5LONB

Structure of /k. lactis/ dcp1-dcp2 decapping complex.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
174
Chain Sequence
STETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Rna binding protein
molecule keywords KLLA0F23980p
total genus 36
structure length 174
sequence length 185
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lonB01
4DBBA 5FI0A 3F5RA 3VIAA 3FM8C 1NU2A 2DTCA 1ISNA 2DHJA 4TYZA 4HAWB 5JHGA 2RGNB 2HTHB 3SV1A 5HE0A 2J59M 1NI2A 3SNHA 2I5FA 3OANA 5DIFB 1FHWA 5DI9B 2G35A 4H8SA 4YONA 4HAVB 4BBKA 1RJ2A 3V5WA 1FB8A 4TKNA 3PVUA 4ZRJA 4HATB 1FHXA 1WG7A 1DBHA 2Z0QA 4HHVA 4XWXA 2P0FA 2DX5A 2DFKA 1AWEA 3M1IB 3KZ1A 2D9XA 1MIXA 3KY9A 2VSZA 1H10A 4DX90 2VRWB 2YT0A 2YS3A 3ODOA 4HB3B 2VKIA 3KRXA 5D3YA 2YSZA 2MWNB 4GMVA 2CAYA 1EGXA 4F7HA 2FJLA 4KVGB 3T06A 3D8DA 1MAIA 4EKUA 1MKEA 1X86A 1KZ7A 4C0AA 2DLWA 4DXAB 4KHBB 1MK7B 1TQZA 2D2QA 2X18A 1K5DB 5C5BA 5JLJB 2DYQA 1RRPB 1U5EA 2IFSA 1PLSA 5J3QA 2I1KA 4B6HA 2UZSA 1P3RA 3VOQA 4ZRIA 2I1JA 1ZVRA 2AL6A 1TXDA 2COFA 4MY6A 1ZSQA 1DDWA 4F7UP 2COAA 2RLOA 2ROVA 5DHAB 2EC1A 3PSCA 1FOEA 3A8PA 4D0NB 2D11A 3GYOA 2NMBA 1UNRA 1WVHA 5CLLB 2ELBA 2CY4A 2ZPYA 1MK9B 3SO6A 5HE2A 1V88A 1H4RA 1I2HA 2R0DA 3N7CA 3ML4A 1MIZB 1FGZA 3DXEA 1QC6A 1U5DA 4EJNA 5L81A 1UPQA 3TO1A 2Q13A 1XKEA 1K5GB 5CLQB 2D9ZA 2Y8FA 4PQ0A 2YT1A 2J0JA 4HAZB 2GCLA 5D3WA 2RSGA 1WI1A 4WVFB 2COCA 3LJUX 2D9YA 1NTVA 1GG3A 1U2BA 2Y7BA 4HB2B 2W2WA 2M38A 5C79A 1UNPA 1PFJA 4CHMA 1UEFA 4IFSA 5KCVA 2LULA 1V5PA 3SUZA 3KSYA 3ODWA 2PZ1A 4A5KA 2UZRA 2N0YA 1ZM0A 3PZDA 2W2XC 2Y8GA 2DHKA 2ELAA 1FAOA 4GZUA 1XX0A 3ULBA 2L2IA 1N3HA 3MDBC 3TW1A 2OTXA 2LYDA 1V61A 3GYPA 2N23A 3A8QA 5KQ4A 3UZTA 5C6RA 1EVHA 4ZRKA 4P7IA 1XD4A 3BJIA 2DN6A 1MPHA 4KHAA 1W1HA 1M7RA 3CXBB 2V76A 2CY5A 2D9VA 3PEGA 2JP2A 2YRYA 4A6KA 3HW2B 2KCJA 2YVCA 5D3XA 2EJ8A 2J0MA 2HE7A 1I7AA 3PVWA 2J0KA 1OY2A 2K00A 1M7EA 1FGYA 4K2PA 1EF1A 3O96A 2CODA 3CIKA 4Z2MB 4A6FB 4L6EA 2DKPA 1U29A 1SHCA 4HB0B 3WA0A 3BINA 2NZ8B 5HE1A 2EMTA 1ZC4B 1V5MA 3DXCA 5FI1A 2AEHA 2GJYA 2RVBB 1DYNA 4KAXB 4K17A 2H7EA 3TVVA 1V5UA 2R09A 4IAPA 3QWMA 4K2OA 3G9WA 1BWNA 1XR0B 2MKRA 1P5TA 5DHFB 3F0WA 4Y94A 2P0DA 5GOWB 2QKMA 2RUKB 2D10A 2ROZB 3HK0A 4F7GA 1NTYA 5EFXA 5J3YA 1J19A 3WYFB 4HDQA 4Z2NA 3TCAA 2DX1A 1X11A 4NY0A 2M14A 3AU4A 1BAKA 1GC6A 1W1DA 4HAUB 1IRSA 1X1GA 2ADZA 4A6HA 5HE3A 1OMWA 1WJMA 3KRWA 3ODXA 4WJ7A 3P6AA 4PNKA 4YL8A 3ULCA 1LB1A 1Q67A 2DA0A 5J3TA 5DH9B 4CHJA 1QQGA 2MDXA 1LW3A 2Z0OA 4GXBA 3AJ4A 3MPXA 2L1CA 2KGXB 3U8ZA 5LOPB 3PG7A 2IYBA 3P7ZA 3QBVB 1SGHA 2DYNA 2XQNM 3X23A 2Z0PA 3A98B 1V89A 5LONB 3AU5A 1B55A 1Y5OA 1KZGA 1J0WA 4GMXB 2RNRB 1GC7A 4A6FA 1W1GA 1WJ1A 4HB4B 1U27A 4KHOA 5C16A 2BCJA 3ZVRA 3D8FA 4DX8A 2W2XD 4IOYX 2MFQA 3ZDTA 2K2JA 3TFMA 4GPTB 2K2UA 1X05A 3QIJA 1U5GA 1EAZA 5D27A 3RCPA 2LG1A 4HAXB 2YS1A 2QKLA 2P0HA 4EMOA 3PVLA 2LOXA 3FEHA 3SYXA 2LOZA 2P8VA 1DROA 1DDVA 3IVFA 1WGUA 1Z87A 2GCJA 1KI1B 1P6SA 3NSUA 5KQ1A 1WGQA 1XCGA 2YS5A 5C5BB 2GS0A 4MK0A 5JHHA 3HQCA 2OQBA 4GN1A 2H7DA 2DKQA 2D4QA 2I5CA 2EMSA 1E5WA 2E2XA 4WSFA 3FSSA 1PMSA 1UNQA 2KUPA 2UVMA 1BTNA 5D3VA 1UPRA 1AQCA 4K81A 2CRFA 1Y19B 1ZC3B 4MT7A 1U5FA 2YF0A 2LKOA 3U7DA 1DDMA 1FHOA 1XODA 2D9WA 2DHIA 1BTKA 5JP4A 4NSWA 4HDOA 1TJ6A 4CYEA 1OQNA 1X1FA 3D8EA 3DXDA 4HAYB 3PP2A
chains in the Genus database with same CATH superfamily
4DBBA 5FI0A 3F5RA 3VIAA 3FM8C 1NU2A 2DTCA 1ISNA 2DHJA 4TYZA 2Z59A 4HAWB 5JHGA 2RGNB 2HTHB 4QJ4B 3SV1A 5HE0A 2J59M 1NI2A 3SNHA 2I5FA 3OANA 5DIFB 1FHWA 5DI9B 2G35A 4H8SA 4YONA 4HAVB 4BBKA 1RJ2A 3V5WA 1FB8A 4TKNA 2KUQA 3PVUA 4ZRJA 4HATB 1FHXA 1WG7A 1DBHA 2Z0QA 4HHVA 4XWXA 2P0FA 2DX5A 2DFKA 3B77A 1AWEA 3M1IB 3KZ1A 2D9XA 1MIXA 3KY9A 2VSZA 1H10A 4DX90 2VRWB 2YT0A 2YS3A 3ODOA 4HSIA 4HB3B 2VKIA 3KRXA 5D3YA 2YSZA 2MWNB 4GMVA 2CAYA 1EGXA 4F7HA 2FJLA 4KVGB 3T06A 3D8DA 1MAIA 4EKUA 1MKEA 1X86A 1KZ7A 1T77A 4C0AA 2DLWA 4DXAB 4KHBB 1MK7B 3NWAA 1TQZA 2D2QA 2X18A 1K5DB 5C5BA 5JLJB 2DYQA 1RRPB 1U5EA 2IFSA 1PLSA 5J3QA 2I1KA 4B6HA 2UZSA 1P3RA 3NW8A 2Z14A 3VOQA 4ZRIA 2I1JA 1ZVRA 2AL6A 1TXDA 2COFA 4MY6A 1ZSQA 1DDWA 4F7UP 2COAA 2RLOA 2ROVA 5DHAB 2FJUB 2EC1A 3PSCA 2GUMA 4D6WA 1FOEA 3A8PA 4D0NB 2D11A 3GYOA 4L1RA 2NMBA 1UNRA 1WVHA 5CLLB 2ELBA 2CY4A 2ZPYA 1MK9B 3SO6A 5HE2A 1V88A 1H4RA 1I2HA 2R0DA 3N7CA 3ML4A 1MIZB 4CSQA 1FGZA 3DXEA 1QC6A 1U5DA 4EJNA 5L81A 1UPQA 3TO1A 2Q13A 1XKEA 1K5GB 5CLQB 2D9ZA 2Y8FA 4PQ0A 2YT1A 2J0JA 4HAZB 2GCLA 5D3WA 2RSGA 1WI1A 4WVFB 2COCA 3LJUX 2KIEA 2D9YA 1NTVA 1GG3A 1U2BA 2Y7BA 4HB2B 2W2WA 2M38A 5C79A 1UNPA 1PFJA 4CHMA 1UEFA 4IFSA 1MI1A 5KCVA 2LULA 1V5PA 3SUZA 3KSYA 3ODWA 2PZ1A 3HIEA 4A5KA 2UZRA 2N0YA 1ZM0A 3PZDA 2W2XC 2Y8GA 2DHKA 2ELAA 1FAOA 4QJ5B 4GZUA 1XX0A 3ULBA 2L2IA 1N3HA 3MDBC 3TW1A 2OTXA 2LYDA 1V61A 3GYPA 2N23A 3A8QA 5KQ4A 3UZTA 2Z4DA 5C6RA 1EVHA 4ZRKA 4P7IA 1XD4A 3BJIA 4GNKB 2DN6A 1MPHA 4KHAA 1W1HA 1M7RA 3CXBB 2V76A 2CY5A 4OT1A 2D9VA 3PEGA 2JP2A 2YRYA 3NWDA 4A6KA 3HW2B 2KCJA 2YVCA 5D3XA 2Z13A 2EJ8A 2J0MA 2HE7A 5I2MA 1I7AA 3PVWA 2J0KA 1OY2A 2K00A 1M7EA 1FGYA 4K2PA 1EF1A 3O96A 2CODA 3CIKA 4Z2MB 4A6FB 4L6EA 2DKPA 1U29A 1SHCA 4HB0B 3WA0A 3BINA 2NZ8B 5HE1A 2EMTA 1ZC4B 1V5MA 3DXCA 4GOUA 5FI1A 2AEHA 2GJYA 2RVBB 1DYNA 4KAXB 3NWFA 3DCXA 4K17A 2H7EA 3TVVA 5M4YB 1V5UA 2R09A 4IAPA 3QWMA 4K2OA 3G9WA 1BWNA 1XR0B 2MKRA 1P5TA 3U12A 3A58A 5DHFB 3OHMB 3F0WA 4Y94A 2P0DA 5GOWB 2QKMA 2RUKB 2D10A 2ROZB 5LG4B 3HK0A 4F7GA 1NTYA 1ZYIA 5EFXA 5J3YA 1J19A 3WYFB 4HDQA 4Z2NA 3TCAA 4QXAB 2DX1A 1X11A 4NY0A 2M14A 3AU4A 2ZKMX 1BAKA 1GC6A 1W1DA 4HAUB 1IRSA 1X1GA 2ADZA 4A6HA 5HE3A 1OMWA 1WJMA 3KRWA 5IRSA 3ODXA 4WJ7A 3P6AA 4PNKA 4YL8A 3ULCA 1LB1A 1Q67A 2DA0A 5J3TA 5DH9B 4CHJA 5I2SA 1QQGA 2MDXA 2YT2A 1LW3A 2Z0OA 4GXBA 3AJ4A 3MPXA 2L1CA 2KGXB 3U8ZA 5LOPB 3PG7A 2IYBA 3P7ZA 2K8EA 3QBVB 1SGHA 2DYNA 2XQNM 3X23A 2Z0PA 3A98B 1V89A 5LONB 3AU5A 1B55A 1Y5OA 2KIGA 1KZGA 1J0WA 4DIXA 4GMXB 2RNRB 1GC7A 4A6FA 1W1GA 1WJ1A 4HB4B 1U27A 4KHOA 5C16A 2BCJA 3ZVRA 3D8FA 4DX8A 2W2XD 4IOYX 2MFQA 3ZDTA 2K2JA 4QJ3B 3TFMA 4GPTB 2K2UA 1X05A 3QIJA 1U5GA 1EAZA 5D27A 3RCPA 2LG1A 2K49A 4HAXB 2YS1A 2QKLA 2P0HA 4EMOA 3PVLA 2LOXA 3FEHA 2KR0A 3SYXA 2LOZA 2P8VA 1DROA 1DDVA 3IVFA 1WGUA 1Z87A 2GCJA 1KI1B 1P6SA 3NSUA 5KQ1A 2RRFA 1WGQA 1XCGA 2YS5A 5C5BB 2GS0A 4MK0A 5JHHA 3HQCA 2OQBA 4GN1A 2H7DA 2DKQA 2D4QA 2I5CA 2EMSA 1E5WA 4OSNA 2E2XA 4WSFA 3FSSA 1PMSA 1UNQA 2KUPA 2UVMA 1BTNA 5D3VA 1UPRA 1AQCA 3HSAA 4K81A 2CRFA 1Y19B 1ZC3B 4MT7A 1U5FA 4KHBA 2YF0A 2LKOA 2R2YA 3U7DA 1DDMA 1FHOA 1XODA 2D9WA 2DHIA 1BTKA 5JP4A 4NSWA 4HDOA 1TJ6A 2NBVA 4CYEA 1OQNA 1X1FA 3D8EA 3DXDA 3FVCA 4HAYB 3PP2A
chains in the Genus database with same CATH topology
4DBBA 5FI0A 3F5RA 3VIAA 3FM8C 1NU2A 2DTCA 1ISNA 2DHJA 4TYZA 4HAWB 5JHGA 2RGNB 2HTHB 3SV1A 5HE0A 2J59M 1NI2A 3SNHA 2I5FA 3OANA 5DIFB 1FHWA 5DI9B 2G35A 4H8SA 4YONA 4HAVB 4BBKA 1RJ2A 3V5WA 1FB8A 4TKNA 3PVUA 4ZRJA 4HATB 1FHXA 1WG7A 1DBHA 2Z0QA 4HHVA 4XWXA 2P0FA 2DX5A 2DFKA 1AWEA 3M1IB 3KZ1A 2D9XA 1MIXA 3KY9A 2VSZA 1H10A 4DX90 2VRWB 2YT0A 2YS3A 3ODOA 4HB3B 2VKIA 3KRXA 5D3YA 2YSZA 2MWNB 4GMVA 2CAYA 1EGXA 4F7HA 2FJLA 4KVGB 3T06A 3D8DA 1MAIA 4EKUA 1MKEA 1X86A 1KZ7A 4C0AA 2DLWA 4DXAB 4KHBB 1MK7B 1TQZA 2D2QA 2X18A 1K5DB 5C5BA 5JLJB 2DYQA 1RRPB 1U5EA 2IFSA 1PLSA 5J3QA 2I1KA 4B6HA 2UZSA 1P3RA 3VOQA 4ZRIA 2I1JA 1ZVRA 2AL6A 1TXDA 2COFA 4MY6A 1ZSQA 1DDWA 4F7UP 2COAA 2RLOA 2ROVA 5DHAB 2EC1A 3PSCA 1FOEA 3A8PA 4D0NB 2D11A 3GYOA 2NMBA 1UNRA 1WVHA 5CLLB 2ELBA 2CY4A 2ZPYA 1MK9B 3SO6A 5HE2A 1V88A 1H4RA 1I2HA 2R0DA 3N7CA 3ML4A 1MIZB 1FGZA 3DXEA 1QC6A 1U5DA 4EJNA 5L81A 1UPQA 3TO1A 2Q13A 1XKEA 1K5GB 5CLQB 2D9ZA 2Y8FA 4PQ0A 2YT1A 2J0JA 4HAZB 2GCLA 5D3WA 2RSGA 1WI1A 4WVFB 2COCA 3LJUX 2D9YA 1NTVA 1GG3A 1U2BA 2Y7BA 4HB2B 2W2WA 2M38A 5C79A 1UNPA 1PFJA 4CHMA 1UEFA 4IFSA 5KCVA 2LULA 1V5PA 3SUZA 3KSYA 3ODWA 2PZ1A 4A5KA 2UZRA 2N0YA 1ZM0A 3PZDA 2W2XC 2Y8GA 2DHKA 2ELAA 1FAOA 4GZUA 1XX0A 3ULBA 2L2IA 1N3HA 3MDBC 3TW1A 2OTXA 2LYDA 1V61A 3GYPA 2N23A 3A8QA 5KQ4A 3UZTA 5C6RA 1EVHA 4ZRKA 4P7IA 1XD4A 3BJIA 2DN6A 1MPHA 4KHAA 1W1HA 1M7RA 3CXBB 2V76A 2CY5A 2D9VA 3PEGA 2JP2A 2YRYA 4A6KA 3HW2B 2KCJA 2YVCA 5D3XA 2EJ8A 2J0MA 2HE7A 1I7AA 3PVWA 2J0KA 1OY2A 2K00A 1M7EA 1FGYA 4K2PA 1EF1A 3O96A 2CODA 3CIKA 4Z2MB 4A6FB 4L6EA 2DKPA 1U29A 1SHCA 4HB0B 3WA0A 3BINA 2NZ8B 5HE1A 2EMTA 1ZC4B 1V5MA 3DXCA 5FI1A 2AEHA 2GJYA 2RVBB 1DYNA 4KAXB 4K17A 2H7EA 3TVVA 1V5UA 2R09A 4IAPA 3QWMA 4K2OA 3G9WA 1BWNA 1XR0B 2MKRA 1P5TA 5DHFB 3F0WA 4Y94A 2P0DA 5GOWB 2QKMA 2RUKB 2D10A 2ROZB 3HK0A 4F7GA 1NTYA 5EFXA 5J3YA 1J19A 3WYFB 4HDQA 4Z2NA 3TCAA 2DX1A 1X11A 4NY0A 2M14A 3AU4A 1BAKA 1GC6A 1W1DA 4HAUB 1IRSA 1X1GA 2ADZA 4A6HA 5HE3A 1OMWA 1WJMA 3KRWA 3ODXA 4WJ7A 3P6AA 4PNKA 4YL8A 3ULCA 1LB1A 1Q67A 2DA0A 5J3TA 5DH9B 4CHJA 1QQGA 2MDXA 1LW3A 2Z0OA 4GXBA 3AJ4A 3MPXA 2L1CA 2KGXB 3U8ZA 5LOPB 3PG7A 2IYBA 3P7ZA 3QBVB 1SGHA 2DYNA 2XQNM 3X23A 2Z0PA 3A98B 1V89A 5LONB 3AU5A 1B55A 1Y5OA 1KZGA 1J0WA 4GMXB 2RNRB 1GC7A 4A6FA 1W1GA 1WJ1A 4HB4B 1U27A 4KHOA 5C16A 2BCJA 3ZVRA 3D8FA 4DX8A 2W2XD 4IOYX 2MFQA 3ZDTA 2K2JA 3TFMA 4GPTB 2K2UA 1X05A 3QIJA 1U5GA 1EAZA 5D27A 3RCPA 2LG1A 4HAXB 2YS1A 2QKLA 2P0HA 4EMOA 3PVLA 2LOXA 3FEHA 3SYXA 2LOZA 2P8VA 1DROA 1DDVA 3IVFA 1WGUA 1Z87A 2GCJA 1KI1B 1P6SA 3NSUA 5KQ1A 1WGQA 1XCGA 2YS5A 5C5BB 2GS0A 4MK0A 5JHHA 3HQCA 2OQBA 4GN1A 2H7DA 2DKQA 2D4QA 2I5CA 2EMSA 1E5WA 2E2XA 4WSFA 3FSSA 1PMSA 1UNQA 2KUPA 2UVMA 1BTNA 5D3VA 1UPRA 1AQCA 4K81A 2CRFA 1Y19B 1ZC3B 4MT7A 1U5FA 2YF0A 2LKOA 3U7DA 1DDMA 1FHOA 1XODA 2D9WA 2DHIA 1BTKA 5JP4A 4NSWA 4HDOA 1TJ6A 4CYEA 1OQNA 1X1FA 3D8EA 3DXDA 4HAYB 3PP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DBB A;  5FI0 A;  3F5R A;  3VIA A;  3FM8 C;  1NU2 A;  2DTC A;  1ISN A;  2DHJ A;  4TYZ A;  4HAW B;  5JHG A;  2RGN B;  2HTH B;  3SV1 A;  5HE0 A;  2J59 M;  1NI2 A;  3SNH A;  2I5F A;  3OAN A;  5DIF B;  1FHW A;  5DI9 B;  2G35 A;  4H8S A;  4YON A;  4HAV B;  4BBK A;  1RJ2 A;  3V5W A;  1FB8 A;  4TKN A;  3PVU A;  4ZRJ A;  4HAT B;  1FHX A;  1WG7 A;  1DBH A;  2Z0Q A;  4HHV A;  4XWX A;  2P0F A;  2DX5 A;  2DFK A;  1AWE A;  3M1I B;  3KZ1 A;  2D9X A;  1MIX A;  3KY9 A;  2VSZ A;  1H10 A;  4DX9 0;  2VRW B;  2YT0 A;  2YS3 A;  3ODO A;  4HB3 B;  2VKI A;  3KRX A;  5D3Y A;  2YSZ A;  2MWN B;  4GMV A;  2CAY A;  1EGX A;  4F7H A;  2FJL A;  4KVG B;  3T06 A;  3D8D A;  1MAI A;  4EKU A;  1MKE A;  1X86 A;  1KZ7 A;  4C0A A;  2DLW A;  4DXA B;  4KHB B;  1MK7 B;  1TQZ A;  2D2Q A;  2X18 A;  1K5D B;  5C5B A;  5JLJ B;  2DYQ A;  1RRP B;  1U5E A;  2IFS A;  1PLS A;  5J3Q A;  2I1K A;  4B6H A;  2UZS A;  1P3R A;  3VOQ A;  4ZRI A;  2I1J A;  1ZVR A;  2AL6 A;  1TXD A;  2COF A;  4MY6 A;  1ZSQ A;  1DDW A;  4F7U P;  2COA A;  2RLO A;  2ROV A;  5DHA B;  2EC1 A;  3PSC A;  1FOE A;  3A8P A;  4D0N B;  2D11 A;  3GYO A;  2NMB A;  1UNR A;  1WVH A;  5CLL B;  2ELB A;  2CY4 A;  2ZPY A;  1MK9 B;  3SO6 A;  5HE2 A;  1V88 A;  1H4R A;  1I2H A;  2R0D A;  3N7C A;  3ML4 A;  1MIZ B;  1FGZ A;  3DXE A;  1QC6 A;  1U5D A;  4EJN A;  5L81 A;  1UPQ A;  3TO1 A;  2Q13 A;  1XKE A;  1K5G B;  5CLQ B;  2D9Z A;  2Y8F A;  4PQ0 A;  2YT1 A;  2J0J A;  4HAZ B;  2GCL A;  5D3W A;  2RSG A;  1WI1 A;  4WVF B;  2COC A;  3LJU X;  2D9Y A;  1NTV A;  1GG3 A;  1U2B A;  2Y7B A;  4HB2 B;  2W2W A;  2M38 A;  5C79 A;  1UNP A;  1PFJ A;  4CHM A;  1UEF A;  4IFS A;  5KCV A;  2LUL A;  1V5P A;  3SUZ A;  3KSY A;  3ODW A;  2PZ1 A;  4A5K A;  2UZR A;  2N0Y A;  1ZM0 A;  3PZD A;  2W2X C;  2Y8G A;  2DHK A;  2ELA A;  1FAO A;  4GZU A;  1XX0 A;  3ULB A;  2L2I A;  1N3H A;  3MDB C;  3TW1 A;  2OTX A;  2LYD A;  1V61 A;  3GYP A;  2N23 A;  3A8Q A;  5KQ4 A;  3UZT A;  5C6R A;  1EVH A;  4ZRK A;  4P7I A;  1XD4 A;  3BJI A;  2DN6 A;  1MPH A;  4KHA A;  1W1H A;  1M7R A;  3CXB B;  2V76 A;  2CY5 A;  2D9V A;  3PEG A;  2JP2 A;  2YRY A;  4A6K A;  3HW2 B;  2KCJ A;  2YVC A;  5D3X A;  2EJ8 A;  2J0M A;  2HE7 A;  1I7A A;  3PVW A;  2J0K A;  1OY2 A;  2K00 A;  1M7E A;  1FGY A;  4K2P A;  1EF1 A;  3O96 A;  2COD A;  3CIK A;  4Z2M B;  4A6F B;  4L6E A;  2DKP A;  1U29 A;  1SHC A;  4HB0 B;  3WA0 A;  3BIN A;  2NZ8 B;  5HE1 A;  2EMT A;  1ZC4 B;  1V5M A;  3DXC A;  5FI1 A;  2AEH A;  2GJY A;  2RVB B;  1DYN A;  4KAX B;  4K17 A;  2H7E A;  3TVV A;  1V5U A;  2R09 A;  4IAP A;  3QWM A;  4K2O A;  3G9W A;  1BWN A;  1XR0 B;  2MKR A;  1P5T A;  5DHF B;  3F0W A;  4Y94 A;  2P0D A;  5GOW B;  2QKM A;  2RUK B;  2D10 A;  2ROZ B;  3HK0 A;  4F7G A;  1NTY A;  5EFX A;  5J3Y A;  1J19 A;  3WYF B;  4HDQ A;  4Z2N A;  3TCA A;  2DX1 A;  1X11 A;  4NY0 A;  2M14 A;  3AU4 A;  1BAK A;  1GC6 A;  1W1D A;  4HAU B;  1IRS A;  1X1G A;  2ADZ A;  4A6H A;  5HE3 A;  1OMW A;  1WJM A;  3KRW A;  3ODX A;  4WJ7 A;  3P6A A;  4PNK A;  4YL8 A;  3ULC A;  1LB1 A;  1Q67 A;  2DA0 A;  5J3T A;  5DH9 B;  4CHJ A;  1QQG A;  2MDX A;  1LW3 A;  2Z0O A;  4GXB A;  3AJ4 A;  3MPX A;  2L1C A;  2KGX B;  3U8Z A;  5LOP B;  3PG7 A;  2IYB A;  3P7Z A;  3QBV B;  1SGH A;  2DYN A;  2XQN M;  3X23 A;  2Z0P A;  3A98 B;  1V89 A;  5LON B;  3AU5 A;  1B55 A;  1Y5O A;  1KZG A;  1J0W A;  4GMX B;  2RNR B;  1GC7 A;  4A6F A;  1W1G A;  1WJ1 A;  4HB4 B;  1U27 A;  4KHO A;  5C16 A;  2BCJ A;  3ZVR A;  3D8F A;  4DX8 A;  2W2X D;  4IOY X;  2MFQ A;  3ZDT A;  2K2J A;  3TFM A;  4GPT B;  2K2U A;  1X05 A;  3QIJ A;  1U5G A;  1EAZ A;  5D27 A;  3RCP A;  2LG1 A;  4HAX B;  2YS1 A;  2QKL A;  2P0H A;  4EMO A;  3PVL A;  2LOX A;  3FEH A;  3SYX A;  2LOZ A;  2P8V A;  1DRO A;  1DDV A;  3IVF A;  1WGU A;  1Z87 A;  2GCJ A;  1KI1 B;  1P6S A;  3NSU A;  5KQ1 A;  1WGQ A;  1XCG A;  2YS5 A;  5C5B B;  2GS0 A;  4MK0 A;  5JHH A;  3HQC A;  2OQB A;  4GN1 A;  2H7D A;  2DKQ A;  2D4Q A;  2I5C A;  2EMS A;  1E5W A;  2E2X A;  4WSF A;  3FSS A;  1PMS A;  1UNQ A;  2KUP A;  2UVM A;  1BTN A;  5D3V A;  1UPR A;  1AQC A;  4K81 A;  2CRF A;  1Y19 B;  1ZC3 B;  4MT7 A;  1U5F A;  2YF0 A;  2LKO A;  3U7D A;  1DDM A;  1FHO A;  1XOD A;  2D9W A;  2DHI A;  1BTK A;  5JP4 A;  4NSW A;  4HDO A;  1TJ6 A;  4CYE A;  1OQN A;  1X1F A;  3D8E A;  3DXD A;  4HAY B;  3PP2 A; 
#chains in the Genus database with same CATH topology
 4DBB A;  5FI0 A;  3F5R A;  3VIA A;  3FM8 C;  1NU2 A;  2DTC A;  1ISN A;  2DHJ A;  4TYZ A;  2Z59 A;  4HAW B;  5JHG A;  2RGN B;  2HTH B;  4QJ4 B;  3SV1 A;  5HE0 A;  2J59 M;  1NI2 A;  3SNH A;  2I5F A;  3OAN A;  5DIF B;  1FHW A;  5DI9 B;  2G35 A;  4H8S A;  4YON A;  4HAV B;  4BBK A;  1RJ2 A;  3V5W A;  1FB8 A;  4TKN A;  2KUQ A;  3PVU A;  4ZRJ A;  4HAT B;  1FHX A;  1WG7 A;  1DBH A;  2Z0Q A;  4HHV A;  4XWX A;  2P0F A;  2DX5 A;  2DFK A;  3B77 A;  1AWE A;  3M1I B;  3KZ1 A;  2D9X A;  1MIX A;  3KY9 A;  2VSZ A;  1H10 A;  4DX9 0;  2VRW B;  2YT0 A;  2YS3 A;  3ODO A;  4HSI A;  4HB3 B;  2VKI A;  3KRX A;  5D3Y A;  2YSZ A;  2MWN B;  4GMV A;  2CAY A;  1EGX A;  4F7H A;  2FJL A;  4KVG B;  3T06 A;  3D8D A;  1MAI A;  4EKU A;  1MKE A;  1X86 A;  1KZ7 A;  1T77 A;  4C0A A;  2DLW A;  4DXA B;  4KHB B;  1MK7 B;  3NWA A;  1TQZ A;  2D2Q A;  2X18 A;  1K5D B;  5C5B A;  5JLJ B;  2DYQ A;  1RRP B;  1U5E A;  2IFS A;  1PLS A;  5J3Q A;  2I1K A;  4B6H A;  2UZS A;  1P3R A;  3NW8 A;  2Z14 A;  3VOQ A;  4ZRI A;  2I1J A;  1ZVR A;  2AL6 A;  1TXD A;  2COF A;  4MY6 A;  1ZSQ A;  1DDW A;  4F7U P;  2COA A;  2RLO A;  2ROV A;  5DHA B;  2FJU B;  2EC1 A;  3PSC A;  2GUM A;  4D6W A;  1FOE A;  3A8P A;  4D0N B;  2D11 A;  3GYO A;  4L1R A;  2NMB A;  1UNR A;  1WVH A;  5CLL B;  2ELB A;  2CY4 A;  2ZPY A;  1MK9 B;  3SO6 A;  5HE2 A;  1V88 A;  1H4R A;  1I2H A;  2R0D A;  3N7C A;  3ML4 A;  1MIZ B;  4CSQ A;  1FGZ A;  3DXE A;  1QC6 A;  1U5D A;  4EJN A;  5L81 A;  1UPQ A;  3TO1 A;  2Q13 A;  1XKE A;  1K5G B;  5CLQ B;  2D9Z A;  2Y8F A;  4PQ0 A;  2YT1 A;  2J0J A;  4HAZ B;  2GCL A;  5D3W A;  2RSG A;  1WI1 A;  4WVF B;  2COC A;  3LJU X;  2KIE A;  2D9Y A;  1NTV A;  1GG3 A;  1U2B A;  2Y7B A;  4HB2 B;  2W2W A;  2M38 A;  5C79 A;  1UNP A;  1PFJ A;  4CHM A;  1UEF A;  4IFS A;  1MI1 A;  5KCV A;  2LUL A;  1V5P A;  3SUZ A;  3KSY A;  3ODW A;  2PZ1 A;  3HIE A;  4A5K A;  2UZR A;  2N0Y A;  1ZM0 A;  3PZD A;  2W2X C;  2Y8G A;  2DHK A;  2ELA A;  1FAO A;  4QJ5 B;  4GZU A;  1XX0 A;  3ULB A;  2L2I A;  1N3H A;  3MDB C;  3TW1 A;  2OTX A;  2LYD A;  1V61 A;  3GYP A;  2N23 A;  3A8Q A;  5KQ4 A;  3UZT A;  2Z4D A;  5C6R A;  1EVH A;  4ZRK A;  4P7I A;  1XD4 A;  3BJI A;  4GNK B;  2DN6 A;  1MPH A;  4KHA A;  1W1H A;  1M7R A;  3CXB B;  2V76 A;  2CY5 A;  4OT1 A;  2D9V A;  3PEG A;  2JP2 A;  2YRY A;  3NWD A;  4A6K A;  3HW2 B;  2KCJ A;  2YVC A;  5D3X A;  2Z13 A;  2EJ8 A;  2J0M A;  2HE7 A;  5I2M A;  1I7A A;  3PVW A;  2J0K A;  1OY2 A;  2K00 A;  1M7E A;  1FGY A;  4K2P A;  1EF1 A;  3O96 A;  2COD A;  3CIK A;  4Z2M B;  4A6F B;  4L6E A;  2DKP A;  1U29 A;  1SHC A;  4HB0 B;  3WA0 A;  3BIN A;  2NZ8 B;  5HE1 A;  2EMT A;  1ZC4 B;  1V5M A;  3DXC A;  4GOU A;  5FI1 A;  2AEH A;  2GJY A;  2RVB B;  1DYN A;  4KAX B;  3NWF A;  3DCX A;  4K17 A;  2H7E A;  3TVV A;  5M4Y B;  1V5U A;  2R09 A;  4IAP A;  3QWM A;  4K2O A;  3G9W A;  1BWN A;  1XR0 B;  2MKR A;  1P5T A;  3U12 A;  3A58 A;  5DHF B;  3OHM B;  3F0W A;  4Y94 A;  2P0D A;  5GOW B;  2QKM A;  2RUK B;  2D10 A;  2ROZ B;  5LG4 B;  3HK0 A;  4F7G A;  1NTY A;  1ZYI A;  5EFX A;  5J3Y A;  1J19 A;  3WYF B;  4HDQ A;  4Z2N A;  3TCA A;  4QXA B;  2DX1 A;  1X11 A;  4NY0 A;  2M14 A;  3AU4 A;  2ZKM X;  1BAK A;  1GC6 A;  1W1D A;  4HAU B;  1IRS A;  1X1G A;  2ADZ A;  4A6H A;  5HE3 A;  1OMW A;  1WJM A;  3KRW A;  5IRS A;  3ODX A;  4WJ7 A;  3P6A A;  4PNK A;  4YL8 A;  3ULC A;  1LB1 A;  1Q67 A;  2DA0 A;  5J3T A;  5DH9 B;  4CHJ A;  5I2S A;  1QQG A;  2MDX A;  2YT2 A;  1LW3 A;  2Z0O A;  4GXB A;  3AJ4 A;  3MPX A;  2L1C A;  2KGX B;  3U8Z A;  5LOP B;  3PG7 A;  2IYB A;  3P7Z A;  2K8E A;  3QBV B;  1SGH A;  2DYN A;  2XQN M;  3X23 A;  2Z0P A;  3A98 B;  1V89 A;  5LON B;  3AU5 A;  1B55 A;  1Y5O A;  2KIG A;  1KZG A;  1J0W A;  4DIX A;  4GMX B;  2RNR B;  1GC7 A;  4A6F A;  1W1G A;  1WJ1 A;  4HB4 B;  1U27 A;  4KHO A;  5C16 A;  2BCJ A;  3ZVR A;  3D8F A;  4DX8 A;  2W2X D;  4IOY X;  2MFQ A;  3ZDT A;  2K2J A;  4QJ3 B;  3TFM A;  4GPT B;  2K2U A;  1X05 A;  3QIJ A;  1U5G A;  1EAZ A;  5D27 A;  3RCP A;  2LG1 A;  2K49 A;  4HAX B;  2YS1 A;  2QKL A;  2P0H A;  4EMO A;  3PVL A;  2LOX A;  3FEH A;  2KR0 A;  3SYX A;  2LOZ A;  2P8V A;  1DRO A;  1DDV A;  3IVF A;  1WGU A;  1Z87 A;  2GCJ A;  1KI1 B;  1P6S A;  3NSU A;  5KQ1 A;  2RRF A;  1WGQ A;  1XCG A;  2YS5 A;  5C5B B;  2GS0 A;  4MK0 A;  5JHH A;  3HQC A;  2OQB A;  4GN1 A;  2H7D A;  2DKQ A;  2D4Q A;  2I5C A;  2EMS A;  1E5W A;  4OSN A;  2E2X A;  4WSF A;  3FSS A;  1PMS A;  1UNQ A;  2KUP A;  2UVM A;  1BTN A;  5D3V A;  1UPR A;  1AQC A;  3HSA A;  4K81 A;  2CRF A;  1Y19 B;  1ZC3 B;  4MT7 A;  1U5F A;  4KHB A;  2YF0 A;  2LKO A;  2R2Y A;  3U7D A;  1DDM A;  1FHO A;  1XOD A;  2D9W A;  2DHI A;  1BTK A;  5JP4 A;  4NSW A;  4HDO A;  1TJ6 A;  2NBV A;  4CYE A;  1OQN A;  1X1F A;  3D8E A;  3DXD A;  3FVC A;  4HAY B;  3PP2 A; 
#chains in the Genus database with same CATH homology
 4DBB A;  5FI0 A;  3F5R A;  3VIA A;  3FM8 C;  1NU2 A;  2DTC A;  1ISN A;  2DHJ A;  4TYZ A;  4HAW B;  5JHG A;  2RGN B;  2HTH B;  3SV1 A;  5HE0 A;  2J59 M;  1NI2 A;  3SNH A;  2I5F A;  3OAN A;  5DIF B;  1FHW A;  5DI9 B;  2G35 A;  4H8S A;  4YON A;  4HAV B;  4BBK A;  1RJ2 A;  3V5W A;  1FB8 A;  4TKN A;  3PVU A;  4ZRJ A;  4HAT B;  1FHX A;  1WG7 A;  1DBH A;  2Z0Q A;  4HHV A;  4XWX A;  2P0F A;  2DX5 A;  2DFK A;  1AWE A;  3M1I B;  3KZ1 A;  2D9X A;  1MIX A;  3KY9 A;  2VSZ A;  1H10 A;  4DX9 0;  2VRW B;  2YT0 A;  2YS3 A;  3ODO A;  4HB3 B;  2VKI A;  3KRX A;  5D3Y A;  2YSZ A;  2MWN B;  4GMV A;  2CAY A;  1EGX A;  4F7H A;  2FJL A;  4KVG B;  3T06 A;  3D8D A;  1MAI A;  4EKU A;  1MKE A;  1X86 A;  1KZ7 A;  4C0A A;  2DLW A;  4DXA B;  4KHB B;  1MK7 B;  1TQZ A;  2D2Q A;  2X18 A;  1K5D B;  5C5B A;  5JLJ B;  2DYQ A;  1RRP B;  1U5E A;  2IFS A;  1PLS A;  5J3Q A;  2I1K A;  4B6H A;  2UZS A;  1P3R A;  3VOQ A;  4ZRI A;  2I1J A;  1ZVR A;  2AL6 A;  1TXD A;  2COF A;  4MY6 A;  1ZSQ A;  1DDW A;  4F7U P;  2COA A;  2RLO A;  2ROV A;  5DHA B;  2EC1 A;  3PSC A;  1FOE A;  3A8P A;  4D0N B;  2D11 A;  3GYO A;  2NMB A;  1UNR A;  1WVH A;  5CLL B;  2ELB A;  2CY4 A;  2ZPY A;  1MK9 B;  3SO6 A;  5HE2 A;  1V88 A;  1H4R A;  1I2H A;  2R0D A;  3N7C A;  3ML4 A;  1MIZ B;  1FGZ A;  3DXE A;  1QC6 A;  1U5D A;  4EJN A;  5L81 A;  1UPQ A;  3TO1 A;  2Q13 A;  1XKE A;  1K5G B;  5CLQ B;  2D9Z A;  2Y8F A;  4PQ0 A;  2YT1 A;  2J0J A;  4HAZ B;  2GCL A;  5D3W A;  2RSG A;  1WI1 A;  4WVF B;  2COC A;  3LJU X;  2D9Y A;  1NTV A;  1GG3 A;  1U2B A;  2Y7B A;  4HB2 B;  2W2W A;  2M38 A;  5C79 A;  1UNP A;  1PFJ A;  4CHM A;  1UEF A;  4IFS A;  5KCV A;  2LUL A;  1V5P A;  3SUZ A;  3KSY A;  3ODW A;  2PZ1 A;  4A5K A;  2UZR A;  2N0Y A;  1ZM0 A;  3PZD A;  2W2X C;  2Y8G A;  2DHK A;  2ELA A;  1FAO A;  4GZU A;  1XX0 A;  3ULB A;  2L2I A;  1N3H A;  3MDB C;  3TW1 A;  2OTX A;  2LYD A;  1V61 A;  3GYP A;  2N23 A;  3A8Q A;  5KQ4 A;  3UZT A;  5C6R A;  1EVH A;  4ZRK A;  4P7I A;  1XD4 A;  3BJI A;  2DN6 A;  1MPH A;  4KHA A;  1W1H A;  1M7R A;  3CXB B;  2V76 A;  2CY5 A;  2D9V A;  3PEG A;  2JP2 A;  2YRY A;  4A6K A;  3HW2 B;  2KCJ A;  2YVC A;  5D3X A;  2EJ8 A;  2J0M A;  2HE7 A;  1I7A A;  3PVW A;  2J0K A;  1OY2 A;  2K00 A;  1M7E A;  1FGY A;  4K2P A;  1EF1 A;  3O96 A;  2COD A;  3CIK A;  4Z2M B;  4A6F B;  4L6E A;  2DKP A;  1U29 A;  1SHC A;  4HB0 B;  3WA0 A;  3BIN A;  2NZ8 B;  5HE1 A;  2EMT A;  1ZC4 B;  1V5M A;  3DXC A;  5FI1 A;  2AEH A;  2GJY A;  2RVB B;  1DYN A;  4KAX B;  4K17 A;  2H7E A;  3TVV A;  1V5U A;  2R09 A;  4IAP A;  3QWM A;  4K2O A;  3G9W A;  1BWN A;  1XR0 B;  2MKR A;  1P5T A;  5DHF B;  3F0W A;  4Y94 A;  2P0D A;  5GOW B;  2QKM A;  2RUK B;  2D10 A;  2ROZ B;  3HK0 A;  4F7G A;  1NTY A;  5EFX A;  5J3Y A;  1J19 A;  3WYF B;  4HDQ A;  4Z2N A;  3TCA A;  2DX1 A;  1X11 A;  4NY0 A;  2M14 A;  3AU4 A;  1BAK A;  1GC6 A;  1W1D A;  4HAU B;  1IRS A;  1X1G A;  2ADZ A;  4A6H A;  5HE3 A;  1OMW A;  1WJM A;  3KRW A;  3ODX A;  4WJ7 A;  3P6A A;  4PNK A;  4YL8 A;  3ULC A;  1LB1 A;  1Q67 A;  2DA0 A;  5J3T A;  5DH9 B;  4CHJ A;  1QQG A;  2MDX A;  1LW3 A;  2Z0O A;  4GXB A;  3AJ4 A;  3MPX A;  2L1C A;  2KGX B;  3U8Z A;  5LOP B;  3PG7 A;  2IYB A;  3P7Z A;  3QBV B;  1SGH A;  2DYN A;  2XQN M;  3X23 A;  2Z0P A;  3A98 B;  1V89 A;  5LON B;  3AU5 A;  1B55 A;  1Y5O A;  1KZG A;  1J0W A;  4GMX B;  2RNR B;  1GC7 A;  4A6F A;  1W1G A;  1WJ1 A;  4HB4 B;  1U27 A;  4KHO A;  5C16 A;  2BCJ A;  3ZVR A;  3D8F A;  4DX8 A;  2W2X D;  4IOY X;  2MFQ A;  3ZDT A;  2K2J A;  3TFM A;  4GPT B;  2K2U A;  1X05 A;  3QIJ A;  1U5G A;  1EAZ A;  5D27 A;  3RCP A;  2LG1 A;  4HAX B;  2YS1 A;  2QKL A;  2P0H A;  4EMO A;  3PVL A;  2LOX A;  3FEH A;  3SYX A;  2LOZ A;  2P8V A;  1DRO A;  1DDV A;  3IVF A;  1WGU A;  1Z87 A;  2GCJ A;  1KI1 B;  1P6S A;  3NSU A;  5KQ1 A;  1WGQ A;  1XCG A;  2YS5 A;  5C5B B;  2GS0 A;  4MK0 A;  5JHH A;  3HQC A;  2OQB A;  4GN1 A;  2H7D A;  2DKQ A;  2D4Q A;  2I5C A;  2EMS A;  1E5W A;  2E2X A;  4WSF A;  3FSS A;  1PMS A;  1UNQ A;  2KUP A;  2UVM A;  1BTN A;  5D3V A;  1UPR A;  1AQC A;  4K81 A;  2CRF A;  1Y19 B;  1ZC3 B;  4MT7 A;  1U5F A;  2YF0 A;  2LKO A;  3U7D A;  1DDM A;  1FHO A;  1XOD A;  2D9W A;  2DHI A;  1BTK A;  5JP4 A;  4NSW A;  4HDO A;  1TJ6 A;  4CYE A;  1OQN A;  1X1F A;  3D8E A;  3DXD A;  4HAY B;  3PP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...