2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 7A
molecule tags Metal binding protein
source organism Homo sapiens
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
1RRPB 2ADZA 3AU4A 5GOWB 2D9WA 5DHAB 1P3RA 2D10A 3FM8C 1J0WA 1GC7A 1MK9B 5C6RA 2N23A 1MKEA 5D3WA 1LW3A 2D11A 1FB8A 2IFSA 2DTCA 1DBHA 2AL6A 2Z0QA 5J3YA 3ODWA 1EVHA 1RJ2A 3ML4A 1FHXA 2DHKA 1XODA 2EMTA 4HB3B 2DKQA 2RNRB 3LJUX 2OQBA 5KQ4A 5DH9B 1X05A 2W2XD 1WVHA 3AJ4A 4KAXB 4HAYB 3N7CA 3QBVB 3GYPA 2BCJA 2YT0A 4GMXB 2Z0OA 5J3TA 4HAVB 4Z2NA 2YT1A 4L6EA 2VKIA 2DX5A 2ZPYA 2E2XA 1WJMA 3BJIA 3HQCA 4A6HA 4EKUA 4PNKA 2NMBA 3A8PA 3QWMA 2LYDA 1V5MA 2YSZA 1UNRA 3P6AA 1OMWA 1PFJA 5C16A 1MIZB 1PLSA 1FHOA 1KZ7A 2K00A 1DDWA 3MDBC 2RVBB 1AQCA 1TJ6A 2DHJA 3QIJA 5DHFB 5C79A 1DYNA 4YL8A 1PMSA 4GXBA 4CHMA 1P6SA 5J3QA 3O96A 4HB2B 4WSFA 2G35A 2GCLA 5HE2A 1P5TA 1WGUA 2CY5A 3PVUA 2EC1A 4DX90 5CLQB 1V88A 3VOQA 2D9XA 2COFA 2DN6A 1BAKA 3OANA 1W1DA 1XX0A 3SV1A 1MAIA 3PZDA 2R09A 3T06A 1NI2A 4MK0A 4NY0A 1H4RA 4HAWB 2ELAA 3VIAA 1FGZA 4TYZA 2XQNM 4KVGB 2D2QA 3PSCA 5JLJB 4HHVA 3SUZA 3PVWA 1DROA 1Z87A 4PQ0A 1EAZA 4F7GA 2DLWA 5C5BA 4XWXA 2GJYA 2UVMA 1XR0B 1ZVRA 4Z2MB 1UEFA 2J0KA 2ROZB 1B55A 4F7UP 1QQGA 2Q13A 5CLLB 1MIXA 3F0WA 5D3XA 4P7IA 4HDQA 1SGHA 2D9YA 2CODA 3PP2A 1H10A 1Y19B 2W2WA 3DXEA 4EMOA 2GS0A 1FOEA 2Y8GA 3ULBA 3WYFB 2I1KA 2UZRA 2VSZA 2D9VA 3SO6A 5HE1A 2MKRA 2MDXA 1BTKA 2W2XC 2I5FA 3NSUA 3TO1A 1BWNA 3U8ZA 3DXDA 2N0YA 3ODOA 2V76A 3M1IB 2LOZA 2CY4A 4DX8A 1AWEA 1ZM0A 2YS3A 4DXAB 4ZRKA 2CRFA 2YRYA 4WVFB 2COAA 4A6FA 2DKPA 5DIFB 4HB4B 2JP2A 2LULA 1X1FA 2HE7A 5KQ1A 1UPQA 2YS1A 4F7HA 2RSGA 3GYOA 4K2PA 3D8FA 2LOXA 4HAZB 1I7AA 2RLOA 4HAXB 4GPTB 5FI1A 1K5GB 3CXBB 2PZ1A 2Z0PA 1KI1B 1J19A 1V5PA 2GCJA 4NSWA 3UZTA 3SYXA 1OY2A 1XD4A 1ZSQA 2DHIA 2MWNB 1M7EA 2QKMA 4A6KA 2CAYA 3CIKA 3ZVRA 3PG7A 3A8QA 2H7DA 1FGYA 2J0MA 4BBKA 1XCGA 5L81A 4ZRIA 3KZ1A 5LONB 1U5EA 1Q67A 3G9WA 4GN1A 3KY9A 3P7ZA 1ISNA 1FHWA 1WG7A 5EFXA 5FI0A 3TVVA 1BTNA 2COCA 2H7EA 2J0JA 4HDOA 2DYNA 2MFQA 5JHGA 2D9ZA 1DDVA 2M14A 1KZGA 2OTXA 1XKEA 1GC6A 1X86A 2P0DA 2KUPA 2DYQA 5KCVA 2EMSA 3KSYA 1W1GA 4D0NB 1V61A 3A98B 2M38A 3D8DA 2UZSA 2LKOA 1U2BA 4IFSA 5D3YA 3ULCA 1UNPA 1UPRA 1LB1A 2DFKA 1NTVA 2KGXB 4ZRJA 4MY6A 5DI9B 1GG3A 2J59M 1IRSA 1FAOA 4CHJA 2AEHA 3SNHA 1ZC3B 2FJLA 2I1JA 1N3HA 1QC6A 1EGXA 3ZDTA 2RGNB 1WJ1A 2YVCA 3HW2B 4EJNA 3PVLA 5C5BB 4CYEA 3AU5A 2VRWB 2QKLA 3D8EA 3TW1A 2ELBA 2YS5A 4HB0B 4MT7A 2KCJA 3X23A 1M7RA 4KHAA 2L1CA 1TQZA 4TKNA 1U29A 3PEGA 3MPXA 2YF0A 4GMVA 1WI1A 5HE3A 4KHBB 3V5WA 1WGQA 4B6HA 5JHHA 4H8SA 1U5FA 4C0AA 4KHOA 4YONA 1DDMA 1I2HA 1EF1A 4WJ7A 2P0FA 2R0DA 3TCAA 4HATB 2NZ8B 4IAPA 3TFMA 2P0HA 2I5CA 2P8VA 3BINA 4K2OA 2HTHB 4GZUA 4K81A 5JP4A 4Y94A 5LOPB 1TXDA 2Y7BA 2Y8FA 1ZC4B 1Y5OA 1UNQA 1E5WA 3FSSA 3WA0A 1U5DA 4IOYX 2D4QA 1V5UA 2L2IA 3ODXA 2RUKB 2K2UA 5D3VA 2EJ8A 3RCPA 1W1HA 4A5KA 4K17A 5HE0A 2X18A 1OQNA 1MPHA 2ROVA 2DA0A 2IYBA 2DX1A 4HAUB 2LG1A 3HK0A 1NTYA 1NU2A 1X1GA 2K2JA 3FEHA 5D27A 3KRWA 1SHCA 3DXCA 4DBBA 1MK7B 1U27A 3U7DA 1K5DB 1U5GA 3F5RA 3IVFA 3KRXA 1X11A 4A6FB 1V89A
chains in the Genus database with same CATH superfamily
1RRPB 4CSQA 2ADZA 3AU4A 5GOWB 2D9WA 2NBVA 5DHAB 1P3RA 2D10A 3FM8C 1J0WA 1GC7A 1MK9B 5C6RA 2N23A 1MKEA 5D3WA 1LW3A 2D11A 1FB8A 2IFSA 2DTCA 1DBHA 2AL6A 2Z0QA 5J3YA 3ODWA 5M4YB 1EVHA 1RJ2A 2KUQA 3ML4A 1FHXA 3A58A 2DHKA 1XODA 2EMTA 4HB3B 2DKQA 2RNRB 4KHBA 3LJUX 2OQBA 5KQ4A 5DH9B 1X05A 2W2XD 1WVHA 3AJ4A 4GNKB 4KAXB 4HAYB 4QJ4B 3N7CA 3QBVB 3GYPA 2BCJA 2YT0A 4GMXB 2Z0OA 5J3TA 4HAVB 4Z2NA 2KIGA 2YT1A 4L6EA 2VKIA 2DX5A 2ZPYA 2E2XA 2K8EA 1WJMA 2KR0A 3HIEA 1MI1A 3BJIA 3HQCA 4A6HA 4EKUA 4PNKA 2NMBA 3A8PA 3QWMA 2LYDA 1V5MA 2YSZA 1UNRA 3P6AA 1OMWA 1PFJA 5C16A 1MIZB 1PLSA 1FHOA 1KZ7A 2K00A 1DDWA 3MDBC 2RVBB 1AQCA 1TJ6A 2DHJA 3QIJA 5DHFB 5C79A 1DYNA 4YL8A 1PMSA 4GXBA 4CHMA 1P6SA 2K49A 5J3QA 3O96A 4HB2B 4WSFA 2G35A 2GCLA 5HE2A 4HSIA 1P5TA 5I2SA 1WGUA 2CY5A 3PVUA 2EC1A 4DX90 5CLQB 5LG4B 1V88A 3NWFA 3VOQA 2D9XA 2COFA 2DN6A 1BAKA 3OANA 4GOUA 1W1DA 1XX0A 3OHMB 3SV1A 2KIEA 1MAIA 3PZDA 2R09A 3T06A 1NI2A 4MK0A 4NY0A 1H4RA 4HAWB 3DCXA 2ELAA 3VIAA 1FGZA 4TYZA 2YT2A 2XQNM 4KVGB 2D2QA 3PSCA 5JLJB 4HHVA 3SUZA 3PVWA 1DROA 1Z87A 4PQ0A 1EAZA 4F7GA 2DLWA 5C5BA 4XWXA 2GJYA 2UVMA 1XR0B 1ZVRA 4Z2MB 1UEFA 2J0KA 2ROZB 1B55A 2GUMA 4F7UP 3U12A 1QQGA 2Q13A 5CLLB 1MIXA 3F0WA 5D3XA 4P7IA 4HDQA 1SGHA 2D9YA 2CODA 3PP2A 1H10A 1Y19B 2W2WA 3DXEA 4QJ5B 4EMOA 2GS0A 1FOEA 2Y8GA 3ULBA 3WYFB 2I1KA 2UZRA 2VSZA 2D9VA 3SO6A 5HE1A 2Z59A 3B77A 2MKRA 2MDXA 1BTKA 2W2XC 2I5FA 3NSUA 3TO1A 1BWNA 3U8ZA 3DXDA 2N0YA 3ODOA 2V76A 3M1IB 2LOZA 2CY4A 4DX8A 1AWEA 1ZM0A 2YS3A 4DXAB 4ZRKA 2CRFA 2YRYA 4WVFB 2COAA 4A6FA 2DKPA 5DIFB 4HB4B 2JP2A 2LULA 1X1FA 2HE7A 5KQ1A 1UPQA 2YS1A 4F7HA 4DIXA 2Z4DA 2RSGA 3GYOA 5I2MA 4OSNA 4K2PA 3D8FA 2LOXA 4HAZB 1I7AA 2RLOA 4HAXB 4GPTB 5FI1A 1K5GB 3CXBB 2PZ1A 2Z0PA 1KI1B 1J19A 1V5PA 2GCJA 4NSWA 1T77A 3UZTA 3SYXA 1OY2A 1XD4A 1ZSQA 2DHIA 2MWNB 3HSAA 1M7EA 2QKMA 4A6KA 2CAYA 3CIKA 3ZVRA 3FVCA 3PG7A 3A8QA 2H7DA 1FGYA 2J0MA 4BBKA 1XCGA 5L81A 4ZRIA 3KZ1A 5LONB 1U5EA 1Q67A 2FJUB 3G9WA 4GN1A 3KY9A 3P7ZA 1ISNA 1FHWA 1WG7A 5EFXA 5FI0A 3TVVA 1BTNA 2COCA 2H7EA 2J0JA 4HDOA 2DYNA 2RRFA 2MFQA 5JHGA 1ZYIA 2D9ZA 1DDVA 2M14A 1KZGA 2OTXA 1XKEA 1GC6A 1X86A 2P0DA 2KUPA 2DYQA 2ZKMX 5KCVA 2EMSA 3KSYA 1W1GA 4D0NB 1V61A 4QXAB 4OT1A 3A98B 2M38A 2Z14A 3D8DA 2UZSA 2LKOA 1U2BA 4IFSA 5D3YA 3ULCA 1UNPA 1UPRA 1LB1A 2DFKA 1NTVA 2KGXB 4ZRJA 4MY6A 5DI9B 1GG3A 2J59M 1IRSA 1FAOA 4CHJA 2AEHA 3SNHA 1ZC3B 2FJLA 2I1JA 1N3HA 1QC6A 1EGXA 3ZDTA 2RGNB 1WJ1A 2YVCA 3HW2B 4EJNA 3PVLA 5C5BB 4CYEA 3AU5A 2VRWB 2QKLA 3D8EA 3TW1A 2ELBA 2YS5A 4HB0B 4MT7A 2KCJA 3X23A 1M7RA 4KHAA 2L1CA 1TQZA 4TKNA 1U29A 3PEGA 3MPXA 2YF0A 4GMVA 1WI1A 5HE3A 4KHBB 3V5WA 1WGQA 4B6HA 5JHHA 4H8SA 1U5FA 4C0AA 4KHOA 4YONA 1DDMA 1I2HA 1EF1A 4WJ7A 2P0FA 2R0DA 3TCAA 4HATB 2NZ8B 4IAPA 3TFMA 2P0HA 2I5CA 2P8VA 3BINA 4K2OA 2HTHB 4GZUA 4K81A 5JP4A 4Y94A 5LOPB 1TXDA 2Y7BA 2Y8FA 1ZC4B 2Z13A 1Y5OA 1UNQA 1E5WA 4D6WA 3FSSA 3WA0A 1U5DA 4IOYX 2D4QA 1V5UA 2L2IA 3NWAA 2RUKB 3ODXA 4QJ3B 2K2UA 2R2YA 5D3VA 2EJ8A 3RCPA 5IRSA 1W1HA 4A5KA 4K17A 5HE0A 2X18A 1OQNA 1MPHA 2ROVA 3NWDA 2DA0A 2IYBA 2DX1A 4HAUB 2LG1A 3HK0A 1NTYA 1NU2A 1X1GA 2K2JA 3FEHA 5D27A 3KRWA 1SHCA 3DXCA 4DBBA 1MK7B 1U27A 3U7DA 1K5DB 1U5GA 3F5RA 3IVFA 4L1RA 3KRXA 1X11A 3NW8A 4A6FB 1V89A
chains in the Genus database with same CATH topology
1RRPB 2ADZA 3AU4A 5GOWB 2D9WA 5DHAB 1P3RA 2D10A 3FM8C 1J0WA 1GC7A 1MK9B 5C6RA 2N23A 1MKEA 5D3WA 1LW3A 2D11A 1FB8A 2IFSA 2DTCA 1DBHA 2AL6A 2Z0QA 5J3YA 3ODWA 1EVHA 1RJ2A 3ML4A 1FHXA 2DHKA 1XODA 2EMTA 4HB3B 2DKQA 2RNRB 3LJUX 2OQBA 5KQ4A 5DH9B 1X05A 2W2XD 1WVHA 3AJ4A 4KAXB 4HAYB 3N7CA 3QBVB 3GYPA 2BCJA 2YT0A 4GMXB 2Z0OA 5J3TA 4HAVB 4Z2NA 2YT1A 4L6EA 2VKIA 2DX5A 2ZPYA 2E2XA 1WJMA 3BJIA 3HQCA 4A6HA 4EKUA 4PNKA 2NMBA 3A8PA 3QWMA 2LYDA 1V5MA 2YSZA 1UNRA 3P6AA 1OMWA 1PFJA 5C16A 1MIZB 1PLSA 1FHOA 1KZ7A 2K00A 1DDWA 3MDBC 2RVBB 1AQCA 1TJ6A 2DHJA 3QIJA 5DHFB 5C79A 1DYNA 4YL8A 1PMSA 4GXBA 4CHMA 1P6SA 5J3QA 3O96A 4HB2B 4WSFA 2G35A 2GCLA 5HE2A 1P5TA 1WGUA 2CY5A 3PVUA 2EC1A 4DX90 5CLQB 1V88A 3VOQA 2D9XA 2COFA 2DN6A 1BAKA 3OANA 1W1DA 1XX0A 3SV1A 1MAIA 3PZDA 2R09A 3T06A 1NI2A 4MK0A 4NY0A 1H4RA 4HAWB 2ELAA 3VIAA 1FGZA 4TYZA 2XQNM 4KVGB 2D2QA 3PSCA 5JLJB 4HHVA 3SUZA 3PVWA 1DROA 1Z87A 4PQ0A 1EAZA 4F7GA 2DLWA 5C5BA 4XWXA 2GJYA 2UVMA 1XR0B 1ZVRA 4Z2MB 1UEFA 2J0KA 2ROZB 1B55A 4F7UP 1QQGA 2Q13A 5CLLB 1MIXA 3F0WA 5D3XA 4P7IA 4HDQA 1SGHA 2D9YA 2CODA 3PP2A 1H10A 1Y19B 2W2WA 3DXEA 4EMOA 2GS0A 1FOEA 2Y8GA 3ULBA 3WYFB 2I1KA 2UZRA 2VSZA 2D9VA 3SO6A 5HE1A 2MKRA 2MDXA 1BTKA 2W2XC 2I5FA 3NSUA 3TO1A 1BWNA 3U8ZA 3DXDA 2N0YA 3ODOA 2V76A 3M1IB 2LOZA 2CY4A 4DX8A 1AWEA 1ZM0A 2YS3A 4DXAB 4ZRKA 2CRFA 2YRYA 4WVFB 2COAA 4A6FA 2DKPA 5DIFB 4HB4B 2JP2A 2LULA 1X1FA 2HE7A 5KQ1A 1UPQA 2YS1A 4F7HA 2RSGA 3GYOA 4K2PA 3D8FA 2LOXA 4HAZB 1I7AA 2RLOA 4HAXB 4GPTB 5FI1A 1K5GB 3CXBB 2PZ1A 2Z0PA 1KI1B 1J19A 1V5PA 2GCJA 4NSWA 3UZTA 3SYXA 1OY2A 1XD4A 1ZSQA 2DHIA 2MWNB 1M7EA 2QKMA 4A6KA 2CAYA 3CIKA 3ZVRA 3PG7A 3A8QA 2H7DA 1FGYA 2J0MA 4BBKA 1XCGA 5L81A 4ZRIA 3KZ1A 5LONB 1U5EA 1Q67A 3G9WA 4GN1A 3KY9A 3P7ZA 1ISNA 1FHWA 1WG7A 5EFXA 5FI0A 3TVVA 1BTNA 2COCA 2H7EA 2J0JA 4HDOA 2DYNA 2MFQA 5JHGA 2D9ZA 1DDVA 2M14A 1KZGA 2OTXA 1XKEA 1GC6A 1X86A 2P0DA 2KUPA 2DYQA 5KCVA 2EMSA 3KSYA 1W1GA 4D0NB 1V61A 3A98B 2M38A 3D8DA 2UZSA 2LKOA 1U2BA 4IFSA 5D3YA 3ULCA 1UNPA 1UPRA 1LB1A 2DFKA 1NTVA 2KGXB 4ZRJA 4MY6A 5DI9B 1GG3A 2J59M 1IRSA 1FAOA 4CHJA 2AEHA 3SNHA 1ZC3B 2FJLA 2I1JA 1N3HA 1QC6A 1EGXA 3ZDTA 2RGNB 1WJ1A 2YVCA 3HW2B 4EJNA 3PVLA 5C5BB 4CYEA 3AU5A 2VRWB 2QKLA 3D8EA 3TW1A 2ELBA 2YS5A 4HB0B 4MT7A 2KCJA 3X23A 1M7RA 4KHAA 2L1CA 1TQZA 4TKNA 1U29A 3PEGA 3MPXA 2YF0A 4GMVA 1WI1A 5HE3A 4KHBB 3V5WA 1WGQA 4B6HA 5JHHA 4H8SA 1U5FA 4C0AA 4KHOA 4YONA 1DDMA 1I2HA 1EF1A 4WJ7A 2P0FA 2R0DA 3TCAA 4HATB 2NZ8B 4IAPA 3TFMA 2P0HA 2I5CA 2P8VA 3BINA 4K2OA 2HTHB 4GZUA 4K81A 5JP4A 4Y94A 5LOPB 1TXDA 2Y7BA 2Y8FA 1ZC4B 1Y5OA 1UNQA 1E5WA 3FSSA 3WA0A 1U5DA 4IOYX 2D4QA 1V5UA 2L2IA 3ODXA 2RUKB 2K2UA 5D3VA 2EJ8A 3RCPA 1W1HA 4A5KA 4K17A 5HE0A 2X18A 1OQNA 1MPHA 2ROVA 2DA0A 2IYBA 2DX1A 4HAUB 2LG1A 3HK0A 1NTYA 1NU2A 1X1GA 2K2JA 3FEHA 5D27A 3KRWA 1SHCA 3DXCA 4DBBA 1MK7B 1U27A 3U7DA 1K5DB 1U5GA 3F5RA 3IVFA 3KRXA 1X11A 4A6FB 1V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRP B;  2ADZ A;  3AU4 A;  5GOW B;  2D9W A;  5DHA B;  1P3R A;  2D10 A;  3FM8 C;  1J0W A;  1GC7 A;  1MK9 B;  5C6R A;  2N23 A;  1MKE A;  5D3W A;  1LW3 A;  2D11 A;  1FB8 A;  2IFS A;  2DTC A;  1DBH A;  2AL6 A;  2Z0Q A;  5J3Y A;  3ODW A;  1EVH A;  1RJ2 A;  3ML4 A;  1FHX A;  2DHK A;  1XOD A;  2EMT A;  4HB3 B;  2DKQ A;  2RNR B;  3LJU X;  2OQB A;  5KQ4 A;  5DH9 B;  1X05 A;  2W2X D;  1WVH A;  3AJ4 A;  4KAX B;  4HAY B;  3N7C A;  3QBV B;  3GYP A;  2BCJ A;  2YT0 A;  4GMX B;  2Z0O A;  5J3T A;  4HAV B;  4Z2N A;  2YT1 A;  4L6E A;  2VKI A;  2DX5 A;  2ZPY A;  2E2X A;  1WJM A;  3BJI A;  3HQC A;  4A6H A;  4EKU A;  4PNK A;  2NMB A;  3A8P A;  3QWM A;  2LYD A;  1V5M A;  2YSZ A;  1UNR A;  3P6A A;  1OMW A;  1PFJ A;  5C16 A;  1MIZ B;  1PLS A;  1FHO A;  1KZ7 A;  2K00 A;  1DDW A;  3MDB C;  2RVB B;  1AQC A;  1TJ6 A;  2DHJ A;  3QIJ A;  5DHF B;  5C79 A;  1DYN A;  4YL8 A;  1PMS A;  4GXB A;  4CHM A;  1P6S A;  5J3Q A;  3O96 A;  4HB2 B;  4WSF A;  2G35 A;  2GCL A;  5HE2 A;  1P5T A;  1WGU A;  2CY5 A;  3PVU A;  2EC1 A;  4DX9 0;  5CLQ B;  1V88 A;  3VOQ A;  2D9X A;  2COF A;  2DN6 A;  1BAK A;  3OAN A;  1W1D A;  1XX0 A;  3SV1 A;  1MAI A;  3PZD A;  2R09 A;  3T06 A;  1NI2 A;  4MK0 A;  4NY0 A;  1H4R A;  4HAW B;  2ELA A;  3VIA A;  1FGZ A;  4TYZ A;  2XQN M;  4KVG B;  2D2Q A;  3PSC A;  5JLJ B;  4HHV A;  3SUZ A;  3PVW A;  1DRO A;  1Z87 A;  4PQ0 A;  1EAZ A;  4F7G A;  2DLW A;  5C5B A;  4XWX A;  2GJY A;  2UVM A;  1XR0 B;  1ZVR A;  4Z2M B;  1UEF A;  2J0K A;  2ROZ B;  1B55 A;  4F7U P;  1QQG A;  2Q13 A;  5CLL B;  1MIX A;  3F0W A;  5D3X A;  4P7I A;  4HDQ A;  1SGH A;  2D9Y A;  2COD A;  3PP2 A;  1H10 A;  1Y19 B;  2W2W A;  3DXE A;  4EMO A;  2GS0 A;  1FOE A;  2Y8G A;  3ULB A;  3WYF B;  2I1K A;  2UZR A;  2VSZ A;  2D9V A;  3SO6 A;  5HE1 A;  2MKR A;  2MDX A;  1BTK A;  2W2X C;  2I5F A;  3NSU A;  3TO1 A;  1BWN A;  3U8Z A;  3DXD A;  2N0Y A;  3ODO A;  2V76 A;  3M1I B;  2LOZ A;  2CY4 A;  4DX8 A;  1AWE A;  1ZM0 A;  2YS3 A;  4DXA B;  4ZRK A;  2CRF A;  2YRY A;  4WVF B;  2COA A;  4A6F A;  2DKP A;  5DIF B;  4HB4 B;  2JP2 A;  2LUL A;  1X1F A;  2HE7 A;  5KQ1 A;  1UPQ A;  2YS1 A;  4F7H A;  2RSG A;  3GYO A;  4K2P A;  3D8F A;  2LOX A;  4HAZ B;  1I7A A;  2RLO A;  4HAX B;  4GPT B;  5FI1 A;  1K5G B;  3CXB B;  2PZ1 A;  2Z0P A;  1KI1 B;  1J19 A;  1V5P A;  2GCJ A;  4NSW A;  3UZT A;  3SYX A;  1OY2 A;  1XD4 A;  1ZSQ A;  2DHI A;  2MWN B;  1M7E A;  2QKM A;  4A6K A;  2CAY A;  3CIK A;  3ZVR A;  3PG7 A;  3A8Q A;  2H7D A;  1FGY A;  2J0M A;  4BBK A;  1XCG A;  5L81 A;  4ZRI A;  3KZ1 A;  5LON B;  1U5E A;  1Q67 A;  3G9W A;  4GN1 A;  3KY9 A;  3P7Z A;  1ISN A;  1FHW A;  1WG7 A;  5EFX A;  5FI0 A;  3TVV A;  1BTN A;  2COC A;  2H7E A;  2J0J A;  4HDO A;  2DYN A;  2MFQ A;  5JHG A;  2D9Z A;  1DDV A;  2M14 A;  1KZG A;  2OTX A;  1XKE A;  1GC6 A;  1X86 A;  2P0D A;  2KUP A;  2DYQ A;  5KCV A;  2EMS A;  3KSY A;  1W1G A;  4D0N B;  1V61 A;  3A98 B;  2M38 A;  3D8D A;  2UZS A;  2LKO A;  1U2B A;  4IFS A;  5D3Y A;  3ULC A;  1UNP A;  1UPR A;  1LB1 A;  2DFK A;  1NTV A;  2KGX B;  4ZRJ A;  4MY6 A;  5DI9 B;  1GG3 A;  2J59 M;  1IRS A;  1FAO A;  4CHJ A;  2AEH A;  3SNH A;  1ZC3 B;  2FJL A;  2I1J A;  1N3H A;  1QC6 A;  1EGX A;  3ZDT A;  2RGN B;  1WJ1 A;  2YVC A;  3HW2 B;  4EJN A;  3PVL A;  5C5B B;  4CYE A;  3AU5 A;  2VRW B;  2QKL A;  3D8E A;  3TW1 A;  2ELB A;  2YS5 A;  4HB0 B;  4MT7 A;  2KCJ A;  3X23 A;  1M7R A;  4KHA A;  2L1C A;  1TQZ A;  4TKN A;  1U29 A;  3PEG A;  3MPX A;  2YF0 A;  4GMV A;  1WI1 A;  5HE3 A;  4KHB B;  3V5W A;  1WGQ A;  4B6H A;  5JHH A;  4H8S A;  1U5F A;  4C0A A;  4KHO A;  4YON A;  1DDM A;  1I2H A;  1EF1 A;  4WJ7 A;  2P0F A;  2R0D A;  3TCA A;  4HAT B;  2NZ8 B;  4IAP A;  3TFM A;  2P0H A;  2I5C A;  2P8V A;  3BIN A;  4K2O A;  2HTH B;  4GZU A;  4K81 A;  5JP4 A;  4Y94 A;  5LOP B;  1TXD A;  2Y7B A;  2Y8F A;  1ZC4 B;  1Y5O A;  1UNQ A;  1E5W A;  3FSS A;  3WA0 A;  1U5D A;  4IOY X;  2D4Q A;  1V5U A;  2L2I A;  3ODX A;  2RUK B;  2K2U A;  5D3V A;  2EJ8 A;  3RCP A;  1W1H A;  4A5K A;  4K17 A;  5HE0 A;  2X18 A;  1OQN A;  1MPH A;  2ROV A;  2DA0 A;  2IYB A;  2DX1 A;  4HAU B;  2LG1 A;  3HK0 A;  1NTY A;  1NU2 A;  1X1G A;  2K2J A;  3FEH A;  5D27 A;  3KRW A;  1SHC A;  3DXC A;  4DBB A;  1MK7 B;  1U27 A;  3U7D A;  1K5D B;  1U5G A;  3F5R A;  3IVF A;  3KRX A;  1X11 A;  4A6F B;  1V89 A; 
#chains in the Genus database with same CATH topology
 1RRP B;  4CSQ A;  2ADZ A;  3AU4 A;  5GOW B;  2D9W A;  2NBV A;  5DHA B;  1P3R A;  2D10 A;  3FM8 C;  1J0W A;  1GC7 A;  1MK9 B;  5C6R A;  2N23 A;  1MKE A;  5D3W A;  1LW3 A;  2D11 A;  1FB8 A;  2IFS A;  2DTC A;  1DBH A;  2AL6 A;  2Z0Q A;  5J3Y A;  3ODW A;  5M4Y B;  1EVH A;  1RJ2 A;  2KUQ A;  3ML4 A;  1FHX A;  3A58 A;  2DHK A;  1XOD A;  2EMT A;  4HB3 B;  2DKQ A;  2RNR B;  4KHB A;  3LJU X;  2OQB A;  5KQ4 A;  5DH9 B;  1X05 A;  2W2X D;  1WVH A;  3AJ4 A;  4GNK B;  4KAX B;  4HAY B;  4QJ4 B;  3N7C A;  3QBV B;  3GYP A;  2BCJ A;  2YT0 A;  4GMX B;  2Z0O A;  5J3T A;  4HAV B;  4Z2N A;  2KIG A;  2YT1 A;  4L6E A;  2VKI A;  2DX5 A;  2ZPY A;  2E2X A;  2K8E A;  1WJM A;  2KR0 A;  3HIE A;  1MI1 A;  3BJI A;  3HQC A;  4A6H A;  4EKU A;  4PNK A;  2NMB A;  3A8P A;  3QWM A;  2LYD A;  1V5M A;  2YSZ A;  1UNR A;  3P6A A;  1OMW A;  1PFJ A;  5C16 A;  1MIZ B;  1PLS A;  1FHO A;  1KZ7 A;  2K00 A;  1DDW A;  3MDB C;  2RVB B;  1AQC A;  1TJ6 A;  2DHJ A;  3QIJ A;  5DHF B;  5C79 A;  1DYN A;  4YL8 A;  1PMS A;  4GXB A;  4CHM A;  1P6S A;  2K49 A;  5J3Q A;  3O96 A;  4HB2 B;  4WSF A;  2G35 A;  2GCL A;  5HE2 A;  4HSI A;  1P5T A;  5I2S A;  1WGU A;  2CY5 A;  3PVU A;  2EC1 A;  4DX9 0;  5CLQ B;  5LG4 B;  1V88 A;  3NWF A;  3VOQ A;  2D9X A;  2COF A;  2DN6 A;  1BAK A;  3OAN A;  4GOU A;  1W1D A;  1XX0 A;  3OHM B;  3SV1 A;  2KIE A;  1MAI A;  3PZD A;  2R09 A;  3T06 A;  1NI2 A;  4MK0 A;  4NY0 A;  1H4R A;  4HAW B;  3DCX A;  2ELA A;  3VIA A;  1FGZ A;  4TYZ A;  2YT2 A;  2XQN M;  4KVG B;  2D2Q A;  3PSC A;  5JLJ B;  4HHV A;  3SUZ A;  3PVW A;  1DRO A;  1Z87 A;  4PQ0 A;  1EAZ A;  4F7G A;  2DLW A;  5C5B A;  4XWX A;  2GJY A;  2UVM A;  1XR0 B;  1ZVR A;  4Z2M B;  1UEF A;  2J0K A;  2ROZ B;  1B55 A;  2GUM A;  4F7U P;  3U12 A;  1QQG A;  2Q13 A;  5CLL B;  1MIX A;  3F0W A;  5D3X A;  4P7I A;  4HDQ A;  1SGH A;  2D9Y A;  2COD A;  3PP2 A;  1H10 A;  1Y19 B;  2W2W A;  3DXE A;  4QJ5 B;  4EMO A;  2GS0 A;  1FOE A;  2Y8G A;  3ULB A;  3WYF B;  2I1K A;  2UZR A;  2VSZ A;  2D9V A;  3SO6 A;  5HE1 A;  2Z59 A;  3B77 A;  2MKR A;  2MDX A;  1BTK A;  2W2X C;  2I5F A;  3NSU A;  3TO1 A;  1BWN A;  3U8Z A;  3DXD A;  2N0Y A;  3ODO A;  2V76 A;  3M1I B;  2LOZ A;  2CY4 A;  4DX8 A;  1AWE A;  1ZM0 A;  2YS3 A;  4DXA B;  4ZRK A;  2CRF A;  2YRY A;  4WVF B;  2COA A;  4A6F A;  2DKP A;  5DIF B;  4HB4 B;  2JP2 A;  2LUL A;  1X1F A;  2HE7 A;  5KQ1 A;  1UPQ A;  2YS1 A;  4F7H A;  4DIX A;  2Z4D A;  2RSG A;  3GYO A;  5I2M A;  4OSN A;  4K2P A;  3D8F A;  2LOX A;  4HAZ B;  1I7A A;  2RLO A;  4HAX B;  4GPT B;  5FI1 A;  1K5G B;  3CXB B;  2PZ1 A;  2Z0P A;  1KI1 B;  1J19 A;  1V5P A;  2GCJ A;  4NSW A;  1T77 A;  3UZT A;  3SYX A;  1OY2 A;  1XD4 A;  1ZSQ A;  2DHI A;  2MWN B;  3HSA A;  1M7E A;  2QKM A;  4A6K A;  2CAY A;  3CIK A;  3ZVR A;  3FVC A;  3PG7 A;  3A8Q A;  2H7D A;  1FGY A;  2J0M A;  4BBK A;  1XCG A;  5L81 A;  4ZRI A;  3KZ1 A;  5LON B;  1U5E A;  1Q67 A;  2FJU B;  3G9W A;  4GN1 A;  3KY9 A;  3P7Z A;  1ISN A;  1FHW A;  1WG7 A;  5EFX A;  5FI0 A;  3TVV A;  1BTN A;  2COC A;  2H7E A;  2J0J A;  4HDO A;  2DYN A;  2RRF A;  2MFQ A;  5JHG A;  1ZYI A;  2D9Z A;  1DDV A;  2M14 A;  1KZG A;  2OTX A;  1XKE A;  1GC6 A;  1X86 A;  2P0D A;  2KUP A;  2DYQ A;  2ZKM X;  5KCV A;  2EMS A;  3KSY A;  1W1G A;  4D0N B;  1V61 A;  4QXA B;  4OT1 A;  3A98 B;  2M38 A;  2Z14 A;  3D8D A;  2UZS A;  2LKO A;  1U2B A;  4IFS A;  5D3Y A;  3ULC A;  1UNP A;  1UPR A;  1LB1 A;  2DFK A;  1NTV A;  2KGX B;  4ZRJ A;  4MY6 A;  5DI9 B;  1GG3 A;  2J59 M;  1IRS A;  1FAO A;  4CHJ A;  2AEH A;  3SNH A;  1ZC3 B;  2FJL A;  2I1J A;  1N3H A;  1QC6 A;  1EGX A;  3ZDT A;  2RGN B;  1WJ1 A;  2YVC A;  3HW2 B;  4EJN A;  3PVL A;  5C5B B;  4CYE A;  3AU5 A;  2VRW B;  2QKL A;  3D8E A;  3TW1 A;  2ELB A;  2YS5 A;  4HB0 B;  4MT7 A;  2KCJ A;  3X23 A;  1M7R A;  4KHA A;  2L1C A;  1TQZ A;  4TKN A;  1U29 A;  3PEG A;  3MPX A;  2YF0 A;  4GMV A;  1WI1 A;  5HE3 A;  4KHB B;  3V5W A;  1WGQ A;  4B6H A;  5JHH A;  4H8S A;  1U5F A;  4C0A A;  4KHO A;  4YON A;  1DDM A;  1I2H A;  1EF1 A;  4WJ7 A;  2P0F A;  2R0D A;  3TCA A;  4HAT B;  2NZ8 B;  4IAP A;  3TFM A;  2P0H A;  2I5C A;  2P8V A;  3BIN A;  4K2O A;  2HTH B;  4GZU A;  4K81 A;  5JP4 A;  4Y94 A;  5LOP B;  1TXD A;  2Y7B A;  2Y8F A;  1ZC4 B;  2Z13 A;  1Y5O A;  1UNQ A;  1E5W A;  4D6W A;  3FSS A;  3WA0 A;  1U5D A;  4IOY X;  2D4Q A;  1V5U A;  2L2I A;  3NWA A;  2RUK B;  3ODX A;  4QJ3 B;  2K2U A;  2R2Y A;  5D3V A;  2EJ8 A;  3RCP A;  5IRS A;  1W1H A;  4A5K A;  4K17 A;  5HE0 A;  2X18 A;  1OQN A;  1MPH A;  2ROV A;  3NWD A;  2DA0 A;  2IYB A;  2DX1 A;  4HAU B;  2LG1 A;  3HK0 A;  1NTY A;  1NU2 A;  1X1G A;  2K2J A;  3FEH A;  5D27 A;  3KRW A;  1SHC A;  3DXC A;  4DBB A;  1MK7 B;  1U27 A;  3U7D A;  1K5D B;  1U5G A;  3F5R A;  3IVF A;  4L1R A;  3KRX A;  1X11 A;  3NW8 A;  4A6F B;  1V89 A; 
#chains in the Genus database with same CATH homology
 1RRP B;  2ADZ A;  3AU4 A;  5GOW B;  2D9W A;  5DHA B;  1P3R A;  2D10 A;  3FM8 C;  1J0W A;  1GC7 A;  1MK9 B;  5C6R A;  2N23 A;  1MKE A;  5D3W A;  1LW3 A;  2D11 A;  1FB8 A;  2IFS A;  2DTC A;  1DBH A;  2AL6 A;  2Z0Q A;  5J3Y A;  3ODW A;  1EVH A;  1RJ2 A;  3ML4 A;  1FHX A;  2DHK A;  1XOD A;  2EMT A;  4HB3 B;  2DKQ A;  2RNR B;  3LJU X;  2OQB A;  5KQ4 A;  5DH9 B;  1X05 A;  2W2X D;  1WVH A;  3AJ4 A;  4KAX B;  4HAY B;  3N7C A;  3QBV B;  3GYP A;  2BCJ A;  2YT0 A;  4GMX B;  2Z0O A;  5J3T A;  4HAV B;  4Z2N A;  2YT1 A;  4L6E A;  2VKI A;  2DX5 A;  2ZPY A;  2E2X A;  1WJM A;  3BJI A;  3HQC A;  4A6H A;  4EKU A;  4PNK A;  2NMB A;  3A8P A;  3QWM A;  2LYD A;  1V5M A;  2YSZ A;  1UNR A;  3P6A A;  1OMW A;  1PFJ A;  5C16 A;  1MIZ B;  1PLS A;  1FHO A;  1KZ7 A;  2K00 A;  1DDW A;  3MDB C;  2RVB B;  1AQC A;  1TJ6 A;  2DHJ A;  3QIJ A;  5DHF B;  5C79 A;  1DYN A;  4YL8 A;  1PMS A;  4GXB A;  4CHM A;  1P6S A;  5J3Q A;  3O96 A;  4HB2 B;  4WSF A;  2G35 A;  2GCL A;  5HE2 A;  1P5T A;  1WGU A;  2CY5 A;  3PVU A;  2EC1 A;  4DX9 0;  5CLQ B;  1V88 A;  3VOQ A;  2D9X A;  2COF A;  2DN6 A;  1BAK A;  3OAN A;  1W1D A;  1XX0 A;  3SV1 A;  1MAI A;  3PZD A;  2R09 A;  3T06 A;  1NI2 A;  4MK0 A;  4NY0 A;  1H4R A;  4HAW B;  2ELA A;  3VIA A;  1FGZ A;  4TYZ A;  2XQN M;  4KVG B;  2D2Q A;  3PSC A;  5JLJ B;  4HHV A;  3SUZ A;  3PVW A;  1DRO A;  1Z87 A;  4PQ0 A;  1EAZ A;  4F7G A;  2DLW A;  5C5B A;  4XWX A;  2GJY A;  2UVM A;  1XR0 B;  1ZVR A;  4Z2M B;  1UEF A;  2J0K A;  2ROZ B;  1B55 A;  4F7U P;  1QQG A;  2Q13 A;  5CLL B;  1MIX A;  3F0W A;  5D3X A;  4P7I A;  4HDQ A;  1SGH A;  2D9Y A;  2COD A;  3PP2 A;  1H10 A;  1Y19 B;  2W2W A;  3DXE A;  4EMO A;  2GS0 A;  1FOE A;  2Y8G A;  3ULB A;  3WYF B;  2I1K A;  2UZR A;  2VSZ A;  2D9V A;  3SO6 A;  5HE1 A;  2MKR A;  2MDX A;  1BTK A;  2W2X C;  2I5F A;  3NSU A;  3TO1 A;  1BWN A;  3U8Z A;  3DXD A;  2N0Y A;  3ODO A;  2V76 A;  3M1I B;  2LOZ A;  2CY4 A;  4DX8 A;  1AWE A;  1ZM0 A;  2YS3 A;  4DXA B;  4ZRK A;  2CRF A;  2YRY A;  4WVF B;  2COA A;  4A6F A;  2DKP A;  5DIF B;  4HB4 B;  2JP2 A;  2LUL A;  1X1F A;  2HE7 A;  5KQ1 A;  1UPQ A;  2YS1 A;  4F7H A;  2RSG A;  3GYO A;  4K2P A;  3D8F A;  2LOX A;  4HAZ B;  1I7A A;  2RLO A;  4HAX B;  4GPT B;  5FI1 A;  1K5G B;  3CXB B;  2PZ1 A;  2Z0P A;  1KI1 B;  1J19 A;  1V5P A;  2GCJ A;  4NSW A;  3UZT A;  3SYX A;  1OY2 A;  1XD4 A;  1ZSQ A;  2DHI A;  2MWN B;  1M7E A;  2QKM A;  4A6K A;  2CAY A;  3CIK A;  3ZVR A;  3PG7 A;  3A8Q A;  2H7D A;  1FGY A;  2J0M A;  4BBK A;  1XCG A;  5L81 A;  4ZRI A;  3KZ1 A;  5LON B;  1U5E A;  1Q67 A;  3G9W A;  4GN1 A;  3KY9 A;  3P7Z A;  1ISN A;  1FHW A;  1WG7 A;  5EFX A;  5FI0 A;  3TVV A;  1BTN A;  2COC A;  2H7E A;  2J0J A;  4HDO A;  2DYN A;  2MFQ A;  5JHG A;  2D9Z A;  1DDV A;  2M14 A;  1KZG A;  2OTX A;  1XKE A;  1GC6 A;  1X86 A;  2P0D A;  2KUP A;  2DYQ A;  5KCV A;  2EMS A;  3KSY A;  1W1G A;  4D0N B;  1V61 A;  3A98 B;  2M38 A;  3D8D A;  2UZS A;  2LKO A;  1U2B A;  4IFS A;  5D3Y A;  3ULC A;  1UNP A;  1UPR A;  1LB1 A;  2DFK A;  1NTV A;  2KGX B;  4ZRJ A;  4MY6 A;  5DI9 B;  1GG3 A;  2J59 M;  1IRS A;  1FAO A;  4CHJ A;  2AEH A;  3SNH A;  1ZC3 B;  2FJL A;  2I1J A;  1N3H A;  1QC6 A;  1EGX A;  3ZDT A;  2RGN B;  1WJ1 A;  2YVC A;  3HW2 B;  4EJN A;  3PVL A;  5C5B B;  4CYE A;  3AU5 A;  2VRW B;  2QKL A;  3D8E A;  3TW1 A;  2ELB A;  2YS5 A;  4HB0 B;  4MT7 A;  2KCJ A;  3X23 A;  1M7R A;  4KHA A;  2L1C A;  1TQZ A;  4TKN A;  1U29 A;  3PEG A;  3MPX A;  2YF0 A;  4GMV A;  1WI1 A;  5HE3 A;  4KHB B;  3V5W A;  1WGQ A;  4B6H A;  5JHH A;  4H8S A;  1U5F A;  4C0A A;  4KHO A;  4YON A;  1DDM A;  1I2H A;  1EF1 A;  4WJ7 A;  2P0F A;  2R0D A;  3TCA A;  4HAT B;  2NZ8 B;  4IAP A;  3TFM A;  2P0H A;  2I5C A;  2P8V A;  3BIN A;  4K2O A;  2HTH B;  4GZU A;  4K81 A;  5JP4 A;  4Y94 A;  5LOP B;  1TXD A;  2Y7B A;  2Y8F A;  1ZC4 B;  1Y5O A;  1UNQ A;  1E5W A;  3FSS A;  3WA0 A;  1U5D A;  4IOY X;  2D4Q A;  1V5U A;  2L2I A;  3ODX A;  2RUK B;  2K2U A;  5D3V A;  2EJ8 A;  3RCP A;  1W1H A;  4A5K A;  4K17 A;  5HE0 A;  2X18 A;  1OQN A;  1MPH A;  2ROV A;  2DA0 A;  2IYB A;  2DX1 A;  4HAU B;  2LG1 A;  3HK0 A;  1NTY A;  1NU2 A;  1X1G A;  2K2J A;  3FEH A;  5D27 A;  3KRW A;  1SHC A;  3DXC A;  4DBB A;  1MK7 B;  1U27 A;  3U7D A;  1K5D B;  1U5G A;  3F5R A;  3IVF A;  3KRX A;  1X11 A;  4A6F B;  1V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...