2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords ACTIN-LIKE PROTEIN 7A
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
1P6SA 2K2UA 3FEHA 5D3YA 4A5KA 1MK7B 2Y8FA 2VRWB 3LJUX 3BJIA 1BTNA 1SHCA 2QKMA 4HAZB 2LG1A 3V5WA 1UNRA 3A8PA 1WGQA 4GMVA 2YVCA 3ODXA 2XQNM 1ZVRA 1NI2A 2LULA 4A6FA 1EF1A 4H8SA 3PSCA 5J3QA 4K17A 1E5WA 4DXAB 4MY6A 2E2XA 4F7UP 1BTKA 5FI0A 3KSYA 1OMWA 1NTYA 4P7IA 3DXEA 1U5GA 2RVBB 4KHOA 1XKEA 3TW1A 3AJ4A 4IAPA 5GOWB 1DDWA 2QKLA 3FSSA 3DXCA 3GYOA 2DHIA 1K5GB 2YS1A 2PZ1A 2D4QA 3SO6A 1Y19B 3P6AA 5LOPB 1AQCA 2RSGA 3QBVB 5JLJB 2COFA 1NTVA 2LYDA 5C5BA 1UPQA 5FI1A 2IYBA 2NZ8B 3CXBB 2Y7BA 3D8DA 4MT7A 4A6FB 5KCVA 2RLOA 5KQ4A 4HAYB 2H7DA 4CYEA 1J19A 4Y94A 2I5FA 2M38A 4Z2NA 1MAIA 1WJ1A 1QC6A 2ZPYA 4HAVB 1K5DB 1U29A 5DHFB 3WYFB 3SNHA 2W2WA 1BWNA 2MWNB 1WI1A 2MKRA 1GC7A 1H4RA 2D9WA 5HE1A 4HAWB 2V76A 3HK0A 2ROVA 4HDQA 3A98B 1LW3A 4PNKA 3D8EA 3SV1A 1UPRA 2OTXA 1U2BA 2D9YA 5L81A 5C5BB 1GC6A 5C16A 1KI1B 2RNRB 1DYNA 3ZDTA 3VIAA 1X86A 3O96A 4XWXA 3AU5A 2KGXB 3U7DA 5DHAB 4B6HA 3PEGA 3TCAA 2KCJA 1WVHA 4GN1A 2Z0QA 3T06A 1P3RA 2COCA 3PP2A 1PMSA 3ML4A 2D9XA 2OQBA 1EAZA 1FHOA 1DDMA 5J3YA 3M1IB 3PVUA 2I1KA 3GYPA 1PFJA 3KZ1A 1WG7A 2MFQA 1FGZA 3PZDA 2R09A 3X23A 2G35A 4WSFA 2EMSA 4EKUA 3ZVRA 2YT0A 4A6HA 2D2QA 2DHJA 1X11A 2K2JA 2YS3A 5C6RA 4IOYX 2L1CA 2NMBA 2P0HA 1EGXA 4TKNA 1RJ2A 4GMXB 1V88A 2I1JA 2K00A 4GZUA 5KQ1A 3TO1A 4L6EA 2ELBA 2DX5A 4D0NB 1FHWA 4K81A 1DDVA 1WJMA 3ULBA 2CY5A 1V61A 1MPHA 3PVLA 4HAXB 1B55A 1FHXA 1TQZA 1IRSA 1ZC3B 4DX8A 1V5PA 4YONA 2W2XD 1FGYA 2GJYA 1GG3A 1TXDA 3KY9A 1XX0A 2LOZA 2DA0A 1V5UA 3ODWA 3TFMA 4CHMA 1SGHA 2UZRA 1KZGA 1FOEA 5CLQB 3IVFA 1MIXA 3ODOA 5JP4A 2M14A 1XR0B 3ULCA 1WGUA 5DI9B 1MKEA 3TVVA 5JHHA 1H10A 4BBKA 3SUZA 4IFSA 2J0JA 1Y5OA 2DLWA 2FJLA 4K2PA 1I2HA 2R0DA 2DKQA 2VKIA 3OANA 2LOXA 2DN6A 2RUKB 2P0DA 1UNPA 2DYNA 2L2IA 4TYZA 1U5EA 2J0KA 1V89A 2I5CA 4DX90 3U8ZA 3P7ZA 4HB4B 2BCJA 2DFKA 2J59M 2N0YA 2VSZA 1OQNA 4Z2MB 2LKOA 2MDXA 3BINA 4A6KA 2H7EA 5HE2A 2CY4A 4CHJA 4HATB 1UNQA 2D9VA 2HE7A 1UEFA 1DROA 5CLLB 2GCJA 4HDOA 3F5RA 2HTHB 4NY0A 4YL8A 2P0FA 3FM8C 1M7RA 1W1HA 2COAA 3D8FA 2DHKA 2EMTA 2D11A 2CAYA 3MDBC 3MPXA 5D3VA 3SYXA 2CRFA 2YS5A 3N7CA 3PVWA 1FAOA 2DTCA 4F7HA 1KZ7A 4HB3B 2YF0A 3A8QA 3F0WA 4HB0B 1BAKA 4ZRJA 2D10A 1ZC4B 5EFXA 1Q67A 1TJ6A 2ELAA 5D3WA 5LONB 3VOQA 2ROZB 3HQCA 4PQ0A 4WJ7A 2DKPA 4KHAA 1PLSA 2D9ZA 1ISNA 4K2OA 1RRPB 1MK9B 4KHBB 1X1GA 3UZTA 1NU2A 2KUPA 1U27A 3AU4A 4KAXB 5C79A 2RGNB 1XD4A 4GXBA 2X18A 2IFSA 2YSZA 5J3TA 5HE0A 4MK0A 4NSWA 1I7AA 3WA0A 4KVGB 5DH9B 2Y8GA 1W1GA 3NSUA 2N23A 2Z0OA 4HHVA 4ZRIA 1EVHA 2Z0PA 2UVMA 1DBHA 4DBBA 2YRYA 2AEHA 3RCPA 1FB8A 4EJNA 4HAUB 2W2XC 1J0WA 1P5TA 4ZRKA 4WVFB 2CODA 1U5DA 2JP2A 4C0AA 1MIZB 2P8VA 1Z87A 3CIKA 1V5MA 4HB2B 5HE3A 1ZSQA 3KRXA 1QQGA 3DXDA 2Q13A 1X05A 1XODA 1OY2A 1U5FA 4GPTB 1N3HA 2EJ8A 2GS0A 5D27A 2YT1A 2DX1A 3PG7A 2AL6A 1XCGA 1M7EA 3HW2B 1W1DA 3G9WA 2DYQA 2GCLA 4F7GA 1X1FA 2UZSA 5D3XA 1LB1A 3QIJA 5DIFB 1ZM0A 5JHGA 2J0MA 3KRWA 2ADZA 2EC1A 4EMOA 1AWEA 3QWMA
chains in the Genus database with same CATH superfamily
1P6SA 2K2UA 3FEHA 5D3YA 4A5KA 5M4YB 1MK7B 2Y8FA 2VRWB 3LJUX 3BJIA 1BTNA 1SHCA 2QKMA 4HAZB 2LG1A 3V5WA 1UNRA 3A8PA 1WGQA 4GMVA 2YVCA 3ODXA 2XQNM 1ZVRA 1NI2A 2LULA 4QXAB 4A6FA 1EF1A 4H8SA 3PSCA 5J3QA 2Z59A 4K17A 1E5WA 3A58A 4DXAB 4MY6A 2E2XA 4F7UP 1BTKA 5FI0A 3KSYA 1OMWA 1NTYA 4P7IA 3DXEA 4QJ5B 1U5GA 2RVBB 4KHOA 1XKEA 3TW1A 3AJ4A 4IAPA 5GOWB 1DDWA 2QKLA 3FSSA 3DXCA 3GYOA 2DHIA 1K5GB 5I2SA 2YS1A 2PZ1A 2D4QA 2KUQA 3SO6A 1Y19B 3P6AA 5LOPB 3HSAA 1AQCA 2RSGA 3QBVB 5JLJB 2COFA 1NTVA 2LYDA 5C5BA 1UPQA 5FI1A 2IYBA 2NZ8B 3CXBB 2Y7BA 3D8DA 4MT7A 4A6FB 5KCVA 2RLOA 5KQ4A 2NBVA 4HAYB 2H7DA 4CYEA 1J19A 4Y94A 2Z14A 2I5FA 2M38A 4Z2NA 1MAIA 1WJ1A 1QC6A 2ZPYA 4HAVB 1K5DB 1U29A 5DHFB 3WYFB 3SNHA 2W2WA 1BWNA 2MWNB 1WI1A 2MKRA 1GC7A 1H4RA 2D9WA 5HE1A 4HAWB 2V76A 3HK0A 2ROVA 4HDQA 3A98B 1LW3A 4PNKA 3D8EA 3SV1A 1UPRA 2OTXA 1U2BA 2D9YA 5L81A 5C5BB 5I2MA 1GC6A 5C16A 1KI1B 2RNRB 1DYNA 3ZDTA 3VIAA 1X86A 3O96A 4GOUA 4XWXA 3AU5A 2KGXB 3U7DA 5DHAB 4B6HA 3PEGA 4QJ4B 3TCAA 2KCJA 1WVHA 2K8EA 4GN1A 2Z0QA 3T06A 4D6WA 1P3RA 2COCA 3PP2A 3B77A 1PMSA 3ML4A 2D9XA 2OQBA 1EAZA 1FHOA 2KR0A 1DDMA 5J3YA 3M1IB 3PVUA 2I1KA 3GYPA 1PFJA 3KZ1A 1WG7A 2MFQA 1FGZA 3PZDA 2R09A 3X23A 2G35A 3OHMB 4WSFA 2EMSA 4EKUA 3ZVRA 2GUMA 2YT0A 4A6HA 2D2QA 2DHJA 1X11A 2K2JA 2YS3A 5C6RA 4IOYX 2L1CA 2NMBA 2P0HA 1EGXA 4TKNA 1RJ2A 3FVCA 4GMXB 1V88A 2I1JA 2K00A 4GZUA 5KQ1A 3TO1A 4L6EA 2ELBA 2DX5A 4D0NB 1FHWA 4K81A 1DDVA 1WJMA 3ULBA 1T77A 2CY5A 1V61A 1MPHA 3PVLA 4HAXB 4CSQA 1B55A 1FHXA 1TQZA 1IRSA 1ZC3B 4DX8A 1V5PA 4YONA 2KIEA 2W2XD 2RRFA 1FGYA 2GJYA 1GG3A 1TXDA 1XX0A 2LOZA 3KY9A 2DA0A 1V5UA 3ODWA 3TFMA 4CHMA 1SGHA 2UZRA 1KZGA 5LG4B 1FOEA 5CLQB 3IVFA 1MIXA 3ODOA 5JP4A 2M14A 1XR0B 3ULCA 1WGUA 5DI9B 1MKEA 3TVVA 5JHHA 1H10A 4BBKA 3SUZA 4IFSA 2J0JA 1Y5OA 2DLWA 2FJLA 4K2PA 1I2HA 2R0DA 2DKQA 2VKIA 2K49A 3OANA 2LOXA 2DN6A 2RUKB 2P0DA 1UNPA 2DYNA 2L2IA 4TYZA 1U5EA 3NWDA 2J0KA 1V89A 2I5CA 4DX90 3U8ZA 3P7ZA 4HB4B 2BCJA 2DFKA 2J59M 2YT2A 2N0YA 2VSZA 1OQNA 4Z2MB 2LKOA 2MDXA 3BINA 4A6KA 2H7EA 2R2YA 2CY4A 5HE2A 4CHJA 4HATB 1UNQA 2D9VA 2HE7A 1UEFA 2FJUB 1DROA 5CLLB 4KHBA 2GCJA 4HDOA 3U12A 3F5RA 2HTHB 4NY0A 4YL8A 2P0FA 3FM8C 1M7RA 1W1HA 2COAA 4QJ3B 3D8FA 2DHKA 2EMTA 1ZYIA 2D11A 2CAYA 3MDBC 3MPXA 5D3VA 3SYXA 2CRFA 2YS5A 3N7CA 3PVWA 4DIXA 1FAOA 2DTCA 4F7HA 1KZ7A 4HB3B 2YF0A 3A8QA 3F0WA 4HB0B 1BAKA 4ZRJA 2D10A 1ZC4B 5EFXA 1Q67A 1TJ6A 2ELAA 3DCXA 5D3WA 5LONB 3VOQA 2ROZB 3HQCA 4PQ0A 4WJ7A 2DKPA 4KHAA 1PLSA 2D9ZA 1ISNA 4K2OA 1RRPB 1MK9B 4KHBB 1MI1A 1X1GA 3UZTA 1NU2A 2KUPA 1U27A 4GNKB 3AU4A 4KAXB 5C79A 2RGNB 1XD4A 2KIGA 2ZKMX 3NWAA 2Z13A 4L1RA 4GXBA 2X18A 2IFSA 5IRSA 2YSZA 5J3TA 5HE0A 4MK0A 4NSWA 1I7AA 3WA0A 4KVGB 5DH9B 2Y8GA 1W1GA 3NSUA 2N23A 2Z0OA 4HHVA 4ZRIA 1EVHA 2Z0PA 2UVMA 1DBHA 4DBBA 3HIEA 2YRYA 2AEHA 3RCPA 1FB8A 4EJNA 4HAUB 2W2XC 1J0WA 1P5TA 4OT1A 4ZRKA 3NWFA 4WVFB 4OSNA 2CODA 1U5DA 2JP2A 4C0AA 1MIZB 2P8VA 1Z87A 3CIKA 1V5MA 4HB2B 5HE3A 1ZSQA 3KRXA 3NW8A 1QQGA 3DXDA 2Q13A 1X05A 1XODA 1OY2A 1U5FA 4GPTB 1N3HA 2EJ8A 2Z4DA 2GS0A 5D27A 2YT1A 2DX1A 3PG7A 2AL6A 1XCGA 3HW2B 1M7EA 1W1DA 3G9WA 2DYQA 2GCLA 4F7GA 1X1FA 2UZSA 5D3XA 4HSIA 1LB1A 3QIJA 5DIFB 1ZM0A 5JHGA 2J0MA 3KRWA 2ADZA 2EC1A 4EMOA 1AWEA 3QWMA
chains in the Genus database with same CATH topology
1P6SA 2K2UA 3FEHA 5D3YA 4A5KA 1MK7B 2Y8FA 2VRWB 3LJUX 3BJIA 1BTNA 1SHCA 2QKMA 4HAZB 2LG1A 3V5WA 1UNRA 3A8PA 1WGQA 4GMVA 2YVCA 3ODXA 2XQNM 1ZVRA 1NI2A 2LULA 4A6FA 1EF1A 4H8SA 3PSCA 5J3QA 4K17A 1E5WA 4DXAB 4MY6A 2E2XA 4F7UP 1BTKA 5FI0A 3KSYA 1OMWA 1NTYA 4P7IA 3DXEA 1U5GA 2RVBB 4KHOA 1XKEA 3TW1A 3AJ4A 4IAPA 5GOWB 1DDWA 2QKLA 3FSSA 3DXCA 3GYOA 2DHIA 1K5GB 2YS1A 2PZ1A 2D4QA 3SO6A 1Y19B 3P6AA 5LOPB 1AQCA 2RSGA 3QBVB 5JLJB 2COFA 1NTVA 2LYDA 5C5BA 1UPQA 5FI1A 2IYBA 2NZ8B 3CXBB 2Y7BA 3D8DA 4MT7A 4A6FB 5KCVA 2RLOA 5KQ4A 4HAYB 2H7DA 4CYEA 1J19A 4Y94A 2I5FA 2M38A 4Z2NA 1MAIA 1WJ1A 1QC6A 2ZPYA 4HAVB 1K5DB 1U29A 5DHFB 3WYFB 3SNHA 2W2WA 1BWNA 2MWNB 1WI1A 2MKRA 1GC7A 1H4RA 2D9WA 5HE1A 4HAWB 2V76A 3HK0A 2ROVA 4HDQA 3A98B 1LW3A 4PNKA 3D8EA 3SV1A 1UPRA 2OTXA 1U2BA 2D9YA 5L81A 5C5BB 1GC6A 5C16A 1KI1B 2RNRB 1DYNA 3ZDTA 3VIAA 1X86A 3O96A 4XWXA 3AU5A 2KGXB 3U7DA 5DHAB 4B6HA 3PEGA 3TCAA 2KCJA 1WVHA 4GN1A 2Z0QA 3T06A 1P3RA 2COCA 3PP2A 1PMSA 3ML4A 2D9XA 2OQBA 1EAZA 1FHOA 1DDMA 5J3YA 3M1IB 3PVUA 2I1KA 3GYPA 1PFJA 3KZ1A 1WG7A 2MFQA 1FGZA 3PZDA 2R09A 3X23A 2G35A 4WSFA 2EMSA 4EKUA 3ZVRA 2YT0A 4A6HA 2D2QA 2DHJA 1X11A 2K2JA 2YS3A 5C6RA 4IOYX 2L1CA 2NMBA 2P0HA 1EGXA 4TKNA 1RJ2A 4GMXB 1V88A 2I1JA 2K00A 4GZUA 5KQ1A 3TO1A 4L6EA 2ELBA 2DX5A 4D0NB 1FHWA 4K81A 1DDVA 1WJMA 3ULBA 2CY5A 1V61A 1MPHA 3PVLA 4HAXB 1B55A 1FHXA 1TQZA 1IRSA 1ZC3B 4DX8A 1V5PA 4YONA 2W2XD 1FGYA 2GJYA 1GG3A 1TXDA 3KY9A 1XX0A 2LOZA 2DA0A 1V5UA 3ODWA 3TFMA 4CHMA 1SGHA 2UZRA 1KZGA 1FOEA 5CLQB 3IVFA 1MIXA 3ODOA 5JP4A 2M14A 1XR0B 3ULCA 1WGUA 5DI9B 1MKEA 3TVVA 5JHHA 1H10A 4BBKA 3SUZA 4IFSA 2J0JA 1Y5OA 2DLWA 2FJLA 4K2PA 1I2HA 2R0DA 2DKQA 2VKIA 3OANA 2LOXA 2DN6A 2RUKB 2P0DA 1UNPA 2DYNA 2L2IA 4TYZA 1U5EA 2J0KA 1V89A 2I5CA 4DX90 3U8ZA 3P7ZA 4HB4B 2BCJA 2DFKA 2J59M 2N0YA 2VSZA 1OQNA 4Z2MB 2LKOA 2MDXA 3BINA 4A6KA 2H7EA 5HE2A 2CY4A 4CHJA 4HATB 1UNQA 2D9VA 2HE7A 1UEFA 1DROA 5CLLB 2GCJA 4HDOA 3F5RA 2HTHB 4NY0A 4YL8A 2P0FA 3FM8C 1M7RA 1W1HA 2COAA 3D8FA 2DHKA 2EMTA 2D11A 2CAYA 3MDBC 3MPXA 5D3VA 3SYXA 2CRFA 2YS5A 3N7CA 3PVWA 1FAOA 2DTCA 4F7HA 1KZ7A 4HB3B 2YF0A 3A8QA 3F0WA 4HB0B 1BAKA 4ZRJA 2D10A 1ZC4B 5EFXA 1Q67A 1TJ6A 2ELAA 5D3WA 5LONB 3VOQA 2ROZB 3HQCA 4PQ0A 4WJ7A 2DKPA 4KHAA 1PLSA 2D9ZA 1ISNA 4K2OA 1RRPB 1MK9B 4KHBB 1X1GA 3UZTA 1NU2A 2KUPA 1U27A 3AU4A 4KAXB 5C79A 2RGNB 1XD4A 4GXBA 2X18A 2IFSA 2YSZA 5J3TA 5HE0A 4MK0A 4NSWA 1I7AA 3WA0A 4KVGB 5DH9B 2Y8GA 1W1GA 3NSUA 2N23A 2Z0OA 4HHVA 4ZRIA 1EVHA 2Z0PA 2UVMA 1DBHA 4DBBA 2YRYA 2AEHA 3RCPA 1FB8A 4EJNA 4HAUB 2W2XC 1J0WA 1P5TA 4ZRKA 4WVFB 2CODA 1U5DA 2JP2A 4C0AA 1MIZB 2P8VA 1Z87A 3CIKA 1V5MA 4HB2B 5HE3A 1ZSQA 3KRXA 1QQGA 3DXDA 2Q13A 1X05A 1XODA 1OY2A 1U5FA 4GPTB 1N3HA 2EJ8A 2GS0A 5D27A 2YT1A 2DX1A 3PG7A 2AL6A 1XCGA 1M7EA 3HW2B 1W1DA 3G9WA 2DYQA 2GCLA 4F7GA 1X1FA 2UZSA 5D3XA 1LB1A 3QIJA 5DIFB 1ZM0A 5JHGA 2J0MA 3KRWA 2ADZA 2EC1A 4EMOA 1AWEA 3QWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P6S A;  2K2U A;  3FEH A;  5D3Y A;  4A5K A;  1MK7 B;  2Y8F A;  2VRW B;  3LJU X;  3BJI A;  1BTN A;  1SHC A;  2QKM A;  4HAZ B;  2LG1 A;  3V5W A;  1UNR A;  3A8P A;  1WGQ A;  4GMV A;  2YVC A;  3ODX A;  2XQN M;  1ZVR A;  1NI2 A;  2LUL A;  4A6F A;  1EF1 A;  4H8S A;  3PSC A;  5J3Q A;  4K17 A;  1E5W A;  4DXA B;  4MY6 A;  2E2X A;  4F7U P;  1BTK A;  5FI0 A;  3KSY A;  1OMW A;  1NTY A;  4P7I A;  3DXE A;  1U5G A;  2RVB B;  4KHO A;  1XKE A;  3TW1 A;  3AJ4 A;  4IAP A;  5GOW B;  1DDW A;  2QKL A;  3FSS A;  3DXC A;  3GYO A;  2DHI A;  1K5G B;  2YS1 A;  2PZ1 A;  2D4Q A;  3SO6 A;  1Y19 B;  3P6A A;  5LOP B;  1AQC A;  2RSG A;  3QBV B;  5JLJ B;  2COF A;  1NTV A;  2LYD A;  5C5B A;  1UPQ A;  5FI1 A;  2IYB A;  2NZ8 B;  3CXB B;  2Y7B A;  3D8D A;  4MT7 A;  4A6F B;  5KCV A;  2RLO A;  5KQ4 A;  4HAY B;  2H7D A;  4CYE A;  1J19 A;  4Y94 A;  2I5F A;  2M38 A;  4Z2N A;  1MAI A;  1WJ1 A;  1QC6 A;  2ZPY A;  4HAV B;  1K5D B;  1U29 A;  5DHF B;  3WYF B;  3SNH A;  2W2W A;  1BWN A;  2MWN B;  1WI1 A;  2MKR A;  1GC7 A;  1H4R A;  2D9W A;  5HE1 A;  4HAW B;  2V76 A;  3HK0 A;  2ROV A;  4HDQ A;  3A98 B;  1LW3 A;  4PNK A;  3D8E A;  3SV1 A;  1UPR A;  2OTX A;  1U2B A;  2D9Y A;  5L81 A;  5C5B B;  1GC6 A;  5C16 A;  1KI1 B;  2RNR B;  1DYN A;  3ZDT A;  3VIA A;  1X86 A;  3O96 A;  4XWX A;  3AU5 A;  2KGX B;  3U7D A;  5DHA B;  4B6H A;  3PEG A;  3TCA A;  2KCJ A;  1WVH A;  4GN1 A;  2Z0Q A;  3T06 A;  1P3R A;  2COC A;  3PP2 A;  1PMS A;  3ML4 A;  2D9X A;  2OQB A;  1EAZ A;  1FHO A;  1DDM A;  5J3Y A;  3M1I B;  3PVU A;  2I1K A;  3GYP A;  1PFJ A;  3KZ1 A;  1WG7 A;  2MFQ A;  1FGZ A;  3PZD A;  2R09 A;  3X23 A;  2G35 A;  4WSF A;  2EMS A;  4EKU A;  3ZVR A;  2YT0 A;  4A6H A;  2D2Q A;  2DHJ A;  1X11 A;  2K2J A;  2YS3 A;  5C6R A;  4IOY X;  2L1C A;  2NMB A;  2P0H A;  1EGX A;  4TKN A;  1RJ2 A;  4GMX B;  1V88 A;  2I1J A;  2K00 A;  4GZU A;  5KQ1 A;  3TO1 A;  4L6E A;  2ELB A;  2DX5 A;  4D0N B;  1FHW A;  4K81 A;  1DDV A;  1WJM A;  3ULB A;  2CY5 A;  1V61 A;  1MPH A;  3PVL A;  4HAX B;  1B55 A;  1FHX A;  1TQZ A;  1IRS A;  1ZC3 B;  4DX8 A;  1V5P A;  4YON A;  2W2X D;  1FGY A;  2GJY A;  1GG3 A;  1TXD A;  3KY9 A;  1XX0 A;  2LOZ A;  2DA0 A;  1V5U A;  3ODW A;  3TFM A;  4CHM A;  1SGH A;  2UZR A;  1KZG A;  1FOE A;  5CLQ B;  3IVF A;  1MIX A;  3ODO A;  5JP4 A;  2M14 A;  1XR0 B;  3ULC A;  1WGU A;  5DI9 B;  1MKE A;  3TVV A;  5JHH A;  1H10 A;  4BBK A;  3SUZ A;  4IFS A;  2J0J A;  1Y5O A;  2DLW A;  2FJL A;  4K2P A;  1I2H A;  2R0D A;  2DKQ A;  2VKI A;  3OAN A;  2LOX A;  2DN6 A;  2RUK B;  2P0D A;  1UNP A;  2DYN A;  2L2I A;  4TYZ A;  1U5E A;  2J0K A;  1V89 A;  2I5C A;  4DX9 0;  3U8Z A;  3P7Z A;  4HB4 B;  2BCJ A;  2DFK A;  2J59 M;  2N0Y A;  2VSZ A;  1OQN A;  4Z2M B;  2LKO A;  2MDX A;  3BIN A;  4A6K A;  2H7E A;  5HE2 A;  2CY4 A;  4CHJ A;  4HAT B;  1UNQ A;  2D9V A;  2HE7 A;  1UEF A;  1DRO A;  5CLL B;  2GCJ A;  4HDO A;  3F5R A;  2HTH B;  4NY0 A;  4YL8 A;  2P0F A;  3FM8 C;  1M7R A;  1W1H A;  2COA A;  3D8F A;  2DHK A;  2EMT A;  2D11 A;  2CAY A;  3MDB C;  3MPX A;  5D3V A;  3SYX A;  2CRF A;  2YS5 A;  3N7C A;  3PVW A;  1FAO A;  2DTC A;  4F7H A;  1KZ7 A;  4HB3 B;  2YF0 A;  3A8Q A;  3F0W A;  4HB0 B;  1BAK A;  4ZRJ A;  2D10 A;  1ZC4 B;  5EFX A;  1Q67 A;  1TJ6 A;  2ELA A;  5D3W A;  5LON B;  3VOQ A;  2ROZ B;  3HQC A;  4PQ0 A;  4WJ7 A;  2DKP A;  4KHA A;  1PLS A;  2D9Z A;  1ISN A;  4K2O A;  1RRP B;  1MK9 B;  4KHB B;  1X1G A;  3UZT A;  1NU2 A;  2KUP A;  1U27 A;  3AU4 A;  4KAX B;  5C79 A;  2RGN B;  1XD4 A;  4GXB A;  2X18 A;  2IFS A;  2YSZ A;  5J3T A;  5HE0 A;  4MK0 A;  4NSW A;  1I7A A;  3WA0 A;  4KVG B;  5DH9 B;  2Y8G A;  1W1G A;  3NSU A;  2N23 A;  2Z0O A;  4HHV A;  4ZRI A;  1EVH A;  2Z0P A;  2UVM A;  1DBH A;  4DBB A;  2YRY A;  2AEH A;  3RCP A;  1FB8 A;  4EJN A;  4HAU B;  2W2X C;  1J0W A;  1P5T A;  4ZRK A;  4WVF B;  2COD A;  1U5D A;  2JP2 A;  4C0A A;  1MIZ B;  2P8V A;  1Z87 A;  3CIK A;  1V5M A;  4HB2 B;  5HE3 A;  1ZSQ A;  3KRX A;  1QQG A;  3DXD A;  2Q13 A;  1X05 A;  1XOD A;  1OY2 A;  1U5F A;  4GPT B;  1N3H A;  2EJ8 A;  2GS0 A;  5D27 A;  2YT1 A;  2DX1 A;  3PG7 A;  2AL6 A;  1XCG A;  1M7E A;  3HW2 B;  1W1D A;  3G9W A;  2DYQ A;  2GCL A;  4F7G A;  1X1F A;  2UZS A;  5D3X A;  1LB1 A;  3QIJ A;  5DIF B;  1ZM0 A;  5JHG A;  2J0M A;  3KRW A;  2ADZ A;  2EC1 A;  4EMO A;  1AWE A;  3QWM A; 
#chains in the Genus database with same CATH topology
 1P6S A;  2K2U A;  3FEH A;  5D3Y A;  4A5K A;  5M4Y B;  1MK7 B;  2Y8F A;  2VRW B;  3LJU X;  3BJI A;  1BTN A;  1SHC A;  2QKM A;  4HAZ B;  2LG1 A;  3V5W A;  1UNR A;  3A8P A;  1WGQ A;  4GMV A;  2YVC A;  3ODX A;  2XQN M;  1ZVR A;  1NI2 A;  2LUL A;  4QXA B;  4A6F A;  1EF1 A;  4H8S A;  3PSC A;  5J3Q A;  2Z59 A;  4K17 A;  1E5W A;  3A58 A;  4DXA B;  4MY6 A;  2E2X A;  4F7U P;  1BTK A;  5FI0 A;  3KSY A;  1OMW A;  1NTY A;  4P7I A;  3DXE A;  4QJ5 B;  1U5G A;  2RVB B;  4KHO A;  1XKE A;  3TW1 A;  3AJ4 A;  4IAP A;  5GOW B;  1DDW A;  2QKL A;  3FSS A;  3DXC A;  3GYO A;  2DHI A;  1K5G B;  5I2S A;  2YS1 A;  2PZ1 A;  2D4Q A;  2KUQ A;  3SO6 A;  1Y19 B;  3P6A A;  5LOP B;  3HSA A;  1AQC A;  2RSG A;  3QBV B;  5JLJ B;  2COF A;  1NTV A;  2LYD A;  5C5B A;  1UPQ A;  5FI1 A;  2IYB A;  2NZ8 B;  3CXB B;  2Y7B A;  3D8D A;  4MT7 A;  4A6F B;  5KCV A;  2RLO A;  5KQ4 A;  2NBV A;  4HAY B;  2H7D A;  4CYE A;  1J19 A;  4Y94 A;  2Z14 A;  2I5F A;  2M38 A;  4Z2N A;  1MAI A;  1WJ1 A;  1QC6 A;  2ZPY A;  4HAV B;  1K5D B;  1U29 A;  5DHF B;  3WYF B;  3SNH A;  2W2W A;  1BWN A;  2MWN B;  1WI1 A;  2MKR A;  1GC7 A;  1H4R A;  2D9W A;  5HE1 A;  4HAW B;  2V76 A;  3HK0 A;  2ROV A;  4HDQ A;  3A98 B;  1LW3 A;  4PNK A;  3D8E A;  3SV1 A;  1UPR A;  2OTX A;  1U2B A;  2D9Y A;  5L81 A;  5C5B B;  5I2M A;  1GC6 A;  5C16 A;  1KI1 B;  2RNR B;  1DYN A;  3ZDT A;  3VIA A;  1X86 A;  3O96 A;  4GOU A;  4XWX A;  3AU5 A;  2KGX B;  3U7D A;  5DHA B;  4B6H A;  3PEG A;  4QJ4 B;  3TCA A;  2KCJ A;  1WVH A;  2K8E A;  4GN1 A;  2Z0Q A;  3T06 A;  4D6W A;  1P3R A;  2COC A;  3PP2 A;  3B77 A;  1PMS A;  3ML4 A;  2D9X A;  2OQB A;  1EAZ A;  1FHO A;  2KR0 A;  1DDM A;  5J3Y A;  3M1I B;  3PVU A;  2I1K A;  3GYP A;  1PFJ A;  3KZ1 A;  1WG7 A;  2MFQ A;  1FGZ A;  3PZD A;  2R09 A;  3X23 A;  2G35 A;  3OHM B;  4WSF A;  2EMS A;  4EKU A;  3ZVR A;  2GUM A;  2YT0 A;  4A6H A;  2D2Q A;  2DHJ A;  1X11 A;  2K2J A;  2YS3 A;  5C6R A;  4IOY X;  2L1C A;  2NMB A;  2P0H A;  1EGX A;  4TKN A;  1RJ2 A;  3FVC A;  4GMX B;  1V88 A;  2I1J A;  2K00 A;  4GZU A;  5KQ1 A;  3TO1 A;  4L6E A;  2ELB A;  2DX5 A;  4D0N B;  1FHW A;  4K81 A;  1DDV A;  1WJM A;  3ULB A;  1T77 A;  2CY5 A;  1V61 A;  1MPH A;  3PVL A;  4HAX B;  4CSQ A;  1B55 A;  1FHX A;  1TQZ A;  1IRS A;  1ZC3 B;  4DX8 A;  1V5P A;  4YON A;  2KIE A;  2W2X D;  2RRF A;  1FGY A;  2GJY A;  1GG3 A;  1TXD A;  1XX0 A;  2LOZ A;  3KY9 A;  2DA0 A;  1V5U A;  3ODW A;  3TFM A;  4CHM A;  1SGH A;  2UZR A;  1KZG A;  5LG4 B;  1FOE A;  5CLQ B;  3IVF A;  1MIX A;  3ODO A;  5JP4 A;  2M14 A;  1XR0 B;  3ULC A;  1WGU A;  5DI9 B;  1MKE A;  3TVV A;  5JHH A;  1H10 A;  4BBK A;  3SUZ A;  4IFS A;  2J0J A;  1Y5O A;  2DLW A;  2FJL A;  4K2P A;  1I2H A;  2R0D A;  2DKQ A;  2VKI A;  2K49 A;  3OAN A;  2LOX A;  2DN6 A;  2RUK B;  2P0D A;  1UNP A;  2DYN A;  2L2I A;  4TYZ A;  1U5E A;  3NWD A;  2J0K A;  1V89 A;  2I5C A;  4DX9 0;  3U8Z A;  3P7Z A;  4HB4 B;  2BCJ A;  2DFK A;  2J59 M;  2YT2 A;  2N0Y A;  2VSZ A;  1OQN A;  4Z2M B;  2LKO A;  2MDX A;  3BIN A;  4A6K A;  2H7E A;  2R2Y A;  2CY4 A;  5HE2 A;  4CHJ A;  4HAT B;  1UNQ A;  2D9V A;  2HE7 A;  1UEF A;  2FJU B;  1DRO A;  5CLL B;  4KHB A;  2GCJ A;  4HDO A;  3U12 A;  3F5R A;  2HTH B;  4NY0 A;  4YL8 A;  2P0F A;  3FM8 C;  1M7R A;  1W1H A;  2COA A;  4QJ3 B;  3D8F A;  2DHK A;  2EMT A;  1ZYI A;  2D11 A;  2CAY A;  3MDB C;  3MPX A;  5D3V A;  3SYX A;  2CRF A;  2YS5 A;  3N7C A;  3PVW A;  4DIX A;  1FAO A;  2DTC A;  4F7H A;  1KZ7 A;  4HB3 B;  2YF0 A;  3A8Q A;  3F0W A;  4HB0 B;  1BAK A;  4ZRJ A;  2D10 A;  1ZC4 B;  5EFX A;  1Q67 A;  1TJ6 A;  2ELA A;  3DCX A;  5D3W A;  5LON B;  3VOQ A;  2ROZ B;  3HQC A;  4PQ0 A;  4WJ7 A;  2DKP A;  4KHA A;  1PLS A;  2D9Z A;  1ISN A;  4K2O A;  1RRP B;  1MK9 B;  4KHB B;  1MI1 A;  1X1G A;  3UZT A;  1NU2 A;  2KUP A;  1U27 A;  4GNK B;  3AU4 A;  4KAX B;  5C79 A;  2RGN B;  1XD4 A;  2KIG A;  2ZKM X;  3NWA A;  2Z13 A;  4L1R A;  4GXB A;  2X18 A;  2IFS A;  5IRS A;  2YSZ A;  5J3T A;  5HE0 A;  4MK0 A;  4NSW A;  1I7A A;  3WA0 A;  4KVG B;  5DH9 B;  2Y8G A;  1W1G A;  3NSU A;  2N23 A;  2Z0O A;  4HHV A;  4ZRI A;  1EVH A;  2Z0P A;  2UVM A;  1DBH A;  4DBB A;  3HIE A;  2YRY A;  2AEH A;  3RCP A;  1FB8 A;  4EJN A;  4HAU B;  2W2X C;  1J0W A;  1P5T A;  4OT1 A;  4ZRK A;  3NWF A;  4WVF B;  4OSN A;  2COD A;  1U5D A;  2JP2 A;  4C0A A;  1MIZ B;  2P8V A;  1Z87 A;  3CIK A;  1V5M A;  4HB2 B;  5HE3 A;  1ZSQ A;  3KRX A;  3NW8 A;  1QQG A;  3DXD A;  2Q13 A;  1X05 A;  1XOD A;  1OY2 A;  1U5F A;  4GPT B;  1N3H A;  2EJ8 A;  2Z4D A;  2GS0 A;  5D27 A;  2YT1 A;  2DX1 A;  3PG7 A;  2AL6 A;  1XCG A;  3HW2 B;  1M7E A;  1W1D A;  3G9W A;  2DYQ A;  2GCL A;  4F7G A;  1X1F A;  2UZS A;  5D3X A;  4HSI A;  1LB1 A;  3QIJ A;  5DIF B;  1ZM0 A;  5JHG A;  2J0M A;  3KRW A;  2ADZ A;  2EC1 A;  4EMO A;  1AWE A;  3QWM A; 
#chains in the Genus database with same CATH homology
 1P6S A;  2K2U A;  3FEH A;  5D3Y A;  4A5K A;  1MK7 B;  2Y8F A;  2VRW B;  3LJU X;  3BJI A;  1BTN A;  1SHC A;  2QKM A;  4HAZ B;  2LG1 A;  3V5W A;  1UNR A;  3A8P A;  1WGQ A;  4GMV A;  2YVC A;  3ODX A;  2XQN M;  1ZVR A;  1NI2 A;  2LUL A;  4A6F A;  1EF1 A;  4H8S A;  3PSC A;  5J3Q A;  4K17 A;  1E5W A;  4DXA B;  4MY6 A;  2E2X A;  4F7U P;  1BTK A;  5FI0 A;  3KSY A;  1OMW A;  1NTY A;  4P7I A;  3DXE A;  1U5G A;  2RVB B;  4KHO A;  1XKE A;  3TW1 A;  3AJ4 A;  4IAP A;  5GOW B;  1DDW A;  2QKL A;  3FSS A;  3DXC A;  3GYO A;  2DHI A;  1K5G B;  2YS1 A;  2PZ1 A;  2D4Q A;  3SO6 A;  1Y19 B;  3P6A A;  5LOP B;  1AQC A;  2RSG A;  3QBV B;  5JLJ B;  2COF A;  1NTV A;  2LYD A;  5C5B A;  1UPQ A;  5FI1 A;  2IYB A;  2NZ8 B;  3CXB B;  2Y7B A;  3D8D A;  4MT7 A;  4A6F B;  5KCV A;  2RLO A;  5KQ4 A;  4HAY B;  2H7D A;  4CYE A;  1J19 A;  4Y94 A;  2I5F A;  2M38 A;  4Z2N A;  1MAI A;  1WJ1 A;  1QC6 A;  2ZPY A;  4HAV B;  1K5D B;  1U29 A;  5DHF B;  3WYF B;  3SNH A;  2W2W A;  1BWN A;  2MWN B;  1WI1 A;  2MKR A;  1GC7 A;  1H4R A;  2D9W A;  5HE1 A;  4HAW B;  2V76 A;  3HK0 A;  2ROV A;  4HDQ A;  3A98 B;  1LW3 A;  4PNK A;  3D8E A;  3SV1 A;  1UPR A;  2OTX A;  1U2B A;  2D9Y A;  5L81 A;  5C5B B;  1GC6 A;  5C16 A;  1KI1 B;  2RNR B;  1DYN A;  3ZDT A;  3VIA A;  1X86 A;  3O96 A;  4XWX A;  3AU5 A;  2KGX B;  3U7D A;  5DHA B;  4B6H A;  3PEG A;  3TCA A;  2KCJ A;  1WVH A;  4GN1 A;  2Z0Q A;  3T06 A;  1P3R A;  2COC A;  3PP2 A;  1PMS A;  3ML4 A;  2D9X A;  2OQB A;  1EAZ A;  1FHO A;  1DDM A;  5J3Y A;  3M1I B;  3PVU A;  2I1K A;  3GYP A;  1PFJ A;  3KZ1 A;  1WG7 A;  2MFQ A;  1FGZ A;  3PZD A;  2R09 A;  3X23 A;  2G35 A;  4WSF A;  2EMS A;  4EKU A;  3ZVR A;  2YT0 A;  4A6H A;  2D2Q A;  2DHJ A;  1X11 A;  2K2J A;  2YS3 A;  5C6R A;  4IOY X;  2L1C A;  2NMB A;  2P0H A;  1EGX A;  4TKN A;  1RJ2 A;  4GMX B;  1V88 A;  2I1J A;  2K00 A;  4GZU A;  5KQ1 A;  3TO1 A;  4L6E A;  2ELB A;  2DX5 A;  4D0N B;  1FHW A;  4K81 A;  1DDV A;  1WJM A;  3ULB A;  2CY5 A;  1V61 A;  1MPH A;  3PVL A;  4HAX B;  1B55 A;  1FHX A;  1TQZ A;  1IRS A;  1ZC3 B;  4DX8 A;  1V5P A;  4YON A;  2W2X D;  1FGY A;  2GJY A;  1GG3 A;  1TXD A;  3KY9 A;  1XX0 A;  2LOZ A;  2DA0 A;  1V5U A;  3ODW A;  3TFM A;  4CHM A;  1SGH A;  2UZR A;  1KZG A;  1FOE A;  5CLQ B;  3IVF A;  1MIX A;  3ODO A;  5JP4 A;  2M14 A;  1XR0 B;  3ULC A;  1WGU A;  5DI9 B;  1MKE A;  3TVV A;  5JHH A;  1H10 A;  4BBK A;  3SUZ A;  4IFS A;  2J0J A;  1Y5O A;  2DLW A;  2FJL A;  4K2P A;  1I2H A;  2R0D A;  2DKQ A;  2VKI A;  3OAN A;  2LOX A;  2DN6 A;  2RUK B;  2P0D A;  1UNP A;  2DYN A;  2L2I A;  4TYZ A;  1U5E A;  2J0K A;  1V89 A;  2I5C A;  4DX9 0;  3U8Z A;  3P7Z A;  4HB4 B;  2BCJ A;  2DFK A;  2J59 M;  2N0Y A;  2VSZ A;  1OQN A;  4Z2M B;  2LKO A;  2MDX A;  3BIN A;  4A6K A;  2H7E A;  5HE2 A;  2CY4 A;  4CHJ A;  4HAT B;  1UNQ A;  2D9V A;  2HE7 A;  1UEF A;  1DRO A;  5CLL B;  2GCJ A;  4HDO A;  3F5R A;  2HTH B;  4NY0 A;  4YL8 A;  2P0F A;  3FM8 C;  1M7R A;  1W1H A;  2COA A;  3D8F A;  2DHK A;  2EMT A;  2D11 A;  2CAY A;  3MDB C;  3MPX A;  5D3V A;  3SYX A;  2CRF A;  2YS5 A;  3N7C A;  3PVW A;  1FAO A;  2DTC A;  4F7H A;  1KZ7 A;  4HB3 B;  2YF0 A;  3A8Q A;  3F0W A;  4HB0 B;  1BAK A;  4ZRJ A;  2D10 A;  1ZC4 B;  5EFX A;  1Q67 A;  1TJ6 A;  2ELA A;  5D3W A;  5LON B;  3VOQ A;  2ROZ B;  3HQC A;  4PQ0 A;  4WJ7 A;  2DKP A;  4KHA A;  1PLS A;  2D9Z A;  1ISN A;  4K2O A;  1RRP B;  1MK9 B;  4KHB B;  1X1G A;  3UZT A;  1NU2 A;  2KUP A;  1U27 A;  3AU4 A;  4KAX B;  5C79 A;  2RGN B;  1XD4 A;  4GXB A;  2X18 A;  2IFS A;  2YSZ A;  5J3T A;  5HE0 A;  4MK0 A;  4NSW A;  1I7A A;  3WA0 A;  4KVG B;  5DH9 B;  2Y8G A;  1W1G A;  3NSU A;  2N23 A;  2Z0O A;  4HHV A;  4ZRI A;  1EVH A;  2Z0P A;  2UVM A;  1DBH A;  4DBB A;  2YRY A;  2AEH A;  3RCP A;  1FB8 A;  4EJN A;  4HAU B;  2W2X C;  1J0W A;  1P5T A;  4ZRK A;  4WVF B;  2COD A;  1U5D A;  2JP2 A;  4C0A A;  1MIZ B;  2P8V A;  1Z87 A;  3CIK A;  1V5M A;  4HB2 B;  5HE3 A;  1ZSQ A;  3KRX A;  1QQG A;  3DXD A;  2Q13 A;  1X05 A;  1XOD A;  1OY2 A;  1U5F A;  4GPT B;  1N3H A;  2EJ8 A;  2GS0 A;  5D27 A;  2YT1 A;  2DX1 A;  3PG7 A;  2AL6 A;  1XCG A;  1M7E A;  3HW2 B;  1W1D A;  3G9W A;  2DYQ A;  2GCL A;  4F7G A;  1X1F A;  2UZS A;  5D3X A;  1LB1 A;  3QIJ A;  5DIF B;  1ZM0 A;  5JHG A;  2J0M A;  3KRW A;  2ADZ A;  2EC1 A;  4EMO A;  1AWE A;  3QWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...