2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords ACTIN-LIKE PROTEIN 7A
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
1WVHA 2AL6A 1X1FA 3ODWA 1P3RA 2COFA 2P0FA 1Z87A 1X05A 3F0WA 1B55A 4A6FB 5D3XA 1QQGA 1LB1A 5J3QA 4TYZA 3TO1A 4XWXA 4K2OA 4D0NB 5JHHA 1E5WA 3VOQA 3ZVRA 2G35A 1AQCA 2DN6A 1N3HA 3U8ZA 2CRFA 1UPRA 1FB8A 2DKPA 3ULBA 4PNKA 4YONA 1V88A 2I5FA 1FGYA 3HW2B 1M7EA 1V89A 2BCJA 2IYBA 4GPTB 1ZC4B 2Z0QA 2DYNA 3HK0A 4ZRJA 4HAZB 1IRSA 4MK0A 1WI1A 2D11A 1FOEA 1XX0A 5FI1A 4GXBA 1BAKA 3D8EA 2YS5A 4HATB 1KZGA 1P5TA 4ZRKA 3PZDA 1GC7A 2ELAA 3KRWA 2IFSA 5DH9B 1I2HA 2CY5A 5DHFB 4MT7A 1MKEA 1SGHA 5LOPB 1EGXA 2ROVA 5D27A 4H8SA 2HE7A 1ISNA 1UPQA 5C79A 1WG7A 3F5RA 2DTCA 2RVBB 3FEHA 1W1HA 4GMXB 2I1JA 3FSSA 1ZSQA 2ROZB 4ZRIA 1SHCA 2NZ8B 2W2XD 3G9WA 2UVMA 2COAA 1K5GB 1WGUA 5HE2A 4CHJA 4GMVA 1TXDA 2H7DA 1H10A 1EF1A 2Y8GA 4KAXB 5C16A 4HAXB 1Q67A 2P0HA 2Q13A 4EKUA 4WVFB 4NSWA 4K17A 2FJLA 1NU2A 2J59M 1KI1B 2D4QA 5DI9B 2MDXA 2D9ZA 4EJNA 1J19A 3SO6A 4PQ0A 3D8DA 3CIKA 3GYOA 3BINA 2E2XA 2Y7BA 2LKOA 1AWEA 2RLOA 5J3YA 4F7HA 2RGNB 3DXDA 3M1IB 1U29A 5KQ4A 1U5GA 5D3WA 1MIZB 2AEHA 1RJ2A 4KVGB 3FM8C 1MIXA 3TCAA 1EAZA 4Y94A 1DDVA 2XQNM 1XCGA 1DDMA 1J0WA 2VSZA 2YSZA 4GN1A 4Z2NA 2K2JA 1XR0B 1W1GA 3ODOA 4DXAB 2EC1A 4HDQA 2YF0A 1U2BA 3IVFA 5JHGA 2HTHB 1MK9B 1PMSA 1UNPA 1Y19B 3P7ZA 1U5DA 3QWMA 2D10A 1K5DB 2H7EA 5D3YA 1UEFA 3SUZA 2YVCA 1WGQA 2KCJA 1EVHA 3MDBC 3V5WA 1I7AA 2DA0A 4F7GA 3GYPA 3AJ4A 1DBHA 2YS3A 3DXCA 3SNHA 1BWNA 4CHMA 3SV1A 5KQ1A 1V5PA 2W2XC 3RCPA 2UZSA 2VRWB 2LG1A 5KCVA 3A8PA 2EJ8A 5FI0A 1ZC3B 3WYFB 2QKMA 4KHAA 5J3TA 4DBBA 3MPXA 1H4RA 3LJUX 1UNRA 3VIAA 3A8QA 1P6SA 1X86A 1FAOA 2GCJA 5CLQB 4NY0A 3QBVB 2N23A 5JP4A 2ZPYA 3CXBB 3N7CA 2LOZA 4EMOA 2EMSA 1X1GA 1UNQA 4C0AA 4TKNA 2YT1A 2KGXB 2L1CA 2RNRB 1XKEA 3AU4A 2R0DA 4DX90 2GJYA 4WSFA 1OQNA 4HB4B 3AU5A 1ZM0A 4K81A 3PVLA 4MY6A 2ADZA 2CODA 4HB3B 4KHBB 2D9WA 2Z0PA 1ZVRA 2M14A 4K2PA 1KZ7A 2LULA 3KZ1A 2PZ1A 5HE3A 2W2WA 2MWNB 1WJ1A 1X11A 2CAYA 2NMBA 5C6RA 2D9YA 4CYEA 2LYDA 1DYNA 2DKQA 2R09A 4A6HA 3BJIA 5GOWB 2MFQA 5C5BB 3WA0A 2COCA 2DHKA 1U5FA 2DX1A 5HE1A 2KUPA 3UZTA 2DHJA 1NI2A 3TFMA 2N0YA 3OANA 2J0JA 2P8VA 3T06A 4HHVA 4BBKA 3SYXA 5DHAB 1OY2A 1WJMA 1MK7B 2I1KA 1PFJA 5CLLB 1V5UA 3PP2A 1RRPB 4HAWB 2VKIA 4HAUB 4F7UP 1V5MA 1OMWA 5JLJB 2Y8FA 1LW3A 1FHOA 4A6FA 3ULCA 3O96A 2YRYA 2DHIA 1PLSA 3P6AA 2P0DA 3PG7A 1TJ6A 4WJ7A 5L81A 3PVUA 4KHOA 1FHXA 1NTYA 3PVWA 5LONB 2D2QA 2OQBA 3U7DA 1U5EA 2J0KA 4HAVB 1BTNA 3KY9A 3KRXA 4HB0B 4HDOA 2DX5A 2M38A 4DX8A 4IAPA 4A6KA 2YS1A 1MAIA 4IOYX 4IFSA 2V76A 2DYQA 3KSYA 3ODXA 2DLWA 2D9XA 4L6EA 1XODA 4HAYB 3A98B 3TVVA 1TQZA 1NTVA 2J0MA 5DIFB 2EMTA 2RUKB 2CY4A 3PEGA 1GC6A 1M7RA 1MPHA 2ELBA 3NSUA 3PSCA 1XD4A 4GZUA 2D9VA 2JP2A 2K2UA 2DFKA 5C5BA 3QIJA 2QKLA 1DROA 1U27A 1GG3A 3ML4A 5HE0A 4HB2B 4YL8A 1W1DA 4Z2MB 2YT0A 4B6HA 3ZDTA 1FHWA 2Z0OA 2OTXA 3X23A 1QC6A 1FGZA 2MKRA 2X18A 2GCLA 4P7IA 3HQCA 2UZRA 5D3VA 5EFXA 2I5CA 1Y5OA 3D8FA 2RSGA 2LOXA 1V61A 1DDWA 3TW1A 4A5KA 2K00A 1BTKA 3DXEA 2GS0A 2L2IA
chains in the Genus database with same CATH superfamily
1WVHA 2AL6A 1X1FA 5IRSA 3ODWA 1P3RA 2COFA 2P0FA 1Z87A 1X05A 3F0WA 1B55A 4A6FB 4GOUA 5D3XA 1QQGA 1LB1A 5J3QA 4TYZA 3TO1A 4XWXA 4K2OA 4D0NB 5JHHA 1E5WA 3VOQA 3ZVRA 2G35A 1AQCA 2DN6A 1N3HA 3U8ZA 2CRFA 1UPRA 4DIXA 1FB8A 2DKPA 3ULBA 4PNKA 4YONA 1V88A 2I5FA 1FGYA 3HW2B 1M7EA 1V89A 2BCJA 2IYBA 4GPTB 1ZC4B 2Z0QA 2DYNA 3HK0A 4ZRJA 4GNKB 4HAZB 1IRSA 4QJ3B 4MK0A 1WI1A 2KUQA 2D11A 1FOEA 1XX0A 5FI1A 4GXBA 1BAKA 3D8EA 2YS5A 4HATB 1KZGA 1P5TA 4ZRKA 3PZDA 1GC7A 2ELAA 3KRWA 2IFSA 5DH9B 1I2HA 2CY5A 5DHFB 4MT7A 1MKEA 2KIEA 1SGHA 5LOPB 1EGXA 2ROVA 5D27A 4H8SA 2HE7A 1ISNA 1UPQA 5C79A 1WG7A 3F5RA 2DTCA 2RVBB 3FEHA 1W1HA 4GMXB 2I1JA 3FSSA 1ZSQA 2ROZB 4L1RA 4ZRIA 1SHCA 2KIGA 3DCXA 4QJ5B 2NZ8B 2W2XD 3G9WA 2UVMA 2COAA 1K5GB 1WGUA 5HE2A 4CHJA 4GMVA 1TXDA 2H7DA 4KHBA 1H10A 1EF1A 2Y8GA 4KAXB 5C16A 1Q67A 2P0HA 2Q13A 4HAXB 4EKUA 4WVFB 4NSWA 4K17A 2FJLA 1NU2A 2J59M 2ZKMX 1KI1B 2D4QA 5DI9B 2MDXA 2D9ZA 4EJNA 1J19A 3SO6A 4PQ0A 3D8DA 3CIKA 3GYOA 3BINA 2E2XA 2Y7BA 2LKOA 1AWEA 2RLOA 5J3YA 4F7HA 2RGNB 3DXDA 3M1IB 1U29A 5KQ4A 4QJ4B 1U5GA 5D3WA 3A58A 2Z13A 1MIZB 2AEHA 1RJ2A 4KVGB 3FM8C 1MIXA 3TCAA 1EAZA 3U12A 4Y94A 1DDVA 2XQNM 1XCGA 1DDMA 1J0WA 2VSZA 2YSZA 4GN1A 4Z2NA 2K2JA 1XR0B 1W1GA 2RRFA 3ODOA 2Z4DA 4DXAB 2EC1A 1MI1A 4HDQA 2YF0A 1U2BA 3IVFA 5JHGA 2HTHB 1MK9B 1PMSA 1UNPA 1Y19B 3P7ZA 1U5DA 3QWMA 2D10A 1K5DB 2H7EA 5D3YA 1T77A 1UEFA 3SUZA 2YVCA 1WGQA 2KCJA 1EVHA 3MDBC 5I2SA 3V5WA 1I7AA 2DA0A 4F7GA 3GYPA 3AJ4A 4OSNA 3FVCA 1DBHA 2NBVA 2YS3A 3DXCA 3SNHA 1BWNA 4CHMA 3SV1A 2GUMA 1ZYIA 3NWFA 5KQ1A 1V5PA 2W2XC 3RCPA 2UZSA 2VRWB 2LG1A 5KCVA 3A8PA 2EJ8A 5FI0A 1ZC3B 3WYFB 2QKMA 4KHAA 5J3TA 4DBBA 3MPXA 1H4RA 3LJUX 1UNRA 3VIAA 3A8QA 1P6SA 1X86A 1FAOA 2GCJA 5CLQB 4NY0A 3QBVB 2N23A 5JP4A 2ZPYA 3CXBB 3N7CA 2LOZA 4EMOA 3NWDA 2EMSA 1X1GA 1UNQA 4D6WA 5I2MA 5LG4B 4C0AA 4TKNA 2YT1A 2KGXB 2L1CA 2RNRB 1XKEA 3AU4A 2R0DA 4DX90 2GJYA 4WSFA 1OQNA 4HB4B 3AU5A 1ZM0A 4K81A 3PVLA 2YT2A 4MY6A 2ADZA 2CODA 4HB3B 4KHBB 2D9WA 2Z0PA 1ZVRA 2M14A 4K2PA 1KZ7A 2LULA 3KZ1A 2PZ1A 5HE3A 2W2WA 2MWNB 2FJUB 1WJ1A 1X11A 2CAYA 2NMBA 5C6RA 2D9YA 4CYEA 2LYDA 1DYNA 2DKQA 2R09A 4A6HA 3BJIA 5GOWB 2MFQA 5C5BB 3WA0A 2COCA 2DHKA 1U5FA 2DX1A 5HE1A 2KUPA 3UZTA 2DHJA 1NI2A 3TFMA 2N0YA 3OANA 2J0JA 2P8VA 3T06A 4HHVA 4BBKA 3SYXA 5DHAB 1OY2A 1WJMA 1MK7B 2I1KA 1PFJA 5CLLB 1V5UA 4HSIA 3PP2A 1RRPB 4HAWB 3HIEA 2VKIA 4HAUB 4F7UP 1V5MA 1OMWA 5JLJB 2Y8FA 1LW3A 1FHOA 4CSQA 4A6FA 3ULCA 3O96A 2YRYA 2DHIA 1PLSA 3OHMB 3P6AA 2P0DA 3B77A 3PG7A 1TJ6A 3NWAA 4WJ7A 5L81A 3PVUA 4QXAB 4KHOA 1FHXA 2Z59A 1NTYA 3PVWA 5LONB 2D2QA 3NW8A 2OQBA 3U7DA 1U5EA 2J0KA 4HAVB 1BTNA 3KY9A 3KRXA 2R2YA 4HDOA 4HB0B 2DX5A 2M38A 4DX8A 4IAPA 4A6KA 2YS1A 1MAIA 4IOYX 4IFSA 2V76A 2DYQA 3KSYA 3ODXA 2DLWA 5M4YB 2D9XA 4L6EA 2K8EA 1XODA 3HSAA 4HAYB 3A98B 2KR0A 1TQZA 3TVVA 1NTVA 2J0MA 5DIFB 2EMTA 2RUKB 2CY4A 3PEGA 1GC6A 1M7RA 1MPHA 2ELBA 3NSUA 3PSCA 1XD4A 4GZUA 2D9VA 2JP2A 2K2UA 2DFKA 5C5BA 3QIJA 2QKLA 1DROA 1U27A 1GG3A 3ML4A 5HE0A 4HB2B 4YL8A 1W1DA 4Z2MB 2YT0A 4B6HA 3ZDTA 1FHWA 2K49A 2Z0OA 2OTXA 3X23A 1QC6A 1FGZA 2MKRA 2X18A 2GCLA 4OT1A 4P7IA 3HQCA 2UZRA 5D3VA 5EFXA 2I5CA 1Y5OA 3D8FA 2RSGA 2LOXA 1V61A 1DDWA 3TW1A 4A5KA 2K00A 1BTKA 2Z14A 3DXEA 2GS0A 2L2IA
chains in the Genus database with same CATH topology
1WVHA 2AL6A 1X1FA 3ODWA 1P3RA 2COFA 2P0FA 1Z87A 1X05A 3F0WA 1B55A 4A6FB 5D3XA 1QQGA 1LB1A 5J3QA 4TYZA 3TO1A 4XWXA 4K2OA 4D0NB 5JHHA 1E5WA 3VOQA 3ZVRA 2G35A 1AQCA 2DN6A 1N3HA 3U8ZA 2CRFA 1UPRA 1FB8A 2DKPA 3ULBA 4PNKA 4YONA 1V88A 2I5FA 1FGYA 3HW2B 1M7EA 1V89A 2BCJA 2IYBA 4GPTB 1ZC4B 2Z0QA 2DYNA 3HK0A 4ZRJA 4HAZB 1IRSA 4MK0A 1WI1A 2D11A 1FOEA 1XX0A 5FI1A 4GXBA 1BAKA 3D8EA 2YS5A 4HATB 1KZGA 1P5TA 4ZRKA 3PZDA 1GC7A 2ELAA 3KRWA 2IFSA 5DH9B 1I2HA 2CY5A 5DHFB 4MT7A 1MKEA 1SGHA 5LOPB 1EGXA 2ROVA 5D27A 4H8SA 2HE7A 1ISNA 1UPQA 5C79A 1WG7A 3F5RA 2DTCA 2RVBB 3FEHA 1W1HA 4GMXB 2I1JA 3FSSA 1ZSQA 2ROZB 4ZRIA 1SHCA 2NZ8B 2W2XD 3G9WA 2UVMA 2COAA 1K5GB 1WGUA 5HE2A 4CHJA 4GMVA 1TXDA 2H7DA 1H10A 1EF1A 2Y8GA 4KAXB 5C16A 4HAXB 1Q67A 2P0HA 2Q13A 4EKUA 4WVFB 4NSWA 4K17A 2FJLA 1NU2A 2J59M 1KI1B 2D4QA 5DI9B 2MDXA 2D9ZA 4EJNA 1J19A 3SO6A 4PQ0A 3D8DA 3CIKA 3GYOA 3BINA 2E2XA 2Y7BA 2LKOA 1AWEA 2RLOA 5J3YA 4F7HA 2RGNB 3DXDA 3M1IB 1U29A 5KQ4A 1U5GA 5D3WA 1MIZB 2AEHA 1RJ2A 4KVGB 3FM8C 1MIXA 3TCAA 1EAZA 4Y94A 1DDVA 2XQNM 1XCGA 1DDMA 1J0WA 2VSZA 2YSZA 4GN1A 4Z2NA 2K2JA 1XR0B 1W1GA 3ODOA 4DXAB 2EC1A 4HDQA 2YF0A 1U2BA 3IVFA 5JHGA 2HTHB 1MK9B 1PMSA 1UNPA 1Y19B 3P7ZA 1U5DA 3QWMA 2D10A 1K5DB 2H7EA 5D3YA 1UEFA 3SUZA 2YVCA 1WGQA 2KCJA 1EVHA 3MDBC 3V5WA 1I7AA 2DA0A 4F7GA 3GYPA 3AJ4A 1DBHA 2YS3A 3DXCA 3SNHA 1BWNA 4CHMA 3SV1A 5KQ1A 1V5PA 2W2XC 3RCPA 2UZSA 2VRWB 2LG1A 5KCVA 3A8PA 2EJ8A 5FI0A 1ZC3B 3WYFB 2QKMA 4KHAA 5J3TA 4DBBA 3MPXA 1H4RA 3LJUX 1UNRA 3VIAA 3A8QA 1P6SA 1X86A 1FAOA 2GCJA 5CLQB 4NY0A 3QBVB 2N23A 5JP4A 2ZPYA 3CXBB 3N7CA 2LOZA 4EMOA 2EMSA 1X1GA 1UNQA 4C0AA 4TKNA 2YT1A 2KGXB 2L1CA 2RNRB 1XKEA 3AU4A 2R0DA 4DX90 2GJYA 4WSFA 1OQNA 4HB4B 3AU5A 1ZM0A 4K81A 3PVLA 4MY6A 2ADZA 2CODA 4HB3B 4KHBB 2D9WA 2Z0PA 1ZVRA 2M14A 4K2PA 1KZ7A 2LULA 3KZ1A 2PZ1A 5HE3A 2W2WA 2MWNB 1WJ1A 1X11A 2CAYA 2NMBA 5C6RA 2D9YA 4CYEA 2LYDA 1DYNA 2DKQA 2R09A 4A6HA 3BJIA 5GOWB 2MFQA 5C5BB 3WA0A 2COCA 2DHKA 1U5FA 2DX1A 5HE1A 2KUPA 3UZTA 2DHJA 1NI2A 3TFMA 2N0YA 3OANA 2J0JA 2P8VA 3T06A 4HHVA 4BBKA 3SYXA 5DHAB 1OY2A 1WJMA 1MK7B 2I1KA 1PFJA 5CLLB 1V5UA 3PP2A 1RRPB 4HAWB 2VKIA 4HAUB 4F7UP 1V5MA 1OMWA 5JLJB 2Y8FA 1LW3A 1FHOA 4A6FA 3ULCA 3O96A 2YRYA 2DHIA 1PLSA 3P6AA 2P0DA 3PG7A 1TJ6A 4WJ7A 5L81A 3PVUA 4KHOA 1FHXA 1NTYA 3PVWA 5LONB 2D2QA 2OQBA 3U7DA 1U5EA 2J0KA 4HAVB 1BTNA 3KY9A 3KRXA 4HB0B 4HDOA 2DX5A 2M38A 4DX8A 4IAPA 4A6KA 2YS1A 1MAIA 4IOYX 4IFSA 2V76A 2DYQA 3KSYA 3ODXA 2DLWA 2D9XA 4L6EA 1XODA 4HAYB 3A98B 3TVVA 1TQZA 1NTVA 2J0MA 5DIFB 2EMTA 2RUKB 2CY4A 3PEGA 1GC6A 1M7RA 1MPHA 2ELBA 3NSUA 3PSCA 1XD4A 4GZUA 2D9VA 2JP2A 2K2UA 2DFKA 5C5BA 3QIJA 2QKLA 1DROA 1U27A 1GG3A 3ML4A 5HE0A 4HB2B 4YL8A 1W1DA 4Z2MB 2YT0A 4B6HA 3ZDTA 1FHWA 2Z0OA 2OTXA 3X23A 1QC6A 1FGZA 2MKRA 2X18A 2GCLA 4P7IA 3HQCA 2UZRA 5D3VA 5EFXA 2I5CA 1Y5OA 3D8FA 2RSGA 2LOXA 1V61A 1DDWA 3TW1A 4A5KA 2K00A 1BTKA 3DXEA 2GS0A 2L2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVH A;  2AL6 A;  1X1F A;  3ODW A;  1P3R A;  2COF A;  2P0F A;  1Z87 A;  1X05 A;  3F0W A;  1B55 A;  4A6F B;  5D3X A;  1QQG A;  1LB1 A;  5J3Q A;  4TYZ A;  3TO1 A;  4XWX A;  4K2O A;  4D0N B;  5JHH A;  1E5W A;  3VOQ A;  3ZVR A;  2G35 A;  1AQC A;  2DN6 A;  1N3H A;  3U8Z A;  2CRF A;  1UPR A;  1FB8 A;  2DKP A;  3ULB A;  4PNK A;  4YON A;  1V88 A;  2I5F A;  1FGY A;  3HW2 B;  1M7E A;  1V89 A;  2BCJ A;  2IYB A;  4GPT B;  1ZC4 B;  2Z0Q A;  2DYN A;  3HK0 A;  4ZRJ A;  4HAZ B;  1IRS A;  4MK0 A;  1WI1 A;  2D11 A;  1FOE A;  1XX0 A;  5FI1 A;  4GXB A;  1BAK A;  3D8E A;  2YS5 A;  4HAT B;  1KZG A;  1P5T A;  4ZRK A;  3PZD A;  1GC7 A;  2ELA A;  3KRW A;  2IFS A;  5DH9 B;  1I2H A;  2CY5 A;  5DHF B;  4MT7 A;  1MKE A;  1SGH A;  5LOP B;  1EGX A;  2ROV A;  5D27 A;  4H8S A;  2HE7 A;  1ISN A;  1UPQ A;  5C79 A;  1WG7 A;  3F5R A;  2DTC A;  2RVB B;  3FEH A;  1W1H A;  4GMX B;  2I1J A;  3FSS A;  1ZSQ A;  2ROZ B;  4ZRI A;  1SHC A;  2NZ8 B;  2W2X D;  3G9W A;  2UVM A;  2COA A;  1K5G B;  1WGU A;  5HE2 A;  4CHJ A;  4GMV A;  1TXD A;  2H7D A;  1H10 A;  1EF1 A;  2Y8G A;  4KAX B;  5C16 A;  4HAX B;  1Q67 A;  2P0H A;  2Q13 A;  4EKU A;  4WVF B;  4NSW A;  4K17 A;  2FJL A;  1NU2 A;  2J59 M;  1KI1 B;  2D4Q A;  5DI9 B;  2MDX A;  2D9Z A;  4EJN A;  1J19 A;  3SO6 A;  4PQ0 A;  3D8D A;  3CIK A;  3GYO A;  3BIN A;  2E2X A;  2Y7B A;  2LKO A;  1AWE A;  2RLO A;  5J3Y A;  4F7H A;  2RGN B;  3DXD A;  3M1I B;  1U29 A;  5KQ4 A;  1U5G A;  5D3W A;  1MIZ B;  2AEH A;  1RJ2 A;  4KVG B;  3FM8 C;  1MIX A;  3TCA A;  1EAZ A;  4Y94 A;  1DDV A;  2XQN M;  1XCG A;  1DDM A;  1J0W A;  2VSZ A;  2YSZ A;  4GN1 A;  4Z2N A;  2K2J A;  1XR0 B;  1W1G A;  3ODO A;  4DXA B;  2EC1 A;  4HDQ A;  2YF0 A;  1U2B A;  3IVF A;  5JHG A;  2HTH B;  1MK9 B;  1PMS A;  1UNP A;  1Y19 B;  3P7Z A;  1U5D A;  3QWM A;  2D10 A;  1K5D B;  2H7E A;  5D3Y A;  1UEF A;  3SUZ A;  2YVC A;  1WGQ A;  2KCJ A;  1EVH A;  3MDB C;  3V5W A;  1I7A A;  2DA0 A;  4F7G A;  3GYP A;  3AJ4 A;  1DBH A;  2YS3 A;  3DXC A;  3SNH A;  1BWN A;  4CHM A;  3SV1 A;  5KQ1 A;  1V5P A;  2W2X C;  3RCP A;  2UZS A;  2VRW B;  2LG1 A;  5KCV A;  3A8P A;  2EJ8 A;  5FI0 A;  1ZC3 B;  3WYF B;  2QKM A;  4KHA A;  5J3T A;  4DBB A;  3MPX A;  1H4R A;  3LJU X;  1UNR A;  3VIA A;  3A8Q A;  1P6S A;  1X86 A;  1FAO A;  2GCJ A;  5CLQ B;  4NY0 A;  3QBV B;  2N23 A;  5JP4 A;  2ZPY A;  3CXB B;  3N7C A;  2LOZ A;  4EMO A;  2EMS A;  1X1G A;  1UNQ A;  4C0A A;  4TKN A;  2YT1 A;  2KGX B;  2L1C A;  2RNR B;  1XKE A;  3AU4 A;  2R0D A;  4DX9 0;  2GJY A;  4WSF A;  1OQN A;  4HB4 B;  3AU5 A;  1ZM0 A;  4K81 A;  3PVL A;  4MY6 A;  2ADZ A;  2COD A;  4HB3 B;  4KHB B;  2D9W A;  2Z0P A;  1ZVR A;  2M14 A;  4K2P A;  1KZ7 A;  2LUL A;  3KZ1 A;  2PZ1 A;  5HE3 A;  2W2W A;  2MWN B;  1WJ1 A;  1X11 A;  2CAY A;  2NMB A;  5C6R A;  2D9Y A;  4CYE A;  2LYD A;  1DYN A;  2DKQ A;  2R09 A;  4A6H A;  3BJI A;  5GOW B;  2MFQ A;  5C5B B;  3WA0 A;  2COC A;  2DHK A;  1U5F A;  2DX1 A;  5HE1 A;  2KUP A;  3UZT A;  2DHJ A;  1NI2 A;  3TFM A;  2N0Y A;  3OAN A;  2J0J A;  2P8V A;  3T06 A;  4HHV A;  4BBK A;  3SYX A;  5DHA B;  1OY2 A;  1WJM A;  1MK7 B;  2I1K A;  1PFJ A;  5CLL B;  1V5U A;  3PP2 A;  1RRP B;  4HAW B;  2VKI A;  4HAU B;  4F7U P;  1V5M A;  1OMW A;  5JLJ B;  2Y8F A;  1LW3 A;  1FHO A;  4A6F A;  3ULC A;  3O96 A;  2YRY A;  2DHI A;  1PLS A;  3P6A A;  2P0D A;  3PG7 A;  1TJ6 A;  4WJ7 A;  5L81 A;  3PVU A;  4KHO A;  1FHX A;  1NTY A;  3PVW A;  5LON B;  2D2Q A;  2OQB A;  3U7D A;  1U5E A;  2J0K A;  4HAV B;  1BTN A;  3KY9 A;  3KRX A;  4HB0 B;  4HDO A;  2DX5 A;  2M38 A;  4DX8 A;  4IAP A;  4A6K A;  2YS1 A;  1MAI A;  4IOY X;  4IFS A;  2V76 A;  2DYQ A;  3KSY A;  3ODX A;  2DLW A;  2D9X A;  4L6E A;  1XOD A;  4HAY B;  3A98 B;  3TVV A;  1TQZ A;  1NTV A;  2J0M A;  5DIF B;  2EMT A;  2RUK B;  2CY4 A;  3PEG A;  1GC6 A;  1M7R A;  1MPH A;  2ELB A;  3NSU A;  3PSC A;  1XD4 A;  4GZU A;  2D9V A;  2JP2 A;  2K2U A;  2DFK A;  5C5B A;  3QIJ A;  2QKL A;  1DRO A;  1U27 A;  1GG3 A;  3ML4 A;  5HE0 A;  4HB2 B;  4YL8 A;  1W1D A;  4Z2M B;  2YT0 A;  4B6H A;  3ZDT A;  1FHW A;  2Z0O A;  2OTX A;  3X23 A;  1QC6 A;  1FGZ A;  2MKR A;  2X18 A;  2GCL A;  4P7I A;  3HQC A;  2UZR A;  5D3V A;  5EFX A;  2I5C A;  1Y5O A;  3D8F A;  2RSG A;  2LOX A;  1V61 A;  1DDW A;  3TW1 A;  4A5K A;  2K00 A;  1BTK A;  3DXE A;  2GS0 A;  2L2I A; 
#chains in the Genus database with same CATH topology
 1WVH A;  2AL6 A;  1X1F A;  5IRS A;  3ODW A;  1P3R A;  2COF A;  2P0F A;  1Z87 A;  1X05 A;  3F0W A;  1B55 A;  4A6F B;  4GOU A;  5D3X A;  1QQG A;  1LB1 A;  5J3Q A;  4TYZ A;  3TO1 A;  4XWX A;  4K2O A;  4D0N B;  5JHH A;  1E5W A;  3VOQ A;  3ZVR A;  2G35 A;  1AQC A;  2DN6 A;  1N3H A;  3U8Z A;  2CRF A;  1UPR A;  4DIX A;  1FB8 A;  2DKP A;  3ULB A;  4PNK A;  4YON A;  1V88 A;  2I5F A;  1FGY A;  3HW2 B;  1M7E A;  1V89 A;  2BCJ A;  2IYB A;  4GPT B;  1ZC4 B;  2Z0Q A;  2DYN A;  3HK0 A;  4ZRJ A;  4GNK B;  4HAZ B;  1IRS A;  4QJ3 B;  4MK0 A;  1WI1 A;  2KUQ A;  2D11 A;  1FOE A;  1XX0 A;  5FI1 A;  4GXB A;  1BAK A;  3D8E A;  2YS5 A;  4HAT B;  1KZG A;  1P5T A;  4ZRK A;  3PZD A;  1GC7 A;  2ELA A;  3KRW A;  2IFS A;  5DH9 B;  1I2H A;  2CY5 A;  5DHF B;  4MT7 A;  1MKE A;  2KIE A;  1SGH A;  5LOP B;  1EGX A;  2ROV A;  5D27 A;  4H8S A;  2HE7 A;  1ISN A;  1UPQ A;  5C79 A;  1WG7 A;  3F5R A;  2DTC A;  2RVB B;  3FEH A;  1W1H A;  4GMX B;  2I1J A;  3FSS A;  1ZSQ A;  2ROZ B;  4L1R A;  4ZRI A;  1SHC A;  2KIG A;  3DCX A;  4QJ5 B;  2NZ8 B;  2W2X D;  3G9W A;  2UVM A;  2COA A;  1K5G B;  1WGU A;  5HE2 A;  4CHJ A;  4GMV A;  1TXD A;  2H7D A;  4KHB A;  1H10 A;  1EF1 A;  2Y8G A;  4KAX B;  5C16 A;  1Q67 A;  2P0H A;  2Q13 A;  4HAX B;  4EKU A;  4WVF B;  4NSW A;  4K17 A;  2FJL A;  1NU2 A;  2J59 M;  2ZKM X;  1KI1 B;  2D4Q A;  5DI9 B;  2MDX A;  2D9Z A;  4EJN A;  1J19 A;  3SO6 A;  4PQ0 A;  3D8D A;  3CIK A;  3GYO A;  3BIN A;  2E2X A;  2Y7B A;  2LKO A;  1AWE A;  2RLO A;  5J3Y A;  4F7H A;  2RGN B;  3DXD A;  3M1I B;  1U29 A;  5KQ4 A;  4QJ4 B;  1U5G A;  5D3W A;  3A58 A;  2Z13 A;  1MIZ B;  2AEH A;  1RJ2 A;  4KVG B;  3FM8 C;  1MIX A;  3TCA A;  1EAZ A;  3U12 A;  4Y94 A;  1DDV A;  2XQN M;  1XCG A;  1DDM A;  1J0W A;  2VSZ A;  2YSZ A;  4GN1 A;  4Z2N A;  2K2J A;  1XR0 B;  1W1G A;  2RRF A;  3ODO A;  2Z4D A;  4DXA B;  2EC1 A;  1MI1 A;  4HDQ A;  2YF0 A;  1U2B A;  3IVF A;  5JHG A;  2HTH B;  1MK9 B;  1PMS A;  1UNP A;  1Y19 B;  3P7Z A;  1U5D A;  3QWM A;  2D10 A;  1K5D B;  2H7E A;  5D3Y A;  1T77 A;  1UEF A;  3SUZ A;  2YVC A;  1WGQ A;  2KCJ A;  1EVH A;  3MDB C;  5I2S A;  3V5W A;  1I7A A;  2DA0 A;  4F7G A;  3GYP A;  3AJ4 A;  4OSN A;  3FVC A;  1DBH A;  2NBV A;  2YS3 A;  3DXC A;  3SNH A;  1BWN A;  4CHM A;  3SV1 A;  2GUM A;  1ZYI A;  3NWF A;  5KQ1 A;  1V5P A;  2W2X C;  3RCP A;  2UZS A;  2VRW B;  2LG1 A;  5KCV A;  3A8P A;  2EJ8 A;  5FI0 A;  1ZC3 B;  3WYF B;  2QKM A;  4KHA A;  5J3T A;  4DBB A;  3MPX A;  1H4R A;  3LJU X;  1UNR A;  3VIA A;  3A8Q A;  1P6S A;  1X86 A;  1FAO A;  2GCJ A;  5CLQ B;  4NY0 A;  3QBV B;  2N23 A;  5JP4 A;  2ZPY A;  3CXB B;  3N7C A;  2LOZ A;  4EMO A;  3NWD A;  2EMS A;  1X1G A;  1UNQ A;  4D6W A;  5I2M A;  5LG4 B;  4C0A A;  4TKN A;  2YT1 A;  2KGX B;  2L1C A;  2RNR B;  1XKE A;  3AU4 A;  2R0D A;  4DX9 0;  2GJY A;  4WSF A;  1OQN A;  4HB4 B;  3AU5 A;  1ZM0 A;  4K81 A;  3PVL A;  2YT2 A;  4MY6 A;  2ADZ A;  2COD A;  4HB3 B;  4KHB B;  2D9W A;  2Z0P A;  1ZVR A;  2M14 A;  4K2P A;  1KZ7 A;  2LUL A;  3KZ1 A;  2PZ1 A;  5HE3 A;  2W2W A;  2MWN B;  2FJU B;  1WJ1 A;  1X11 A;  2CAY A;  2NMB A;  5C6R A;  2D9Y A;  4CYE A;  2LYD A;  1DYN A;  2DKQ A;  2R09 A;  4A6H A;  3BJI A;  5GOW B;  2MFQ A;  5C5B B;  3WA0 A;  2COC A;  2DHK A;  1U5F A;  2DX1 A;  5HE1 A;  2KUP A;  3UZT A;  2DHJ A;  1NI2 A;  3TFM A;  2N0Y A;  3OAN A;  2J0J A;  2P8V A;  3T06 A;  4HHV A;  4BBK A;  3SYX A;  5DHA B;  1OY2 A;  1WJM A;  1MK7 B;  2I1K A;  1PFJ A;  5CLL B;  1V5U A;  4HSI A;  3PP2 A;  1RRP B;  4HAW B;  3HIE A;  2VKI A;  4HAU B;  4F7U P;  1V5M A;  1OMW A;  5JLJ B;  2Y8F A;  1LW3 A;  1FHO A;  4CSQ A;  4A6F A;  3ULC A;  3O96 A;  2YRY A;  2DHI A;  1PLS A;  3OHM B;  3P6A A;  2P0D A;  3B77 A;  3PG7 A;  1TJ6 A;  3NWA A;  4WJ7 A;  5L81 A;  3PVU A;  4QXA B;  4KHO A;  1FHX A;  2Z59 A;  1NTY A;  3PVW A;  5LON B;  2D2Q A;  3NW8 A;  2OQB A;  3U7D A;  1U5E A;  2J0K A;  4HAV B;  1BTN A;  3KY9 A;  3KRX A;  2R2Y A;  4HDO A;  4HB0 B;  2DX5 A;  2M38 A;  4DX8 A;  4IAP A;  4A6K A;  2YS1 A;  1MAI A;  4IOY X;  4IFS A;  2V76 A;  2DYQ A;  3KSY A;  3ODX A;  2DLW A;  5M4Y B;  2D9X A;  4L6E A;  2K8E A;  1XOD A;  3HSA A;  4HAY B;  3A98 B;  2KR0 A;  1TQZ A;  3TVV A;  1NTV A;  2J0M A;  5DIF B;  2EMT A;  2RUK B;  2CY4 A;  3PEG A;  1GC6 A;  1M7R A;  1MPH A;  2ELB A;  3NSU A;  3PSC A;  1XD4 A;  4GZU A;  2D9V A;  2JP2 A;  2K2U A;  2DFK A;  5C5B A;  3QIJ A;  2QKL A;  1DRO A;  1U27 A;  1GG3 A;  3ML4 A;  5HE0 A;  4HB2 B;  4YL8 A;  1W1D A;  4Z2M B;  2YT0 A;  4B6H A;  3ZDT A;  1FHW A;  2K49 A;  2Z0O A;  2OTX A;  3X23 A;  1QC6 A;  1FGZ A;  2MKR A;  2X18 A;  2GCL A;  4OT1 A;  4P7I A;  3HQC A;  2UZR A;  5D3V A;  5EFX A;  2I5C A;  1Y5O A;  3D8F A;  2RSG A;  2LOX A;  1V61 A;  1DDW A;  3TW1 A;  4A5K A;  2K00 A;  1BTK A;  2Z14 A;  3DXE A;  2GS0 A;  2L2I A; 
#chains in the Genus database with same CATH homology
 1WVH A;  2AL6 A;  1X1F A;  3ODW A;  1P3R A;  2COF A;  2P0F A;  1Z87 A;  1X05 A;  3F0W A;  1B55 A;  4A6F B;  5D3X A;  1QQG A;  1LB1 A;  5J3Q A;  4TYZ A;  3TO1 A;  4XWX A;  4K2O A;  4D0N B;  5JHH A;  1E5W A;  3VOQ A;  3ZVR A;  2G35 A;  1AQC A;  2DN6 A;  1N3H A;  3U8Z A;  2CRF A;  1UPR A;  1FB8 A;  2DKP A;  3ULB A;  4PNK A;  4YON A;  1V88 A;  2I5F A;  1FGY A;  3HW2 B;  1M7E A;  1V89 A;  2BCJ A;  2IYB A;  4GPT B;  1ZC4 B;  2Z0Q A;  2DYN A;  3HK0 A;  4ZRJ A;  4HAZ B;  1IRS A;  4MK0 A;  1WI1 A;  2D11 A;  1FOE A;  1XX0 A;  5FI1 A;  4GXB A;  1BAK A;  3D8E A;  2YS5 A;  4HAT B;  1KZG A;  1P5T A;  4ZRK A;  3PZD A;  1GC7 A;  2ELA A;  3KRW A;  2IFS A;  5DH9 B;  1I2H A;  2CY5 A;  5DHF B;  4MT7 A;  1MKE A;  1SGH A;  5LOP B;  1EGX A;  2ROV A;  5D27 A;  4H8S A;  2HE7 A;  1ISN A;  1UPQ A;  5C79 A;  1WG7 A;  3F5R A;  2DTC A;  2RVB B;  3FEH A;  1W1H A;  4GMX B;  2I1J A;  3FSS A;  1ZSQ A;  2ROZ B;  4ZRI A;  1SHC A;  2NZ8 B;  2W2X D;  3G9W A;  2UVM A;  2COA A;  1K5G B;  1WGU A;  5HE2 A;  4CHJ A;  4GMV A;  1TXD A;  2H7D A;  1H10 A;  1EF1 A;  2Y8G A;  4KAX B;  5C16 A;  4HAX B;  1Q67 A;  2P0H A;  2Q13 A;  4EKU A;  4WVF B;  4NSW A;  4K17 A;  2FJL A;  1NU2 A;  2J59 M;  1KI1 B;  2D4Q A;  5DI9 B;  2MDX A;  2D9Z A;  4EJN A;  1J19 A;  3SO6 A;  4PQ0 A;  3D8D A;  3CIK A;  3GYO A;  3BIN A;  2E2X A;  2Y7B A;  2LKO A;  1AWE A;  2RLO A;  5J3Y A;  4F7H A;  2RGN B;  3DXD A;  3M1I B;  1U29 A;  5KQ4 A;  1U5G A;  5D3W A;  1MIZ B;  2AEH A;  1RJ2 A;  4KVG B;  3FM8 C;  1MIX A;  3TCA A;  1EAZ A;  4Y94 A;  1DDV A;  2XQN M;  1XCG A;  1DDM A;  1J0W A;  2VSZ A;  2YSZ A;  4GN1 A;  4Z2N A;  2K2J A;  1XR0 B;  1W1G A;  3ODO A;  4DXA B;  2EC1 A;  4HDQ A;  2YF0 A;  1U2B A;  3IVF A;  5JHG A;  2HTH B;  1MK9 B;  1PMS A;  1UNP A;  1Y19 B;  3P7Z A;  1U5D A;  3QWM A;  2D10 A;  1K5D B;  2H7E A;  5D3Y A;  1UEF A;  3SUZ A;  2YVC A;  1WGQ A;  2KCJ A;  1EVH A;  3MDB C;  3V5W A;  1I7A A;  2DA0 A;  4F7G A;  3GYP A;  3AJ4 A;  1DBH A;  2YS3 A;  3DXC A;  3SNH A;  1BWN A;  4CHM A;  3SV1 A;  5KQ1 A;  1V5P A;  2W2X C;  3RCP A;  2UZS A;  2VRW B;  2LG1 A;  5KCV A;  3A8P A;  2EJ8 A;  5FI0 A;  1ZC3 B;  3WYF B;  2QKM A;  4KHA A;  5J3T A;  4DBB A;  3MPX A;  1H4R A;  3LJU X;  1UNR A;  3VIA A;  3A8Q A;  1P6S A;  1X86 A;  1FAO A;  2GCJ A;  5CLQ B;  4NY0 A;  3QBV B;  2N23 A;  5JP4 A;  2ZPY A;  3CXB B;  3N7C A;  2LOZ A;  4EMO A;  2EMS A;  1X1G A;  1UNQ A;  4C0A A;  4TKN A;  2YT1 A;  2KGX B;  2L1C A;  2RNR B;  1XKE A;  3AU4 A;  2R0D A;  4DX9 0;  2GJY A;  4WSF A;  1OQN A;  4HB4 B;  3AU5 A;  1ZM0 A;  4K81 A;  3PVL A;  4MY6 A;  2ADZ A;  2COD A;  4HB3 B;  4KHB B;  2D9W A;  2Z0P A;  1ZVR A;  2M14 A;  4K2P A;  1KZ7 A;  2LUL A;  3KZ1 A;  2PZ1 A;  5HE3 A;  2W2W A;  2MWN B;  1WJ1 A;  1X11 A;  2CAY A;  2NMB A;  5C6R A;  2D9Y A;  4CYE A;  2LYD A;  1DYN A;  2DKQ A;  2R09 A;  4A6H A;  3BJI A;  5GOW B;  2MFQ A;  5C5B B;  3WA0 A;  2COC A;  2DHK A;  1U5F A;  2DX1 A;  5HE1 A;  2KUP A;  3UZT A;  2DHJ A;  1NI2 A;  3TFM A;  2N0Y A;  3OAN A;  2J0J A;  2P8V A;  3T06 A;  4HHV A;  4BBK A;  3SYX A;  5DHA B;  1OY2 A;  1WJM A;  1MK7 B;  2I1K A;  1PFJ A;  5CLL B;  1V5U A;  3PP2 A;  1RRP B;  4HAW B;  2VKI A;  4HAU B;  4F7U P;  1V5M A;  1OMW A;  5JLJ B;  2Y8F A;  1LW3 A;  1FHO A;  4A6F A;  3ULC A;  3O96 A;  2YRY A;  2DHI A;  1PLS A;  3P6A A;  2P0D A;  3PG7 A;  1TJ6 A;  4WJ7 A;  5L81 A;  3PVU A;  4KHO A;  1FHX A;  1NTY A;  3PVW A;  5LON B;  2D2Q A;  2OQB A;  3U7D A;  1U5E A;  2J0K A;  4HAV B;  1BTN A;  3KY9 A;  3KRX A;  4HB0 B;  4HDO A;  2DX5 A;  2M38 A;  4DX8 A;  4IAP A;  4A6K A;  2YS1 A;  1MAI A;  4IOY X;  4IFS A;  2V76 A;  2DYQ A;  3KSY A;  3ODX A;  2DLW A;  2D9X A;  4L6E A;  1XOD A;  4HAY B;  3A98 B;  3TVV A;  1TQZ A;  1NTV A;  2J0M A;  5DIF B;  2EMT A;  2RUK B;  2CY4 A;  3PEG A;  1GC6 A;  1M7R A;  1MPH A;  2ELB A;  3NSU A;  3PSC A;  1XD4 A;  4GZU A;  2D9V A;  2JP2 A;  2K2U A;  2DFK A;  5C5B A;  3QIJ A;  2QKL A;  1DRO A;  1U27 A;  1GG3 A;  3ML4 A;  5HE0 A;  4HB2 B;  4YL8 A;  1W1D A;  4Z2M B;  2YT0 A;  4B6H A;  3ZDT A;  1FHW A;  2Z0O A;  2OTX A;  3X23 A;  1QC6 A;  1FGZ A;  2MKR A;  2X18 A;  2GCL A;  4P7I A;  3HQC A;  2UZR A;  5D3V A;  5EFX A;  2I5C A;  1Y5O A;  3D8F A;  2RSG A;  2LOX A;  1V61 A;  1DDW A;  3TW1 A;  4A5K A;  2K00 A;  1BTK A;  3DXE A;  2GS0 A;  2L2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...