2XQNM

Complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
AARMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords ACTIN-LIKE PROTEIN 7A
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2xqnM00
2YVCA 1WGUA 4KVGB 1PLSA 1PMSA 2I1JA 4EKUA 1TXDA 3OANA 2GCJA 2DTCA 5J3QA 2Z0QA 4NY0A 2ZPYA 1XODA 5C5BB 2L2IA 5KCVA 2RLOA 1MK7B 3ZDTA 3HK0A 1RJ2A 4KHAA 2NMBA 2W2XC 3MDBC 2P0DA 4GMVA 1UPQA 2X18A 2ROVA 1GC6A 1U2BA 4IAPA 4HHVA 4WSFA 5DH9B 1MIXA 3CXBB 4GN1A 3U8ZA 2LYDA 2RNRB 2CY5A 2BCJA 2JP2A 3PVUA 4A6FA 1P5TA 3D8FA 3SV1A 4KHOA 1FOEA 1E5WA 1KZGA 2IYBA 2I1KA 4L6EA 2H7DA 4DX90 3PVLA 5C6RA 2COCA 4IFSA 4HDOA 5D3YA 2QKLA 1TQZA 3A8PA 3HQCA 3KY9A 2CAYA 1J19A 1UEFA 4MT7A 1OMWA 2J0MA 1WJ1A 2J59M 3O96A 5J3YA 3SUZA 1W1GA 2J0KA 2VRWB 4C0AA 1XR0B 4H8SA 1MIZB 4HB2B 1N3HA 2R0DA 1LB1A 3LJUX 4D0NB 5HE2A 4F7GA 4K81A 1I2HA 2YSZA 1V89A 2DYQA 1UNRA 3WA0A 2OQBA 1WG7A 1UPRA 2W2XD 3SO6A 1TJ6A 4HB4B 4DBBA 4F7UP 3TO1A 2CY4A 1K5GB 1FGZA 4K2PA 3UZTA 1KZ7A 4HB0B 1UNPA 3KRXA 1AWEA 2DX1A 2GJYA 1X1GA 2M14A 2YT1A 1LW3A 1GC7A 3TVVA 1XCGA 3D8EA 5KQ1A 3F0WA 2LOZA 2DN6A 1V5MA 3GYOA 2D2QA 1DDWA 5DHFB 2DKPA 2Z0OA 3G9WA 3PG7A 2KGXB 4A6KA 1IRSA 4PQ0A 2Z0PA 4Z2NA 3HW2B 2H7EA 4HB3B 2K00A 4HAWB 1KI1B 3ODOA 5D3VA 1ZSQA 1Q67A 1GG3A 2P0FA 4B6HA 2L1CA 4HAVB 2N0YA 1WGQA 1EVHA 4CHMA 3SNHA 5L81A 2DYNA 1WI1A 3IVFA 2J0JA 2P8VA 3VOQA 4F7HA 1XD4A 3D8DA 4HDQA 3ODXA 1DBHA 5D3WA 4HAZB 4DXAB 3KZ1A 4Z2MB 1FGYA 1U5FA 5C79A 3RCPA 2ADZA 4TKNA 1EAZA 1X1FA 1U5EA 3P6AA 2COFA 3TW1A 1QQGA 2UZRA 2D10A 4HAXB 3FEHA 1BTNA 1W1DA 1NTVA 4HAUB 4XWXA 4K2OA 2Y7BA 4KHBB 2UVMA 1RRPB 4IOYX 1EF1A 1H10A 5LOPB 2Y8GA 4ZRKA 4KAXB 1U29A 4ZRIA 1DROA 3BJIA 1W1HA 4K17A 5DIFB 3TFMA 2LKOA 4GPTB 2K2JA 1XKEA 3ODWA 2D9XA 2IFSA 2YS5A 2G35A 2ELAA 2LG1A 1U5GA 2NZ8B 1AQCA 3PEGA 3PZDA 1U27A 1DDMA 1FAOA 4HATB 2MKRA 4ZRJA 3PSCA 3A8QA 1M7EA 4MK0A 2KCJA 2EMTA 5GOWB 5HE1A 1ZC3B 1V5UA 3FM8C 4MY6A 2D9ZA 4DX8A 5JLJB 2VSZA 2DHIA 4EMOA 2RGNB 3QBVB 4YONA 5D27A 2OTXA 1X11A 2ROZB 5DHAB 1V88A 3QIJA 4YL8A 3FSSA 1XX0A 1BAKA 5JP4A 3GYPA 1ISNA 3ULCA 2DLWA 2N23A 3MPXA 3M1IB 2YRYA 5HE3A 5KQ4A 2Y8FA 2PZ1A 2YT0A 2AEHA 2EC1A 2HTHB 4A6FB 2HE7A 3F5RA 1WJMA 5FI1A 2XQNM 2M38A 1FHWA 2D9VA 3KRWA 1DYNA 4TYZA 1ZC4B 2D9WA 1B55A 1P3RA 1OQNA 5JHHA 2DHJA 2D11A 2MFQA 1QC6A 1K5DB 1NI2A 4EJNA 1J0WA 2COAA 4NSWA 1V61A 4Y94A 2RSGA 2LOXA 2P0HA 3ULBA 4GMXB 2I5FA 1MPHA 3N7CA 2EJ8A 2YS3A 2YF0A 1UNQA 1SHCA 2CRFA 3AJ4A 3DXCA 3TCAA 2DA0A 2DFKA 2K2UA 1MK9B 3A98B 1FHOA 2Q13A 3VIAA 1PFJA 1NU2A 2MWNB 3AU5A 4CYEA 2KUPA 1MKEA 3V5WA 3BINA 4BBKA 3WYFB 1FB8A 2RVBB 1ZVRA 1Z87A 2MDXA 4HAYB 5C5BA 5D3XA 1SGHA 1V5PA 3ZVRA 2QKMA 2LULA 3DXEA 1FHXA 2E2XA 3SYXA 4GXBA 2DX5A 3KSYA 3QWMA 1OY2A 5HE0A 1M7RA 5EFXA 2VKIA 2EMSA 5C16A 4PNKA 3PP2A 2DKQA 5LONB 1NTYA 3NSUA 1BWNA 5CLLB 1DDVA 5JHGA 1MAIA 2R09A 1Y19B 3U7DA 2DHKA 2YS1A 4WVFB 5CLQB 1X05A 3CIKA 1I7AA 2CODA 2D4QA 2GS0A 5FI0A 4CHJA 4A5KA 3PVWA 1X86A 3AU4A 2FJLA 1P6SA 3ML4A 2V76A 1U5DA 4WJ7A 5J3TA 2RUKB 4A6HA 1EGXA 1WVHA 3X23A 2W2WA 4GZUA 2GCLA 5DI9B 3DXDA 2ELBA 3P7ZA 2D9YA 2I5CA 1Y5OA 4P7IA 1ZM0A 2AL6A 2UZSA 1H4RA 1BTKA 3T06A
chains in the Genus database with same CATH superfamily
5I2MA 2YVCA 1WGUA 4KVGB 1PLSA 3DCXA 1PMSA 4KHBA 2I1JA 4EKUA 1TXDA 1ZYIA 3OANA 2GCJA 2DTCA 5J3QA 2Z0QA 4NY0A 2ZPYA 1XODA 5C5BB 2L2IA 5KCVA 2RLOA 1MK7B 3ZDTA 3HK0A 1RJ2A 4KHAA 2NMBA 2W2XC 3MDBC 2P0DA 4GMVA 1UPQA 2X18A 4L1RA 1MI1A 2ROVA 1GC6A 1U2BA 4IAPA 3OHMB 4HHVA 2KR0A 4WSFA 5DH9B 1MIXA 3CXBB 4GN1A 3U8ZA 2LYDA 2RNRB 2CY5A 2BCJA 2JP2A 3PVUA 4A6FA 1P5TA 3D8FA 3SV1A 4KHOA 1FOEA 1E5WA 1KZGA 4D6WA 2IYBA 2I1KA 4L6EA 2H7DA 4DX90 3PVLA 5C6RA 2COCA 4IFSA 4HDOA 5D3YA 2QKLA 1TQZA 3A8PA 3HQCA 3KY9A 2CAYA 1J19A 2Z14A 1UEFA 4HSIA 4MT7A 1OMWA 2J0MA 1WJ1A 2Z59A 2J59M 3O96A 5J3YA 3SUZA 1W1GA 2J0KA 2VRWB 4C0AA 5I2SA 1XR0B 4H8SA 1MIZB 4HB2B 1N3HA 2R0DA 1LB1A 3LJUX 3NWFA 4D0NB 5HE2A 2R2YA 4F7GA 4K81A 1I2HA 3U12A 4CSQA 1T77A 2YSZA 1V89A 2DYQA 1UNRA 3WA0A 2OQBA 1WG7A 1UPRA 2W2XD 4DIXA 3SO6A 2NBVA 1TJ6A 4HB4B 3FVCA 2YT2A 4DBBA 4F7UP 3TO1A 2CY4A 1K5GB 1FGZA 4K2PA 3UZTA 1KZ7A 4HB0B 1UNPA 3KRXA 1AWEA 2DX1A 2GJYA 1X1GA 2M14A 2YT1A 1LW3A 1GC7A 3TVVA 1XCGA 3D8EA 5KQ1A 3F0WA 2LOZA 2DN6A 1V5MA 3GYOA 2D2QA 1DDWA 5DHFB 2DKPA 2Z0OA 3G9WA 3PG7A 2KGXB 4A6KA 1IRSA 4PQ0A 2Z0PA 4Z2NA 3HW2B 2H7EA 4HB3B 2K00A 4HAWB 1KI1B 5IRSA 3ODOA 5D3VA 1ZSQA 1Q67A 1GG3A 2P0FA 2Z13A 4B6HA 2L1CA 4HAVB 2N0YA 1WGQA 1EVHA 4CHMA 3SNHA 5L81A 2DYNA 5M4YB 1WI1A 3IVFA 3NWDA 2J0JA 2P8VA 3VOQA 4F7HA 1XD4A 3D8DA 4HDQA 3ODXA 1DBHA 5D3WA 4HAZB 4DXAB 3KZ1A 4Z2MB 1FGYA 1U5FA 5C79A 3RCPA 2ADZA 4TKNA 1EAZA 1X1FA 1U5EA 3P6AA 2COFA 3TW1A 1QQGA 2UZRA 2D10A 4QJ5B 4HAXB 4QJ4B 3FEHA 1BTNA 1W1DA 1NTVA 4HAUB 4XWXA 4K2OA 2Y7BA 4KHBB 2UVMA 1RRPB 4IOYX 1EF1A 1H10A 5LOPB 2Y8GA 4ZRKA 4KAXB 1U29A 4ZRIA 1DROA 3BJIA 1W1HA 4GNKB 4K17A 5DIFB 3TFMA 2LKOA 4QJ3B 2Z4DA 4GPTB 3NWAA 2K2JA 1XKEA 3NW8A 3ODWA 2D9XA 2IFSA 2YS5A 2G35A 2ELAA 2LG1A 1U5GA 2NZ8B 1AQCA 3PEGA 3PZDA 1U27A 1DDMA 1FAOA 4HATB 2MKRA 4ZRJA 3PSCA 3A8QA 1M7EA 4MK0A 3HSAA 2KCJA 2EMTA 2KIEA 5GOWB 4OSNA 5LG4B 5HE1A 1ZC3B 1V5UA 3FM8C 4MY6A 2D9ZA 4DX8A 5JLJB 2VSZA 2DHIA 4EMOA 2RGNB 3QBVB 4YONA 5D27A 2OTXA 1X11A 2ROZB 5DHAB 2ZKMX 1V88A 3QIJA 4YL8A 3FSSA 1XX0A 1BAKA 5JP4A 3GYPA 1ISNA 3ULCA 2DLWA 2KUQA 2N23A 3MPXA 3M1IB 2YRYA 5HE3A 5KQ4A 2Y8FA 2PZ1A 2YT0A 3A58A 2AEHA 2EC1A 2HTHB 4A6FB 2HE7A 3F5RA 1WJMA 5FI1A 2XQNM 2M38A 1FHWA 2D9VA 3KRWA 1DYNA 4TYZA 1ZC4B 2D9WA 1B55A 1P3RA 1OQNA 5JHHA 2DHJA 2D11A 2MFQA 1QC6A 1K5DB 1NI2A 4EJNA 1J0WA 2COAA 4NSWA 1V61A 4Y94A 2RSGA 2LOXA 2P0HA 3ULBA 4GMXB 2GUMA 2I5FA 1MPHA 3N7CA 2EJ8A 2YS3A 2YF0A 1UNQA 1SHCA 2CRFA 3AJ4A 3DXCA 3TCAA 4QXAB 2DA0A 2DFKA 2K2UA 1MK9B 3A98B 1FHOA 2Q13A 3VIAA 1PFJA 1NU2A 2MWNB 3AU5A 4CYEA 2KUPA 1MKEA 3V5WA 3BINA 4BBKA 3WYFB 1FB8A 2RVBB 1ZVRA 1Z87A 2MDXA 4HAYB 5C5BA 5D3XA 1SGHA 1V5PA 3ZVRA 2QKMA 2LULA 3DXEA 1FHXA 4GOUA 2E2XA 3SYXA 4GXBA 2DX5A 3KSYA 3QWMA 1OY2A 5HE0A 1M7RA 5EFXA 2VKIA 2EMSA 5C16A 4PNKA 3PP2A 2DKQA 5LONB 3B77A 4OT1A 1NTYA 3NSUA 1BWNA 5CLLB 1DDVA 5JHGA 1MAIA 2R09A 1Y19B 3U7DA 2DHKA 2YS1A 4WVFB 5CLQB 3HIEA 1X05A 3CIKA 1I7AA 2CODA 2D4QA 2GS0A 5FI0A 4CHJA 4A5KA 3PVWA 1X86A 3AU4A 2FJLA 1P6SA 3ML4A 2V76A 1U5DA 4WJ7A 2RRFA 5J3TA 2RUKB 4A6HA 1EGXA 1WVHA 2K49A 3X23A 2W2WA 4GZUA 2GCLA 5DI9B 2KIGA 3DXDA 2ELBA 3P7ZA 2D9YA 2K8EA 2I5CA 1Y5OA 4P7IA 1ZM0A 2AL6A 2UZSA 1H4RA 2FJUB 1BTKA 3T06A
chains in the Genus database with same CATH topology
2YVCA 1WGUA 4KVGB 1PLSA 1PMSA 2I1JA 4EKUA 1TXDA 3OANA 2GCJA 2DTCA 5J3QA 2Z0QA 4NY0A 2ZPYA 1XODA 5C5BB 2L2IA 5KCVA 2RLOA 1MK7B 3ZDTA 3HK0A 1RJ2A 4KHAA 2NMBA 2W2XC 3MDBC 2P0DA 4GMVA 1UPQA 2X18A 2ROVA 1GC6A 1U2BA 4IAPA 4HHVA 4WSFA 5DH9B 1MIXA 3CXBB 4GN1A 3U8ZA 2LYDA 2RNRB 2CY5A 2BCJA 2JP2A 3PVUA 4A6FA 1P5TA 3D8FA 3SV1A 4KHOA 1FOEA 1E5WA 1KZGA 2IYBA 2I1KA 4L6EA 2H7DA 4DX90 3PVLA 5C6RA 2COCA 4IFSA 4HDOA 5D3YA 2QKLA 1TQZA 3A8PA 3HQCA 3KY9A 2CAYA 1J19A 1UEFA 4MT7A 1OMWA 2J0MA 1WJ1A 2J59M 3O96A 5J3YA 3SUZA 1W1GA 2J0KA 2VRWB 4C0AA 1XR0B 4H8SA 1MIZB 4HB2B 1N3HA 2R0DA 1LB1A 3LJUX 4D0NB 5HE2A 4F7GA 4K81A 1I2HA 2YSZA 1V89A 2DYQA 1UNRA 3WA0A 2OQBA 1WG7A 1UPRA 2W2XD 3SO6A 1TJ6A 4HB4B 4DBBA 4F7UP 3TO1A 2CY4A 1K5GB 1FGZA 4K2PA 3UZTA 1KZ7A 4HB0B 1UNPA 3KRXA 1AWEA 2DX1A 2GJYA 1X1GA 2M14A 2YT1A 1LW3A 1GC7A 3TVVA 1XCGA 3D8EA 5KQ1A 3F0WA 2LOZA 2DN6A 1V5MA 3GYOA 2D2QA 1DDWA 5DHFB 2DKPA 2Z0OA 3G9WA 3PG7A 2KGXB 4A6KA 1IRSA 4PQ0A 2Z0PA 4Z2NA 3HW2B 2H7EA 4HB3B 2K00A 4HAWB 1KI1B 3ODOA 5D3VA 1ZSQA 1Q67A 1GG3A 2P0FA 4B6HA 2L1CA 4HAVB 2N0YA 1WGQA 1EVHA 4CHMA 3SNHA 5L81A 2DYNA 1WI1A 3IVFA 2J0JA 2P8VA 3VOQA 4F7HA 1XD4A 3D8DA 4HDQA 3ODXA 1DBHA 5D3WA 4HAZB 4DXAB 3KZ1A 4Z2MB 1FGYA 1U5FA 5C79A 3RCPA 2ADZA 4TKNA 1EAZA 1X1FA 1U5EA 3P6AA 2COFA 3TW1A 1QQGA 2UZRA 2D10A 4HAXB 3FEHA 1BTNA 1W1DA 1NTVA 4HAUB 4XWXA 4K2OA 2Y7BA 4KHBB 2UVMA 1RRPB 4IOYX 1EF1A 1H10A 5LOPB 2Y8GA 4ZRKA 4KAXB 1U29A 4ZRIA 1DROA 3BJIA 1W1HA 4K17A 5DIFB 3TFMA 2LKOA 4GPTB 2K2JA 1XKEA 3ODWA 2D9XA 2IFSA 2YS5A 2G35A 2ELAA 2LG1A 1U5GA 2NZ8B 1AQCA 3PEGA 3PZDA 1U27A 1DDMA 1FAOA 4HATB 2MKRA 4ZRJA 3PSCA 3A8QA 1M7EA 4MK0A 2KCJA 2EMTA 5GOWB 5HE1A 1ZC3B 1V5UA 3FM8C 4MY6A 2D9ZA 4DX8A 5JLJB 2VSZA 2DHIA 4EMOA 2RGNB 3QBVB 4YONA 5D27A 2OTXA 1X11A 2ROZB 5DHAB 1V88A 3QIJA 4YL8A 3FSSA 1XX0A 1BAKA 5JP4A 3GYPA 1ISNA 3ULCA 2DLWA 2N23A 3MPXA 3M1IB 2YRYA 5HE3A 5KQ4A 2Y8FA 2PZ1A 2YT0A 2AEHA 2EC1A 2HTHB 4A6FB 2HE7A 3F5RA 1WJMA 5FI1A 2XQNM 2M38A 1FHWA 2D9VA 3KRWA 1DYNA 4TYZA 1ZC4B 2D9WA 1B55A 1P3RA 1OQNA 5JHHA 2DHJA 2D11A 2MFQA 1QC6A 1K5DB 1NI2A 4EJNA 1J0WA 2COAA 4NSWA 1V61A 4Y94A 2RSGA 2LOXA 2P0HA 3ULBA 4GMXB 2I5FA 1MPHA 3N7CA 2EJ8A 2YS3A 2YF0A 1UNQA 1SHCA 2CRFA 3AJ4A 3DXCA 3TCAA 2DA0A 2DFKA 2K2UA 1MK9B 3A98B 1FHOA 2Q13A 3VIAA 1PFJA 1NU2A 2MWNB 3AU5A 4CYEA 2KUPA 1MKEA 3V5WA 3BINA 4BBKA 3WYFB 1FB8A 2RVBB 1ZVRA 1Z87A 2MDXA 4HAYB 5C5BA 5D3XA 1SGHA 1V5PA 3ZVRA 2QKMA 2LULA 3DXEA 1FHXA 2E2XA 3SYXA 4GXBA 2DX5A 3KSYA 3QWMA 1OY2A 5HE0A 1M7RA 5EFXA 2VKIA 2EMSA 5C16A 4PNKA 3PP2A 2DKQA 5LONB 1NTYA 3NSUA 1BWNA 5CLLB 1DDVA 5JHGA 1MAIA 2R09A 1Y19B 3U7DA 2DHKA 2YS1A 4WVFB 5CLQB 1X05A 3CIKA 1I7AA 2CODA 2D4QA 2GS0A 5FI0A 4CHJA 4A5KA 3PVWA 1X86A 3AU4A 2FJLA 1P6SA 3ML4A 2V76A 1U5DA 4WJ7A 5J3TA 2RUKB 4A6HA 1EGXA 1WVHA 3X23A 2W2WA 4GZUA 2GCLA 5DI9B 3DXDA 2ELBA 3P7ZA 2D9YA 2I5CA 1Y5OA 4P7IA 1ZM0A 2AL6A 2UZSA 1H4RA 1BTKA 3T06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVC A;  1WGU A;  4KVG B;  1PLS A;  1PMS A;  2I1J A;  4EKU A;  1TXD A;  3OAN A;  2GCJ A;  2DTC A;  5J3Q A;  2Z0Q A;  4NY0 A;  2ZPY A;  1XOD A;  5C5B B;  2L2I A;  5KCV A;  2RLO A;  1MK7 B;  3ZDT A;  3HK0 A;  1RJ2 A;  4KHA A;  2NMB A;  2W2X C;  3MDB C;  2P0D A;  4GMV A;  1UPQ A;  2X18 A;  2ROV A;  1GC6 A;  1U2B A;  4IAP A;  4HHV A;  4WSF A;  5DH9 B;  1MIX A;  3CXB B;  4GN1 A;  3U8Z A;  2LYD A;  2RNR B;  2CY5 A;  2BCJ A;  2JP2 A;  3PVU A;  4A6F A;  1P5T A;  3D8F A;  3SV1 A;  4KHO A;  1FOE A;  1E5W A;  1KZG A;  2IYB A;  2I1K A;  4L6E A;  2H7D A;  4DX9 0;  3PVL A;  5C6R A;  2COC A;  4IFS A;  4HDO A;  5D3Y A;  2QKL A;  1TQZ A;  3A8P A;  3HQC A;  3KY9 A;  2CAY A;  1J19 A;  1UEF A;  4MT7 A;  1OMW A;  2J0M A;  1WJ1 A;  2J59 M;  3O96 A;  5J3Y A;  3SUZ A;  1W1G A;  2J0K A;  2VRW B;  4C0A A;  1XR0 B;  4H8S A;  1MIZ B;  4HB2 B;  1N3H A;  2R0D A;  1LB1 A;  3LJU X;  4D0N B;  5HE2 A;  4F7G A;  4K81 A;  1I2H A;  2YSZ A;  1V89 A;  2DYQ A;  1UNR A;  3WA0 A;  2OQB A;  1WG7 A;  1UPR A;  2W2X D;  3SO6 A;  1TJ6 A;  4HB4 B;  4DBB A;  4F7U P;  3TO1 A;  2CY4 A;  1K5G B;  1FGZ A;  4K2P A;  3UZT A;  1KZ7 A;  4HB0 B;  1UNP A;  3KRX A;  1AWE A;  2DX1 A;  2GJY A;  1X1G A;  2M14 A;  2YT1 A;  1LW3 A;  1GC7 A;  3TVV A;  1XCG A;  3D8E A;  5KQ1 A;  3F0W A;  2LOZ A;  2DN6 A;  1V5M A;  3GYO A;  2D2Q A;  1DDW A;  5DHF B;  2DKP A;  2Z0O A;  3G9W A;  3PG7 A;  2KGX B;  4A6K A;  1IRS A;  4PQ0 A;  2Z0P A;  4Z2N A;  3HW2 B;  2H7E A;  4HB3 B;  2K00 A;  4HAW B;  1KI1 B;  3ODO A;  5D3V A;  1ZSQ A;  1Q67 A;  1GG3 A;  2P0F A;  4B6H A;  2L1C A;  4HAV B;  2N0Y A;  1WGQ A;  1EVH A;  4CHM A;  3SNH A;  5L81 A;  2DYN A;  1WI1 A;  3IVF A;  2J0J A;  2P8V A;  3VOQ A;  4F7H A;  1XD4 A;  3D8D A;  4HDQ A;  3ODX A;  1DBH A;  5D3W A;  4HAZ B;  4DXA B;  3KZ1 A;  4Z2M B;  1FGY A;  1U5F A;  5C79 A;  3RCP A;  2ADZ A;  4TKN A;  1EAZ A;  1X1F A;  1U5E A;  3P6A A;  2COF A;  3TW1 A;  1QQG A;  2UZR A;  2D10 A;  4HAX B;  3FEH A;  1BTN A;  1W1D A;  1NTV A;  4HAU B;  4XWX A;  4K2O A;  2Y7B A;  4KHB B;  2UVM A;  1RRP B;  4IOY X;  1EF1 A;  1H10 A;  5LOP B;  2Y8G A;  4ZRK A;  4KAX B;  1U29 A;  4ZRI A;  1DRO A;  3BJI A;  1W1H A;  4K17 A;  5DIF B;  3TFM A;  2LKO A;  4GPT B;  2K2J A;  1XKE A;  3ODW A;  2D9X A;  2IFS A;  2YS5 A;  2G35 A;  2ELA A;  2LG1 A;  1U5G A;  2NZ8 B;  1AQC A;  3PEG A;  3PZD A;  1U27 A;  1DDM A;  1FAO A;  4HAT B;  2MKR A;  4ZRJ A;  3PSC A;  3A8Q A;  1M7E A;  4MK0 A;  2KCJ A;  2EMT A;  5GOW B;  5HE1 A;  1ZC3 B;  1V5U A;  3FM8 C;  4MY6 A;  2D9Z A;  4DX8 A;  5JLJ B;  2VSZ A;  2DHI A;  4EMO A;  2RGN B;  3QBV B;  4YON A;  5D27 A;  2OTX A;  1X11 A;  2ROZ B;  5DHA B;  1V88 A;  3QIJ A;  4YL8 A;  3FSS A;  1XX0 A;  1BAK A;  5JP4 A;  3GYP A;  1ISN A;  3ULC A;  2DLW A;  2N23 A;  3MPX A;  3M1I B;  2YRY A;  5HE3 A;  5KQ4 A;  2Y8F A;  2PZ1 A;  2YT0 A;  2AEH A;  2EC1 A;  2HTH B;  4A6F B;  2HE7 A;  3F5R A;  1WJM A;  5FI1 A;  2XQN M;  2M38 A;  1FHW A;  2D9V A;  3KRW A;  1DYN A;  4TYZ A;  1ZC4 B;  2D9W A;  1B55 A;  1P3R A;  1OQN A;  5JHH A;  2DHJ A;  2D11 A;  2MFQ A;  1QC6 A;  1K5D B;  1NI2 A;  4EJN A;  1J0W A;  2COA A;  4NSW A;  1V61 A;  4Y94 A;  2RSG A;  2LOX A;  2P0H A;  3ULB A;  4GMX B;  2I5F A;  1MPH A;  3N7C A;  2EJ8 A;  2YS3 A;  2YF0 A;  1UNQ A;  1SHC A;  2CRF A;  3AJ4 A;  3DXC A;  3TCA A;  2DA0 A;  2DFK A;  2K2U A;  1MK9 B;  3A98 B;  1FHO A;  2Q13 A;  3VIA A;  1PFJ A;  1NU2 A;  2MWN B;  3AU5 A;  4CYE A;  2KUP A;  1MKE A;  3V5W A;  3BIN A;  4BBK A;  3WYF B;  1FB8 A;  2RVB B;  1ZVR A;  1Z87 A;  2MDX A;  4HAY B;  5C5B A;  5D3X A;  1SGH A;  1V5P A;  3ZVR A;  2QKM A;  2LUL A;  3DXE A;  1FHX A;  2E2X A;  3SYX A;  4GXB A;  2DX5 A;  3KSY A;  3QWM A;  1OY2 A;  5HE0 A;  1M7R A;  5EFX A;  2VKI A;  2EMS A;  5C16 A;  4PNK A;  3PP2 A;  2DKQ A;  5LON B;  1NTY A;  3NSU A;  1BWN A;  5CLL B;  1DDV A;  5JHG A;  1MAI A;  2R09 A;  1Y19 B;  3U7D A;  2DHK A;  2YS1 A;  4WVF B;  5CLQ B;  1X05 A;  3CIK A;  1I7A A;  2COD A;  2D4Q A;  2GS0 A;  5FI0 A;  4CHJ A;  4A5K A;  3PVW A;  1X86 A;  3AU4 A;  2FJL A;  1P6S A;  3ML4 A;  2V76 A;  1U5D A;  4WJ7 A;  5J3T A;  2RUK B;  4A6H A;  1EGX A;  1WVH A;  3X23 A;  2W2W A;  4GZU A;  2GCL A;  5DI9 B;  3DXD A;  2ELB A;  3P7Z A;  2D9Y A;  2I5C A;  1Y5O A;  4P7I A;  1ZM0 A;  2AL6 A;  2UZS A;  1H4R A;  1BTK A;  3T06 A; 
#chains in the Genus database with same CATH topology
 5I2M A;  2YVC A;  1WGU A;  4KVG B;  1PLS A;  3DCX A;  1PMS A;  4KHB A;  2I1J A;  4EKU A;  1TXD A;  1ZYI A;  3OAN A;  2GCJ A;  2DTC A;  5J3Q A;  2Z0Q A;  4NY0 A;  2ZPY A;  1XOD A;  5C5B B;  2L2I A;  5KCV A;  2RLO A;  1MK7 B;  3ZDT A;  3HK0 A;  1RJ2 A;  4KHA A;  2NMB A;  2W2X C;  3MDB C;  2P0D A;  4GMV A;  1UPQ A;  2X18 A;  4L1R A;  1MI1 A;  2ROV A;  1GC6 A;  1U2B A;  4IAP A;  3OHM B;  4HHV A;  2KR0 A;  4WSF A;  5DH9 B;  1MIX A;  3CXB B;  4GN1 A;  3U8Z A;  2LYD A;  2RNR B;  2CY5 A;  2BCJ A;  2JP2 A;  3PVU A;  4A6F A;  1P5T A;  3D8F A;  3SV1 A;  4KHO A;  1FOE A;  1E5W A;  1KZG A;  4D6W A;  2IYB A;  2I1K A;  4L6E A;  2H7D A;  4DX9 0;  3PVL A;  5C6R A;  2COC A;  4IFS A;  4HDO A;  5D3Y A;  2QKL A;  1TQZ A;  3A8P A;  3HQC A;  3KY9 A;  2CAY A;  1J19 A;  2Z14 A;  1UEF A;  4HSI A;  4MT7 A;  1OMW A;  2J0M A;  1WJ1 A;  2Z59 A;  2J59 M;  3O96 A;  5J3Y A;  3SUZ A;  1W1G A;  2J0K A;  2VRW B;  4C0A A;  5I2S A;  1XR0 B;  4H8S A;  1MIZ B;  4HB2 B;  1N3H A;  2R0D A;  1LB1 A;  3LJU X;  3NWF A;  4D0N B;  5HE2 A;  2R2Y A;  4F7G A;  4K81 A;  1I2H A;  3U12 A;  4CSQ A;  1T77 A;  2YSZ A;  1V89 A;  2DYQ A;  1UNR A;  3WA0 A;  2OQB A;  1WG7 A;  1UPR A;  2W2X D;  4DIX A;  3SO6 A;  2NBV A;  1TJ6 A;  4HB4 B;  3FVC A;  2YT2 A;  4DBB A;  4F7U P;  3TO1 A;  2CY4 A;  1K5G B;  1FGZ A;  4K2P A;  3UZT A;  1KZ7 A;  4HB0 B;  1UNP A;  3KRX A;  1AWE A;  2DX1 A;  2GJY A;  1X1G A;  2M14 A;  2YT1 A;  1LW3 A;  1GC7 A;  3TVV A;  1XCG A;  3D8E A;  5KQ1 A;  3F0W A;  2LOZ A;  2DN6 A;  1V5M A;  3GYO A;  2D2Q A;  1DDW A;  5DHF B;  2DKP A;  2Z0O A;  3G9W A;  3PG7 A;  2KGX B;  4A6K A;  1IRS A;  4PQ0 A;  2Z0P A;  4Z2N A;  3HW2 B;  2H7E A;  4HB3 B;  2K00 A;  4HAW B;  1KI1 B;  5IRS A;  3ODO A;  5D3V A;  1ZSQ A;  1Q67 A;  1GG3 A;  2P0F A;  2Z13 A;  4B6H A;  2L1C A;  4HAV B;  2N0Y A;  1WGQ A;  1EVH A;  4CHM A;  3SNH A;  5L81 A;  2DYN A;  5M4Y B;  1WI1 A;  3IVF A;  3NWD A;  2J0J A;  2P8V A;  3VOQ A;  4F7H A;  1XD4 A;  3D8D A;  4HDQ A;  3ODX A;  1DBH A;  5D3W A;  4HAZ B;  4DXA B;  3KZ1 A;  4Z2M B;  1FGY A;  1U5F A;  5C79 A;  3RCP A;  2ADZ A;  4TKN A;  1EAZ A;  1X1F A;  1U5E A;  3P6A A;  2COF A;  3TW1 A;  1QQG A;  2UZR A;  2D10 A;  4QJ5 B;  4HAX B;  4QJ4 B;  3FEH A;  1BTN A;  1W1D A;  1NTV A;  4HAU B;  4XWX A;  4K2O A;  2Y7B A;  4KHB B;  2UVM A;  1RRP B;  4IOY X;  1EF1 A;  1H10 A;  5LOP B;  2Y8G A;  4ZRK A;  4KAX B;  1U29 A;  4ZRI A;  1DRO A;  3BJI A;  1W1H A;  4GNK B;  4K17 A;  5DIF B;  3TFM A;  2LKO A;  4QJ3 B;  2Z4D A;  4GPT B;  3NWA A;  2K2J A;  1XKE A;  3NW8 A;  3ODW A;  2D9X A;  2IFS A;  2YS5 A;  2G35 A;  2ELA A;  2LG1 A;  1U5G A;  2NZ8 B;  1AQC A;  3PEG A;  3PZD A;  1U27 A;  1DDM A;  1FAO A;  4HAT B;  2MKR A;  4ZRJ A;  3PSC A;  3A8Q A;  1M7E A;  4MK0 A;  3HSA A;  2KCJ A;  2EMT A;  2KIE A;  5GOW B;  4OSN A;  5LG4 B;  5HE1 A;  1ZC3 B;  1V5U A;  3FM8 C;  4MY6 A;  2D9Z A;  4DX8 A;  5JLJ B;  2VSZ A;  2DHI A;  4EMO A;  2RGN B;  3QBV B;  4YON A;  5D27 A;  2OTX A;  1X11 A;  2ROZ B;  5DHA B;  2ZKM X;  1V88 A;  3QIJ A;  4YL8 A;  3FSS A;  1XX0 A;  1BAK A;  5JP4 A;  3GYP A;  1ISN A;  3ULC A;  2DLW A;  2KUQ A;  2N23 A;  3MPX A;  3M1I B;  2YRY A;  5HE3 A;  5KQ4 A;  2Y8F A;  2PZ1 A;  2YT0 A;  3A58 A;  2AEH A;  2EC1 A;  2HTH B;  4A6F B;  2HE7 A;  3F5R A;  1WJM A;  5FI1 A;  2XQN M;  2M38 A;  1FHW A;  2D9V A;  3KRW A;  1DYN A;  4TYZ A;  1ZC4 B;  2D9W A;  1B55 A;  1P3R A;  1OQN A;  5JHH A;  2DHJ A;  2D11 A;  2MFQ A;  1QC6 A;  1K5D B;  1NI2 A;  4EJN A;  1J0W A;  2COA A;  4NSW A;  1V61 A;  4Y94 A;  2RSG A;  2LOX A;  2P0H A;  3ULB A;  4GMX B;  2GUM A;  2I5F A;  1MPH A;  3N7C A;  2EJ8 A;  2YS3 A;  2YF0 A;  1UNQ A;  1SHC A;  2CRF A;  3AJ4 A;  3DXC A;  3TCA A;  4QXA B;  2DA0 A;  2DFK A;  2K2U A;  1MK9 B;  3A98 B;  1FHO A;  2Q13 A;  3VIA A;  1PFJ A;  1NU2 A;  2MWN B;  3AU5 A;  4CYE A;  2KUP A;  1MKE A;  3V5W A;  3BIN A;  4BBK A;  3WYF B;  1FB8 A;  2RVB B;  1ZVR A;  1Z87 A;  2MDX A;  4HAY B;  5C5B A;  5D3X A;  1SGH A;  1V5P A;  3ZVR A;  2QKM A;  2LUL A;  3DXE A;  1FHX A;  4GOU A;  2E2X A;  3SYX A;  4GXB A;  2DX5 A;  3KSY A;  3QWM A;  1OY2 A;  5HE0 A;  1M7R A;  5EFX A;  2VKI A;  2EMS A;  5C16 A;  4PNK A;  3PP2 A;  2DKQ A;  5LON B;  3B77 A;  4OT1 A;  1NTY A;  3NSU A;  1BWN A;  5CLL B;  1DDV A;  5JHG A;  1MAI A;  2R09 A;  1Y19 B;  3U7D A;  2DHK A;  2YS1 A;  4WVF B;  5CLQ B;  3HIE A;  1X05 A;  3CIK A;  1I7A A;  2COD A;  2D4Q A;  2GS0 A;  5FI0 A;  4CHJ A;  4A5K A;  3PVW A;  1X86 A;  3AU4 A;  2FJL A;  1P6S A;  3ML4 A;  2V76 A;  1U5D A;  4WJ7 A;  2RRF A;  5J3T A;  2RUK B;  4A6H A;  1EGX A;  1WVH A;  2K49 A;  3X23 A;  2W2W A;  4GZU A;  2GCL A;  5DI9 B;  2KIG A;  3DXD A;  2ELB A;  3P7Z A;  2D9Y A;  2K8E A;  2I5C A;  1Y5O A;  4P7I A;  1ZM0 A;  2AL6 A;  2UZS A;  1H4R A;  2FJU B;  1BTK A;  3T06 A; 
#chains in the Genus database with same CATH homology
 2YVC A;  1WGU A;  4KVG B;  1PLS A;  1PMS A;  2I1J A;  4EKU A;  1TXD A;  3OAN A;  2GCJ A;  2DTC A;  5J3Q A;  2Z0Q A;  4NY0 A;  2ZPY A;  1XOD A;  5C5B B;  2L2I A;  5KCV A;  2RLO A;  1MK7 B;  3ZDT A;  3HK0 A;  1RJ2 A;  4KHA A;  2NMB A;  2W2X C;  3MDB C;  2P0D A;  4GMV A;  1UPQ A;  2X18 A;  2ROV A;  1GC6 A;  1U2B A;  4IAP A;  4HHV A;  4WSF A;  5DH9 B;  1MIX A;  3CXB B;  4GN1 A;  3U8Z A;  2LYD A;  2RNR B;  2CY5 A;  2BCJ A;  2JP2 A;  3PVU A;  4A6F A;  1P5T A;  3D8F A;  3SV1 A;  4KHO A;  1FOE A;  1E5W A;  1KZG A;  2IYB A;  2I1K A;  4L6E A;  2H7D A;  4DX9 0;  3PVL A;  5C6R A;  2COC A;  4IFS A;  4HDO A;  5D3Y A;  2QKL A;  1TQZ A;  3A8P A;  3HQC A;  3KY9 A;  2CAY A;  1J19 A;  1UEF A;  4MT7 A;  1OMW A;  2J0M A;  1WJ1 A;  2J59 M;  3O96 A;  5J3Y A;  3SUZ A;  1W1G A;  2J0K A;  2VRW B;  4C0A A;  1XR0 B;  4H8S A;  1MIZ B;  4HB2 B;  1N3H A;  2R0D A;  1LB1 A;  3LJU X;  4D0N B;  5HE2 A;  4F7G A;  4K81 A;  1I2H A;  2YSZ A;  1V89 A;  2DYQ A;  1UNR A;  3WA0 A;  2OQB A;  1WG7 A;  1UPR A;  2W2X D;  3SO6 A;  1TJ6 A;  4HB4 B;  4DBB A;  4F7U P;  3TO1 A;  2CY4 A;  1K5G B;  1FGZ A;  4K2P A;  3UZT A;  1KZ7 A;  4HB0 B;  1UNP A;  3KRX A;  1AWE A;  2DX1 A;  2GJY A;  1X1G A;  2M14 A;  2YT1 A;  1LW3 A;  1GC7 A;  3TVV A;  1XCG A;  3D8E A;  5KQ1 A;  3F0W A;  2LOZ A;  2DN6 A;  1V5M A;  3GYO A;  2D2Q A;  1DDW A;  5DHF B;  2DKP A;  2Z0O A;  3G9W A;  3PG7 A;  2KGX B;  4A6K A;  1IRS A;  4PQ0 A;  2Z0P A;  4Z2N A;  3HW2 B;  2H7E A;  4HB3 B;  2K00 A;  4HAW B;  1KI1 B;  3ODO A;  5D3V A;  1ZSQ A;  1Q67 A;  1GG3 A;  2P0F A;  4B6H A;  2L1C A;  4HAV B;  2N0Y A;  1WGQ A;  1EVH A;  4CHM A;  3SNH A;  5L81 A;  2DYN A;  1WI1 A;  3IVF A;  2J0J A;  2P8V A;  3VOQ A;  4F7H A;  1XD4 A;  3D8D A;  4HDQ A;  3ODX A;  1DBH A;  5D3W A;  4HAZ B;  4DXA B;  3KZ1 A;  4Z2M B;  1FGY A;  1U5F A;  5C79 A;  3RCP A;  2ADZ A;  4TKN A;  1EAZ A;  1X1F A;  1U5E A;  3P6A A;  2COF A;  3TW1 A;  1QQG A;  2UZR A;  2D10 A;  4HAX B;  3FEH A;  1BTN A;  1W1D A;  1NTV A;  4HAU B;  4XWX A;  4K2O A;  2Y7B A;  4KHB B;  2UVM A;  1RRP B;  4IOY X;  1EF1 A;  1H10 A;  5LOP B;  2Y8G A;  4ZRK A;  4KAX B;  1U29 A;  4ZRI A;  1DRO A;  3BJI A;  1W1H A;  4K17 A;  5DIF B;  3TFM A;  2LKO A;  4GPT B;  2K2J A;  1XKE A;  3ODW A;  2D9X A;  2IFS A;  2YS5 A;  2G35 A;  2ELA A;  2LG1 A;  1U5G A;  2NZ8 B;  1AQC A;  3PEG A;  3PZD A;  1U27 A;  1DDM A;  1FAO A;  4HAT B;  2MKR A;  4ZRJ A;  3PSC A;  3A8Q A;  1M7E A;  4MK0 A;  2KCJ A;  2EMT A;  5GOW B;  5HE1 A;  1ZC3 B;  1V5U A;  3FM8 C;  4MY6 A;  2D9Z A;  4DX8 A;  5JLJ B;  2VSZ A;  2DHI A;  4EMO A;  2RGN B;  3QBV B;  4YON A;  5D27 A;  2OTX A;  1X11 A;  2ROZ B;  5DHA B;  1V88 A;  3QIJ A;  4YL8 A;  3FSS A;  1XX0 A;  1BAK A;  5JP4 A;  3GYP A;  1ISN A;  3ULC A;  2DLW A;  2N23 A;  3MPX A;  3M1I B;  2YRY A;  5HE3 A;  5KQ4 A;  2Y8F A;  2PZ1 A;  2YT0 A;  2AEH A;  2EC1 A;  2HTH B;  4A6F B;  2HE7 A;  3F5R A;  1WJM A;  5FI1 A;  2XQN M;  2M38 A;  1FHW A;  2D9V A;  3KRW A;  1DYN A;  4TYZ A;  1ZC4 B;  2D9W A;  1B55 A;  1P3R A;  1OQN A;  5JHH A;  2DHJ A;  2D11 A;  2MFQ A;  1QC6 A;  1K5D B;  1NI2 A;  4EJN A;  1J0W A;  2COA A;  4NSW A;  1V61 A;  4Y94 A;  2RSG A;  2LOX A;  2P0H A;  3ULB A;  4GMX B;  2I5F A;  1MPH A;  3N7C A;  2EJ8 A;  2YS3 A;  2YF0 A;  1UNQ A;  1SHC A;  2CRF A;  3AJ4 A;  3DXC A;  3TCA A;  2DA0 A;  2DFK A;  2K2U A;  1MK9 B;  3A98 B;  1FHO A;  2Q13 A;  3VIA A;  1PFJ A;  1NU2 A;  2MWN B;  3AU5 A;  4CYE A;  2KUP A;  1MKE A;  3V5W A;  3BIN A;  4BBK A;  3WYF B;  1FB8 A;  2RVB B;  1ZVR A;  1Z87 A;  2MDX A;  4HAY B;  5C5B A;  5D3X A;  1SGH A;  1V5P A;  3ZVR A;  2QKM A;  2LUL A;  3DXE A;  1FHX A;  2E2X A;  3SYX A;  4GXB A;  2DX5 A;  3KSY A;  3QWM A;  1OY2 A;  5HE0 A;  1M7R A;  5EFX A;  2VKI A;  2EMS A;  5C16 A;  4PNK A;  3PP2 A;  2DKQ A;  5LON B;  1NTY A;  3NSU A;  1BWN A;  5CLL B;  1DDV A;  5JHG A;  1MAI A;  2R09 A;  1Y19 B;  3U7D A;  2DHK A;  2YS1 A;  4WVF B;  5CLQ B;  1X05 A;  3CIK A;  1I7A A;  2COD A;  2D4Q A;  2GS0 A;  5FI0 A;  4CHJ A;  4A5K A;  3PVW A;  1X86 A;  3AU4 A;  2FJL A;  1P6S A;  3ML4 A;  2V76 A;  1U5D A;  4WJ7 A;  5J3T A;  2RUK B;  4A6H A;  1EGX A;  1WVH A;  3X23 A;  2W2W A;  4GZU A;  2GCL A;  5DI9 B;  3DXD A;  2ELB A;  3P7Z A;  2D9Y A;  2I5C A;  1Y5O A;  4P7I A;  1ZM0 A;  2AL6 A;  2UZS A;  1H4R A;  1BTK A;  3T06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...