2N23 A;  5CLQ B;  1MK9 B;  3PP2 A;  1ZC3 B;  1U2B A;  2RGN B;  1V5U A;  5D3X A;  1X86 A;  4MT7 A;  3P7Z A;  3ZDT A;  1SGH A;  2HTH B;  5DH9 B;  2J0M A;  2J0J A;  2LYD A;  1XD4 A;  3HW2 B;  2LG1 A;  3SUZ A;  2EMS A;  1QC6 A;  4NSW A;  1DRO A;  1OY2 A;  3PVU A;  2QKL A;  1ZVR A;  1PLS A;  1OQN A;  3SNH A;  2I1J A;  4L6E A;  1UNP A; 
#chains in the Genus database with same CATH topology
 5HE2 A;  1RJ2 A;  4CSQ A;  1MK7 B;  4A6F B;  1BTK A;  1PFJ A;  2P8V A;  1DBH A;  1MIZ B;  1UPR A;  1ZC4 B;  1MPH A;  4GZU A;  2YS3 A;  1AQC A;  3A8P A;  1OMW A;  2Q13 A;  1MI1 A;  5HE0 A;  2LOZ A;  3D8E A;  4BBK A;  1NTY A;  4TKN A;  1FHO A;  3A98 B;  5J3Y A;  1SHC A;  3ODX A;  4D0N B;  5L81 A;  2D11 A;  4HAX B;  1X11 A;  1XR0 B;  4KHA A;  1X1G A;  2YF0 A;  4QJ4 B;  2GJY A;  1FB8 A;  2H7E A;  1T77 A;  3HIE A;  2EMT A;  1NU2 A;  4C0A A;  3GYP A;  1EF1 A;  4HDQ A;  3FEH A;  3X23 A;  1H10 A;  2E2X A;  3HK0 A;  2ROV A;  3SYX A;  4GMX B;  3BIN A;  3OAN A;  2N0Y A;  4Z2M B;  2RUK B;  2G35 A;  2I5C A;  2ELA A;  2ADZ A;  4GOU A;  2UZS A;  2K2J A;  1DDM A;  4F7U P;  1M7R A;  1XCG A;  5HE3 A;  1GC7 A;  2KGX B;  3SO6 A;  4KAX B;  2KCJ A;  1MAI A;  3GYO A;  4PQ0 A;  5D27 A;  2P0F A;  1WGU A;  3U12 A;  4B6H A;  5J3Q A;  5DHA B;  4PNK A;  2RNR B;  4HB4 B;  1P5T A;  4TYZ A;  3CIK A;  2DN6 A;  2DFK A;  3TW1 A;  1N3H A;  3DCX A;  3SV1 A;  3MDB C;  1V5P A;  1U5G A;  1XX0 A;  3PZD A;  4GPT B;  2KUP A;  2Y8F A;  4HDO A;  2COF A;  1NI2 A;  2H7D A;  2VSZ A;  1FHX A;  2DHI A;  3PVL A;  4A5K A;  5D3Y A;  2I1K A;  2YT2 A;  3A8Q A;  2ELB A;  1TJ6 A;  2D9X A;  3WA0 A;  1XOD A;  2MKR A;  4K2O A;  5CLL B;  1P3R A;  1RRP B;  1P6S A;  3KRX A;  3MPX A;  4GN1 A;  4HAZ B;  4YL8 A;  1FOE A;  4P7I A;  3NSU A;  2KR0 A;  1WJ1 A;  3HSA A;  2D4Q A;  2LUL A;  3D8F A;  1W1H A;  3KY9 A;  5JP4 A;  2RLO A;  4KHB B;  2Z0P A;  2K00 A;  4OSN A;  3KRW A;  2MDX A;  2L1C A;  4A6H A;  1Q67 A;  4EJN A;  2EC1 A;  3B77 A;  2AL6 A;  1Y19 B;  3P6A A;  4IFS A;  4KVG B;  2YRY A;  3PEG A;  5DI9 B;  1GG3 A;  2ROZ B;  4CYE A;  2DKQ A;  1DDW A;  5HE1 A;  3O96 A;  1EGX A;  2ZKM X;  5LG4 B;  4KHB A;  2CAY A;  1BWN A;  1WI1 A;  2DA0 A;  2EJ8 A;  1IRS A;  2W2W A;  1NTV A;  4GNK B;  1WG7 A;  4WSF A;  4GXB A;  3AJ4 A;  1TQZ A;  3PG7 A;  4XWX A;  2GCL A;  2Y7B A;  1UNQ A;  2QKM A;  1WVH A;  1V61 A;  2R0D A;  1KZG A;  1TXD A;  3FVC A;  3QBV B;  3F0W A;  3WYF B;  3NWF A;  3LJU X;  2CRF A;  2DHJ A;  2UZR A;  1UNR A;  3TO1 A;  3ULC A;  2CY5 A;  5I2M A;  1W1D A;  2W2X D;  2KIG A;  3U8Z A;  3BJI A;  4CHJ A;  2P0D A;  4HAW B;  2DX1 A;  2M14 A;  2J59 M;  2Z13 A;  1WGQ A;  2NBV A;  5C6R A;  4WJ7 A;  1B55 A;  3FM8 C;  1EVH A;  1AWE A;  1PMS A;  1QQG A;  5FI1 A;  4DXA B;  4MY6 A;  5J3T A;  2YS5 A;  5I2S A;  3QIJ A;  4ZRK A;  5C5B A;  2VKI A;  4WVF B;  3ODW A;  3ZVR A;  2HE7 A;  3CXB B;  2BCJ A;  2L2I A;  3T06 A;  2DLW A;  1X1F A;  2D9Z A;  5C79 A;  4A6K A;  2D2Q A;  2RSG A;  1K5G B;  4ZRJ A;  1V5M A;  2D9V A;  3D8D A;  2I5F A;  4F7H A;  3ML4 A;  2NMB A;  1J0W A;  2YT1 A;  4HAU B;  1MIX A;  3U7D A;  3NWA A;  1ZM0 A;  5M4Y B;  5JHH A;  2RRF A;  1W1G A;  1XKE A;  1U29 A;  2D9Y A;  2DHK A;  4K81 A;  2UVM A;  2Z0Q A;  2OQB A;  4MK0 A;  2DX5 A;  2Z59 A;  3NW8 A;  4QXA B;  5EFX A;  2R2Y A;  3IVF A;  1FGZ A;  2R09 A;  2Z0O A;  1Y5O A;  3TFM A;  4DX9 0;  3DXC A;  2MFQ A;  4HB2 B;  2ZPY A;  4HSI A;  1Z87 A;  4D6W A;  1UPQ A;  4NY0 A;  3TVV A;  3F5R A;  1E5W A;  4EMO A;  3PSC A;  3VOQ A;  4DIX A;  3A58 A;  2GCJ A;  3QWM A;  5D3V A;  1V88 A;  2OTX A;  1U5E A;  4DX8 A;  1KI1 B;  4QJ3 B;  1DDV A;  3OHM B;  2Y8G A;  3ODO A;  1U27 A;  1FGY A;  1WJM A;  4ZRI A;  2AEH A;  3AU4 A;  3TCA A;  2D10 A;  2KIE A;  4DBB A;  3KSY A;  2DTC A;  1MKE A;  5KCV A;  1BAK A;  3KZ1 A;  1FHW A;  4CHM A;  2COA A;  3G9W A;  2CY4 A;  1ZSQ A;  2DYQ A;  1U5F A;  2VRW B;  2MWN B;  1BTN A;  2X18 A;  1X05 A;  2LKO A;  5C5B B;  3NWD A;  4HAT B;  2W2X C;  3VIA A;  4YON A;  4F7G A;  4OT1 A;  4Z2N A;  2M38 A;  4A6F A;  2PZ1 A;  2FJL A;  3UZT A;  2J0K A;  1H4R A;  1I7A A;  1ISN A;  2JP2 A;  1LB1 A;  2Z4D A;  2IYB A;  2D9W A;  4H8S A;  2NZ8 B;  1J19 A;  4Y94 A;  4K17 A;  5GOW B;  4KHO A;  2YT0 A;  5FI0 A;  3RCP A;  1U5D A;  4HAY B;  2Z14 A;  5LOP B;  4EKU A;  2XQN M;  1LW3 A;  1K5D B;  3AU5 A;  4HB0 B;  2V76 A;  5D3W A;  4K2P A;  3HQC A;  3V5W A;  1I2H A;  3ULB A;  1M7E A;  3FSS A;  5JLJ B;  2COD A;  2COC A;  2YVC A;  5C16 A;  1GC6 A;  5JHG A;  2YS1 A;  2YSZ A;  3M1I B;  1EAZ A;  1UEF A;  4HHV A;  1DYN A;  2DYN A;  4HAV B;  2KUQ A;  2GS0 A;  3PVW A;  2FJU B;  1V89 A;  5DIF B;  2DKP A;  4HB3 B;  2LOX A;  1FAO A;  3N7C A;  4IAP A;  5KQ4 A;  5DHF B;  1KZ7 A;  5LON B;  4GMV A;  3DXD A;  3DXE A;  4IOY X;  2IFS A;  2K2U A;  2RVB B;  5KQ1 A;  2P0H A;  2N23 A;  4L1R A;  5CLQ B;  1MK9 B;  3PP2 A;  1ZC3 B;  1U2B A;  2RGN B;  1V5U A;  5D3X A;  1X86 A;  4MT7 A;  3P7Z A;  3ZDT A;  1SGH A;  2HTH B;  5DH9 B;  2J0M A;  2J0J A;  2LYD A;  1XD4 A;  3HW2 B;  2LG1 A;  3SUZ A;  2EMS A;  1QC6 A;  4NSW A;  1DRO A;  1OY2 A;  5IRS A;  3PVU A;  2QKL A;  1ZVR A;  1PLS A;  1OQN A;  2GUM A;  3SNH A;  2K49 A;  2K8E A;  2I1J A;  4L6E A;  4QJ5 B;  1ZYI A;  1UNP A; 
#chains in the Genus database with same CATH homology
 5HE2 A;  1RJ2 A;  1MK7 B;  4A6F B;  1BTK A;  1PFJ A;  2P8V A;  1DBH A;  1MIZ B;  1UPR A;  1ZC4 B;  1MPH A;  4GZU A;  2YS3 A;  1AQC A;  3A8P A;  1OMW A;  2Q13 A;  5HE0 A;  2LOZ A;  3D8E A;  4BBK A;  1NTY A;  4TKN A;  1FHO A;  3A98 B;  5J3Y A;  1SHC A;  3ODX A;  4D0N B;  5L81 A;  2D11 A;  4HAX B;  1X11 A;  1XR0 B;  4KHA A;  1X1G A;  2YF0 A;  2GJY A;  1FB8 A;  2H7E A;  2EMT A;  1NU2 A;  4C0A A;  3GYP A;  1EF1 A;  4HDQ A;  3FEH A;  3X23 A;  1H10 A;  2E2X A;  3HK0 A;  2ROV A;  3SYX A;  4GMX B;  3BIN A;  3OAN A;  2N0Y A;  4Z2M B;  2RUK B;  2G35 A;  2I5C A;  2ELA A;  2ADZ A;  2UZS A;  2K2J A;  1DDM A;  4F7U P;  1M7R A;  1XCG A;  5HE3 A;  1GC7 A;  2KGX B;  3SO6 A;  4KAX B;  2KCJ A;  1MAI A;  3GYO A;  4PQ0 A;  5D27 A;  2P0F A;  1WGU A;  4B6H A;  5J3Q A;  5DHA B;  4PNK A;  2RNR B;  4HB4 B;  1P5T A;  4TYZ A;  3CIK A;  2DN6 A;  2DFK A;  3TW1 A;  1N3H A;  3SV1 A;  3MDB C;  1V5P A;  1U5G A;  1XX0 A;  3PZD A;  4GPT B;  2KUP A;  2Y8F A;  4HDO A;  2COF A;  1NI2 A;  2H7D A;  2VSZ A;  1FHX A;  2DHI A;  3PVL A;  4A5K A;  5D3Y A;  2I1K A;  3A8Q A;  2ELB A;  1TJ6 A;  2D9X A;  3WA0 A;  1XOD A;  2MKR A;  4K2O A;  5CLL B;  1P3R A;  1RRP B;  1P6S A;  3KRX A;  3MPX A;  4GN1 A;  4HAZ B;  4YL8 A;  1FOE A;  4P7I A;  3NSU A;  1WJ1 A;  2D4Q A;  2LUL A;  3D8F A;  1W1H A;  3KY9 A;  5JP4 A;  2RLO A;  4KHB B;  2Z0P A;  2K00 A;  3KRW A;  2MDX A;  2L1C A;  4A6H A;  1Q67 A;  4EJN A;  2EC1 A;  3P6A A;  2AL6 A;  1Y19 B;  4IFS A;  4KVG B;  3PEG A;  2YRY A;  5DI9 B;  1GG3 A;  2ROZ B;  4CYE A;  2DKQ A;  1DDW A;  5HE1 A;  3O96 A;  1EGX A;  2CAY A;  1BWN A;  1WI1 A;  2DA0 A;  2EJ8 A;  1IRS A;  2W2W A;  1NTV A;  1WG7 A;  4WSF A;  4GXB A;  3AJ4 A;  1TQZ A;  3PG7 A;  4XWX A;  2GCL A;  2Y7B A;  1UNQ A;  2QKM A;  1WVH A;  1V61 A;  2R0D A;  1KZG A;  1TXD A;  3QBV B;  3F0W A;  3WYF B;  3LJU X;  2CRF A;  2DHJ A;  2UZR A;  1UNR A;  3TO1 A;  3ULC A;  2CY5 A;  1W1D A;  2W2X D;  3U8Z A;  3BJI A;  4CHJ A;  2P0D A;  4HAW B;  2DX1 A;  2M14 A;  2J59 M;  1WGQ A;  5C6R A;  4WJ7 A;  1B55 A;  3FM8 C;  1EVH A;  1AWE A;  1PMS A;  1QQG A;  5FI1 A;  4DXA B;  4MY6 A;  5J3T A;  2YS5 A;  3QIJ A;  4ZRK A;  5C5B A;  2VKI A;  4WVF B;  3ODW A;  3ZVR A;  2HE7 A;  3CXB B;  2BCJ A;  2L2I A;  3T06 A;  2DLW A;  1X1F A;  2D9Z A;  5C79 A;  4A6K A;  2D2Q A;  2RSG A;  1K5G B;  4ZRJ A;  1V5M A;  2D9V A;  3D8D A;  2I5F A;  4F7H A;  3ML4 A;  2NMB A;  1J0W A;  2YT1 A;  4HAU B;  1MIX A;  3U7D A;  1ZM0 A;  5JHH A;  1W1G A;  1XKE A;  1U29 A;  2D9Y A;  2DHK A;  4K81 A;  2UVM A;  2Z0Q A;  2OQB A;  4MK0 A;  2DX5 A;  5EFX A;  3IVF A;  1FGZ A;  2R09 A;  2Z0O A;  1Y5O A;  3TFM A;  4DX9 0;  3DXC A;  2MFQ A;  4HB2 B;  2ZPY A;  1Z87 A;  1UPQ A;  4NY0 A;  3TVV A;  3F5R A;  1E5W A;  4EMO A;  3PSC A;  3VOQ A;  2GCJ A;  3QWM A;  5D3V A;  1V88 A;  2OTX A;  1U5E A;  4DX8 A;  1KI1 B;  1DDV A;  2Y8G A;  3ODO A;  1U27 A;  1FGY A;  1WJM A;  4ZRI A;  2AEH A;  3AU4 A;  3TCA A;  2D10 A;  4DBB A;  3KSY A;  2DTC A;  1MKE A;  5KCV A;  1BAK A;  3KZ1 A;  1FHW A;  4CHM A;  2COA A;  3G9W A;  2CY4 A;  1ZSQ A;  2DYQ A;  1U5F A;  2VRW B;  2MWN B;  1BTN A;  2X18 A;  1X05 A;  2LKO A;  5C5B B;  4HAT B;  2W2X C;  3VIA A;  4YON A;  4F7G A;  4Z2N A;  2M38 A;  4A6F A;  2PZ1 A;  2FJL A;  3UZT A;  2J0K A;  1H4R A;  1I7A A;  1ISN A;  2JP2 A;  1LB1 A;  2IYB A;  2D9W A;  4H8S A;  2NZ8 B;  1J19 A;  4Y94 A;  4K17 A;  5GOW B;  4KHO A;  2YT0 A;  5FI0 A;  3RCP A;  1U5D A;  4HAY B;  5LOP B;  4EKU A;  2XQN M;  1LW3 A;  1K5D B;  3AU5 A;  4HB0 B;  2V76 A;  5D3W A;  4K2P A;  3HQC A;  3V5W A;  1I2H A;  3ULB A;  1M7E A;  3FSS A;  5JLJ B;  2COD A;  2COC A;  2YVC A;  5C16 A;  1GC6 A;  5JHG A;  2YS1 A;  2YSZ A;  3M1I B;  1EAZ A;  1UEF A;  4HHV A;  1DYN A;  2DYN A;  4HAV B;  2GS0 A;  3PVW A;  1V89 A;  5DIF B;  2DKP A;  4HB3 B;  2LOX A;  1FAO A;  3N7C A;  4IAP A;  5KQ4 A;  5DHF B;  1KZ7 A;  5LON B;  4GMV A;  3DXD A;  3DXE A;  4IOY X;  2IFS A;  2K2U A;  2RVB B;  5KQ1 A;  2P0H A;  2N23 A;  5CLQ B;  1MK9 B;  3PP2 A;  1ZC3 B;  1U2B A;  2RGN B;  1V5U A;  5D3X A;  1X86 A;  4MT7 A;  3P7Z A;  3ZDT A;  1SGH A;  2HTH B;  5DH9 B;  2J0M A;  2J0J A;  2LYD A;  1XD4 A;  3HW2 B;  2LG1 A;  3SUZ A;  2EMS A;  1QC6 A;  4NSW A;  1DRO A;  1OY2 A;  3PVU A;  2QKL A;  1ZVR A;  1PLS A;  1OQN A;  3SNH A;  2I1J A;  4L6E A;  1UNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...