2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 7A
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
3TVVA 5LOPB 4CYEA 1XODA 3DXDA 2DFKA 3KRWA 1DROA 2LKOA 3A8QA 4HDOA 2Z0PA 2D2QA 2W2XD 1PMSA 5JP4A 2KGXB 3KY9A 1KZGA 1V5PA 2VSZA 2RSGA 2OTXA 2GCLA 1V61A 4Y94A 2L2IA 1X05A 3DXCA 3T06A 4DXAB 3BJIA 2MKRA 3ODXA 1GC7A 4IOYX 4A6FA 4F7HA 4EKUA 1UNRA 1Q67A 1ISNA 2ADZA 1W1DA 1ZC3B 4ZRIA 4ZRKA 3O96A 2K00A 4GMVA 2RGNB 2UZRA 4Z2MB 1J19A 4HAYB 5KCVA 1Z87A 2YS3A 1WVHA 1FHOA 2Z0QA 1FHWA 5D3VA 1ZC4B 4F7UP 1EGXA 2RVBB 5D3XA 2ELAA 3ODWA 3PVWA 2P0DA 2M38A 2Z0OA 1U5EA 2DYNA 4KHBB 4L6EA 2YT1A 1X1GA 4GZUA 4GN1A 1DDVA 2N23A 4GMXB 4KVGB 2OQBA 2CY4A 4K2OA 1DYNA 1WJMA 3BINA 4GPTB 1E5WA 4WSFA 4P7IA 1EF1A 1XR0B 4KHAA 4IAPA 2G35A 3HQCA 1DBHA 3PEGA 1IRSA 1M7EA 4NSWA 5KQ1A 1XCGA 3CIKA 3CXBB 2AL6A 2GCJA 3TW1A 2J0MA 3P6AA 4DX8A 3AU5A 1U27A 1RJ2A 1BWNA 3PSCA 1OMWA 5JHHA 4HAUB 4HB2B 4WVFB 3ZVRA 3IVFA 2D11A 2H7DA 3M1IB 5HE0A 1ZSQA 5C5BA 2P8VA 1QC6A 1P6SA 4PNKA 3HK0A 2D9XA 5DI9B 4Z2NA 2IYBA 1NTYA 2CODA 3KRXA 4MT7A 4B6HA 3FEHA 1V5UA 5C16A 1BAKA 2VKIA 3PZDA 5CLQB 1P3RA 1MAIA 2I5FA 1FOEA 1RRPB 2DHJA 2YT0A 2DA0A 4IFSA 4K2PA 2EC1A 4EMOA 4EJNA 1UPRA 2Y8FA 2I1JA 2DN6A 2BCJA 1NI2A 2HTHB 3G9WA 3GYPA 3TFMA 4HAWB 5HE1A 1TQZA 1WGUA 1X11A 3PVLA 4ZRJA 1XKEA 1UNPA 2NZ8B 1EAZA 2K2JA 2D9VA 2E2XA 1N3HA 2KCJA 4HHVA 4A5KA 2DKQA 2YVCA 4HAVB 1AWEA 3DXEA 3SV1A 1NU2A 4WJ7A 3F5RA 1FHXA 2RNRB 4H8SA 2D9ZA 2Y8GA 4DBBA 4HATB 1K5GB 2YS5A 1U2BA 5J3QA 3F0WA 1MK7B 1WGQA 2YS1A 1KZ7A 2N0YA 5FI1A 4NY0A 3QIJA 3NSUA 3SO6A 5KQ4A 1V88A 2V76A 2D10A 4A6HA 4C0AA 1BTNA 3PG7A 2DKPA 3VOQA 2J0JA 1I7AA 3PP2A 2IFSA 2NMBA 5DIFB 3FSSA 3RCPA 1WJ1A 2HE7A 1TJ6A 1BTKA 1PLSA 5C79A 2D9WA 5JHGA 1P5TA 1UPQA 4K81A 2CRFA 2EJ8A 3KSYA 2COCA 1EVHA 5LONB 4YL8A 3ML4A 3SYXA 1V89A 4DX90 2DX1A 2K2UA 1DDMA 1H10A 2W2WA 3VIAA 1U5GA 1FGYA 2RUKB 2CAYA 1U5DA 1LW3A 2I5CA 2UZSA 3ZDTA 3WYFB 2R0DA 1W1HA 2DLWA 1FB8A 2L1CA 2GJYA 4HAXB 3GYOA 3AU4A 1MIZB 5C5BB 1V5MA 3V5WA 5DHAB 2CY5A 1GC6A 4GXBA 2W2XC 2D4QA 2EMSA 1W1GA 1U5FA 4HB3B 4CHJA 2DYQA 4HB4B 2M14A 2J0KA 3QBVB 1OQNA 1X1FA 2YSZA 4HB0B 1Y19B 1MIXA 1GG3A 1X86A 1K5DB 2MWNB 2COAA 4YONA 1MK9B 5DHFB 2UVMA 1ZVRA 2LYDA 1SHCA 4KAXB 2EMTA 2LG1A 1FGZA 3D8FA 1I2HA 2COFA 2DX5A 2ROZB 1WG7A 2DTCA 5D3YA 4K17A 4A6FB 4A6KA 5JLJB 1B55A 1XX0A 1ZM0A 5FI0A 3N7CA 3A8PA 2P0FA 2J59M 3QWMA 1M7RA 2D9YA 2P0HA 1MKEA 5J3YA 3UZTA 2DHIA 2ZPYA 5CLLB 3KZ1A 1FAOA 2R09A 3ULCA 1DDWA 1XD4A 1QQGA 2YF0A 1AQCA 4D0NB 2XQNM 3SNHA 1OY2A 4BBKA 1WI1A 1UNQA 3LJUX 1LB1A 1PFJA 5C6RA 2LOZA 4F7GA 2I1KA 2JP2A 4TKNA 3D8EA 3MPXA 3X23A 4MK0A 5J3TA 4KHOA 3WA0A 4PQ0A 5D3WA 3OANA 1NTVA 1SGHA 1KI1B 3AJ4A 3FM8C 1J0WA 2H7EA 2KUPA 2DHKA 3PVUA 3ULBA 2AEHA 4HDQA 3U7DA 2VRWB 5D27A 3D8DA 2RLOA 3A98B 3TCAA 2Y7BA 2PZ1A 2ROVA 3HW2B 5GOWB 1U29A 2ELBA 4XWXA 1UEFA 4TYZA 5HE3A 5L81A 1Y5OA 2X18A 4MY6A 2FJLA 4CHMA 3MDBC 2QKLA 3U8ZA 2MFQA 1MPHA 1TXDA 2GS0A 2LOXA 3ODOA 1H4RA 3SUZA 3P7ZA 2YRYA 5EFXA 2QKMA 5DH9B 2MDXA 4HAZB 2Q13A 3TO1A 5HE2A 2LULA
chains in the Genus database with same CATH superfamily
3TVVA 3NW8A 5LOPB 4CYEA 1XODA 3DXDA 2Z14A 2DFKA 3KRWA 1DROA 2LKOA 3A8QA 4HDOA 2ZKMX 2Z0PA 2D2QA 2W2XD 1PMSA 3NWAA 5JP4A 2KGXB 3KY9A 1KZGA 1V5PA 2VSZA 2GUMA 2RSGA 2OTXA 2GCLA 1V61A 4Y94A 2L2IA 1X05A 3DXCA 3T06A 4DXAB 3BJIA 2MKRA 3ODXA 1GC7A 4IOYX 4A6FA 4F7HA 4EKUA 1UNRA 1Q67A 1ISNA 2ADZA 1W1DA 1ZC3B 4ZRIA 4ZRKA 3O96A 2K00A 4GMVA 2RGNB 2UZRA 4Z2MB 1J19A 4HAYB 5KCVA 1Z87A 2YS3A 1WVHA 1FHOA 2Z0QA 1FHWA 5D3VA 1ZC4B 4F7UP 1EGXA 2RVBB 5D3XA 2ELAA 3ODWA 3PVWA 2P0DA 2M38A 2Z0OA 3NWFA 1U5EA 2DYNA 4KHBB 2NBVA 4L6EA 2YT1A 1X1GA 4GZUA 4GN1A 4OT1A 1DDVA 2N23A 4GMXB 4KVGB 2OQBA 4HSIA 2CY4A 4K2OA 4QJ5B 1DYNA 1WJMA 3BINA 4GPTB 1E5WA 4WSFA 5I2MA 2Z13A 4P7IA 1EF1A 1XR0B 4KHAA 4IAPA 2G35A 3HQCA 1DBHA 3PEGA 5IRSA 1IRSA 1M7EA 4NSWA 5KQ1A 3OHMB 1XCGA 3CIKA 3CXBB 2AL6A 2GCJA 3TW1A 2J0MA 3P6AA 4DX8A 2KR0A 3AU5A 1U27A 4QJ3B 1RJ2A 1BWNA 3PSCA 4L1RA 1OMWA 5JHHA 4HAUB 4HB2B 4WVFB 3ZVRA 3IVFA 2D11A 2H7DA 3M1IB 5HE0A 1ZSQA 5C5BA 2KIEA 2P8VA 1QC6A 2Z4DA 1P6SA 4PNKA 3HK0A 2D9XA 5DI9B 4Z2NA 2IYBA 1NTYA 2CODA 3KRXA 4MT7A 4B6HA 2RRFA 3FEHA 1V5UA 5C16A 1BAKA 2VKIA 3PZDA 5CLQB 3FVCA 1P3RA 1MAIA 2I5FA 1FOEA 3DCXA 1RRPB 2DHJA 2YT0A 2DA0A 4IFSA 4K2PA 2EC1A 4EMOA 3B77A 4EJNA 1UPRA 2Y8FA 2I1JA 2DN6A 2K49A 2BCJA 1NI2A 2HTHB 3G9WA 3GYPA 3TFMA 4HAWB 5HE1A 1TQZA 1WGUA 1X11A 3PVLA 4ZRJA 1XKEA 1UNPA 2NZ8B 4QJ4B 1EAZA 2K2JA 2D9VA 2E2XA 1N3HA 2KCJA 4HHVA 4A5KA 2DKQA 2YVCA 4HAVB 1AWEA 3DXEA 3SV1A 1NU2A 4WJ7A 3F5RA 1FHXA 2RNRB 4H8SA 1ZYIA 2D9ZA 2Y8GA 4QXAB 2FJUB 4DBBA 1T77A 4HATB 1K5GB 2YS5A 1U2BA 5J3QA 3F0WA 1MK7B 1WGQA 2YS1A 1KZ7A 2N0YA 5FI1A 4NY0A 3QIJA 3NSUA 3SO6A 5KQ4A 1V88A 2V76A 2D10A 4A6HA 4C0AA 1BTNA 3PG7A 2DKPA 3VOQA 2J0JA 1I7AA 3PP2A 2IFSA 2NMBA 5DIFB 3FSSA 3RCPA 1WJ1A 2HE7A 1TJ6A 1BTKA 1PLSA 5C79A 2D9WA 5JHGA 1P5TA 1UPQA 4K81A 2CRFA 2EJ8A 3KSYA 2COCA 1EVHA 5LONB 4YL8A 3ML4A 3SYXA 1V89A 4DX90 2DX1A 2K2UA 1DDMA 2Z59A 1H10A 2W2WA 3VIAA 1U5GA 1FGYA 2RUKB 2CAYA 1U5DA 1LW3A 2I5CA 2UZSA 3A58A 3ZDTA 3WYFB 2R0DA 1W1HA 2DLWA 1FB8A 2KUQA 2L1CA 2GJYA 4HAXB 3GYOA 3AU4A 4DIXA 1MIZB 3NWDA 5C5BB 1V5MA 3V5WA 5DHAB 4CSQA 2CY5A 1GC6A 4GXBA 2W2XC 4OSNA 2D4QA 2EMSA 1W1GA 1U5FA 4HB3B 4CHJA 4GNKB 2DYQA 4HB4B 2M14A 2J0KA 3QBVB 1OQNA 1X1FA 2YSZA 4HB0B 1Y19B 1MIXA 1GG3A 1X86A 1K5DB 2MWNB 2COAA 4YONA 1MK9B 5DHFB 2UVMA 1ZVRA 2LYDA 1SHCA 4KAXB 2EMTA 2LG1A 4D6WA 1FGZA 3D8FA 1I2HA 2COFA 2DX5A 2ROZB 1WG7A 2DTCA 5D3YA 4K17A 4A6FB 4A6KA 5JLJB 1B55A 1XX0A 1ZM0A 5FI0A 3A8PA 3N7CA 2P0FA 2J59M 3QWMA 1M7RA 2D9YA 2P0HA 1MKEA 5J3YA 3UZTA 2DHIA 2ZPYA 5CLLB 3KZ1A 1FAOA 2R09A 5I2SA 3ULCA 1DDWA 1XD4A 4GOUA 1QQGA 2YF0A 1AQCA 3HIEA 2XQNM 4D0NB 3SNHA 1OY2A 4BBKA 1WI1A 1UNQA 3LJUX 1LB1A 1PFJA 5C6RA 2LOZA 4F7GA 4KHBA 2I1KA 2JP2A 4TKNA 3D8EA 3MPXA 3X23A 4MK0A 5J3TA 5LG4B 4KHOA 3WA0A 4PQ0A 5D3WA 3OANA 1NTVA 1SGHA 1KI1B 3AJ4A 2K8EA 1J0WA 2H7EA 2KUPA 2DHKA 3FM8C 3PVUA 3ULBA 2AEHA 4HDQA 3U7DA 2VRWB 5D27A 3D8DA 2RLOA 3A98B 3TCAA 2Y7BA 2PZ1A 2ROVA 3HW2B 2R2YA 2YT2A 5GOWB 1U29A 2ELBA 4XWXA 1UEFA 4TYZA 5HE3A 5L81A 1Y5OA 2X18A 1MI1A 2FJLA 4MY6A 4CHMA 3MDBC 2QKLA 3U8ZA 2MFQA 5M4YB 1MPHA 1TXDA 2GS0A 2LOXA 3ODOA 1H4RA 3SUZA 3P7ZA 2YRYA 3HSAA 2QKMA 5EFXA 3U12A 5DH9B 2MDXA 4HAZB 2Q13A 3TO1A 5HE2A 2LULA 2KIGA
chains in the Genus database with same CATH topology
3TVVA 5LOPB 4CYEA 1XODA 3DXDA 2DFKA 3KRWA 1DROA 2LKOA 3A8QA 4HDOA 2Z0PA 2D2QA 2W2XD 1PMSA 5JP4A 2KGXB 3KY9A 1KZGA 1V5PA 2VSZA 2RSGA 2OTXA 2GCLA 1V61A 4Y94A 2L2IA 1X05A 3DXCA 3T06A 4DXAB 3BJIA 2MKRA 3ODXA 1GC7A 4IOYX 4A6FA 4F7HA 4EKUA 1UNRA 1Q67A 1ISNA 2ADZA 1W1DA 1ZC3B 4ZRIA 4ZRKA 3O96A 2K00A 4GMVA 2RGNB 2UZRA 4Z2MB 1J19A 4HAYB 5KCVA 1Z87A 2YS3A 1WVHA 1FHOA 2Z0QA 1FHWA 5D3VA 1ZC4B 4F7UP 1EGXA 2RVBB 5D3XA 2ELAA 3ODWA 3PVWA 2P0DA 2M38A 2Z0OA 1U5EA 2DYNA 4KHBB 4L6EA 2YT1A 1X1GA 4GZUA 4GN1A 1DDVA 2N23A 4GMXB 4KVGB 2OQBA 2CY4A 4K2OA 1DYNA 1WJMA 3BINA 4GPTB 1E5WA 4WSFA 4P7IA 1EF1A 1XR0B 4KHAA 4IAPA 2G35A 3HQCA 1DBHA 3PEGA 1IRSA 1M7EA 4NSWA 5KQ1A 1XCGA 3CIKA 3CXBB 2AL6A 2GCJA 3TW1A 2J0MA 3P6AA 4DX8A 3AU5A 1U27A 1RJ2A 1BWNA 3PSCA 1OMWA 5JHHA 4HAUB 4HB2B 4WVFB 3ZVRA 3IVFA 2D11A 2H7DA 3M1IB 5HE0A 1ZSQA 5C5BA 2P8VA 1QC6A 1P6SA 4PNKA 3HK0A 2D9XA 5DI9B 4Z2NA 2IYBA 1NTYA 2CODA 3KRXA 4MT7A 4B6HA 3FEHA 1V5UA 5C16A 1BAKA 2VKIA 3PZDA 5CLQB 1P3RA 1MAIA 2I5FA 1FOEA 1RRPB 2DHJA 2YT0A 2DA0A 4IFSA 4K2PA 2EC1A 4EMOA 4EJNA 1UPRA 2Y8FA 2I1JA 2DN6A 2BCJA 1NI2A 2HTHB 3G9WA 3GYPA 3TFMA 4HAWB 5HE1A 1TQZA 1WGUA 1X11A 3PVLA 4ZRJA 1XKEA 1UNPA 2NZ8B 1EAZA 2K2JA 2D9VA 2E2XA 1N3HA 2KCJA 4HHVA 4A5KA 2DKQA 2YVCA 4HAVB 1AWEA 3DXEA 3SV1A 1NU2A 4WJ7A 3F5RA 1FHXA 2RNRB 4H8SA 2D9ZA 2Y8GA 4DBBA 4HATB 1K5GB 2YS5A 1U2BA 5J3QA 3F0WA 1MK7B 1WGQA 2YS1A 1KZ7A 2N0YA 5FI1A 4NY0A 3QIJA 3NSUA 3SO6A 5KQ4A 1V88A 2V76A 2D10A 4A6HA 4C0AA 1BTNA 3PG7A 2DKPA 3VOQA 2J0JA 1I7AA 3PP2A 2IFSA 2NMBA 5DIFB 3FSSA 3RCPA 1WJ1A 2HE7A 1TJ6A 1BTKA 1PLSA 5C79A 2D9WA 5JHGA 1P5TA 1UPQA 4K81A 2CRFA 2EJ8A 3KSYA 2COCA 1EVHA 5LONB 4YL8A 3ML4A 3SYXA 1V89A 4DX90 2DX1A 2K2UA 1DDMA 1H10A 2W2WA 3VIAA 1U5GA 1FGYA 2RUKB 2CAYA 1U5DA 1LW3A 2I5CA 2UZSA 3ZDTA 3WYFB 2R0DA 1W1HA 2DLWA 1FB8A 2L1CA 2GJYA 4HAXB 3GYOA 3AU4A 1MIZB 5C5BB 1V5MA 3V5WA 5DHAB 2CY5A 1GC6A 4GXBA 2W2XC 2D4QA 2EMSA 1W1GA 1U5FA 4HB3B 4CHJA 2DYQA 4HB4B 2M14A 2J0KA 3QBVB 1OQNA 1X1FA 2YSZA 4HB0B 1Y19B 1MIXA 1GG3A 1X86A 1K5DB 2MWNB 2COAA 4YONA 1MK9B 5DHFB 2UVMA 1ZVRA 2LYDA 1SHCA 4KAXB 2EMTA 2LG1A 1FGZA 3D8FA 1I2HA 2COFA 2DX5A 2ROZB 1WG7A 2DTCA 5D3YA 4K17A 4A6FB 4A6KA 5JLJB 1B55A 1XX0A 1ZM0A 5FI0A 3N7CA 3A8PA 2P0FA 2J59M 3QWMA 1M7RA 2D9YA 2P0HA 1MKEA 5J3YA 3UZTA 2DHIA 2ZPYA 5CLLB 3KZ1A 1FAOA 2R09A 3ULCA 1DDWA 1XD4A 1QQGA 2YF0A 1AQCA 4D0NB 2XQNM 3SNHA 1OY2A 4BBKA 1WI1A 1UNQA 3LJUX 1LB1A 1PFJA 5C6RA 2LOZA 4F7GA 2I1KA 2JP2A 4TKNA 3D8EA 3MPXA 3X23A 4MK0A 5J3TA 4KHOA 3WA0A 4PQ0A 5D3WA 3OANA 1NTVA 1SGHA 1KI1B 3AJ4A 3FM8C 1J0WA 2H7EA 2KUPA 2DHKA 3PVUA 3ULBA 2AEHA 4HDQA 3U7DA 2VRWB 5D27A 3D8DA 2RLOA 3A98B 3TCAA 2Y7BA 2PZ1A 2ROVA 3HW2B 5GOWB 1U29A 2ELBA 4XWXA 1UEFA 4TYZA 5HE3A 5L81A 1Y5OA 2X18A 4MY6A 2FJLA 4CHMA 3MDBC 2QKLA 3U8ZA 2MFQA 1MPHA 1TXDA 2GS0A 2LOXA 3ODOA 1H4RA 3SUZA 3P7ZA 2YRYA 5EFXA 2QKMA 5DH9B 2MDXA 4HAZB 2Q13A 3TO1A 5HE2A 2LULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVV A;  5LOP B;  4CYE A;  1XOD A;  3DXD A;  2DFK A;  3KRW A;  1DRO A;  2LKO A;  3A8Q A;  4HDO A;  2Z0P A;  2D2Q A;  2W2X D;  1PMS A;  5JP4 A;  2KGX B;  3KY9 A;  1KZG A;  1V5P A;  2VSZ A;  2RSG A;  2OTX A;  2GCL A;  1V61 A;  4Y94 A;  2L2I A;  1X05 A;  3DXC A;  3T06 A;  4DXA B;  3BJI A;  2MKR A;  3ODX A;  1GC7 A;  4IOY X;  4A6F A;  4F7H A;  4EKU A;  1UNR A;  1Q67 A;  1ISN A;  2ADZ A;  1W1D A;  1ZC3 B;  4ZRI A;  4ZRK A;  3O96 A;  2K00 A;  4GMV A;  2RGN B;  2UZR A;  4Z2M B;  1J19 A;  4HAY B;  5KCV A;  1Z87 A;  2YS3 A;  1WVH A;  1FHO A;  2Z0Q A;  1FHW A;  5D3V A;  1ZC4 B;  4F7U P;  1EGX A;  2RVB B;  5D3X A;  2ELA A;  3ODW A;  3PVW A;  2P0D A;  2M38 A;  2Z0O A;  1U5E A;  2DYN A;  4KHB B;  4L6E A;  2YT1 A;  1X1G A;  4GZU A;  4GN1 A;  1DDV A;  2N23 A;  4GMX B;  4KVG B;  2OQB A;  2CY4 A;  4K2O A;  1DYN A;  1WJM A;  3BIN A;  4GPT B;  1E5W A;  4WSF A;  4P7I A;  1EF1 A;  1XR0 B;  4KHA A;  4IAP A;  2G35 A;  3HQC A;  1DBH A;  3PEG A;  1IRS A;  1M7E A;  4NSW A;  5KQ1 A;  1XCG A;  3CIK A;  3CXB B;  2AL6 A;  2GCJ A;  3TW1 A;  2J0M A;  3P6A A;  4DX8 A;  3AU5 A;  1U27 A;  1RJ2 A;  1BWN A;  3PSC A;  1OMW A;  5JHH A;  4HAU B;  4HB2 B;  4WVF B;  3ZVR A;  3IVF A;  2D11 A;  2H7D A;  3M1I B;  5HE0 A;  1ZSQ A;  5C5B A;  2P8V A;  1QC6 A;  1P6S A;  4PNK A;  3HK0 A;  2D9X A;  5DI9 B;  4Z2N A;  2IYB A;  1NTY A;  2COD A;  3KRX A;  4MT7 A;  4B6H A;  3FEH A;  1V5U A;  5C16 A;  1BAK A;  2VKI A;  3PZD A;  5CLQ B;  1P3R A;  1MAI A;  2I5F A;  1FOE A;  1RRP B;  2DHJ A;  2YT0 A;  2DA0 A;  4IFS A;  4K2P A;  2EC1 A;  4EMO A;  4EJN A;  1UPR A;  2Y8F A;  2I1J A;  2DN6 A;  2BCJ A;  1NI2 A;  2HTH B;  3G9W A;  3GYP A;  3TFM A;  4HAW B;  5HE1 A;  1TQZ A;  1WGU A;  1X11 A;  3PVL A;  4ZRJ A;  1XKE A;  1UNP A;  2NZ8 B;  1EAZ A;  2K2J A;  2D9V A;  2E2X A;  1N3H A;  2KCJ A;  4HHV A;  4A5K A;  2DKQ A;  2YVC A;  4HAV B;  1AWE A;  3DXE A;  3SV1 A;  1NU2 A;  4WJ7 A;  3F5R A;  1FHX A;  2RNR B;  4H8S A;  2D9Z A;  2Y8G A;  4DBB A;  4HAT B;  1K5G B;  2YS5 A;  1U2B A;  5J3Q A;  3F0W A;  1MK7 B;  1WGQ A;  2YS1 A;  1KZ7 A;  2N0Y A;  5FI1 A;  4NY0 A;  3QIJ A;  3NSU A;  3SO6 A;  5KQ4 A;  1V88 A;  2V76 A;  2D10 A;  4A6H A;  4C0A A;  1BTN A;  3PG7 A;  2DKP A;  3VOQ A;  2J0J A;  1I7A A;  3PP2 A;  2IFS A;  2NMB A;  5DIF B;  3FSS A;  3RCP A;  1WJ1 A;  2HE7 A;  1TJ6 A;  1BTK A;  1PLS A;  5C79 A;  2D9W A;  5JHG A;  1P5T A;  1UPQ A;  4K81 A;  2CRF A;  2EJ8 A;  3KSY A;  2COC A;  1EVH A;  5LON B;  4YL8 A;  3ML4 A;  3SYX A;  1V89 A;  4DX9 0;  2DX1 A;  2K2U A;  1DDM A;  1H10 A;  2W2W A;  3VIA A;  1U5G A;  1FGY A;  2RUK B;  2CAY A;  1U5D A;  1LW3 A;  2I5C A;  2UZS A;  3ZDT A;  3WYF B;  2R0D A;  1W1H A;  2DLW A;  1FB8 A;  2L1C A;  2GJY A;  4HAX B;  3GYO A;  3AU4 A;  1MIZ B;  5C5B B;  1V5M A;  3V5W A;  5DHA B;  2CY5 A;  1GC6 A;  4GXB A;  2W2X C;  2D4Q A;  2EMS A;  1W1G A;  1U5F A;  4HB3 B;  4CHJ A;  2DYQ A;  4HB4 B;  2M14 A;  2J0K A;  3QBV B;  1OQN A;  1X1F A;  2YSZ A;  4HB0 B;  1Y19 B;  1MIX A;  1GG3 A;  1X86 A;  1K5D B;  2MWN B;  2COA A;  4YON A;  1MK9 B;  5DHF B;  2UVM A;  1ZVR A;  2LYD A;  1SHC A;  4KAX B;  2EMT A;  2LG1 A;  1FGZ A;  3D8F A;  1I2H A;  2COF A;  2DX5 A;  2ROZ B;  1WG7 A;  2DTC A;  5D3Y A;  4K17 A;  4A6F B;  4A6K A;  5JLJ B;  1B55 A;  1XX0 A;  1ZM0 A;  5FI0 A;  3N7C A;  3A8P A;  2P0F A;  2J59 M;  3QWM A;  1M7R A;  2D9Y A;  2P0H A;  1MKE A;  5J3Y A;  3UZT A;  2DHI A;  2ZPY A;  5CLL B;  3KZ1 A;  1FAO A;  2R09 A;  3ULC A;  1DDW A;  1XD4 A;  1QQG A;  2YF0 A;  1AQC A;  4D0N B;  2XQN M;  3SNH A;  1OY2 A;  4BBK A;  1WI1 A;  1UNQ A;  3LJU X;  1LB1 A;  1PFJ A;  5C6R A;  2LOZ A;  4F7G A;  2I1K A;  2JP2 A;  4TKN A;  3D8E A;  3MPX A;  3X23 A;  4MK0 A;  5J3T A;  4KHO A;  3WA0 A;  4PQ0 A;  5D3W A;  3OAN A;  1NTV A;  1SGH A;  1KI1 B;  3AJ4 A;  3FM8 C;  1J0W A;  2H7E A;  2KUP A;  2DHK A;  3PVU A;  3ULB A;  2AEH A;  4HDQ A;  3U7D A;  2VRW B;  5D27 A;  3D8D A;  2RLO A;  3A98 B;  3TCA A;  2Y7B A;  2PZ1 A;  2ROV A;  3HW2 B;  5GOW B;  1U29 A;  2ELB A;  4XWX A;  1UEF A;  4TYZ A;  5HE3 A;  5L81 A;  1Y5O A;  2X18 A;  4MY6 A;  2FJL A;  4CHM A;  3MDB C;  2QKL A;  3U8Z A;  2MFQ A;  1MPH A;  1TXD A;  2GS0 A;  2LOX A;  3ODO A;  1H4R A;  3SUZ A;  3P7Z A;  2YRY A;  5EFX A;  2QKM A;  5DH9 B;  2MDX A;  4HAZ B;  2Q13 A;  3TO1 A;  5HE2 A;  2LUL A; 
#chains in the Genus database with same CATH topology
 3TVV A;  3NW8 A;  5LOP B;  4CYE A;  1XOD A;  3DXD A;  2Z14 A;  2DFK A;  3KRW A;  1DRO A;  2LKO A;  3A8Q A;  4HDO A;  2ZKM X;  2Z0P A;  2D2Q A;  2W2X D;  1PMS A;  3NWA A;  5JP4 A;  2KGX B;  3KY9 A;  1KZG A;  1V5P A;  2VSZ A;  2GUM A;  2RSG A;  2OTX A;  2GCL A;  1V61 A;  4Y94 A;  2L2I A;  1X05 A;  3DXC A;  3T06 A;  4DXA B;  3BJI A;  2MKR A;  3ODX A;  1GC7 A;  4IOY X;  4A6F A;  4F7H A;  4EKU A;  1UNR A;  1Q67 A;  1ISN A;  2ADZ A;  1W1D A;  1ZC3 B;  4ZRI A;  4ZRK A;  3O96 A;  2K00 A;  4GMV A;  2RGN B;  2UZR A;  4Z2M B;  1J19 A;  4HAY B;  5KCV A;  1Z87 A;  2YS3 A;  1WVH A;  1FHO A;  2Z0Q A;  1FHW A;  5D3V A;  1ZC4 B;  4F7U P;  1EGX A;  2RVB B;  5D3X A;  2ELA A;  3ODW A;  3PVW A;  2P0D A;  2M38 A;  2Z0O A;  3NWF A;  1U5E A;  2DYN A;  4KHB B;  2NBV A;  4L6E A;  2YT1 A;  1X1G A;  4GZU A;  4GN1 A;  4OT1 A;  1DDV A;  2N23 A;  4GMX B;  4KVG B;  2OQB A;  4HSI A;  2CY4 A;  4K2O A;  4QJ5 B;  1DYN A;  1WJM A;  3BIN A;  4GPT B;  1E5W A;  4WSF A;  5I2M A;  2Z13 A;  4P7I A;  1EF1 A;  1XR0 B;  4KHA A;  4IAP A;  2G35 A;  3HQC A;  1DBH A;  3PEG A;  5IRS A;  1IRS A;  1M7E A;  4NSW A;  5KQ1 A;  3OHM B;  1XCG A;  3CIK A;  3CXB B;  2AL6 A;  2GCJ A;  3TW1 A;  2J0M A;  3P6A A;  4DX8 A;  2KR0 A;  3AU5 A;  1U27 A;  4QJ3 B;  1RJ2 A;  1BWN A;  3PSC A;  4L1R A;  1OMW A;  5JHH A;  4HAU B;  4HB2 B;  4WVF B;  3ZVR A;  3IVF A;  2D11 A;  2H7D A;  3M1I B;  5HE0 A;  1ZSQ A;  5C5B A;  2KIE A;  2P8V A;  1QC6 A;  2Z4D A;  1P6S A;  4PNK A;  3HK0 A;  2D9X A;  5DI9 B;  4Z2N A;  2IYB A;  1NTY A;  2COD A;  3KRX A;  4MT7 A;  4B6H A;  2RRF A;  3FEH A;  1V5U A;  5C16 A;  1BAK A;  2VKI A;  3PZD A;  5CLQ B;  3FVC A;  1P3R A;  1MAI A;  2I5F A;  1FOE A;  3DCX A;  1RRP B;  2DHJ A;  2YT0 A;  2DA0 A;  4IFS A;  4K2P A;  2EC1 A;  4EMO A;  3B77 A;  4EJN A;  1UPR A;  2Y8F A;  2I1J A;  2DN6 A;  2K49 A;  2BCJ A;  1NI2 A;  2HTH B;  3G9W A;  3GYP A;  3TFM A;  4HAW B;  5HE1 A;  1TQZ A;  1WGU A;  1X11 A;  3PVL A;  4ZRJ A;  1XKE A;  1UNP A;  2NZ8 B;  4QJ4 B;  1EAZ A;  2K2J A;  2D9V A;  2E2X A;  1N3H A;  2KCJ A;  4HHV A;  4A5K A;  2DKQ A;  2YVC A;  4HAV B;  1AWE A;  3DXE A;  3SV1 A;  1NU2 A;  4WJ7 A;  3F5R A;  1FHX A;  2RNR B;  4H8S A;  1ZYI A;  2D9Z A;  2Y8G A;  4QXA B;  2FJU B;  4DBB A;  1T77 A;  4HAT B;  1K5G B;  2YS5 A;  1U2B A;  5J3Q A;  3F0W A;  1MK7 B;  1WGQ A;  2YS1 A;  1KZ7 A;  2N0Y A;  5FI1 A;  4NY0 A;  3QIJ A;  3NSU A;  3SO6 A;  5KQ4 A;  1V88 A;  2V76 A;  2D10 A;  4A6H A;  4C0A A;  1BTN A;  3PG7 A;  2DKP A;  3VOQ A;  2J0J A;  1I7A A;  3PP2 A;  2IFS A;  2NMB A;  5DIF B;  3FSS A;  3RCP A;  1WJ1 A;  2HE7 A;  1TJ6 A;  1BTK A;  1PLS A;  5C79 A;  2D9W A;  5JHG A;  1P5T A;  1UPQ A;  4K81 A;  2CRF A;  2EJ8 A;  3KSY A;  2COC A;  1EVH A;  5LON B;  4YL8 A;  3ML4 A;  3SYX A;  1V89 A;  4DX9 0;  2DX1 A;  2K2U A;  1DDM A;  2Z59 A;  1H10 A;  2W2W A;  3VIA A;  1U5G A;  1FGY A;  2RUK B;  2CAY A;  1U5D A;  1LW3 A;  2I5C A;  2UZS A;  3A58 A;  3ZDT A;  3WYF B;  2R0D A;  1W1H A;  2DLW A;  1FB8 A;  2KUQ A;  2L1C A;  2GJY A;  4HAX B;  3GYO A;  3AU4 A;  4DIX A;  1MIZ B;  3NWD A;  5C5B B;  1V5M A;  3V5W A;  5DHA B;  4CSQ A;  2CY5 A;  1GC6 A;  4GXB A;  2W2X C;  4OSN A;  2D4Q A;  2EMS A;  1W1G A;  1U5F A;  4HB3 B;  4CHJ A;  4GNK B;  2DYQ A;  4HB4 B;  2M14 A;  2J0K A;  3QBV B;  1OQN A;  1X1F A;  2YSZ A;  4HB0 B;  1Y19 B;  1MIX A;  1GG3 A;  1X86 A;  1K5D B;  2MWN B;  2COA A;  4YON A;  1MK9 B;  5DHF B;  2UVM A;  1ZVR A;  2LYD A;  1SHC A;  4KAX B;  2EMT A;  2LG1 A;  4D6W A;  1FGZ A;  3D8F A;  1I2H A;  2COF A;  2DX5 A;  2ROZ B;  1WG7 A;  2DTC A;  5D3Y A;  4K17 A;  4A6F B;  4A6K A;  5JLJ B;  1B55 A;  1XX0 A;  1ZM0 A;  5FI0 A;  3A8P A;  3N7C A;  2P0F A;  2J59 M;  3QWM A;  1M7R A;  2D9Y A;  2P0H A;  1MKE A;  5J3Y A;  3UZT A;  2DHI A;  2ZPY A;  5CLL B;  3KZ1 A;  1FAO A;  2R09 A;  5I2S A;  3ULC A;  1DDW A;  1XD4 A;  4GOU A;  1QQG A;  2YF0 A;  1AQC A;  3HIE A;  2XQN M;  4D0N B;  3SNH A;  1OY2 A;  4BBK A;  1WI1 A;  1UNQ A;  3LJU X;  1LB1 A;  1PFJ A;  5C6R A;  2LOZ A;  4F7G A;  4KHB A;  2I1K A;  2JP2 A;  4TKN A;  3D8E A;  3MPX A;  3X23 A;  4MK0 A;  5J3T A;  5LG4 B;  4KHO A;  3WA0 A;  4PQ0 A;  5D3W A;  3OAN A;  1NTV A;  1SGH A;  1KI1 B;  3AJ4 A;  2K8E A;  1J0W A;  2H7E A;  2KUP A;  2DHK A;  3FM8 C;  3PVU A;  3ULB A;  2AEH A;  4HDQ A;  3U7D A;  2VRW B;  5D27 A;  3D8D A;  2RLO A;  3A98 B;  3TCA A;  2Y7B A;  2PZ1 A;  2ROV A;  3HW2 B;  2R2Y A;  2YT2 A;  5GOW B;  1U29 A;  2ELB A;  4XWX A;  1UEF A;  4TYZ A;  5HE3 A;  5L81 A;  1Y5O A;  2X18 A;  1MI1 A;  2FJL A;  4MY6 A;  4CHM A;  3MDB C;  2QKL A;  3U8Z A;  2MFQ A;  5M4Y B;  1MPH A;  1TXD A;  2GS0 A;  2LOX A;  3ODO A;  1H4R A;  3SUZ A;  3P7Z A;  2YRY A;  3HSA A;  2QKM A;  5EFX A;  3U12 A;  5DH9 B;  2MDX A;  4HAZ B;  2Q13 A;  3TO1 A;  5HE2 A;  2LUL A;  2KIG A; 
#chains in the Genus database with same CATH homology
 3TVV A;  5LOP B;  4CYE A;  1XOD A;  3DXD A;  2DFK A;  3KRW A;  1DRO A;  2LKO A;  3A8Q A;  4HDO A;  2Z0P A;  2D2Q A;  2W2X D;  1PMS A;  5JP4 A;  2KGX B;  3KY9 A;  1KZG A;  1V5P A;  2VSZ A;  2RSG A;  2OTX A;  2GCL A;  1V61 A;  4Y94 A;  2L2I A;  1X05 A;  3DXC A;  3T06 A;  4DXA B;  3BJI A;  2MKR A;  3ODX A;  1GC7 A;  4IOY X;  4A6F A;  4F7H A;  4EKU A;  1UNR A;  1Q67 A;  1ISN A;  2ADZ A;  1W1D A;  1ZC3 B;  4ZRI A;  4ZRK A;  3O96 A;  2K00 A;  4GMV A;  2RGN B;  2UZR A;  4Z2M B;  1J19 A;  4HAY B;  5KCV A;  1Z87 A;  2YS3 A;  1WVH A;  1FHO A;  2Z0Q A;  1FHW A;  5D3V A;  1ZC4 B;  4F7U P;  1EGX A;  2RVB B;  5D3X A;  2ELA A;  3ODW A;  3PVW A;  2P0D A;  2M38 A;  2Z0O A;  1U5E A;  2DYN A;  4KHB B;  4L6E A;  2YT1 A;  1X1G A;  4GZU A;  4GN1 A;  1DDV A;  2N23 A;  4GMX B;  4KVG B;  2OQB A;  2CY4 A;  4K2O A;  1DYN A;  1WJM A;  3BIN A;  4GPT B;  1E5W A;  4WSF A;  4P7I A;  1EF1 A;  1XR0 B;  4KHA A;  4IAP A;  2G35 A;  3HQC A;  1DBH A;  3PEG A;  1IRS A;  1M7E A;  4NSW A;  5KQ1 A;  1XCG A;  3CIK A;  3CXB B;  2AL6 A;  2GCJ A;  3TW1 A;  2J0M A;  3P6A A;  4DX8 A;  3AU5 A;  1U27 A;  1RJ2 A;  1BWN A;  3PSC A;  1OMW A;  5JHH A;  4HAU B;  4HB2 B;  4WVF B;  3ZVR A;  3IVF A;  2D11 A;  2H7D A;  3M1I B;  5HE0 A;  1ZSQ A;  5C5B A;  2P8V A;  1QC6 A;  1P6S A;  4PNK A;  3HK0 A;  2D9X A;  5DI9 B;  4Z2N A;  2IYB A;  1NTY A;  2COD A;  3KRX A;  4MT7 A;  4B6H A;  3FEH A;  1V5U A;  5C16 A;  1BAK A;  2VKI A;  3PZD A;  5CLQ B;  1P3R A;  1MAI A;  2I5F A;  1FOE A;  1RRP B;  2DHJ A;  2YT0 A;  2DA0 A;  4IFS A;  4K2P A;  2EC1 A;  4EMO A;  4EJN A;  1UPR A;  2Y8F A;  2I1J A;  2DN6 A;  2BCJ A;  1NI2 A;  2HTH B;  3G9W A;  3GYP A;  3TFM A;  4HAW B;  5HE1 A;  1TQZ A;  1WGU A;  1X11 A;  3PVL A;  4ZRJ A;  1XKE A;  1UNP A;  2NZ8 B;  1EAZ A;  2K2J A;  2D9V A;  2E2X A;  1N3H A;  2KCJ A;  4HHV A;  4A5K A;  2DKQ A;  2YVC A;  4HAV B;  1AWE A;  3DXE A;  3SV1 A;  1NU2 A;  4WJ7 A;  3F5R A;  1FHX A;  2RNR B;  4H8S A;  2D9Z A;  2Y8G A;  4DBB A;  4HAT B;  1K5G B;  2YS5 A;  1U2B A;  5J3Q A;  3F0W A;  1MK7 B;  1WGQ A;  2YS1 A;  1KZ7 A;  2N0Y A;  5FI1 A;  4NY0 A;  3QIJ A;  3NSU A;  3SO6 A;  5KQ4 A;  1V88 A;  2V76 A;  2D10 A;  4A6H A;  4C0A A;  1BTN A;  3PG7 A;  2DKP A;  3VOQ A;  2J0J A;  1I7A A;  3PP2 A;  2IFS A;  2NMB A;  5DIF B;  3FSS A;  3RCP A;  1WJ1 A;  2HE7 A;  1TJ6 A;  1BTK A;  1PLS A;  5C79 A;  2D9W A;  5JHG A;  1P5T A;  1UPQ A;  4K81 A;  2CRF A;  2EJ8 A;  3KSY A;  2COC A;  1EVH A;  5LON B;  4YL8 A;  3ML4 A;  3SYX A;  1V89 A;  4DX9 0;  2DX1 A;  2K2U A;  1DDM A;  1H10 A;  2W2W A;  3VIA A;  1U5G A;  1FGY A;  2RUK B;  2CAY A;  1U5D A;  1LW3 A;  2I5C A;  2UZS A;  3ZDT A;  3WYF B;  2R0D A;  1W1H A;  2DLW A;  1FB8 A;  2L1C A;  2GJY A;  4HAX B;  3GYO A;  3AU4 A;  1MIZ B;  5C5B B;  1V5M A;  3V5W A;  5DHA B;  2CY5 A;  1GC6 A;  4GXB A;  2W2X C;  2D4Q A;  2EMS A;  1W1G A;  1U5F A;  4HB3 B;  4CHJ A;  2DYQ A;  4HB4 B;  2M14 A;  2J0K A;  3QBV B;  1OQN A;  1X1F A;  2YSZ A;  4HB0 B;  1Y19 B;  1MIX A;  1GG3 A;  1X86 A;  1K5D B;  2MWN B;  2COA A;  4YON A;  1MK9 B;  5DHF B;  2UVM A;  1ZVR A;  2LYD A;  1SHC A;  4KAX B;  2EMT A;  2LG1 A;  1FGZ A;  3D8F A;  1I2H A;  2COF A;  2DX5 A;  2ROZ B;  1WG7 A;  2DTC A;  5D3Y A;  4K17 A;  4A6F B;  4A6K A;  5JLJ B;  1B55 A;  1XX0 A;  1ZM0 A;  5FI0 A;  3N7C A;  3A8P A;  2P0F A;  2J59 M;  3QWM A;  1M7R A;  2D9Y A;  2P0H A;  1MKE A;  5J3Y A;  3UZT A;  2DHI A;  2ZPY A;  5CLL B;  3KZ1 A;  1FAO A;  2R09 A;  3ULC A;  1DDW A;  1XD4 A;  1QQG A;  2YF0 A;  1AQC A;  4D0N B;  2XQN M;  3SNH A;  1OY2 A;  4BBK A;  1WI1 A;  1UNQ A;  3LJU X;  1LB1 A;  1PFJ A;  5C6R A;  2LOZ A;  4F7G A;  2I1K A;  2JP2 A;  4TKN A;  3D8E A;  3MPX A;  3X23 A;  4MK0 A;  5J3T A;  4KHO A;  3WA0 A;  4PQ0 A;  5D3W A;  3OAN A;  1NTV A;  1SGH A;  1KI1 B;  3AJ4 A;  3FM8 C;  1J0W A;  2H7E A;  2KUP A;  2DHK A;  3PVU A;  3ULB A;  2AEH A;  4HDQ A;  3U7D A;  2VRW B;  5D27 A;  3D8D A;  2RLO A;  3A98 B;  3TCA A;  2Y7B A;  2PZ1 A;  2ROV A;  3HW2 B;  5GOW B;  1U29 A;  2ELB A;  4XWX A;  1UEF A;  4TYZ A;  5HE3 A;  5L81 A;  1Y5O A;  2X18 A;  4MY6 A;  2FJL A;  4CHM A;  3MDB C;  2QKL A;  3U8Z A;  2MFQ A;  1MPH A;  1TXD A;  2GS0 A;  2LOX A;  3ODO A;  1H4R A;  3SUZ A;  3P7Z A;  2YRY A;  5EFX A;  2QKM A;  5DH9 B;  2MDX A;  4HAZ B;  2Q13 A;  3TO1 A;  5HE2 A;  2LUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...