2DX5A

The complex structure between the mouse eap45-glue domain and ubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
99
Chain Sequence
LLEINETLVIQQRGVRVYDGEEKFDAGTLLLSTHRLIWRDQKNNECCMAIPLSQIVFIEEQAKIVVHLHSKNSYIRLSFKEHGQIEFYRRLSEEMTQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting protein 36
publication title Structural basis of ubiquitin recognition by mammalian Eap45 GLUE domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport/signaling protein
total genus 14
structure length 99
sequence length 121
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dx5A00
4BBKA 2MDXA 4P7IA 2Z0QA 2LG1A 4A5KA 1DDVA 5HE0A 2EC1A 4IAPA 1M7EA 1NTVA 3AU5A 2D11A 1IRSA 1FHWA 2YT0A 1U27A 2CY5A 2KGXB 1X86A 1UNRA 3QWMA 4K2OA 1ZC3B 1GG3A 2RUKB 2YVCA 1XR0B 2H7DA 2DHJA 4HB3B 1FHOA 1QQGA 4B6HA 4CHMA 4D0NB 4GPTB 1WVHA 2KUPA 1FAOA 2GJYA 1X11A 5DHAB 2D2QA 4KHBB 2P0FA 1U5EA 2ZPYA 3FM8C 5HE3A 2DN6A 1X1FA 2R09A 4MT7A 1V5UA 1V88A 2RLOA 5C5BA 4HB2B 3U8ZA 4KVGB 1BAKA 1V5MA 3NSUA 4EMOA 5KQ4A 3CIKA 2DX5A 3M1IB 2XQNM 3BJIA 4EJNA 3ULCA 2P0DA 1BWNA 1MKEA 1U5DA 1MAIA 3X23A 2DA0A 2RGNB 5CLQB 4A6HA 4NY0A 1U29A 5D27A 4KHOA 2DYQA 3RCPA 1SGHA 4IOYX 4DX8A 3A8PA 3VIAA 3GYOA 3G9WA 2JP2A 3T06A 2I1KA 3TVVA 1DYNA 3PVUA 2YSZA 4YL8A 1XD4A 4DX90 4XWXA 3ZVRA 4NSWA 2DKPA 2M38A 1WGUA 2QKMA 1M7RA 1I7AA 3KRWA 4HDOA 2MFQA 1TJ6A 1Q67A 3IVFA 2P0HA 3OANA 3PVWA 2CRFA 1ISNA 3ZDTA 2DFKA 1EF1A 1GC7A 1UNQA 4K81A 2I5FA 2LYDA 1U5GA 4F7UP 5JP4A 3TO1A 3PZDA 2NZ8B 4GZUA 2Y8FA 3QBVB 3ODXA 1V5PA 1ZVRA 1X05A 1OMWA 5JHGA 2D9ZA 1AWEA 1MIXA 5HE2A 2DYNA 4CHJA 3FEHA 2R0DA 2ROZB 5LONB 2COCA 1ZM0A 1GC6A 2YS5A 2H7EA 2FJLA 2D9YA 4H8SA 1OY2A 4WSFA 2DLWA 3PG7A 1DDWA 2D10A 3SNHA 2LOZA 4Y94A 2IYBA 2DHIA 3ODWA 1ZSQA 2D4QA 4HAUB 2ELBA 5CLLB 4F7GA 4HHVA 1Z87A 1K5DB 2CY4A 3D8FA 3WA0A 3DXEA 1QC6A 3SV1A 4MK0A 1I2HA 2Z0PA 4GXBA 2IFSA 1XKEA 5KCVA 2COFA 2LOXA 1Y5OA 3DXCA 2VRWB 4TKNA 1EVHA 3ML4A 5D3XA 1UEFA 4WVFB 4HAZB 2AEHA 2MKRA 2COAA 1SHCA 5D3VA 1DROA 2Q13A 3DXDA 5C79A 2DTCA 1RRPB 2EMSA 4PNKA 1FOEA 1X1GA 3TW1A 2UVMA 4WJ7A 5J3QA 2BCJA 2MWNB 3A8QA 1P3RA 2D9WA 2G35A 2N23A 1W1HA 2RNRB 5D3WA 3ULBA 5C16A 1MIZB 1KZGA 5C6RA 1V61A 1XCGA 2OQBA 3FSSA 2NMBA 3GYPA 4HAVB 4HAXB 1BTKA 4DXAB 4Z2NA 1PLSA 3KY9A 1PMSA 5J3YA 5EFXA 4MY6A 2E2XA 3PP2A 2I5CA 5L81A 1TXDA 2DKQA 4F7HA 2X18A 3SUZA 5C5BB 2DX1A 2D9VA 4HAWB 4KHAA 3TCAA 1P5TA 2CAYA 1UPRA 3V5WA 4A6FB 3HQCA 3D8DA 3CXBB 1W1DA 1FHXA 5GOWB 2J0KA 3LJUX 4GMVA 2K2UA 4HDQA 2EMTA 1KI1B 1W1GA 3A98B 2GCJA 1FGYA 2ADZA 2K2JA 2LKOA 3P7ZA 2W2XD 1MK7B 3KRXA 4DBBA 1TQZA 1U5FA 1P6SA 4HAYB 1J0WA 2Y7BA 4HB0B 2GS0A 2J0MA 2DHKA 2ELAA 2M14A 2CODA 5DI9B 1DBHA 1LW3A 4K2PA 2GCLA 2RSGA 3MDBC 1WJ1A 1XX0A 1WJMA 1BTNA 5J3TA 4GMXB 4TYZA 4PQ0A 2AL6A 1U2BA 2I1JA 2QKLA 3PSCA 3D8EA 4YONA 3BINA 3KZ1A 3TFMA 1LB1A 4Z2MB 1MK9B 4EKUA 1NI2A 1FGZA 4L6EA 3MPXA 2LULA 3QIJA 2OTXA 1H4RA 3AJ4A 1PFJA 3HW2B 1WG7A 3SYXA 2N0YA 4A6FA 1V89A 2L1CA 1MPHA 3PEGA 3PVLA 1WGQA 2W2WA 3KSYA 2HE7A 2RVBB 4HATB 4KAXB 3N7CA 5FI1A 4C0AA 1OQNA 2EJ8A 3WYFB 2YRYA 2YS3A 5DIFB 2PZ1A 4ZRKA 3U7DA 2J59M 4IFSA 3HK0A 3AU4A 4HB4B 4ZRJA 4A6KA 1UPQA 5HE1A 1WI1A 2D9XA 1Y19B 2Z0OA 2UZRA 2YS1A 3ODOA 2V76A 4ZRIA 3VOQA 1XODA 2L2IA 1NU2A 3P6AA 1EAZA 1ZC4B 2YF0A 3O96A 5JHHA 1FB8A 5DH9B 2J0JA 1E5WA 2VSZA 5LOPB 3UZTA 2UZSA 2VKIA 4CYEA 4GN1A 2HTHB 1K5GB 1KZ7A 1J19A 1EGXA 3F5RA 3SO6A 1RJ2A 3F0WA 1B55A 2Y8GA 1N3HA 2K00A 1AQCA 5JLJB 1NTYA 5DHFB 2ROVA 5FI0A 4K17A 2KCJA 2P8VA 5KQ1A 1UNPA 2W2XC 2YT1A 5D3YA 1DDMA 1H10A
chains in the Genus database with same CATH superfamily
4BBKA 1T77A 2MDXA 5I2MA 4P7IA 2Z0QA 2LG1A 4A5KA 1DDVA 5HE0A 2EC1A 4IAPA 4HSIA 1M7EA 1NTVA 3AU5A 2D11A 1IRSA 1FHWA 2YT0A 1U27A 2CY5A 2KGXB 1X86A 1UNRA 3QWMA 4K2OA 1ZC3B 1GG3A 2RUKB 2YVCA 1XR0B 2H7DA 2DHJA 4HB3B 1FHOA 1QQGA 4B6HA 4CHMA 4D0NB 4GPTB 2KR0A 4QJ4B 1WVHA 2KUPA 1FAOA 2GJYA 1X11A 5DHAB 2D2QA 4KHBB 2P0FA 1U5EA 2ZPYA 3FM8C 5HE3A 2DN6A 1X1FA 2R09A 4MT7A 1V5UA 1V88A 2RLOA 5C5BA 4HB2B 3U8ZA 4KVGB 1BAKA 1V5MA 3NSUA 4EMOA 5KQ4A 3CIKA 2DX5A 3M1IB 2XQNM 3BJIA 3DCXA 4EJNA 3ULCA 2P0DA 3HSAA 1BWNA 1MKEA 1U5DA 1MAIA 3X23A 2DA0A 2RGNB 5CLQB 2YT2A 4A6HA 4NY0A 1U29A 5D27A 4KHOA 2DYQA 3RCPA 3U12A 1SGHA 4IOYX 4DX8A 3B77A 3A8PA 3VIAA 5IRSA 3GYOA 3G9WA 2KIEA 2JP2A 3T06A 2I1KA 3TVVA 1DYNA 3PVUA 2YSZA 4YL8A 1XD4A 4DX90 4XWXA 3ZVRA 4NSWA 2DKPA 2M38A 4D6WA 1WGUA 2QKMA 4L1RA 1M7RA 1I7AA 3KRWA 4HDOA 2MFQA 1TJ6A 1Q67A 3IVFA 2P0HA 3OANA 3PVWA 2CRFA 1ISNA 3ZDTA 2DFKA 1EF1A 3OHMB 1GC7A 1UNQA 4K81A 2I5FA 2LYDA 1U5GA 4F7UP 5JP4A 3TO1A 3PZDA 2NZ8B 2FJUB 4GZUA 2Y8FA 3QBVB 3ODXA 3HIEA 1V5PA 1ZVRA 1X05A 1OMWA 5JHGA 2D9ZA 1AWEA 1MIXA 2K49A 5HE2A 2DYNA 4CHJA 3FEHA 2R0DA 2ROZB 5LONB 2COCA 1ZM0A 1GC6A 2YS5A 2H7EA 2FJLA 2D9YA 4QJ3B 4H8SA 1OY2A 4WSFA 2DLWA 5LG4B 3PG7A 1DDWA 2D10A 3SNHA 2LOZA 4Y94A 4CSQA 4QJ5B 2IYBA 2DHIA 3ODWA 1ZSQA 2D4QA 4HAUB 2ELBA 2RRFA 5CLLB 4F7GA 4HHVA 1Z87A 3FVCA 1K5DB 1MI1A 2CY4A 3D8FA 3WA0A 3DXEA 1QC6A 3SV1A 4MK0A 1I2HA 2Z0PA 4GXBA 2IFSA 1XKEA 4DIXA 2COFA 5KCVA 4GNKB 2LOXA 1Y5OA 3DXCA 2VRWB 4TKNA 1EVHA 3ML4A 5D3XA 1UEFA 4WVFB 4HAZB 2AEHA 2MKRA 2COAA 1SHCA 3NWAA 5D3VA 1DROA 2Q13A 3DXDA 5C79A 2DTCA 3NW8A 1RRPB 2EMSA 4PNKA 1FOEA 1X1GA 3TW1A 2UVMA 4WJ7A 5J3QA 2BCJA 2MWNB 3A8QA 1P3RA 2D9WA 2G35A 2N23A 1W1HA 2RNRB 5D3WA 3ULBA 5C16A 1MIZB 1KZGA 5C6RA 5M4YB 4OSNA 1V61A 1XCGA 2OQBA 3FSSA 2NMBA 3GYPA 4HAVB 4HAXB 1BTKA 4DXAB 4Z2NA 1PLSA 4KHBA 3KY9A 1PMSA 5J3YA 5EFXA 2K8EA 4MY6A 2E2XA 3PP2A 2I5CA 5L81A 1TXDA 2DKQA 4F7HA 2X18A 3SUZA 3NWFA 5C5BB 2DX1A 2D9VA 4HAWB 4KHAA 3TCAA 1P5TA 2CAYA 1UPRA 2Z59A 3V5WA 4A6FB 3HQCA 3D8DA 3CXBB 1W1DA 1FHXA 5GOWB 2J0KA 4QXAB 3LJUX 4GMVA 2K2UA 4HDQA 2EMTA 1KI1B 1W1GA 3A98B 2GCJA 1FGYA 2ADZA 2K2JA 2LKOA 3P7ZA 2W2XD 1MK7B 3KRXA 2Z4DA 4DBBA 1TQZA 1U5FA 1P6SA 4HAYB 2Z13A 1J0WA 2Y7BA 4HB0B 2GS0A 2J0MA 2DHKA 2ELAA 2M14A 2CODA 5DI9B 1DBHA 1LW3A 3NWDA 4K2PA 2GCLA 2RSGA 3MDBC 1WJ1A 1XX0A 2R2YA 1WJMA 1BTNA 5J3TA 4GMXB 4TYZA 4PQ0A 2AL6A 1U2BA 2I1JA 2QKLA 3PSCA 3D8EA 4YONA 3BINA 3KZ1A 3TFMA 2GUMA 1LB1A 4Z2MB 1MK9B 4GOUA 4EKUA 1NI2A 1FGZA 4L6EA 3MPXA 2LULA 3QIJA 2OTXA 1H4RA 3AJ4A 1PFJA 3HW2B 1WG7A 4OT1A 3SYXA 2N0YA 4A6FA 1V89A 2L1CA 1MPHA 3PEGA 3PVLA 1WGQA 2W2WA 3KSYA 2HE7A 2RVBB 4HATB 4KAXB 3N7CA 2NBVA 5FI1A 4C0AA 1OQNA 2EJ8A 3WYFB 2YRYA 2YS3A 5DIFB 2PZ1A 4ZRKA 3U7DA 2J59M 4IFSA 3HK0A 3AU4A 4HB4B 4ZRJA 4A6KA 1UPQA 5HE1A 1WI1A 2D9XA 5I2SA 2ZKMX 1Y19B 2Z0OA 2UZRA 2YS1A 3ODOA 2V76A 4ZRIA 3VOQA 1XODA 2L2IA 1NU2A 2YF0A 1EAZA 1ZC4B 3O96A 3P6AA 5JHHA 2Z14A 1FB8A 5DH9B 2J0JA 1E5WA 2KIGA 2VSZA 5LOPB 3UZTA 2UZSA 2VKIA 4CYEA 4GN1A 2HTHB 1K5GB 1KZ7A 1J19A 1EGXA 3F5RA 1ZYIA 3SO6A 1RJ2A 3F0WA 1B55A 2Y8GA 1N3HA 2K00A 1AQCA 2KUQA 5JLJB 1NTYA 5DHFB 2ROVA 5FI0A 4K17A 2KCJA 3A58A 2P8VA 5KQ1A 1UNPA 2W2XC 2YT1A 5D3YA 1DDMA 1H10A
chains in the Genus database with same CATH topology
4BBKA 2MDXA 4P7IA 2Z0QA 2LG1A 4A5KA 1DDVA 5HE0A 2EC1A 4IAPA 1M7EA 1NTVA 3AU5A 2D11A 1IRSA 1FHWA 2YT0A 1U27A 2CY5A 2KGXB 1X86A 1UNRA 3QWMA 4K2OA 1ZC3B 1GG3A 2RUKB 2YVCA 1XR0B 2H7DA 2DHJA 4HB3B 1FHOA 1QQGA 4B6HA 4CHMA 4D0NB 4GPTB 1WVHA 2KUPA 1FAOA 2GJYA 1X11A 5DHAB 2D2QA 4KHBB 2P0FA 1U5EA 2ZPYA 3FM8C 5HE3A 2DN6A 1X1FA 2R09A 4MT7A 1V5UA 1V88A 2RLOA 5C5BA 4HB2B 3U8ZA 4KVGB 1BAKA 1V5MA 3NSUA 4EMOA 5KQ4A 3CIKA 2DX5A 3M1IB 2XQNM 3BJIA 4EJNA 3ULCA 2P0DA 1BWNA 1MKEA 1U5DA 1MAIA 3X23A 2DA0A 2RGNB 5CLQB 4A6HA 4NY0A 1U29A 5D27A 4KHOA 2DYQA 3RCPA 1SGHA 4IOYX 4DX8A 3A8PA 3VIAA 3GYOA 3G9WA 2JP2A 3T06A 2I1KA 3TVVA 1DYNA 3PVUA 2YSZA 4YL8A 1XD4A 4DX90 4XWXA 3ZVRA 4NSWA 2DKPA 2M38A 1WGUA 2QKMA 1M7RA 1I7AA 3KRWA 4HDOA 2MFQA 1TJ6A 1Q67A 3IVFA 2P0HA 3OANA 3PVWA 2CRFA 1ISNA 3ZDTA 2DFKA 1EF1A 1GC7A 1UNQA 4K81A 2I5FA 2LYDA 1U5GA 4F7UP 5JP4A 3TO1A 3PZDA 2NZ8B 4GZUA 2Y8FA 3QBVB 3ODXA 1V5PA 1ZVRA 1X05A 1OMWA 5JHGA 2D9ZA 1AWEA 1MIXA 5HE2A 2DYNA 4CHJA 3FEHA 2R0DA 2ROZB 5LONB 2COCA 1ZM0A 1GC6A 2YS5A 2H7EA 2FJLA 2D9YA 4H8SA 1OY2A 4WSFA 2DLWA 3PG7A 1DDWA 2D10A 3SNHA 2LOZA 4Y94A 2IYBA 2DHIA 3ODWA 1ZSQA 2D4QA 4HAUB 2ELBA 5CLLB 4F7GA 4HHVA 1Z87A 1K5DB 2CY4A 3D8FA 3WA0A 3DXEA 1QC6A 3SV1A 4MK0A 1I2HA 2Z0PA 4GXBA 2IFSA 1XKEA 5KCVA 2COFA 2LOXA 1Y5OA 3DXCA 2VRWB 4TKNA 1EVHA 3ML4A 5D3XA 1UEFA 4WVFB 4HAZB 2AEHA 2MKRA 2COAA 1SHCA 5D3VA 1DROA 2Q13A 3DXDA 5C79A 2DTCA 1RRPB 2EMSA 4PNKA 1FOEA 1X1GA 3TW1A 2UVMA 4WJ7A 5J3QA 2BCJA 2MWNB 3A8QA 1P3RA 2D9WA 2G35A 2N23A 1W1HA 2RNRB 5D3WA 3ULBA 5C16A 1MIZB 1KZGA 5C6RA 1V61A 1XCGA 2OQBA 3FSSA 2NMBA 3GYPA 4HAVB 4HAXB 1BTKA 4DXAB 4Z2NA 1PLSA 3KY9A 1PMSA 5J3YA 5EFXA 4MY6A 2E2XA 3PP2A 2I5CA 5L81A 1TXDA 2DKQA 4F7HA 2X18A 3SUZA 5C5BB 2DX1A 2D9VA 4HAWB 4KHAA 3TCAA 1P5TA 2CAYA 1UPRA 3V5WA 4A6FB 3HQCA 3D8DA 3CXBB 1W1DA 1FHXA 5GOWB 2J0KA 3LJUX 4GMVA 2K2UA 4HDQA 2EMTA 1KI1B 1W1GA 3A98B 2GCJA 1FGYA 2ADZA 2K2JA 2LKOA 3P7ZA 2W2XD 1MK7B 3KRXA 4DBBA 1TQZA 1U5FA 1P6SA 4HAYB 1J0WA 2Y7BA 4HB0B 2GS0A 2J0MA 2DHKA 2ELAA 2M14A 2CODA 5DI9B 1DBHA 1LW3A 4K2PA 2GCLA 2RSGA 3MDBC 1WJ1A 1XX0A 1WJMA 1BTNA 5J3TA 4GMXB 4TYZA 4PQ0A 2AL6A 1U2BA 2I1JA 2QKLA 3PSCA 3D8EA 4YONA 3BINA 3KZ1A 3TFMA 1LB1A 4Z2MB 1MK9B 4EKUA 1NI2A 1FGZA 4L6EA 3MPXA 2LULA 3QIJA 2OTXA 1H4RA 3AJ4A 1PFJA 3HW2B 1WG7A 3SYXA 2N0YA 4A6FA 1V89A 2L1CA 1MPHA 3PEGA 3PVLA 1WGQA 2W2WA 3KSYA 2HE7A 2RVBB 4HATB 4KAXB 3N7CA 5FI1A 4C0AA 1OQNA 2EJ8A 3WYFB 2YRYA 2YS3A 5DIFB 2PZ1A 4ZRKA 3U7DA 2J59M 4IFSA 3HK0A 3AU4A 4HB4B 4ZRJA 4A6KA 1UPQA 5HE1A 1WI1A 2D9XA 1Y19B 2Z0OA 2UZRA 2YS1A 3ODOA 2V76A 4ZRIA 3VOQA 1XODA 2L2IA 1NU2A 3P6AA 1EAZA 1ZC4B 2YF0A 3O96A 5JHHA 1FB8A 5DH9B 2J0JA 1E5WA 2VSZA 5LOPB 3UZTA 2UZSA 2VKIA 4CYEA 4GN1A 2HTHB 1K5GB 1KZ7A 1J19A 1EGXA 3F5RA 3SO6A 1RJ2A 3F0WA 1B55A 2Y8GA 1N3HA 2K00A 1AQCA 5JLJB 1NTYA 5DHFB 2ROVA 5FI0A 4K17A 2KCJA 2P8VA 5KQ1A 1UNPA 2W2XC 2YT1A 5D3YA 1DDMA 1H10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBK A;  2MDX A;  4P7I A;  2Z0Q A;  2LG1 A;  4A5K A;  1DDV A;  5HE0 A;  2EC1 A;  4IAP A;  1M7E A;  1NTV A;  3AU5 A;  2D11 A;  1IRS A;  1FHW A;  2YT0 A;  1U27 A;  2CY5 A;  2KGX B;  1X86 A;  1UNR A;  3QWM A;  4K2O A;  1ZC3 B;  1GG3 A;  2RUK B;  2YVC A;  1XR0 B;  2H7D A;  2DHJ A;  4HB3 B;  1FHO A;  1QQG A;  4B6H A;  4CHM A;  4D0N B;  4GPT B;  1WVH A;  2KUP A;  1FAO A;  2GJY A;  1X11 A;  5DHA B;  2D2Q A;  4KHB B;  2P0F A;  1U5E A;  2ZPY A;  3FM8 C;  5HE3 A;  2DN6 A;  1X1F A;  2R09 A;  4MT7 A;  1V5U A;  1V88 A;  2RLO A;  5C5B A;  4HB2 B;  3U8Z A;  4KVG B;  1BAK A;  1V5M A;  3NSU A;  4EMO A;  5KQ4 A;  3CIK A;  2DX5 A;  3M1I B;  2XQN M;  3BJI A;  4EJN A;  3ULC A;  2P0D A;  1BWN A;  1MKE A;  1U5D A;  1MAI A;  3X23 A;  2DA0 A;  2RGN B;  5CLQ B;  4A6H A;  4NY0 A;  1U29 A;  5D27 A;  4KHO A;  2DYQ A;  3RCP A;  1SGH A;  4IOY X;  4DX8 A;  3A8P A;  3VIA A;  3GYO A;  3G9W A;  2JP2 A;  3T06 A;  2I1K A;  3TVV A;  1DYN A;  3PVU A;  2YSZ A;  4YL8 A;  1XD4 A;  4DX9 0;  4XWX A;  3ZVR A;  4NSW A;  2DKP A;  2M38 A;  1WGU A;  2QKM A;  1M7R A;  1I7A A;  3KRW A;  4HDO A;  2MFQ A;  1TJ6 A;  1Q67 A;  3IVF A;  2P0H A;  3OAN A;  3PVW A;  2CRF A;  1ISN A;  3ZDT A;  2DFK A;  1EF1 A;  1GC7 A;  1UNQ A;  4K81 A;  2I5F A;  2LYD A;  1U5G A;  4F7U P;  5JP4 A;  3TO1 A;  3PZD A;  2NZ8 B;  4GZU A;  2Y8F A;  3QBV B;  3ODX A;  1V5P A;  1ZVR A;  1X05 A;  1OMW A;  5JHG A;  2D9Z A;  1AWE A;  1MIX A;  5HE2 A;  2DYN A;  4CHJ A;  3FEH A;  2R0D A;  2ROZ B;  5LON B;  2COC A;  1ZM0 A;  1GC6 A;  2YS5 A;  2H7E A;  2FJL A;  2D9Y A;  4H8S A;  1OY2 A;  4WSF A;  2DLW A;  3PG7 A;  1DDW A;  2D10 A;  3SNH A;  2LOZ A;  4Y94 A;  2IYB A;  2DHI A;  3ODW A;  1ZSQ A;  2D4Q A;  4HAU B;  2ELB A;  5CLL B;  4F7G A;  4HHV A;  1Z87 A;  1K5D B;  2CY4 A;  3D8F A;  3WA0 A;  3DXE A;  1QC6 A;  3SV1 A;  4MK0 A;  1I2H A;  2Z0P A;  4GXB A;  2IFS A;  1XKE A;  5KCV A;  2COF A;  2LOX A;  1Y5O A;  3DXC A;  2VRW B;  4TKN A;  1EVH A;  3ML4 A;  5D3X A;  1UEF A;  4WVF B;  4HAZ B;  2AEH A;  2MKR A;  2COA A;  1SHC A;  5D3V A;  1DRO A;  2Q13 A;  3DXD A;  5C79 A;  2DTC A;  1RRP B;  2EMS A;  4PNK A;  1FOE A;  1X1G A;  3TW1 A;  2UVM A;  4WJ7 A;  5J3Q A;  2BCJ A;  2MWN B;  3A8Q A;  1P3R A;  2D9W A;  2G35 A;  2N23 A;  1W1H A;  2RNR B;  5D3W A;  3ULB A;  5C16 A;  1MIZ B;  1KZG A;  5C6R A;  1V61 A;  1XCG A;  2OQB A;  3FSS A;  2NMB A;  3GYP A;  4HAV B;  4HAX B;  1BTK A;  4DXA B;  4Z2N A;  1PLS A;  3KY9 A;  1PMS A;  5J3Y A;  5EFX A;  4MY6 A;  2E2X A;  3PP2 A;  2I5C A;  5L81 A;  1TXD A;  2DKQ A;  4F7H A;  2X18 A;  3SUZ A;  5C5B B;  2DX1 A;  2D9V A;  4HAW B;  4KHA A;  3TCA A;  1P5T A;  2CAY A;  1UPR A;  3V5W A;  4A6F B;  3HQC A;  3D8D A;  3CXB B;  1W1D A;  1FHX A;  5GOW B;  2J0K A;  3LJU X;  4GMV A;  2K2U A;  4HDQ A;  2EMT A;  1KI1 B;  1W1G A;  3A98 B;  2GCJ A;  1FGY A;  2ADZ A;  2K2J A;  2LKO A;  3P7Z A;  2W2X D;  1MK7 B;  3KRX A;  4DBB A;  1TQZ A;  1U5F A;  1P6S A;  4HAY B;  1J0W A;  2Y7B A;  4HB0 B;  2GS0 A;  2J0M A;  2DHK A;  2ELA A;  2M14 A;  2COD A;  5DI9 B;  1DBH A;  1LW3 A;  4K2P A;  2GCL A;  2RSG A;  3MDB C;  1WJ1 A;  1XX0 A;  1WJM A;  1BTN A;  5J3T A;  4GMX B;  4TYZ A;  4PQ0 A;  2AL6 A;  1U2B A;  2I1J A;  2QKL A;  3PSC A;  3D8E A;  4YON A;  3BIN A;  3KZ1 A;  3TFM A;  1LB1 A;  4Z2M B;  1MK9 B;  4EKU A;  1NI2 A;  1FGZ A;  4L6E A;  3MPX A;  2LUL A;  3QIJ A;  2OTX A;  1H4R A;  3AJ4 A;  1PFJ A;  3HW2 B;  1WG7 A;  3SYX A;  2N0Y A;  4A6F A;  1V89 A;  2L1C A;  1MPH A;  3PEG A;  3PVL A;  1WGQ A;  2W2W A;  3KSY A;  2HE7 A;  2RVB B;  4HAT B;  4KAX B;  3N7C A;  5FI1 A;  4C0A A;  1OQN A;  2EJ8 A;  3WYF B;  2YRY A;  2YS3 A;  5DIF B;  2PZ1 A;  4ZRK A;  3U7D A;  2J59 M;  4IFS A;  3HK0 A;  3AU4 A;  4HB4 B;  4ZRJ A;  4A6K A;  1UPQ A;  5HE1 A;  1WI1 A;  2D9X A;  1Y19 B;  2Z0O A;  2UZR A;  2YS1 A;  3ODO A;  2V76 A;  4ZRI A;  3VOQ A;  1XOD A;  2L2I A;  1NU2 A;  3P6A A;  1EAZ A;  1ZC4 B;  2YF0 A;  3O96 A;  5JHH A;  1FB8 A;  5DH9 B;  2J0J A;  1E5W A;  2VSZ A;  5LOP B;  3UZT A;  2UZS A;  2VKI A;  4CYE A;  4GN1 A;  2HTH B;  1K5G B;  1KZ7 A;  1J19 A;  1EGX A;  3F5R A;  3SO6 A;  1RJ2 A;  3F0W A;  1B55 A;  2Y8G A;  1N3H A;  2K00 A;  1AQC A;  5JLJ B;  1NTY A;  5DHF B;  2ROV A;  5FI0 A;  4K17 A;  2KCJ A;  2P8V A;  5KQ1 A;  1UNP A;  2W2X C;  2YT1 A;  5D3Y A;  1DDM A;  1H10 A; 
#chains in the Genus database with same CATH topology
 4BBK A;  1T77 A;  2MDX A;  5I2M A;  4P7I A;  2Z0Q A;  2LG1 A;  4A5K A;  1DDV A;  5HE0 A;  2EC1 A;  4IAP A;  4HSI A;  1M7E A;  1NTV A;  3AU5 A;  2D11 A;  1IRS A;  1FHW A;  2YT0 A;  1U27 A;  2CY5 A;  2KGX B;  1X86 A;  1UNR A;  3QWM A;  4K2O A;  1ZC3 B;  1GG3 A;  2RUK B;  2YVC A;  1XR0 B;  2H7D A;  2DHJ A;  4HB3 B;  1FHO A;  1QQG A;  4B6H A;  4CHM A;  4D0N B;  4GPT B;  2KR0 A;  4QJ4 B;  1WVH A;  2KUP A;  1FAO A;  2GJY A;  1X11 A;  5DHA B;  2D2Q A;  4KHB B;  2P0F A;  1U5E A;  2ZPY A;  3FM8 C;  5HE3 A;  2DN6 A;  1X1F A;  2R09 A;  4MT7 A;  1V5U A;  1V88 A;  2RLO A;  5C5B A;  4HB2 B;  3U8Z A;  4KVG B;  1BAK A;  1V5M A;  3NSU A;  4EMO A;  5KQ4 A;  3CIK A;  2DX5 A;  3M1I B;  2XQN M;  3BJI A;  3DCX A;  4EJN A;  3ULC A;  2P0D A;  3HSA A;  1BWN A;  1MKE A;  1U5D A;  1MAI A;  3X23 A;  2DA0 A;  2RGN B;  5CLQ B;  2YT2 A;  4A6H A;  4NY0 A;  1U29 A;  5D27 A;  4KHO A;  2DYQ A;  3RCP A;  3U12 A;  1SGH A;  4IOY X;  4DX8 A;  3B77 A;  3A8P A;  3VIA A;  5IRS A;  3GYO A;  3G9W A;  2KIE A;  2JP2 A;  3T06 A;  2I1K A;  3TVV A;  1DYN A;  3PVU A;  2YSZ A;  4YL8 A;  1XD4 A;  4DX9 0;  4XWX A;  3ZVR A;  4NSW A;  2DKP A;  2M38 A;  4D6W A;  1WGU A;  2QKM A;  4L1R A;  1M7R A;  1I7A A;  3KRW A;  4HDO A;  2MFQ A;  1TJ6 A;  1Q67 A;  3IVF A;  2P0H A;  3OAN A;  3PVW A;  2CRF A;  1ISN A;  3ZDT A;  2DFK A;  1EF1 A;  3OHM B;  1GC7 A;  1UNQ A;  4K81 A;  2I5F A;  2LYD A;  1U5G A;  4F7U P;  5JP4 A;  3TO1 A;  3PZD A;  2NZ8 B;  2FJU B;  4GZU A;  2Y8F A;  3QBV B;  3ODX A;  3HIE A;  1V5P A;  1ZVR A;  1X05 A;  1OMW A;  5JHG A;  2D9Z A;  1AWE A;  1MIX A;  2K49 A;  5HE2 A;  2DYN A;  4CHJ A;  3FEH A;  2R0D A;  2ROZ B;  5LON B;  2COC A;  1ZM0 A;  1GC6 A;  2YS5 A;  2H7E A;  2FJL A;  2D9Y A;  4QJ3 B;  4H8S A;  1OY2 A;  4WSF A;  2DLW A;  5LG4 B;  3PG7 A;  1DDW A;  2D10 A;  3SNH A;  2LOZ A;  4Y94 A;  4CSQ A;  4QJ5 B;  2IYB A;  2DHI A;  3ODW A;  1ZSQ A;  2D4Q A;  4HAU B;  2ELB A;  2RRF A;  5CLL B;  4F7G A;  4HHV A;  1Z87 A;  3FVC A;  1K5D B;  1MI1 A;  2CY4 A;  3D8F A;  3WA0 A;  3DXE A;  1QC6 A;  3SV1 A;  4MK0 A;  1I2H A;  2Z0P A;  4GXB A;  2IFS A;  1XKE A;  4DIX A;  2COF A;  5KCV A;  4GNK B;  2LOX A;  1Y5O A;  3DXC A;  2VRW B;  4TKN A;  1EVH A;  3ML4 A;  5D3X A;  1UEF A;  4WVF B;  4HAZ B;  2AEH A;  2MKR A;  2COA A;  1SHC A;  3NWA A;  5D3V A;  1DRO A;  2Q13 A;  3DXD A;  5C79 A;  2DTC A;  3NW8 A;  1RRP B;  2EMS A;  4PNK A;  1FOE A;  1X1G A;  3TW1 A;  2UVM A;  4WJ7 A;  5J3Q A;  2BCJ A;  2MWN B;  3A8Q A;  1P3R A;  2D9W A;  2G35 A;  2N23 A;  1W1H A;  2RNR B;  5D3W A;  3ULB A;  5C16 A;  1MIZ B;  1KZG A;  5C6R A;  5M4Y B;  4OSN A;  1V61 A;  1XCG A;  2OQB A;  3FSS A;  2NMB A;  3GYP A;  4HAV B;  4HAX B;  1BTK A;  4DXA B;  4Z2N A;  1PLS A;  4KHB A;  3KY9 A;  1PMS A;  5J3Y A;  5EFX A;  2K8E A;  4MY6 A;  2E2X A;  3PP2 A;  2I5C A;  5L81 A;  1TXD A;  2DKQ A;  4F7H A;  2X18 A;  3SUZ A;  3NWF A;  5C5B B;  2DX1 A;  2D9V A;  4HAW B;  4KHA A;  3TCA A;  1P5T A;  2CAY A;  1UPR A;  2Z59 A;  3V5W A;  4A6F B;  3HQC A;  3D8D A;  3CXB B;  1W1D A;  1FHX A;  5GOW B;  2J0K A;  4QXA B;  3LJU X;  4GMV A;  2K2U A;  4HDQ A;  2EMT A;  1KI1 B;  1W1G A;  3A98 B;  2GCJ A;  1FGY A;  2ADZ A;  2K2J A;  2LKO A;  3P7Z A;  2W2X D;  1MK7 B;  3KRX A;  2Z4D A;  4DBB A;  1TQZ A;  1U5F A;  1P6S A;  4HAY B;  2Z13 A;  1J0W A;  2Y7B A;  4HB0 B;  2GS0 A;  2J0M A;  2DHK A;  2ELA A;  2M14 A;  2COD A;  5DI9 B;  1DBH A;  1LW3 A;  3NWD A;  4K2P A;  2GCL A;  2RSG A;  3MDB C;  1WJ1 A;  1XX0 A;  2R2Y A;  1WJM A;  1BTN A;  5J3T A;  4GMX B;  4TYZ A;  4PQ0 A;  2AL6 A;  1U2B A;  2I1J A;  2QKL A;  3PSC A;  3D8E A;  4YON A;  3BIN A;  3KZ1 A;  3TFM A;  2GUM A;  1LB1 A;  4Z2M B;  1MK9 B;  4GOU A;  4EKU A;  1NI2 A;  1FGZ A;  4L6E A;  3MPX A;  2LUL A;  3QIJ A;  2OTX A;  1H4R A;  3AJ4 A;  1PFJ A;  3HW2 B;  1WG7 A;  4OT1 A;  3SYX A;  2N0Y A;  4A6F A;  1V89 A;  2L1C A;  1MPH A;  3PEG A;  3PVL A;  1WGQ A;  2W2W A;  3KSY A;  2HE7 A;  2RVB B;  4HAT B;  4KAX B;  3N7C A;  2NBV A;  5FI1 A;  4C0A A;  1OQN A;  2EJ8 A;  3WYF B;  2YRY A;  2YS3 A;  5DIF B;  2PZ1 A;  4ZRK A;  3U7D A;  2J59 M;  4IFS A;  3HK0 A;  3AU4 A;  4HB4 B;  4ZRJ A;  4A6K A;  1UPQ A;  5HE1 A;  1WI1 A;  2D9X A;  5I2S A;  2ZKM X;  1Y19 B;  2Z0O A;  2UZR A;  2YS1 A;  3ODO A;  2V76 A;  4ZRI A;  3VOQ A;  1XOD A;  2L2I A;  1NU2 A;  2YF0 A;  1EAZ A;  1ZC4 B;  3O96 A;  3P6A A;  5JHH A;  2Z14 A;  1FB8 A;  5DH9 B;  2J0J A;  1E5W A;  2KIG A;  2VSZ A;  5LOP B;  3UZT A;  2UZS A;  2VKI A;  4CYE A;  4GN1 A;  2HTH B;  1K5G B;  1KZ7 A;  1J19 A;  1EGX A;  3F5R A;  1ZYI A;  3SO6 A;  1RJ2 A;  3F0W A;  1B55 A;  2Y8G A;  1N3H A;  2K00 A;  1AQC A;  2KUQ A;  5JLJ B;  1NTY A;  5DHF B;  2ROV A;  5FI0 A;  4K17 A;  2KCJ A;  3A58 A;  2P8V A;  5KQ1 A;  1UNP A;  2W2X C;  2YT1 A;  5D3Y A;  1DDM A;  1H10 A; 
#chains in the Genus database with same CATH homology
 4BBK A;  2MDX A;  4P7I A;  2Z0Q A;  2LG1 A;  4A5K A;  1DDV A;  5HE0 A;  2EC1 A;  4IAP A;  1M7E A;  1NTV A;  3AU5 A;  2D11 A;  1IRS A;  1FHW A;  2YT0 A;  1U27 A;  2CY5 A;  2KGX B;  1X86 A;  1UNR A;  3QWM A;  4K2O A;  1ZC3 B;  1GG3 A;  2RUK B;  2YVC A;  1XR0 B;  2H7D A;  2DHJ A;  4HB3 B;  1FHO A;  1QQG A;  4B6H A;  4CHM A;  4D0N B;  4GPT B;  1WVH A;  2KUP A;  1FAO A;  2GJY A;  1X11 A;  5DHA B;  2D2Q A;  4KHB B;  2P0F A;  1U5E A;  2ZPY A;  3FM8 C;  5HE3 A;  2DN6 A;  1X1F A;  2R09 A;  4MT7 A;  1V5U A;  1V88 A;  2RLO A;  5C5B A;  4HB2 B;  3U8Z A;  4KVG B;  1BAK A;  1V5M A;  3NSU A;  4EMO A;  5KQ4 A;  3CIK A;  2DX5 A;  3M1I B;  2XQN M;  3BJI A;  4EJN A;  3ULC A;  2P0D A;  1BWN A;  1MKE A;  1U5D A;  1MAI A;  3X23 A;  2DA0 A;  2RGN B;  5CLQ B;  4A6H A;  4NY0 A;  1U29 A;  5D27 A;  4KHO A;  2DYQ A;  3RCP A;  1SGH A;  4IOY X;  4DX8 A;  3A8P A;  3VIA A;  3GYO A;  3G9W A;  2JP2 A;  3T06 A;  2I1K A;  3TVV A;  1DYN A;  3PVU A;  2YSZ A;  4YL8 A;  1XD4 A;  4DX9 0;  4XWX A;  3ZVR A;  4NSW A;  2DKP A;  2M38 A;  1WGU A;  2QKM A;  1M7R A;  1I7A A;  3KRW A;  4HDO A;  2MFQ A;  1TJ6 A;  1Q67 A;  3IVF A;  2P0H A;  3OAN A;  3PVW A;  2CRF A;  1ISN A;  3ZDT A;  2DFK A;  1EF1 A;  1GC7 A;  1UNQ A;  4K81 A;  2I5F A;  2LYD A;  1U5G A;  4F7U P;  5JP4 A;  3TO1 A;  3PZD A;  2NZ8 B;  4GZU A;  2Y8F A;  3QBV B;  3ODX A;  1V5P A;  1ZVR A;  1X05 A;  1OMW A;  5JHG A;  2D9Z A;  1AWE A;  1MIX A;  5HE2 A;  2DYN A;  4CHJ A;  3FEH A;  2R0D A;  2ROZ B;  5LON B;  2COC A;  1ZM0 A;  1GC6 A;  2YS5 A;  2H7E A;  2FJL A;  2D9Y A;  4H8S A;  1OY2 A;  4WSF A;  2DLW A;  3PG7 A;  1DDW A;  2D10 A;  3SNH A;  2LOZ A;  4Y94 A;  2IYB A;  2DHI A;  3ODW A;  1ZSQ A;  2D4Q A;  4HAU B;  2ELB A;  5CLL B;  4F7G A;  4HHV A;  1Z87 A;  1K5D B;  2CY4 A;  3D8F A;  3WA0 A;  3DXE A;  1QC6 A;  3SV1 A;  4MK0 A;  1I2H A;  2Z0P A;  4GXB A;  2IFS A;  1XKE A;  5KCV A;  2COF A;  2LOX A;  1Y5O A;  3DXC A;  2VRW B;  4TKN A;  1EVH A;  3ML4 A;  5D3X A;  1UEF A;  4WVF B;  4HAZ B;  2AEH A;  2MKR A;  2COA A;  1SHC A;  5D3V A;  1DRO A;  2Q13 A;  3DXD A;  5C79 A;  2DTC A;  1RRP B;  2EMS A;  4PNK A;  1FOE A;  1X1G A;  3TW1 A;  2UVM A;  4WJ7 A;  5J3Q A;  2BCJ A;  2MWN B;  3A8Q A;  1P3R A;  2D9W A;  2G35 A;  2N23 A;  1W1H A;  2RNR B;  5D3W A;  3ULB A;  5C16 A;  1MIZ B;  1KZG A;  5C6R A;  1V61 A;  1XCG A;  2OQB A;  3FSS A;  2NMB A;  3GYP A;  4HAV B;  4HAX B;  1BTK A;  4DXA B;  4Z2N A;  1PLS A;  3KY9 A;  1PMS A;  5J3Y A;  5EFX A;  4MY6 A;  2E2X A;  3PP2 A;  2I5C A;  5L81 A;  1TXD A;  2DKQ A;  4F7H A;  2X18 A;  3SUZ A;  5C5B B;  2DX1 A;  2D9V A;  4HAW B;  4KHA A;  3TCA A;  1P5T A;  2CAY A;  1UPR A;  3V5W A;  4A6F B;  3HQC A;  3D8D A;  3CXB B;  1W1D A;  1FHX A;  5GOW B;  2J0K A;  3LJU X;  4GMV A;  2K2U A;  4HDQ A;  2EMT A;  1KI1 B;  1W1G A;  3A98 B;  2GCJ A;  1FGY A;  2ADZ A;  2K2J A;  2LKO A;  3P7Z A;  2W2X D;  1MK7 B;  3KRX A;  4DBB A;  1TQZ A;  1U5F A;  1P6S A;  4HAY B;  1J0W A;  2Y7B A;  4HB0 B;  2GS0 A;  2J0M A;  2DHK A;  2ELA A;  2M14 A;  2COD A;  5DI9 B;  1DBH A;  1LW3 A;  4K2P A;  2GCL A;  2RSG A;  3MDB C;  1WJ1 A;  1XX0 A;  1WJM A;  1BTN A;  5J3T A;  4GMX B;  4TYZ A;  4PQ0 A;  2AL6 A;  1U2B A;  2I1J A;  2QKL A;  3PSC A;  3D8E A;  4YON A;  3BIN A;  3KZ1 A;  3TFM A;  1LB1 A;  4Z2M B;  1MK9 B;  4EKU A;  1NI2 A;  1FGZ A;  4L6E A;  3MPX A;  2LUL A;  3QIJ A;  2OTX A;  1H4R A;  3AJ4 A;  1PFJ A;  3HW2 B;  1WG7 A;  3SYX A;  2N0Y A;  4A6F A;  1V89 A;  2L1C A;  1MPH A;  3PEG A;  3PVL A;  1WGQ A;  2W2W A;  3KSY A;  2HE7 A;  2RVB B;  4HAT B;  4KAX B;  3N7C A;  5FI1 A;  4C0A A;  1OQN A;  2EJ8 A;  3WYF B;  2YRY A;  2YS3 A;  5DIF B;  2PZ1 A;  4ZRK A;  3U7D A;  2J59 M;  4IFS A;  3HK0 A;  3AU4 A;  4HB4 B;  4ZRJ A;  4A6K A;  1UPQ A;  5HE1 A;  1WI1 A;  2D9X A;  1Y19 B;  2Z0O A;  2UZR A;  2YS1 A;  3ODO A;  2V76 A;  4ZRI A;  3VOQ A;  1XOD A;  2L2I A;  1NU2 A;  3P6A A;  1EAZ A;  1ZC4 B;  2YF0 A;  3O96 A;  5JHH A;  1FB8 A;  5DH9 B;  2J0J A;  1E5W A;  2VSZ A;  5LOP B;  3UZT A;  2UZS A;  2VKI A;  4CYE A;  4GN1 A;  2HTH B;  1K5G B;  1KZ7 A;  1J19 A;  1EGX A;  3F5R A;  3SO6 A;  1RJ2 A;  3F0W A;  1B55 A;  2Y8G A;  1N3H A;  2K00 A;  1AQC A;  5JLJ B;  1NTY A;  5DHF B;  2ROV A;  5FI0 A;  4K17 A;  2KCJ A;  2P8V A;  5KQ1 A;  1UNP A;  2W2X C;  2YT1 A;  5D3Y A;  1DDM A;  1H10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...