2DX5A

The complex structure between the mouse eap45-glue domain and ubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
99
Chain Sequence
LLEINETLVIQQRGVRVYDGEEKFDAGTLLLSTHRLIWRDQKNNECCMAIPLSQIVFIEEQAKIVVHLHSKNSYIRLSFKEHGQIEFYRRLSEEMTQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting protein 36
publication title Structural basis of ubiquitin recognition by mammalian Eap45 GLUE domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport/signaling protein
total genus 14
structure length 99
sequence length 121
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dx5A00
4PQ0A 2DX5A 2D9XA 2IYBA 3FEHA 4Y94A 1W1GA 3TO1A 1PLSA 2AEHA 1U5DA 4XWXA 3HW2B 5KCVA 1NTYA 2ROZB 3DXCA 1DBHA 2ELBA 4GN1A 4KAXB 1UNQA 1DROA 4EKUA 2D9YA 2EMTA 4A6KA 2DKPA 4HB2B 3ZDTA 1ZM0A 2DYQA 2P8VA 1GC6A 2COCA 4YONA 3F0WA 3FSSA 1PMSA 1FHWA 2YVCA 4Z2NA 1NU2A 4HATB 1UPRA 2P0DA 5LONB 4HB4B 3V5WA 1MK7B 3VIAA 4GXBA 4P7IA 4BBKA 3PSCA 2J59M 2LYDA 2Y8FA 2L1CA 4KHBB 4A6FB 2UZSA 1V61A 2I1KA 1MKEA 5DHAB 2ADZA 2MKRA 4K2PA 1I2HA 4H8SA 5EFXA 2D10A 1X11A 1FHXA 3KY9A 3AU4A 3LJUX 3M1IB 5DIFB 4YL8A 5D3VA 4A6HA 4HAWB 1AWEA 1UEFA 1QC6A 3X23A 3D8FA 2D9WA 2D9VA 5C5BA 1V5UA 4HAYB 3DXDA 2I1JA 4HAXB 1V5MA 5C16A 1BTNA 2Z0OA 4GZUA 2N0YA 3ULBA 2QKMA 1OY2A 1X86A 1FHOA 3D8EA 3U8ZA 4IFSA 1XD4A 1Q67A 5C5BB 4KHAA 5JHHA 2DX1A 4ZRKA 4K81A 5D3XA 1EF1A 3QBVB 2R09A 2COAA 2CY4A 2VRWB 1W1HA 5J3YA 2YS3A 3VOQA 1X05A 1OQNA 1K5DB 2DA0A 5D3WA 5CLLB 2X18A 2K2JA 5JLJB 5D3YA 4DX90 2MWNB 5L81A 1WJMA 3WA0A 1LW3A 1ZC4B 2CY5A 1MK9B 2D2QA 1UNRA 3IVFA 5FI0A 3A8PA 3PVUA 4IOYX 2EC1A 4NY0A 1J19A 4ZRJA 5FI1A 1KZ7A 4WJ7A 5KQ1A 3PVLA 3N7CA 2PZ1A 3TW1A 2ZPYA 3F5RA 3TFMA 3PEGA 2J0KA 2KUPA 4DBBA 1GC7A 3T06A 2DFKA 1EAZA 1BWNA 2DHKA 2L2IA 4DX8A 1MPHA 3PZDA 5LOPB 2DHIA 5DH9B 3DXEA 2XQNM 2J0JA 2Z0PA 1WJ1A 1FOEA 2Y8GA 5HE3A 3SNHA 2UZRA 2EJ8A 3NSUA 4HDQA 2HE7A 3SO6A 1FAOA 1UNPA 2G35A 2RVBB 4HAUB 1U2BA 2RSGA 2OQBA 3CIKA 4MT7A 3ML4A 3TVVA 1GG3A 1X1FA 2E2XA 2DYNA 2J0MA 1H10A 3O96A 1FGZA 2HTHB 4KVGB 1BAKA 1XX0A 1KI1B 4B6HA 3GYOA 1K5GB 2KGXB 5CLQB 4D0NB 2N23A 1B55A 1DYNA 3SYXA 3ULCA 2H7DA 2DHJA 1U27A 5HE1A 3SUZA 3TCAA 1H4RA 4HB3B 2LG1A 3ZVRA 3KRXA 3SV1A 1QQGA 2W2WA 2GCLA 2P0HA 1V5PA 3P6AA 2R0DA 3UZTA 2CAYA 3MDBC 4L6EA 3RCPA 1WG7A 1ZC3B 1TXDA 1Y19B 3AU5A 2YT1A 1RJ2A 1PFJA 3QWMA 1XCGA 4EJNA 1XR0B 1NTVA 4HDOA 3QIJA 2LOZA 2YF0A 4DXAB 1W1DA 1OMWA 2I5FA 2OTXA 2VKIA 1P6SA 1EGXA 3OANA 2AL6A 2V76A 2D11A 2RNRB 2QKLA 2YS1A 2CRFA 4HAZB 2YT0A 1EVHA 4IAPA 2ELAA 2Z0QA 4NSWA 1ISNA 1J0WA 1N3HA 2D4QA 2RGNB 2M14A 4PNKA 2I5CA 3PVWA 1M7EA 5C6RA 2H7EA 3D8DA 1DDMA 2P0FA 1E5WA 2NZ8B 4HHVA 1MIXA 2RUKB 3KSYA 1P3RA 1SGHA 5C79A 2GCJA 1XKEA 1ZSQA 5KQ4A 2MFQA 3A8QA 1V89A 1X1GA 4Z2MB 3AJ4A 3KZ1A 4K2OA 1WI1A 3ODXA 4WVFB 2YRYA 1LB1A 1AQCA 3HQCA 1UPQA 2W2XC 4A5KA 2BCJA 4A6FA 3HK0A 4F7HA 2JP2A 2YS5A 4GPTB 3KRWA 4KHOA 1P5TA 2IFSA 1RRPB 2DLWA 1MAIA 4CHJA 1NI2A 2W2XD 1WGUA 2M38A 3ODOA 5HE0A 4C0AA 2LOXA 1ZVRA 2K00A 3P7ZA 5HE2A 3PP2A 1KZGA 2YSZA 4MY6A 1WVHA 2UVMA 3BJIA 3MPXA 4TKNA 5J3QA 1MIZB 2DKQA 2FJLA 4TYZA 4CYEA 5D27A 4HAVB 5GOWB 3A98B 2CODA 2MDXA 4HB0B 2LULA 4CHMA 1M7RA 1FB8A 1U5FA 1I7AA 2Q13A 5J3TA 3WYFB 4ZRIA 5JP4A 2D9ZA 1DDWA 3G9WA 1XODA 3BINA 3GYPA 1IRSA 3ODWA 4F7UP 2LKOA 2NMBA 4GMXB 5JHGA 4GMVA 2EMSA 1U5EA 1TJ6A 1TQZA 4MK0A 2VSZA 2GS0A 1V88A 1WGQA 4WSFA 2KCJA 2COFA 1SHCA 1FGYA 1U5GA 2Y7BA 4K17A 2GJYA 3FM8C 1U29A 2DN6A 1DDVA 3CXBB 1BTKA 2ROVA 1Y5OA 3PG7A 4EMOA 2DTCA 3U7DA 5DI9B 1Z87A 2K2UA 4F7GA 2RLOA 5DHFB
chains in the Genus database with same CATH superfamily
4PQ0A 2DX5A 2D9XA 2IYBA 3FEHA 4Y94A 1W1GA 3TO1A 2GUMA 1PLSA 2AEHA 1U5DA 4XWXA 3HW2B 5KCVA 1NTYA 2ROZB 3DXCA 1DBHA 2ELBA 4GN1A 4KAXB 1UNQA 1DROA 4EKUA 2D9YA 2EMTA 4A6KA 2DKPA 4HB2B 3ZDTA 1ZM0A 2DYQA 2P8VA 1GC6A 2COCA 4YONA 3F0WA 4KHBA 3FSSA 1PMSA 1FHWA 2YVCA 4Z2NA 1NU2A 4HATB 1UPRA 2P0DA 5LONB 4HB4B 3V5WA 1MK7B 3VIAA 4GXBA 4P7IA 4BBKA 3PSCA 2J59M 2LYDA 2Y8FA 2L1CA 4KHBB 4A6FB 2UZSA 1V61A 2I1KA 1MKEA 5DHAB 2ADZA 1ZYIA 2MKRA 4K2PA 1I2HA 4H8SA 5EFXA 2D10A 1X11A 2ZKMX 1FHXA 3KY9A 3AU4A 3LJUX 3M1IB 5DIFB 4YL8A 5D3VA 4A6HA 4HAWB 1AWEA 1UEFA 1QC6A 3X23A 5IRSA 3D8FA 2D9WA 1MI1A 2D9VA 5C5BA 2K49A 1V5UA 4HAYB 3DXDA 2I1JA 4HAXB 1V5MA 5C16A 1BTNA 2Z0OA 4GZUA 2N0YA 3ULBA 2QKMA 1OY2A 1X86A 1FHOA 3D8EA 3U8ZA 2Z13A 4IFSA 1XD4A 1Q67A 5C5BB 4KHAA 5JHHA 2DX1A 4ZRKA 2R2YA 4K81A 4QJ5B 5D3XA 1EF1A 3QBVB 2R09A 2COAA 2CY4A 2VRWB 1W1HA 5J3YA 2YS3A 3VOQA 1X05A 1OQNA 5LG4B 1K5DB 2DA0A 5D3WA 5CLLB 3B77A 2X18A 2K2JA 5JLJB 5D3YA 4DX90 2MWNB 5L81A 1WJMA 3WA0A 1LW3A 1ZC4B 2CY5A 1MK9B 2D2QA 1UNRA 3IVFA 5FI0A 3A8PA 3PVUA 4IOYX 2EC1A 4NY0A 1J19A 4ZRJA 2K8EA 5FI1A 1KZ7A 4WJ7A 5KQ1A 3PVLA 3N7CA 2PZ1A 3TW1A 2ZPYA 3NW8A 3F5RA 3TFMA 3PEGA 2J0KA 2KUPA 4DBBA 1GC7A 3T06A 2DFKA 1EAZA 1BWNA 2DHKA 2L2IA 4DX8A 1MPHA 3PZDA 5LOPB 2DHIA 2KR0A 5DH9B 3DXEA 2XQNM 2J0JA 2Z0PA 1WJ1A 5M4YB 1FOEA 4QXAB 2Y8GA 5HE3A 3SNHA 2UZRA 2EJ8A 3NSUA 4HDQA 2HE7A 3SO6A 1FAOA 1UNPA 4GOUA 2G35A 2FJUB 2RVBB 4HAUB 1U2BA 2RSGA 2OQBA 3CIKA 4MT7A 3ML4A 3TVVA 3HSAA 1GG3A 3HIEA 1X1FA 4HSIA 2E2XA 2DYNA 2J0MA 1H10A 3O96A 1FGZA 2HTHB 4KVGB 1BAKA 1XX0A 1KI1B 4B6HA 3GYOA 1K5GB 2KGXB 5CLQB 2Z59A 4D0NB 2N23A 1B55A 1DYNA 3SYXA 3ULCA 2H7DA 2DHJA 1U27A 5HE1A 3SUZA 3TCAA 1H4RA 4HB3B 2LG1A 3ZVRA 3KRXA 3SV1A 1QQGA 4L1RA 2W2WA 2GCLA 2P0HA 1V5PA 4OT1A 3P6AA 2R0DA 3UZTA 4GNKB 2CAYA 3MDBC 4L6EA 3RCPA 1WG7A 1ZC3B 1TXDA 1Y19B 3AU5A 2YT1A 1RJ2A 1PFJA 3QWMA 1XCGA 4DIXA 4EJNA 3NWDA 1XR0B 1NTVA 4HDOA 3QIJA 2LOZA 2YF0A 4DXAB 1W1DA 1OMWA 2I5FA 2OTXA 2VKIA 1P6SA 1EGXA 3OANA 2AL6A 2V76A 2D11A 2RNRB 2QKLA 2YS1A 2CRFA 4HAZB 2YT0A 1EVHA 4IAPA 2ELAA 2Z0QA 4NSWA 1ISNA 1J0WA 1N3HA 2D4QA 2RGNB 2M14A 4QJ4B 4PNKA 2KIEA 2I5CA 3PVWA 1M7EA 5C6RA 2H7EA 3D8DA 1DDMA 2RRFA 2P0FA 1E5WA 2NZ8B 4HHVA 1MIXA 2RUKB 1P3RA 3KSYA 1SGHA 5C79A 2GCJA 1XKEA 1ZSQA 3OHMB 5KQ4A 2MFQA 3A8QA 1V89A 1X1GA 4Z2MB 3AJ4A 3KZ1A 4K2OA 1WI1A 3ODXA 4WVFB 4D6WA 2YRYA 1LB1A 1AQCA 3HQCA 1UPQA 2W2XC 4A5KA 2BCJA 4OSNA 4A6FA 3HK0A 4F7HA 2JP2A 2YS5A 4GPTB 3KRWA 2Z4DA 4KHOA 1P5TA 2IFSA 1RRPB 2DLWA 1MAIA 5I2SA 2KUQA 2NBVA 4CHJA 1NI2A 2W2XD 2YT2A 1WGUA 2M38A 3ODOA 3NWAA 3FVCA 5HE0A 4C0AA 2LOXA 1ZVRA 2K00A 3P7ZA 3DCXA 5HE2A 3PP2A 1KZGA 2YSZA 3A58A 4MY6A 1WVHA 2UVMA 3BJIA 3MPXA 4TKNA 5J3QA 1MIZB 2DKQA 2FJLA 4TYZA 4CYEA 5D27A 4HAVB 5GOWB 3A98B 2CODA 2MDXA 4HB0B 2LULA 4CHMA 1M7RA 1FB8A 3U12A 1U5FA 1I7AA 2Q13A 5J3TA 3WYFB 4ZRIA 5JP4A 2D9ZA 1DDWA 3G9WA 1XODA 3BINA 3GYPA 1IRSA 3ODWA 4F7UP 2LKOA 2NMBA 4CSQA 4GMXB 5JHGA 4GMVA 3NWFA 2EMSA 5I2MA 1U5EA 1TJ6A 1TQZA 4MK0A 2KIGA 2VSZA 2GS0A 1V88A 1WGQA 4WSFA 2KCJA 2COFA 1SHCA 1FGYA 1U5GA 2Y7BA 4K17A 2GJYA 3FM8C 2Z14A 1U29A 2DN6A 1DDVA 1T77A 3CXBB 1BTKA 2ROVA 1Y5OA 3PG7A 4EMOA 2DTCA 3U7DA 5DI9B 1Z87A 2K2UA 4F7GA 2RLOA 4QJ3B 5DHFB
chains in the Genus database with same CATH topology
4PQ0A 2DX5A 2D9XA 2IYBA 3FEHA 4Y94A 1W1GA 3TO1A 1PLSA 2AEHA 1U5DA 4XWXA 3HW2B 5KCVA 1NTYA 2ROZB 3DXCA 1DBHA 2ELBA 4GN1A 4KAXB 1UNQA 1DROA 4EKUA 2D9YA 2EMTA 4A6KA 2DKPA 4HB2B 3ZDTA 1ZM0A 2DYQA 2P8VA 1GC6A 2COCA 4YONA 3F0WA 3FSSA 1PMSA 1FHWA 2YVCA 4Z2NA 1NU2A 4HATB 1UPRA 2P0DA 5LONB 4HB4B 3V5WA 1MK7B 3VIAA 4GXBA 4P7IA 4BBKA 3PSCA 2J59M 2LYDA 2Y8FA 2L1CA 4KHBB 4A6FB 2UZSA 1V61A 2I1KA 1MKEA 5DHAB 2ADZA 2MKRA 4K2PA 1I2HA 4H8SA 5EFXA 2D10A 1X11A 1FHXA 3KY9A 3AU4A 3LJUX 3M1IB 5DIFB 4YL8A 5D3VA 4A6HA 4HAWB 1AWEA 1UEFA 1QC6A 3X23A 3D8FA 2D9WA 2D9VA 5C5BA 1V5UA 4HAYB 3DXDA 2I1JA 4HAXB 1V5MA 5C16A 1BTNA 2Z0OA 4GZUA 2N0YA 3ULBA 2QKMA 1OY2A 1X86A 1FHOA 3D8EA 3U8ZA 4IFSA 1XD4A 1Q67A 5C5BB 4KHAA 5JHHA 2DX1A 4ZRKA 4K81A 5D3XA 1EF1A 3QBVB 2R09A 2COAA 2CY4A 2VRWB 1W1HA 5J3YA 2YS3A 3VOQA 1X05A 1OQNA 1K5DB 2DA0A 5D3WA 5CLLB 2X18A 2K2JA 5JLJB 5D3YA 4DX90 2MWNB 5L81A 1WJMA 3WA0A 1LW3A 1ZC4B 2CY5A 1MK9B 2D2QA 1UNRA 3IVFA 5FI0A 3A8PA 3PVUA 4IOYX 2EC1A 4NY0A 1J19A 4ZRJA 5FI1A 1KZ7A 4WJ7A 5KQ1A 3PVLA 3N7CA 2PZ1A 3TW1A 2ZPYA 3F5RA 3TFMA 3PEGA 2J0KA 2KUPA 4DBBA 1GC7A 3T06A 2DFKA 1EAZA 1BWNA 2DHKA 2L2IA 4DX8A 1MPHA 3PZDA 5LOPB 2DHIA 5DH9B 3DXEA 2XQNM 2J0JA 2Z0PA 1WJ1A 1FOEA 2Y8GA 5HE3A 3SNHA 2UZRA 2EJ8A 3NSUA 4HDQA 2HE7A 3SO6A 1FAOA 1UNPA 2G35A 2RVBB 4HAUB 1U2BA 2RSGA 2OQBA 3CIKA 4MT7A 3ML4A 3TVVA 1GG3A 1X1FA 2E2XA 2DYNA 2J0MA 1H10A 3O96A 1FGZA 2HTHB 4KVGB 1BAKA 1XX0A 1KI1B 4B6HA 3GYOA 1K5GB 2KGXB 5CLQB 4D0NB 2N23A 1B55A 1DYNA 3SYXA 3ULCA 2H7DA 2DHJA 1U27A 5HE1A 3SUZA 3TCAA 1H4RA 4HB3B 2LG1A 3ZVRA 3KRXA 3SV1A 1QQGA 2W2WA 2GCLA 2P0HA 1V5PA 3P6AA 2R0DA 3UZTA 2CAYA 3MDBC 4L6EA 3RCPA 1WG7A 1ZC3B 1TXDA 1Y19B 3AU5A 2YT1A 1RJ2A 1PFJA 3QWMA 1XCGA 4EJNA 1XR0B 1NTVA 4HDOA 3QIJA 2LOZA 2YF0A 4DXAB 1W1DA 1OMWA 2I5FA 2OTXA 2VKIA 1P6SA 1EGXA 3OANA 2AL6A 2V76A 2D11A 2RNRB 2QKLA 2YS1A 2CRFA 4HAZB 2YT0A 1EVHA 4IAPA 2ELAA 2Z0QA 4NSWA 1ISNA 1J0WA 1N3HA 2D4QA 2RGNB 2M14A 4PNKA 2I5CA 3PVWA 1M7EA 5C6RA 2H7EA 3D8DA 1DDMA 2P0FA 1E5WA 2NZ8B 4HHVA 1MIXA 2RUKB 3KSYA 1P3RA 1SGHA 5C79A 2GCJA 1XKEA 1ZSQA 5KQ4A 2MFQA 3A8QA 1V89A 1X1GA 4Z2MB 3AJ4A 3KZ1A 4K2OA 1WI1A 3ODXA 4WVFB 2YRYA 1LB1A 1AQCA 3HQCA 1UPQA 2W2XC 4A5KA 2BCJA 4A6FA 3HK0A 4F7HA 2JP2A 2YS5A 4GPTB 3KRWA 4KHOA 1P5TA 2IFSA 1RRPB 2DLWA 1MAIA 4CHJA 1NI2A 2W2XD 1WGUA 2M38A 3ODOA 5HE0A 4C0AA 2LOXA 1ZVRA 2K00A 3P7ZA 5HE2A 3PP2A 1KZGA 2YSZA 4MY6A 1WVHA 2UVMA 3BJIA 3MPXA 4TKNA 5J3QA 1MIZB 2DKQA 2FJLA 4TYZA 4CYEA 5D27A 4HAVB 5GOWB 3A98B 2CODA 2MDXA 4HB0B 2LULA 4CHMA 1M7RA 1FB8A 1U5FA 1I7AA 2Q13A 5J3TA 3WYFB 4ZRIA 5JP4A 2D9ZA 1DDWA 3G9WA 1XODA 3BINA 3GYPA 1IRSA 3ODWA 4F7UP 2LKOA 2NMBA 4GMXB 5JHGA 4GMVA 2EMSA 1U5EA 1TJ6A 1TQZA 4MK0A 2VSZA 2GS0A 1V88A 1WGQA 4WSFA 2KCJA 2COFA 1SHCA 1FGYA 1U5GA 2Y7BA 4K17A 2GJYA 3FM8C 1U29A 2DN6A 1DDVA 3CXBB 1BTKA 2ROVA 1Y5OA 3PG7A 4EMOA 2DTCA 3U7DA 5DI9B 1Z87A 2K2UA 4F7GA 2RLOA 5DHFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQ0 A;  2DX5 A;  2D9X A;  2IYB A;  3FEH A;  4Y94 A;  1W1G A;  3TO1 A;  1PLS A;  2AEH A;  1U5D A;  4XWX A;  3HW2 B;  5KCV A;  1NTY A;  2ROZ B;  3DXC A;  1DBH A;  2ELB A;  4GN1 A;  4KAX B;  1UNQ A;  1DRO A;  4EKU A;  2D9Y A;  2EMT A;  4A6K A;  2DKP A;  4HB2 B;  3ZDT A;  1ZM0 A;  2DYQ A;  2P8V A;  1GC6 A;  2COC A;  4YON A;  3F0W A;  3FSS A;  1PMS A;  1FHW A;  2YVC A;  4Z2N A;  1NU2 A;  4HAT B;  1UPR A;  2P0D A;  5LON B;  4HB4 B;  3V5W A;  1MK7 B;  3VIA A;  4GXB A;  4P7I A;  4BBK A;  3PSC A;  2J59 M;  2LYD A;  2Y8F A;  2L1C A;  4KHB B;  4A6F B;  2UZS A;  1V61 A;  2I1K A;  1MKE A;  5DHA B;  2ADZ A;  2MKR A;  4K2P A;  1I2H A;  4H8S A;  5EFX A;  2D10 A;  1X11 A;  1FHX A;  3KY9 A;  3AU4 A;  3LJU X;  3M1I B;  5DIF B;  4YL8 A;  5D3V A;  4A6H A;  4HAW B;  1AWE A;  1UEF A;  1QC6 A;  3X23 A;  3D8F A;  2D9W A;  2D9V A;  5C5B A;  1V5U A;  4HAY B;  3DXD A;  2I1J A;  4HAX B;  1V5M A;  5C16 A;  1BTN A;  2Z0O A;  4GZU A;  2N0Y A;  3ULB A;  2QKM A;  1OY2 A;  1X86 A;  1FHO A;  3D8E A;  3U8Z A;  4IFS A;  1XD4 A;  1Q67 A;  5C5B B;  4KHA A;  5JHH A;  2DX1 A;  4ZRK A;  4K81 A;  5D3X A;  1EF1 A;  3QBV B;  2R09 A;  2COA A;  2CY4 A;  2VRW B;  1W1H A;  5J3Y A;  2YS3 A;  3VOQ A;  1X05 A;  1OQN A;  1K5D B;  2DA0 A;  5D3W A;  5CLL B;  2X18 A;  2K2J A;  5JLJ B;  5D3Y A;  4DX9 0;  2MWN B;  5L81 A;  1WJM A;  3WA0 A;  1LW3 A;  1ZC4 B;  2CY5 A;  1MK9 B;  2D2Q A;  1UNR A;  3IVF A;  5FI0 A;  3A8P A;  3PVU A;  4IOY X;  2EC1 A;  4NY0 A;  1J19 A;  4ZRJ A;  5FI1 A;  1KZ7 A;  4WJ7 A;  5KQ1 A;  3PVL A;  3N7C A;  2PZ1 A;  3TW1 A;  2ZPY A;  3F5R A;  3TFM A;  3PEG A;  2J0K A;  2KUP A;  4DBB A;  1GC7 A;  3T06 A;  2DFK A;  1EAZ A;  1BWN A;  2DHK A;  2L2I A;  4DX8 A;  1MPH A;  3PZD A;  5LOP B;  2DHI A;  5DH9 B;  3DXE A;  2XQN M;  2J0J A;  2Z0P A;  1WJ1 A;  1FOE A;  2Y8G A;  5HE3 A;  3SNH A;  2UZR A;  2EJ8 A;  3NSU A;  4HDQ A;  2HE7 A;  3SO6 A;  1FAO A;  1UNP A;  2G35 A;  2RVB B;  4HAU B;  1U2B A;  2RSG A;  2OQB A;  3CIK A;  4MT7 A;  3ML4 A;  3TVV A;  1GG3 A;  1X1F A;  2E2X A;  2DYN A;  2J0M A;  1H10 A;  3O96 A;  1FGZ A;  2HTH B;  4KVG B;  1BAK A;  1XX0 A;  1KI1 B;  4B6H A;  3GYO A;  1K5G B;  2KGX B;  5CLQ B;  4D0N B;  2N23 A;  1B55 A;  1DYN A;  3SYX A;  3ULC A;  2H7D A;  2DHJ A;  1U27 A;  5HE1 A;  3SUZ A;  3TCA A;  1H4R A;  4HB3 B;  2LG1 A;  3ZVR A;  3KRX A;  3SV1 A;  1QQG A;  2W2W A;  2GCL A;  2P0H A;  1V5P A;  3P6A A;  2R0D A;  3UZT A;  2CAY A;  3MDB C;  4L6E A;  3RCP A;  1WG7 A;  1ZC3 B;  1TXD A;  1Y19 B;  3AU5 A;  2YT1 A;  1RJ2 A;  1PFJ A;  3QWM A;  1XCG A;  4EJN A;  1XR0 B;  1NTV A;  4HDO A;  3QIJ A;  2LOZ A;  2YF0 A;  4DXA B;  1W1D A;  1OMW A;  2I5F A;  2OTX A;  2VKI A;  1P6S A;  1EGX A;  3OAN A;  2AL6 A;  2V76 A;  2D11 A;  2RNR B;  2QKL A;  2YS1 A;  2CRF A;  4HAZ B;  2YT0 A;  1EVH A;  4IAP A;  2ELA A;  2Z0Q A;  4NSW A;  1ISN A;  1J0W A;  1N3H A;  2D4Q A;  2RGN B;  2M14 A;  4PNK A;  2I5C A;  3PVW A;  1M7E A;  5C6R A;  2H7E A;  3D8D A;  1DDM A;  2P0F A;  1E5W A;  2NZ8 B;  4HHV A;  1MIX A;  2RUK B;  3KSY A;  1P3R A;  1SGH A;  5C79 A;  2GCJ A;  1XKE A;  1ZSQ A;  5KQ4 A;  2MFQ A;  3A8Q A;  1V89 A;  1X1G A;  4Z2M B;  3AJ4 A;  3KZ1 A;  4K2O A;  1WI1 A;  3ODX A;  4WVF B;  2YRY A;  1LB1 A;  1AQC A;  3HQC A;  1UPQ A;  2W2X C;  4A5K A;  2BCJ A;  4A6F A;  3HK0 A;  4F7H A;  2JP2 A;  2YS5 A;  4GPT B;  3KRW A;  4KHO A;  1P5T A;  2IFS A;  1RRP B;  2DLW A;  1MAI A;  4CHJ A;  1NI2 A;  2W2X D;  1WGU A;  2M38 A;  3ODO A;  5HE0 A;  4C0A A;  2LOX A;  1ZVR A;  2K00 A;  3P7Z A;  5HE2 A;  3PP2 A;  1KZG A;  2YSZ A;  4MY6 A;  1WVH A;  2UVM A;  3BJI A;  3MPX A;  4TKN A;  5J3Q A;  1MIZ B;  2DKQ A;  2FJL A;  4TYZ A;  4CYE A;  5D27 A;  4HAV B;  5GOW B;  3A98 B;  2COD A;  2MDX A;  4HB0 B;  2LUL A;  4CHM A;  1M7R A;  1FB8 A;  1U5F A;  1I7A A;  2Q13 A;  5J3T A;  3WYF B;  4ZRI A;  5JP4 A;  2D9Z A;  1DDW A;  3G9W A;  1XOD A;  3BIN A;  3GYP A;  1IRS A;  3ODW A;  4F7U P;  2LKO A;  2NMB A;  4GMX B;  5JHG A;  4GMV A;  2EMS A;  1U5E A;  1TJ6 A;  1TQZ A;  4MK0 A;  2VSZ A;  2GS0 A;  1V88 A;  1WGQ A;  4WSF A;  2KCJ A;  2COF A;  1SHC A;  1FGY A;  1U5G A;  2Y7B A;  4K17 A;  2GJY A;  3FM8 C;  1U29 A;  2DN6 A;  1DDV A;  3CXB B;  1BTK A;  2ROV A;  1Y5O A;  3PG7 A;  4EMO A;  2DTC A;  3U7D A;  5DI9 B;  1Z87 A;  2K2U A;  4F7G A;  2RLO A;  5DHF B; 
#chains in the Genus database with same CATH topology
 4PQ0 A;  2DX5 A;  2D9X A;  2IYB A;  3FEH A;  4Y94 A;  1W1G A;  3TO1 A;  2GUM A;  1PLS A;  2AEH A;  1U5D A;  4XWX A;  3HW2 B;  5KCV A;  1NTY A;  2ROZ B;  3DXC A;  1DBH A;  2ELB A;  4GN1 A;  4KAX B;  1UNQ A;  1DRO A;  4EKU A;  2D9Y A;  2EMT A;  4A6K A;  2DKP A;  4HB2 B;  3ZDT A;  1ZM0 A;  2DYQ A;  2P8V A;  1GC6 A;  2COC A;  4YON A;  3F0W A;  4KHB A;  3FSS A;  1PMS A;  1FHW A;  2YVC A;  4Z2N A;  1NU2 A;  4HAT B;  1UPR A;  2P0D A;  5LON B;  4HB4 B;  3V5W A;  1MK7 B;  3VIA A;  4GXB A;  4P7I A;  4BBK A;  3PSC A;  2J59 M;  2LYD A;  2Y8F A;  2L1C A;  4KHB B;  4A6F B;  2UZS A;  1V61 A;  2I1K A;  1MKE A;  5DHA B;  2ADZ A;  1ZYI A;  2MKR A;  4K2P A;  1I2H A;  4H8S A;  5EFX A;  2D10 A;  1X11 A;  2ZKM X;  1FHX A;  3KY9 A;  3AU4 A;  3LJU X;  3M1I B;  5DIF B;  4YL8 A;  5D3V A;  4A6H A;  4HAW B;  1AWE A;  1UEF A;  1QC6 A;  3X23 A;  5IRS A;  3D8F A;  2D9W A;  1MI1 A;  2D9V A;  5C5B A;  2K49 A;  1V5U A;  4HAY B;  3DXD A;  2I1J A;  4HAX B;  1V5M A;  5C16 A;  1BTN A;  2Z0O A;  4GZU A;  2N0Y A;  3ULB A;  2QKM A;  1OY2 A;  1X86 A;  1FHO A;  3D8E A;  3U8Z A;  2Z13 A;  4IFS A;  1XD4 A;  1Q67 A;  5C5B B;  4KHA A;  5JHH A;  2DX1 A;  4ZRK A;  2R2Y A;  4K81 A;  4QJ5 B;  5D3X A;  1EF1 A;  3QBV B;  2R09 A;  2COA A;  2CY4 A;  2VRW B;  1W1H A;  5J3Y A;  2YS3 A;  3VOQ A;  1X05 A;  1OQN A;  5LG4 B;  1K5D B;  2DA0 A;  5D3W A;  5CLL B;  3B77 A;  2X18 A;  2K2J A;  5JLJ B;  5D3Y A;  4DX9 0;  2MWN B;  5L81 A;  1WJM A;  3WA0 A;  1LW3 A;  1ZC4 B;  2CY5 A;  1MK9 B;  2D2Q A;  1UNR A;  3IVF A;  5FI0 A;  3A8P A;  3PVU A;  4IOY X;  2EC1 A;  4NY0 A;  1J19 A;  4ZRJ A;  2K8E A;  5FI1 A;  1KZ7 A;  4WJ7 A;  5KQ1 A;  3PVL A;  3N7C A;  2PZ1 A;  3TW1 A;  2ZPY A;  3NW8 A;  3F5R A;  3TFM A;  3PEG A;  2J0K A;  2KUP A;  4DBB A;  1GC7 A;  3T06 A;  2DFK A;  1EAZ A;  1BWN A;  2DHK A;  2L2I A;  4DX8 A;  1MPH A;  3PZD A;  5LOP B;  2DHI A;  2KR0 A;  5DH9 B;  3DXE A;  2XQN M;  2J0J A;  2Z0P A;  1WJ1 A;  5M4Y B;  1FOE A;  4QXA B;  2Y8G A;  5HE3 A;  3SNH A;  2UZR A;  2EJ8 A;  3NSU A;  4HDQ A;  2HE7 A;  3SO6 A;  1FAO A;  1UNP A;  4GOU A;  2G35 A;  2FJU B;  2RVB B;  4HAU B;  1U2B A;  2RSG A;  2OQB A;  3CIK A;  4MT7 A;  3ML4 A;  3TVV A;  3HSA A;  1GG3 A;  3HIE A;  1X1F A;  4HSI A;  2E2X A;  2DYN A;  2J0M A;  1H10 A;  3O96 A;  1FGZ A;  2HTH B;  4KVG B;  1BAK A;  1XX0 A;  1KI1 B;  4B6H A;  3GYO A;  1K5G B;  2KGX B;  5CLQ B;  2Z59 A;  4D0N B;  2N23 A;  1B55 A;  1DYN A;  3SYX A;  3ULC A;  2H7D A;  2DHJ A;  1U27 A;  5HE1 A;  3SUZ A;  3TCA A;  1H4R A;  4HB3 B;  2LG1 A;  3ZVR A;  3KRX A;  3SV1 A;  1QQG A;  4L1R A;  2W2W A;  2GCL A;  2P0H A;  1V5P A;  4OT1 A;  3P6A A;  2R0D A;  3UZT A;  4GNK B;  2CAY A;  3MDB C;  4L6E A;  3RCP A;  1WG7 A;  1ZC3 B;  1TXD A;  1Y19 B;  3AU5 A;  2YT1 A;  1RJ2 A;  1PFJ A;  3QWM A;  1XCG A;  4DIX A;  4EJN A;  3NWD A;  1XR0 B;  1NTV A;  4HDO A;  3QIJ A;  2LOZ A;  2YF0 A;  4DXA B;  1W1D A;  1OMW A;  2I5F A;  2OTX A;  2VKI A;  1P6S A;  1EGX A;  3OAN A;  2AL6 A;  2V76 A;  2D11 A;  2RNR B;  2QKL A;  2YS1 A;  2CRF A;  4HAZ B;  2YT0 A;  1EVH A;  4IAP A;  2ELA A;  2Z0Q A;  4NSW A;  1ISN A;  1J0W A;  1N3H A;  2D4Q A;  2RGN B;  2M14 A;  4QJ4 B;  4PNK A;  2KIE A;  2I5C A;  3PVW A;  1M7E A;  5C6R A;  2H7E A;  3D8D A;  1DDM A;  2RRF A;  2P0F A;  1E5W A;  2NZ8 B;  4HHV A;  1MIX A;  2RUK B;  1P3R A;  3KSY A;  1SGH A;  5C79 A;  2GCJ A;  1XKE A;  1ZSQ A;  3OHM B;  5KQ4 A;  2MFQ A;  3A8Q A;  1V89 A;  1X1G A;  4Z2M B;  3AJ4 A;  3KZ1 A;  4K2O A;  1WI1 A;  3ODX A;  4WVF B;  4D6W A;  2YRY A;  1LB1 A;  1AQC A;  3HQC A;  1UPQ A;  2W2X C;  4A5K A;  2BCJ A;  4OSN A;  4A6F A;  3HK0 A;  4F7H A;  2JP2 A;  2YS5 A;  4GPT B;  3KRW A;  2Z4D A;  4KHO A;  1P5T A;  2IFS A;  1RRP B;  2DLW A;  1MAI A;  5I2S A;  2KUQ A;  2NBV A;  4CHJ A;  1NI2 A;  2W2X D;  2YT2 A;  1WGU A;  2M38 A;  3ODO A;  3NWA A;  3FVC A;  5HE0 A;  4C0A A;  2LOX A;  1ZVR A;  2K00 A;  3P7Z A;  3DCX A;  5HE2 A;  3PP2 A;  1KZG A;  2YSZ A;  3A58 A;  4MY6 A;  1WVH A;  2UVM A;  3BJI A;  3MPX A;  4TKN A;  5J3Q A;  1MIZ B;  2DKQ A;  2FJL A;  4TYZ A;  4CYE A;  5D27 A;  4HAV B;  5GOW B;  3A98 B;  2COD A;  2MDX A;  4HB0 B;  2LUL A;  4CHM A;  1M7R A;  1FB8 A;  3U12 A;  1U5F A;  1I7A A;  2Q13 A;  5J3T A;  3WYF B;  4ZRI A;  5JP4 A;  2D9Z A;  1DDW A;  3G9W A;  1XOD A;  3BIN A;  3GYP A;  1IRS A;  3ODW A;  4F7U P;  2LKO A;  2NMB A;  4CSQ A;  4GMX B;  5JHG A;  4GMV A;  3NWF A;  2EMS A;  5I2M A;  1U5E A;  1TJ6 A;  1TQZ A;  4MK0 A;  2KIG A;  2VSZ A;  2GS0 A;  1V88 A;  1WGQ A;  4WSF A;  2KCJ A;  2COF A;  1SHC A;  1FGY A;  1U5G A;  2Y7B A;  4K17 A;  2GJY A;  3FM8 C;  2Z14 A;  1U29 A;  2DN6 A;  1DDV A;  1T77 A;  3CXB B;  1BTK A;  2ROV A;  1Y5O A;  3PG7 A;  4EMO A;  2DTC A;  3U7D A;  5DI9 B;  1Z87 A;  2K2U A;  4F7G A;  2RLO A;  4QJ3 B;  5DHF B; 
#chains in the Genus database with same CATH homology
 4PQ0 A;  2DX5 A;  2D9X A;  2IYB A;  3FEH A;  4Y94 A;  1W1G A;  3TO1 A;  1PLS A;  2AEH A;  1U5D A;  4XWX A;  3HW2 B;  5KCV A;  1NTY A;  2ROZ B;  3DXC A;  1DBH A;  2ELB A;  4GN1 A;  4KAX B;  1UNQ A;  1DRO A;  4EKU A;  2D9Y A;  2EMT A;  4A6K A;  2DKP A;  4HB2 B;  3ZDT A;  1ZM0 A;  2DYQ A;  2P8V A;  1GC6 A;  2COC A;  4YON A;  3F0W A;  3FSS A;  1PMS A;  1FHW A;  2YVC A;  4Z2N A;  1NU2 A;  4HAT B;  1UPR A;  2P0D A;  5LON B;  4HB4 B;  3V5W A;  1MK7 B;  3VIA A;  4GXB A;  4P7I A;  4BBK A;  3PSC A;  2J59 M;  2LYD A;  2Y8F A;  2L1C A;  4KHB B;  4A6F B;  2UZS A;  1V61 A;  2I1K A;  1MKE A;  5DHA B;  2ADZ A;  2MKR A;  4K2P A;  1I2H A;  4H8S A;  5EFX A;  2D10 A;  1X11 A;  1FHX A;  3KY9 A;  3AU4 A;  3LJU X;  3M1I B;  5DIF B;  4YL8 A;  5D3V A;  4A6H A;  4HAW B;  1AWE A;  1UEF A;  1QC6 A;  3X23 A;  3D8F A;  2D9W A;  2D9V A;  5C5B A;  1V5U A;  4HAY B;  3DXD A;  2I1J A;  4HAX B;  1V5M A;  5C16 A;  1BTN A;  2Z0O A;  4GZU A;  2N0Y A;  3ULB A;  2QKM A;  1OY2 A;  1X86 A;  1FHO A;  3D8E A;  3U8Z A;  4IFS A;  1XD4 A;  1Q67 A;  5C5B B;  4KHA A;  5JHH A;  2DX1 A;  4ZRK A;  4K81 A;  5D3X A;  1EF1 A;  3QBV B;  2R09 A;  2COA A;  2CY4 A;  2VRW B;  1W1H A;  5J3Y A;  2YS3 A;  3VOQ A;  1X05 A;  1OQN A;  1K5D B;  2DA0 A;  5D3W A;  5CLL B;  2X18 A;  2K2J A;  5JLJ B;  5D3Y A;  4DX9 0;  2MWN B;  5L81 A;  1WJM A;  3WA0 A;  1LW3 A;  1ZC4 B;  2CY5 A;  1MK9 B;  2D2Q A;  1UNR A;  3IVF A;  5FI0 A;  3A8P A;  3PVU A;  4IOY X;  2EC1 A;  4NY0 A;  1J19 A;  4ZRJ A;  5FI1 A;  1KZ7 A;  4WJ7 A;  5KQ1 A;  3PVL A;  3N7C A;  2PZ1 A;  3TW1 A;  2ZPY A;  3F5R A;  3TFM A;  3PEG A;  2J0K A;  2KUP A;  4DBB A;  1GC7 A;  3T06 A;  2DFK A;  1EAZ A;  1BWN A;  2DHK A;  2L2I A;  4DX8 A;  1MPH A;  3PZD A;  5LOP B;  2DHI A;  5DH9 B;  3DXE A;  2XQN M;  2J0J A;  2Z0P A;  1WJ1 A;  1FOE A;  2Y8G A;  5HE3 A;  3SNH A;  2UZR A;  2EJ8 A;  3NSU A;  4HDQ A;  2HE7 A;  3SO6 A;  1FAO A;  1UNP A;  2G35 A;  2RVB B;  4HAU B;  1U2B A;  2RSG A;  2OQB A;  3CIK A;  4MT7 A;  3ML4 A;  3TVV A;  1GG3 A;  1X1F A;  2E2X A;  2DYN A;  2J0M A;  1H10 A;  3O96 A;  1FGZ A;  2HTH B;  4KVG B;  1BAK A;  1XX0 A;  1KI1 B;  4B6H A;  3GYO A;  1K5G B;  2KGX B;  5CLQ B;  4D0N B;  2N23 A;  1B55 A;  1DYN A;  3SYX A;  3ULC A;  2H7D A;  2DHJ A;  1U27 A;  5HE1 A;  3SUZ A;  3TCA A;  1H4R A;  4HB3 B;  2LG1 A;  3ZVR A;  3KRX A;  3SV1 A;  1QQG A;  2W2W A;  2GCL A;  2P0H A;  1V5P A;  3P6A A;  2R0D A;  3UZT A;  2CAY A;  3MDB C;  4L6E A;  3RCP A;  1WG7 A;  1ZC3 B;  1TXD A;  1Y19 B;  3AU5 A;  2YT1 A;  1RJ2 A;  1PFJ A;  3QWM A;  1XCG A;  4EJN A;  1XR0 B;  1NTV A;  4HDO A;  3QIJ A;  2LOZ A;  2YF0 A;  4DXA B;  1W1D A;  1OMW A;  2I5F A;  2OTX A;  2VKI A;  1P6S A;  1EGX A;  3OAN A;  2AL6 A;  2V76 A;  2D11 A;  2RNR B;  2QKL A;  2YS1 A;  2CRF A;  4HAZ B;  2YT0 A;  1EVH A;  4IAP A;  2ELA A;  2Z0Q A;  4NSW A;  1ISN A;  1J0W A;  1N3H A;  2D4Q A;  2RGN B;  2M14 A;  4PNK A;  2I5C A;  3PVW A;  1M7E A;  5C6R A;  2H7E A;  3D8D A;  1DDM A;  2P0F A;  1E5W A;  2NZ8 B;  4HHV A;  1MIX A;  2RUK B;  3KSY A;  1P3R A;  1SGH A;  5C79 A;  2GCJ A;  1XKE A;  1ZSQ A;  5KQ4 A;  2MFQ A;  3A8Q A;  1V89 A;  1X1G A;  4Z2M B;  3AJ4 A;  3KZ1 A;  4K2O A;  1WI1 A;  3ODX A;  4WVF B;  2YRY A;  1LB1 A;  1AQC A;  3HQC A;  1UPQ A;  2W2X C;  4A5K A;  2BCJ A;  4A6F A;  3HK0 A;  4F7H A;  2JP2 A;  2YS5 A;  4GPT B;  3KRW A;  4KHO A;  1P5T A;  2IFS A;  1RRP B;  2DLW A;  1MAI A;  4CHJ A;  1NI2 A;  2W2X D;  1WGU A;  2M38 A;  3ODO A;  5HE0 A;  4C0A A;  2LOX A;  1ZVR A;  2K00 A;  3P7Z A;  5HE2 A;  3PP2 A;  1KZG A;  2YSZ A;  4MY6 A;  1WVH A;  2UVM A;  3BJI A;  3MPX A;  4TKN A;  5J3Q A;  1MIZ B;  2DKQ A;  2FJL A;  4TYZ A;  4CYE A;  5D27 A;  4HAV B;  5GOW B;  3A98 B;  2COD A;  2MDX A;  4HB0 B;  2LUL A;  4CHM A;  1M7R A;  1FB8 A;  1U5F A;  1I7A A;  2Q13 A;  5J3T A;  3WYF B;  4ZRI A;  5JP4 A;  2D9Z A;  1DDW A;  3G9W A;  1XOD A;  3BIN A;  3GYP A;  1IRS A;  3ODW A;  4F7U P;  2LKO A;  2NMB A;  4GMX B;  5JHG A;  4GMV A;  2EMS A;  1U5E A;  1TJ6 A;  1TQZ A;  4MK0 A;  2VSZ A;  2GS0 A;  1V88 A;  1WGQ A;  4WSF A;  2KCJ A;  2COF A;  1SHC A;  1FGY A;  1U5G A;  2Y7B A;  4K17 A;  2GJY A;  3FM8 C;  1U29 A;  2DN6 A;  1DDV A;  3CXB B;  1BTK A;  2ROV A;  1Y5O A;  3PG7 A;  4EMO A;  2DTC A;  3U7D A;  5DI9 B;  1Z87 A;  2K2U A;  4F7G A;  2RLO A;  5DHF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...