5LONB

Structure of /k. lactis/ dcp1-dcp2 decapping complex.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
174
Chain Sequence
STETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Rna binding protein
molecule keywords KLLA0F23980p
total genus 36
structure length 174
sequence length 185
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lonB01
1BWNA 2ROVA 2KGXB 2KCJA 3OANA 2EC1A 5DI9B 3CIKA 3AU5A 1BTNA 3PZDA 4A6FB 3F5RA 2NZ8B 4GMXB 2L1CA 1OY2A 4NSWA 2MDXA 1ISNA 1FGZA 1UEFA 4GPTB 5DH9B 2YRYA 1NTYA 2LULA 4DX8A 5D3XA 3D8DA 2RNRB 4K17A 4XWXA 5C5BA 3CXBB 2KUPA 1DDVA 2XQNM 2D11A 3PSCA 3GYOA 2ROZB 2I1JA 3QIJA 1U5GA 4HAVB 3PVLA 1UPQA 1XX0A 2K00A 2AEHA 1U2BA 1WJMA 5L81A 3LJUX 3AJ4A 4DBBA 4HATB 3X23A 4ZRKA 4GN1A 2YS1A 2YVCA 1MKEA 5J3TA 2DA0A 1BAKA 1NU2A 1DDWA 2P0FA 1XKEA 3KZ1A 1Y5OA 2QKMA 5LONB 4P7IA 2DHKA 3ODXA 3P6AA 1B55A 1EAZA 2N0YA 2YF0A 4ZRJA 3N7CA 1P5TA 2RVBB 2OQBA 4HB4B 1DDMA 5FI0A 4L6EA 4NY0A 3RCPA 2R0DA 2LKOA 1WJ1A 2BCJA 1LB1A 4IAPA 2W2XC 1M7EA 2QKLA 1Y19B 3KSYA 1WGQA 5JHHA 1U5EA 2LOXA 1N3HA 3A8QA 1IRSA 2HTHB 3PVUA 3SNHA 2CY5A 5KQ1A 4ZRIA 2AL6A 1RRPB 2H7DA 2LG1A 1MPHA 3ODOA 3QWMA 2M14A 3ULCA 5HE1A 2CRFA 1FHWA 2CY4A 2ELAA 3O96A 2LYDA 2D2QA 1AQCA 2EMTA 4K2OA 1X86A 2ADZA 4WVFB 1Z87A 1QQGA 3U7DA 3VOQA 1M7RA 1LW3A 4GXBA 1U29A 4F7HA 5C79A 5KCVA 4CHMA 2D9VA 1V61A 3PVWA 1FB8A 1OQNA 2I1KA 1TXDA 5C6RA 2UVMA 2YT0A 4A5KA 2IYBA 2YS3A 2J0MA 2CODA 3ZDTA 4WSFA 5DHAB 5GOWB 1XODA 1KZ7A 3HQCA 3NSUA 2FJLA 4YONA 4CYEA 2VSZA 2JP2A 2UZRA 2E2XA 2DKPA 2DN6A 2MKRA 1P6SA 3HW2B 3BJIA 4K81A 4IOYX 2Q13A 3D8EA 4KHOA 4WJ7A 1I2HA 2ELBA 2HE7A 1WI1A 2X18A 1FOEA 1H4RA 3TW1A 2COCA 2MFQA 3DXDA 1SHCA 3ML4A 1ZM0A 5HE3A 1UPRA 1WG7A 4MT7A 5JHGA 2M38A 5C16A 5JLJB 4KAXB 3TCAA 1H10A 5FI1A 2GCJA 1X05A 4A6FA 2D9XA 3SV1A 1WGUA 1QC6A 1FGYA 4MY6A 3UZTA 3A98B 4HB3B 2YT1A 1XD4A 2P8VA 4GZUA 2ZPYA 3ZVRA 2OTXA 3P7ZA 4GMVA 5DHFB 2W2WA 1ZSQA 2EMSA 3U8ZA 2DLWA 2NMBA 3WA0A 3KRWA 3SUZA 2DYQA 2IFSA 1GG3A 3AU4A 4C0AA 2GJYA 2D9YA 5DIFB 4Z2NA 2LOZA 1I7AA 1AWEA 2DX1A 1XCGA 4F7UP 2DX5A 4BBKA 1XR0B 3KY9A 2RUKB 1EVHA 1MIZB 2Y7BA 4KVGB 4HAWB 4PQ0A 3PEGA 4Y94A 5LOPB 4HHVA 2D10A 3KRXA 1V5UA 2I5CA 3MDBC 1ZC4B 2DYNA 4D0NB 2K2UA 1PLSA 4MK0A 1V5PA 3DXEA 3GYPA 2COFA 2YS5A 5D3VA 4EJNA 4HDOA 1GC7A 1EGXA 1KZGA 3D8FA 3TFMA 4TKNA 1FAOA 1W1HA 5HE2A 2RGNB 3PP2A 1MAIA 1U27A 3ULBA 2COAA 1U5DA 2L2IA 1FHXA 1ZC3B 2EJ8A 5J3YA 3ODWA 4KHAA 1X1GA 4DX90 1DYNA 4PNKA 2I5FA 5JP4A 3G9WA 1DROA 5C5BB 2P0DA 2D9WA 4HAXB 2DFKA 3HK0A 3IVFA 5D3YA 1MIXA 3T06A 4HAUB 1EF1A 1TJ6A 1ZVRA 5HE0A 2MWNB 2PZ1A 2H7EA 1Q67A 1V5MA 2DHJA 2CAYA 3FSSA 1DBHA 1WVHA 4B6HA 4IFSA 4K2PA 4CHJA 2J59M 1MK9B 1NI2A 2K2JA 1V89A 2R09A 3TVVA 4HAZB 5EFXA 4HAYB 4EKUA 1KI1B 4EMOA 5CLLB 4F7GA 2Y8FA 1FHOA 2YSZA 2Z0QA 2Z0PA 5D27A 1TQZA 1V88A 1BTKA 1GC6A 2DTCA 4DXAB 2GS0A 3F0WA 2VKIA 1E5WA 1W1DA 1OMWA 2W2XD 3QBVB 1K5DB 2Z0OA 2DHIA 1UNPA 4H8SA 4A6HA 1PMSA 3PG7A 4HB2B 2J0KA 4YL8A 2RSGA 4TYZA 1MK7B 3M1IB 3VIAA 1X11A 2J0JA 3WYFB 2D4QA 4A6KA 2UZSA 1PFJA 5J3QA 3FEHA 4HDQA 1NTVA 3TO1A 2D9ZA 2P0HA 1SGHA 3V5WA 3FM8C 2Y8GA 3BINA 1J19A 2VRWB 5CLQB 5KQ4A 2N23A 1UNRA 1P3RA 2G35A 5D3WA 1J0WA 3SYXA 1K5GB 3DXCA 1X1FA 3MPXA 3SO6A 4Z2MB 1UNQA 2GCLA 1RJ2A 2V76A 1U5FA 4HB0B 4KHBB 2RLOA 1W1GA 3A8PA 2DKQA
chains in the Genus database with same CATH superfamily
3NW8A 1BWNA 2ROVA 2KGXB 4OT1A 2KCJA 3OANA 2EC1A 5DI9B 3CIKA 3AU5A 1BTNA 2Z14A 3PZDA 4A6FB 3F5RA 2NZ8B 5IRSA 4GMXB 2L1CA 1OY2A 4NSWA 2KR0A 2MDXA 1ISNA 1FGZA 1UEFA 3B77A 4GPTB 5DH9B 2YRYA 1NTYA 2Z59A 2LULA 4DX8A 5D3XA 3D8DA 2RNRB 4K17A 4XWXA 5C5BA 5LG4B 3CXBB 2KUPA 1DDVA 2XQNM 2D11A 3PSCA 3GYOA 2ROZB 2I1JA 3QIJA 1T77A 1U5GA 2Z4DA 4HAVB 3PVLA 1UPQA 3FVCA 4GNKB 1XX0A 2K00A 2AEHA 1U2BA 1WJMA 5L81A 3LJUX 3AJ4A 4DBBA 4HATB 3X23A 4ZRKA 4GN1A 2YS1A 2YVCA 1MKEA 5J3TA 2KIGA 3HSAA 2DA0A 1BAKA 1NU2A 1DDWA 2P0FA 1XKEA 3KZ1A 1Y5OA 2QKMA 5LONB 4QJ5B 4P7IA 2DHKA 3DCXA 3ODXA 3P6AA 1B55A 1EAZA 2N0YA 2YF0A 4ZRJA 3N7CA 1P5TA 2RVBB 2OQBA 4HB4B 5I2SA 1DDMA 3A58A 5FI0A 4L6EA 4NY0A 3RCPA 2R0DA 2LKOA 1WJ1A 2BCJA 2ZKMX 1LB1A 4IAPA 2W2XC 1M7EA 2QKLA 1Y19B 3KSYA 2K49A 1WGQA 5JHHA 1U5EA 2LOXA 1N3HA 3A8QA 1IRSA 2HTHB 3PVUA 3SNHA 2CY5A 5KQ1A 4ZRIA 2AL6A 2GUMA 1RRPB 2H7DA 5I2MA 2LG1A 1MPHA 3ODOA 3QWMA 2M14A 3ULCA 5HE1A 2CRFA 1FHWA 2CY4A 2ELAA 3O96A 2LYDA 2D2QA 1AQCA 2EMTA 4K2OA 1X86A 2ADZA 4WVFB 1Z87A 1QQGA 3U7DA 3VOQA 1M7RA 1LW3A 4GXBA 1U29A 4F7HA 5C79A 5KCVA 4CHMA 2D9VA 1V61A 3PVWA 3HIEA 1FB8A 1OQNA 2I1KA 1TXDA 5C6RA 2UVMA 2YT0A 4A5KA 2IYBA 3NWFA 4QJ4B 2YS3A 2J0MA 2CODA 3ZDTA 4WSFA 5DHAB 5GOWB 1XODA 1KZ7A 3HQCA 3NSUA 2FJLA 4YONA 4CYEA 2VSZA 2JP2A 2UZRA 2E2XA 2DKPA 2DN6A 2MKRA 1P6SA 3HW2B 3BJIA 4K81A 4IOYX 2Q13A 3D8EA 4KHOA 4WJ7A 1I2HA 2ELBA 2HE7A 1WI1A 2X18A 1FOEA 1H4RA 3TW1A 2COCA 2MFQA 3DXDA 1SHCA 3ML4A 1ZM0A 5HE3A 1UPRA 1WG7A 4MT7A 3OHMB 5JHGA 2M38A 5C16A 3NWDA 3NWAA 5JLJB 4KAXB 3TCAA 1H10A 5FI1A 2GCJA 1X05A 4A6FA 2D9XA 3SV1A 1WGUA 1QC6A 1FGYA 4MY6A 2KUQA 3UZTA 3A98B 4HB3B 3U12A 2YT1A 4KHBA 1XD4A 2P8VA 4GZUA 2ZPYA 3ZVRA 2OTXA 3P7ZA 4GMVA 4HSIA 5DHFB 2W2WA 1ZSQA 2EMSA 3U8ZA 2DLWA 2NMBA 3WA0A 2K8EA 3KRWA 3SUZA 2DYQA 2IFSA 1GG3A 3AU4A 4OSNA 4C0AA 2GJYA 2D9YA 5DIFB 4Z2NA 2LOZA 1I7AA 2YT2A 1AWEA 2DX1A 2R2YA 1XCGA 4F7UP 2DX5A 4BBKA 1XR0B 3KY9A 2RUKB 1EVHA 1MIZB 2Y7BA 4KVGB 4HAWB 4PQ0A 3PEGA 4Y94A 5LOPB 4HHVA 2D10A 3KRXA 1V5UA 2I5CA 3MDBC 1ZC4B 2DYNA 4D0NB 2K2UA 1PLSA 4MK0A 5M4YB 1V5PA 3DXEA 3GYPA 2COFA 2YS5A 5D3VA 4EJNA 4HDOA 1GC7A 1EGXA 1KZGA 4GOUA 3D8FA 3TFMA 4TKNA 1FAOA 1W1HA 5HE2A 2RGNB 3PP2A 1MAIA 4D6WA 1U27A 2FJUB 3ULBA 2COAA 1U5DA 2L2IA 1FHXA 1ZC3B 2EJ8A 5J3YA 3ODWA 4KHAA 1X1GA 4DX90 1DYNA 4PNKA 2I5FA 5JP4A 3G9WA 4QJ3B 1DROA 5C5BB 2P0DA 2D9WA 4CSQA 4HAXB 2DFKA 3HK0A 3IVFA 5D3YA 1MIXA 3T06A 4HAUB 1EF1A 1TJ6A 1ZVRA 5HE0A 2MWNB 4L1RA 2PZ1A 2H7EA 1Q67A 1V5MA 2DHJA 2CAYA 3FSSA 4QXAB 1DBHA 1WVHA 4B6HA 4IFSA 4K2PA 4CHJA 2J59M 1MK9B 1NI2A 2K2JA 1V89A 2R09A 2NBVA 3TVVA 4HAZB 5EFXA 4HAYB 4EKUA 1KI1B 4EMOA 5CLLB 4F7GA 2Y8FA 1FHOA 2YSZA 2Z0QA 2KIEA 2Z0PA 5D27A 1TQZA 4DIXA 1V88A 1BTKA 1MI1A 1GC6A 2DTCA 4DXAB 2GS0A 3F0WA 2VKIA 1E5WA 1W1DA 1OMWA 2W2XD 3QBVB 1K5DB 2Z0OA 2DHIA 1UNPA 4H8SA 4A6HA 1PMSA 3PG7A 4HB2B 2J0KA 4YL8A 2RSGA 4TYZA 1MK7B 3M1IB 3VIAA 1X11A 2J0JA 1ZYIA 3WYFB 2D4QA 4A6KA 2UZSA 1PFJA 5J3QA 3FEHA 4HDQA 1NTVA 2RRFA 3TO1A 2D9ZA 2P0HA 1SGHA 3V5WA 3FM8C 2Y8GA 3BINA 1J19A 2VRWB 5CLQB 5KQ4A 2N23A 1UNRA 1P3RA 2G35A 5D3WA 1J0WA 3SYXA 1K5GB 3DXCA 1X1FA 3MPXA 3SO6A 4Z2MB 1UNQA 2Z13A 2GCLA 1RJ2A 2V76A 1U5FA 4HB0B 4KHBB 2RLOA 1W1GA 3A8PA 2DKQA
chains in the Genus database with same CATH topology
1BWNA 2ROVA 2KGXB 2KCJA 3OANA 2EC1A 5DI9B 3CIKA 3AU5A 1BTNA 3PZDA 4A6FB 3F5RA 2NZ8B 4GMXB 2L1CA 1OY2A 4NSWA 2MDXA 1ISNA 1FGZA 1UEFA 4GPTB 5DH9B 2YRYA 1NTYA 2LULA 4DX8A 5D3XA 3D8DA 2RNRB 4K17A 4XWXA 5C5BA 3CXBB 2KUPA 1DDVA 2XQNM 2D11A 3PSCA 3GYOA 2ROZB 2I1JA 3QIJA 1U5GA 4HAVB 3PVLA 1UPQA 1XX0A 2K00A 2AEHA 1U2BA 1WJMA 5L81A 3LJUX 3AJ4A 4DBBA 4HATB 3X23A 4ZRKA 4GN1A 2YS1A 2YVCA 1MKEA 5J3TA 2DA0A 1BAKA 1NU2A 1DDWA 2P0FA 1XKEA 3KZ1A 1Y5OA 2QKMA 5LONB 4P7IA 2DHKA 3ODXA 3P6AA 1B55A 1EAZA 2N0YA 2YF0A 4ZRJA 3N7CA 1P5TA 2RVBB 2OQBA 4HB4B 1DDMA 5FI0A 4L6EA 4NY0A 3RCPA 2R0DA 2LKOA 1WJ1A 2BCJA 1LB1A 4IAPA 2W2XC 1M7EA 2QKLA 1Y19B 3KSYA 1WGQA 5JHHA 1U5EA 2LOXA 1N3HA 3A8QA 1IRSA 2HTHB 3PVUA 3SNHA 2CY5A 5KQ1A 4ZRIA 2AL6A 1RRPB 2H7DA 2LG1A 1MPHA 3ODOA 3QWMA 2M14A 3ULCA 5HE1A 2CRFA 1FHWA 2CY4A 2ELAA 3O96A 2LYDA 2D2QA 1AQCA 2EMTA 4K2OA 1X86A 2ADZA 4WVFB 1Z87A 1QQGA 3U7DA 3VOQA 1M7RA 1LW3A 4GXBA 1U29A 4F7HA 5C79A 5KCVA 4CHMA 2D9VA 1V61A 3PVWA 1FB8A 1OQNA 2I1KA 1TXDA 5C6RA 2UVMA 2YT0A 4A5KA 2IYBA 2YS3A 2J0MA 2CODA 3ZDTA 4WSFA 5DHAB 5GOWB 1XODA 1KZ7A 3HQCA 3NSUA 2FJLA 4YONA 4CYEA 2VSZA 2JP2A 2UZRA 2E2XA 2DKPA 2DN6A 2MKRA 1P6SA 3HW2B 3BJIA 4K81A 4IOYX 2Q13A 3D8EA 4KHOA 4WJ7A 1I2HA 2ELBA 2HE7A 1WI1A 2X18A 1FOEA 1H4RA 3TW1A 2COCA 2MFQA 3DXDA 1SHCA 3ML4A 1ZM0A 5HE3A 1UPRA 1WG7A 4MT7A 5JHGA 2M38A 5C16A 5JLJB 4KAXB 3TCAA 1H10A 5FI1A 2GCJA 1X05A 4A6FA 2D9XA 3SV1A 1WGUA 1QC6A 1FGYA 4MY6A 3UZTA 3A98B 4HB3B 2YT1A 1XD4A 2P8VA 4GZUA 2ZPYA 3ZVRA 2OTXA 3P7ZA 4GMVA 5DHFB 2W2WA 1ZSQA 2EMSA 3U8ZA 2DLWA 2NMBA 3WA0A 3KRWA 3SUZA 2DYQA 2IFSA 1GG3A 3AU4A 4C0AA 2GJYA 2D9YA 5DIFB 4Z2NA 2LOZA 1I7AA 1AWEA 2DX1A 1XCGA 4F7UP 2DX5A 4BBKA 1XR0B 3KY9A 2RUKB 1EVHA 1MIZB 2Y7BA 4KVGB 4HAWB 4PQ0A 3PEGA 4Y94A 5LOPB 4HHVA 2D10A 3KRXA 1V5UA 2I5CA 3MDBC 1ZC4B 2DYNA 4D0NB 2K2UA 1PLSA 4MK0A 1V5PA 3DXEA 3GYPA 2COFA 2YS5A 5D3VA 4EJNA 4HDOA 1GC7A 1EGXA 1KZGA 3D8FA 3TFMA 4TKNA 1FAOA 1W1HA 5HE2A 2RGNB 3PP2A 1MAIA 1U27A 3ULBA 2COAA 1U5DA 2L2IA 1FHXA 1ZC3B 2EJ8A 5J3YA 3ODWA 4KHAA 1X1GA 4DX90 1DYNA 4PNKA 2I5FA 5JP4A 3G9WA 1DROA 5C5BB 2P0DA 2D9WA 4HAXB 2DFKA 3HK0A 3IVFA 5D3YA 1MIXA 3T06A 4HAUB 1EF1A 1TJ6A 1ZVRA 5HE0A 2MWNB 2PZ1A 2H7EA 1Q67A 1V5MA 2DHJA 2CAYA 3FSSA 1DBHA 1WVHA 4B6HA 4IFSA 4K2PA 4CHJA 2J59M 1MK9B 1NI2A 2K2JA 1V89A 2R09A 3TVVA 4HAZB 5EFXA 4HAYB 4EKUA 1KI1B 4EMOA 5CLLB 4F7GA 2Y8FA 1FHOA 2YSZA 2Z0QA 2Z0PA 5D27A 1TQZA 1V88A 1BTKA 1GC6A 2DTCA 4DXAB 2GS0A 3F0WA 2VKIA 1E5WA 1W1DA 1OMWA 2W2XD 3QBVB 1K5DB 2Z0OA 2DHIA 1UNPA 4H8SA 4A6HA 1PMSA 3PG7A 4HB2B 2J0KA 4YL8A 2RSGA 4TYZA 1MK7B 3M1IB 3VIAA 1X11A 2J0JA 3WYFB 2D4QA 4A6KA 2UZSA 1PFJA 5J3QA 3FEHA 4HDQA 1NTVA 3TO1A 2D9ZA 2P0HA 1SGHA 3V5WA 3FM8C 2Y8GA 3BINA 1J19A 2VRWB 5CLQB 5KQ4A 2N23A 1UNRA 1P3RA 2G35A 5D3WA 1J0WA 3SYXA 1K5GB 3DXCA 1X1FA 3MPXA 3SO6A 4Z2MB 1UNQA 2GCLA 1RJ2A 2V76A 1U5FA 4HB0B 4KHBB 2RLOA 1W1GA 3A8PA 2DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWN A;  2ROV A;  2KGX B;  2KCJ A;  3OAN A;  2EC1 A;  5DI9 B;  3CIK A;  3AU5 A;  1BTN A;  3PZD A;  4A6F B;  3F5R A;  2NZ8 B;  4GMX B;  2L1C A;  1OY2 A;  4NSW A;  2MDX A;  1ISN A;  1FGZ A;  1UEF A;  4GPT B;  5DH9 B;  2YRY A;  1NTY A;  2LUL A;  4DX8 A;  5D3X A;  3D8D A;  2RNR B;  4K17 A;  4XWX A;  5C5B A;  3CXB B;  2KUP A;  1DDV A;  2XQN M;  2D11 A;  3PSC A;  3GYO A;  2ROZ B;  2I1J A;  3QIJ A;  1U5G A;  4HAV B;  3PVL A;  1UPQ A;  1XX0 A;  2K00 A;  2AEH A;  1U2B A;  1WJM A;  5L81 A;  3LJU X;  3AJ4 A;  4DBB A;  4HAT B;  3X23 A;  4ZRK A;  4GN1 A;  2YS1 A;  2YVC A;  1MKE A;  5J3T A;  2DA0 A;  1BAK A;  1NU2 A;  1DDW A;  2P0F A;  1XKE A;  3KZ1 A;  1Y5O A;  2QKM A;  5LON B;  4P7I A;  2DHK A;  3ODX A;  3P6A A;  1B55 A;  1EAZ A;  2N0Y A;  2YF0 A;  4ZRJ A;  3N7C A;  1P5T A;  2RVB B;  2OQB A;  4HB4 B;  1DDM A;  5FI0 A;  4L6E A;  4NY0 A;  3RCP A;  2R0D A;  2LKO A;  1WJ1 A;  2BCJ A;  1LB1 A;  4IAP A;  2W2X C;  1M7E A;  2QKL A;  1Y19 B;  3KSY A;  1WGQ A;  5JHH A;  1U5E A;  2LOX A;  1N3H A;  3A8Q A;  1IRS A;  2HTH B;  3PVU A;  3SNH A;  2CY5 A;  5KQ1 A;  4ZRI A;  2AL6 A;  1RRP B;  2H7D A;  2LG1 A;  1MPH A;  3ODO A;  3QWM A;  2M14 A;  3ULC A;  5HE1 A;  2CRF A;  1FHW A;  2CY4 A;  2ELA A;  3O96 A;  2LYD A;  2D2Q A;  1AQC A;  2EMT A;  4K2O A;  1X86 A;  2ADZ A;  4WVF B;  1Z87 A;  1QQG A;  3U7D A;  3VOQ A;  1M7R A;  1LW3 A;  4GXB A;  1U29 A;  4F7H A;  5C79 A;  5KCV A;  4CHM A;  2D9V A;  1V61 A;  3PVW A;  1FB8 A;  1OQN A;  2I1K A;  1TXD A;  5C6R A;  2UVM A;  2YT0 A;  4A5K A;  2IYB A;  2YS3 A;  2J0M A;  2COD A;  3ZDT A;  4WSF A;  5DHA B;  5GOW B;  1XOD A;  1KZ7 A;  3HQC A;  3NSU A;  2FJL A;  4YON A;  4CYE A;  2VSZ A;  2JP2 A;  2UZR A;  2E2X A;  2DKP A;  2DN6 A;  2MKR A;  1P6S A;  3HW2 B;  3BJI A;  4K81 A;  4IOY X;  2Q13 A;  3D8E A;  4KHO A;  4WJ7 A;  1I2H A;  2ELB A;  2HE7 A;  1WI1 A;  2X18 A;  1FOE A;  1H4R A;  3TW1 A;  2COC A;  2MFQ A;  3DXD A;  1SHC A;  3ML4 A;  1ZM0 A;  5HE3 A;  1UPR A;  1WG7 A;  4MT7 A;  5JHG A;  2M38 A;  5C16 A;  5JLJ B;  4KAX B;  3TCA A;  1H10 A;  5FI1 A;  2GCJ A;  1X05 A;  4A6F A;  2D9X A;  3SV1 A;  1WGU A;  1QC6 A;  1FGY A;  4MY6 A;  3UZT A;  3A98 B;  4HB3 B;  2YT1 A;  1XD4 A;  2P8V A;  4GZU A;  2ZPY A;  3ZVR A;  2OTX A;  3P7Z A;  4GMV A;  5DHF B;  2W2W A;  1ZSQ A;  2EMS A;  3U8Z A;  2DLW A;  2NMB A;  3WA0 A;  3KRW A;  3SUZ A;  2DYQ A;  2IFS A;  1GG3 A;  3AU4 A;  4C0A A;  2GJY A;  2D9Y A;  5DIF B;  4Z2N A;  2LOZ A;  1I7A A;  1AWE A;  2DX1 A;  1XCG A;  4F7U P;  2DX5 A;  4BBK A;  1XR0 B;  3KY9 A;  2RUK B;  1EVH A;  1MIZ B;  2Y7B A;  4KVG B;  4HAW B;  4PQ0 A;  3PEG A;  4Y94 A;  5LOP B;  4HHV A;  2D10 A;  3KRX A;  1V5U A;  2I5C A;  3MDB C;  1ZC4 B;  2DYN A;  4D0N B;  2K2U A;  1PLS A;  4MK0 A;  1V5P A;  3DXE A;  3GYP A;  2COF A;  2YS5 A;  5D3V A;  4EJN A;  4HDO A;  1GC7 A;  1EGX A;  1KZG A;  3D8F A;  3TFM A;  4TKN A;  1FAO A;  1W1H A;  5HE2 A;  2RGN B;  3PP2 A;  1MAI A;  1U27 A;  3ULB A;  2COA A;  1U5D A;  2L2I A;  1FHX A;  1ZC3 B;  2EJ8 A;  5J3Y A;  3ODW A;  4KHA A;  1X1G A;  4DX9 0;  1DYN A;  4PNK A;  2I5F A;  5JP4 A;  3G9W A;  1DRO A;  5C5B B;  2P0D A;  2D9W A;  4HAX B;  2DFK A;  3HK0 A;  3IVF A;  5D3Y A;  1MIX A;  3T06 A;  4HAU B;  1EF1 A;  1TJ6 A;  1ZVR A;  5HE0 A;  2MWN B;  2PZ1 A;  2H7E A;  1Q67 A;  1V5M A;  2DHJ A;  2CAY A;  3FSS A;  1DBH A;  1WVH A;  4B6H A;  4IFS A;  4K2P A;  4CHJ A;  2J59 M;  1MK9 B;  1NI2 A;  2K2J A;  1V89 A;  2R09 A;  3TVV A;  4HAZ B;  5EFX A;  4HAY B;  4EKU A;  1KI1 B;  4EMO A;  5CLL B;  4F7G A;  2Y8F A;  1FHO A;  2YSZ A;  2Z0Q A;  2Z0P A;  5D27 A;  1TQZ A;  1V88 A;  1BTK A;  1GC6 A;  2DTC A;  4DXA B;  2GS0 A;  3F0W A;  2VKI A;  1E5W A;  1W1D A;  1OMW A;  2W2X D;  3QBV B;  1K5D B;  2Z0O A;  2DHI A;  1UNP A;  4H8S A;  4A6H A;  1PMS A;  3PG7 A;  4HB2 B;  2J0K A;  4YL8 A;  2RSG A;  4TYZ A;  1MK7 B;  3M1I B;  3VIA A;  1X11 A;  2J0J A;  3WYF B;  2D4Q A;  4A6K A;  2UZS A;  1PFJ A;  5J3Q A;  3FEH A;  4HDQ A;  1NTV A;  3TO1 A;  2D9Z A;  2P0H A;  1SGH A;  3V5W A;  3FM8 C;  2Y8G A;  3BIN A;  1J19 A;  2VRW B;  5CLQ B;  5KQ4 A;  2N23 A;  1UNR A;  1P3R A;  2G35 A;  5D3W A;  1J0W A;  3SYX A;  1K5G B;  3DXC A;  1X1F A;  3MPX A;  3SO6 A;  4Z2M B;  1UNQ A;  2GCL A;  1RJ2 A;  2V76 A;  1U5F A;  4HB0 B;  4KHB B;  2RLO A;  1W1G A;  3A8P A;  2DKQ A; 
#chains in the Genus database with same CATH topology
 3NW8 A;  1BWN A;  2ROV A;  2KGX B;  4OT1 A;  2KCJ A;  3OAN A;  2EC1 A;  5DI9 B;  3CIK A;  3AU5 A;  1BTN A;  2Z14 A;  3PZD A;  4A6F B;  3F5R A;  2NZ8 B;  5IRS A;  4GMX B;  2L1C A;  1OY2 A;  4NSW A;  2KR0 A;  2MDX A;  1ISN A;  1FGZ A;  1UEF A;  3B77 A;  4GPT B;  5DH9 B;  2YRY A;  1NTY A;  2Z59 A;  2LUL A;  4DX8 A;  5D3X A;  3D8D A;  2RNR B;  4K17 A;  4XWX A;  5C5B A;  5LG4 B;  3CXB B;  2KUP A;  1DDV A;  2XQN M;  2D11 A;  3PSC A;  3GYO A;  2ROZ B;  2I1J A;  3QIJ A;  1T77 A;  1U5G A;  2Z4D A;  4HAV B;  3PVL A;  1UPQ A;  3FVC A;  4GNK B;  1XX0 A;  2K00 A;  2AEH A;  1U2B A;  1WJM A;  5L81 A;  3LJU X;  3AJ4 A;  4DBB A;  4HAT B;  3X23 A;  4ZRK A;  4GN1 A;  2YS1 A;  2YVC A;  1MKE A;  5J3T A;  2KIG A;  3HSA A;  2DA0 A;  1BAK A;  1NU2 A;  1DDW A;  2P0F A;  1XKE A;  3KZ1 A;  1Y5O A;  2QKM A;  5LON B;  4QJ5 B;  4P7I A;  2DHK A;  3DCX A;  3ODX A;  3P6A A;  1B55 A;  1EAZ A;  2N0Y A;  2YF0 A;  4ZRJ A;  3N7C A;  1P5T A;  2RVB B;  2OQB A;  4HB4 B;  5I2S A;  1DDM A;  3A58 A;  5FI0 A;  4L6E A;  4NY0 A;  3RCP A;  2R0D A;  2LKO A;  1WJ1 A;  2BCJ A;  2ZKM X;  1LB1 A;  4IAP A;  2W2X C;  1M7E A;  2QKL A;  1Y19 B;  3KSY A;  2K49 A;  1WGQ A;  5JHH A;  1U5E A;  2LOX A;  1N3H A;  3A8Q A;  1IRS A;  2HTH B;  3PVU A;  3SNH A;  2CY5 A;  5KQ1 A;  4ZRI A;  2AL6 A;  2GUM A;  1RRP B;  2H7D A;  5I2M A;  2LG1 A;  1MPH A;  3ODO A;  3QWM A;  2M14 A;  3ULC A;  5HE1 A;  2CRF A;  1FHW A;  2CY4 A;  2ELA A;  3O96 A;  2LYD A;  2D2Q A;  1AQC A;  2EMT A;  4K2O A;  1X86 A;  2ADZ A;  4WVF B;  1Z87 A;  1QQG A;  3U7D A;  3VOQ A;  1M7R A;  1LW3 A;  4GXB A;  1U29 A;  4F7H A;  5C79 A;  5KCV A;  4CHM A;  2D9V A;  1V61 A;  3PVW A;  3HIE A;  1FB8 A;  1OQN A;  2I1K A;  1TXD A;  5C6R A;  2UVM A;  2YT0 A;  4A5K A;  2IYB A;  3NWF A;  4QJ4 B;  2YS3 A;  2J0M A;  2COD A;  3ZDT A;  4WSF A;  5DHA B;  5GOW B;  1XOD A;  1KZ7 A;  3HQC A;  3NSU A;  2FJL A;  4YON A;  4CYE A;  2VSZ A;  2JP2 A;  2UZR A;  2E2X A;  2DKP A;  2DN6 A;  2MKR A;  1P6S A;  3HW2 B;  3BJI A;  4K81 A;  4IOY X;  2Q13 A;  3D8E A;  4KHO A;  4WJ7 A;  1I2H A;  2ELB A;  2HE7 A;  1WI1 A;  2X18 A;  1FOE A;  1H4R A;  3TW1 A;  2COC A;  2MFQ A;  3DXD A;  1SHC A;  3ML4 A;  1ZM0 A;  5HE3 A;  1UPR A;  1WG7 A;  4MT7 A;  3OHM B;  5JHG A;  2M38 A;  5C16 A;  3NWD A;  3NWA A;  5JLJ B;  4KAX B;  3TCA A;  1H10 A;  5FI1 A;  2GCJ A;  1X05 A;  4A6F A;  2D9X A;  3SV1 A;  1WGU A;  1QC6 A;  1FGY A;  4MY6 A;  2KUQ A;  3UZT A;  3A98 B;  4HB3 B;  3U12 A;  2YT1 A;  4KHB A;  1XD4 A;  2P8V A;  4GZU A;  2ZPY A;  3ZVR A;  2OTX A;  3P7Z A;  4GMV A;  4HSI A;  5DHF B;  2W2W A;  1ZSQ A;  2EMS A;  3U8Z A;  2DLW A;  2NMB A;  3WA0 A;  2K8E A;  3KRW A;  3SUZ A;  2DYQ A;  2IFS A;  1GG3 A;  3AU4 A;  4OSN A;  4C0A A;  2GJY A;  2D9Y A;  5DIF B;  4Z2N A;  2LOZ A;  1I7A A;  2YT2 A;  1AWE A;  2DX1 A;  2R2Y A;  1XCG A;  4F7U P;  2DX5 A;  4BBK A;  1XR0 B;  3KY9 A;  2RUK B;  1EVH A;  1MIZ B;  2Y7B A;  4KVG B;  4HAW B;  4PQ0 A;  3PEG A;  4Y94 A;  5LOP B;  4HHV A;  2D10 A;  3KRX A;  1V5U A;  2I5C A;  3MDB C;  1ZC4 B;  2DYN A;  4D0N B;  2K2U A;  1PLS A;  4MK0 A;  5M4Y B;  1V5P A;  3DXE A;  3GYP A;  2COF A;  2YS5 A;  5D3V A;  4EJN A;  4HDO A;  1GC7 A;  1EGX A;  1KZG A;  4GOU A;  3D8F A;  3TFM A;  4TKN A;  1FAO A;  1W1H A;  5HE2 A;  2RGN B;  3PP2 A;  1MAI A;  4D6W A;  1U27 A;  2FJU B;  3ULB A;  2COA A;  1U5D A;  2L2I A;  1FHX A;  1ZC3 B;  2EJ8 A;  5J3Y A;  3ODW A;  4KHA A;  1X1G A;  4DX9 0;  1DYN A;  4PNK A;  2I5F A;  5JP4 A;  3G9W A;  4QJ3 B;  1DRO A;  5C5B B;  2P0D A;  2D9W A;  4CSQ A;  4HAX B;  2DFK A;  3HK0 A;  3IVF A;  5D3Y A;  1MIX A;  3T06 A;  4HAU B;  1EF1 A;  1TJ6 A;  1ZVR A;  5HE0 A;  2MWN B;  4L1R A;  2PZ1 A;  2H7E A;  1Q67 A;  1V5M A;  2DHJ A;  2CAY A;  3FSS A;  4QXA B;  1DBH A;  1WVH A;  4B6H A;  4IFS A;  4K2P A;  4CHJ A;  2J59 M;  1MK9 B;  1NI2 A;  2K2J A;  1V89 A;  2R09 A;  2NBV A;  3TVV A;  4HAZ B;  5EFX A;  4HAY B;  4EKU A;  1KI1 B;  4EMO A;  5CLL B;  4F7G A;  2Y8F A;  1FHO A;  2YSZ A;  2Z0Q A;  2KIE A;  2Z0P A;  5D27 A;  1TQZ A;  4DIX A;  1V88 A;  1BTK A;  1MI1 A;  1GC6 A;  2DTC A;  4DXA B;  2GS0 A;  3F0W A;  2VKI A;  1E5W A;  1W1D A;  1OMW A;  2W2X D;  3QBV B;  1K5D B;  2Z0O A;  2DHI A;  1UNP A;  4H8S A;  4A6H A;  1PMS A;  3PG7 A;  4HB2 B;  2J0K A;  4YL8 A;  2RSG A;  4TYZ A;  1MK7 B;  3M1I B;  3VIA A;  1X11 A;  2J0J A;  1ZYI A;  3WYF B;  2D4Q A;  4A6K A;  2UZS A;  1PFJ A;  5J3Q A;  3FEH A;  4HDQ A;  1NTV A;  2RRF A;  3TO1 A;  2D9Z A;  2P0H A;  1SGH A;  3V5W A;  3FM8 C;  2Y8G A;  3BIN A;  1J19 A;  2VRW B;  5CLQ B;  5KQ4 A;  2N23 A;  1UNR A;  1P3R A;  2G35 A;  5D3W A;  1J0W A;  3SYX A;  1K5G B;  3DXC A;  1X1F A;  3MPX A;  3SO6 A;  4Z2M B;  1UNQ A;  2Z13 A;  2GCL A;  1RJ2 A;  2V76 A;  1U5F A;  4HB0 B;  4KHB B;  2RLO A;  1W1G A;  3A8P A;  2DKQ A; 
#chains in the Genus database with same CATH homology
 1BWN A;  2ROV A;  2KGX B;  2KCJ A;  3OAN A;  2EC1 A;  5DI9 B;  3CIK A;  3AU5 A;  1BTN A;  3PZD A;  4A6F B;  3F5R A;  2NZ8 B;  4GMX B;  2L1C A;  1OY2 A;  4NSW A;  2MDX A;  1ISN A;  1FGZ A;  1UEF A;  4GPT B;  5DH9 B;  2YRY A;  1NTY A;  2LUL A;  4DX8 A;  5D3X A;  3D8D A;  2RNR B;  4K17 A;  4XWX A;  5C5B A;  3CXB B;  2KUP A;  1DDV A;  2XQN M;  2D11 A;  3PSC A;  3GYO A;  2ROZ B;  2I1J A;  3QIJ A;  1U5G A;  4HAV B;  3PVL A;  1UPQ A;  1XX0 A;  2K00 A;  2AEH A;  1U2B A;  1WJM A;  5L81 A;  3LJU X;  3AJ4 A;  4DBB A;  4HAT B;  3X23 A;  4ZRK A;  4GN1 A;  2YS1 A;  2YVC A;  1MKE A;  5J3T A;  2DA0 A;  1BAK A;  1NU2 A;  1DDW A;  2P0F A;  1XKE A;  3KZ1 A;  1Y5O A;  2QKM A;  5LON B;  4P7I A;  2DHK A;  3ODX A;  3P6A A;  1B55 A;  1EAZ A;  2N0Y A;  2YF0 A;  4ZRJ A;  3N7C A;  1P5T A;  2RVB B;  2OQB A;  4HB4 B;  1DDM A;  5FI0 A;  4L6E A;  4NY0 A;  3RCP A;  2R0D A;  2LKO A;  1WJ1 A;  2BCJ A;  1LB1 A;  4IAP A;  2W2X C;  1M7E A;  2QKL A;  1Y19 B;  3KSY A;  1WGQ A;  5JHH A;  1U5E A;  2LOX A;  1N3H A;  3A8Q A;  1IRS A;  2HTH B;  3PVU A;  3SNH A;  2CY5 A;  5KQ1 A;  4ZRI A;  2AL6 A;  1RRP B;  2H7D A;  2LG1 A;  1MPH A;  3ODO A;  3QWM A;  2M14 A;  3ULC A;  5HE1 A;  2CRF A;  1FHW A;  2CY4 A;  2ELA A;  3O96 A;  2LYD A;  2D2Q A;  1AQC A;  2EMT A;  4K2O A;  1X86 A;  2ADZ A;  4WVF B;  1Z87 A;  1QQG A;  3U7D A;  3VOQ A;  1M7R A;  1LW3 A;  4GXB A;  1U29 A;  4F7H A;  5C79 A;  5KCV A;  4CHM A;  2D9V A;  1V61 A;  3PVW A;  1FB8 A;  1OQN A;  2I1K A;  1TXD A;  5C6R A;  2UVM A;  2YT0 A;  4A5K A;  2IYB A;  2YS3 A;  2J0M A;  2COD A;  3ZDT A;  4WSF A;  5DHA B;  5GOW B;  1XOD A;  1KZ7 A;  3HQC A;  3NSU A;  2FJL A;  4YON A;  4CYE A;  2VSZ A;  2JP2 A;  2UZR A;  2E2X A;  2DKP A;  2DN6 A;  2MKR A;  1P6S A;  3HW2 B;  3BJI A;  4K81 A;  4IOY X;  2Q13 A;  3D8E A;  4KHO A;  4WJ7 A;  1I2H A;  2ELB A;  2HE7 A;  1WI1 A;  2X18 A;  1FOE A;  1H4R A;  3TW1 A;  2COC A;  2MFQ A;  3DXD A;  1SHC A;  3ML4 A;  1ZM0 A;  5HE3 A;  1UPR A;  1WG7 A;  4MT7 A;  5JHG A;  2M38 A;  5C16 A;  5JLJ B;  4KAX B;  3TCA A;  1H10 A;  5FI1 A;  2GCJ A;  1X05 A;  4A6F A;  2D9X A;  3SV1 A;  1WGU A;  1QC6 A;  1FGY A;  4MY6 A;  3UZT A;  3A98 B;  4HB3 B;  2YT1 A;  1XD4 A;  2P8V A;  4GZU A;  2ZPY A;  3ZVR A;  2OTX A;  3P7Z A;  4GMV A;  5DHF B;  2W2W A;  1ZSQ A;  2EMS A;  3U8Z A;  2DLW A;  2NMB A;  3WA0 A;  3KRW A;  3SUZ A;  2DYQ A;  2IFS A;  1GG3 A;  3AU4 A;  4C0A A;  2GJY A;  2D9Y A;  5DIF B;  4Z2N A;  2LOZ A;  1I7A A;  1AWE A;  2DX1 A;  1XCG A;  4F7U P;  2DX5 A;  4BBK A;  1XR0 B;  3KY9 A;  2RUK B;  1EVH A;  1MIZ B;  2Y7B A;  4KVG B;  4HAW B;  4PQ0 A;  3PEG A;  4Y94 A;  5LOP B;  4HHV A;  2D10 A;  3KRX A;  1V5U A;  2I5C A;  3MDB C;  1ZC4 B;  2DYN A;  4D0N B;  2K2U A;  1PLS A;  4MK0 A;  1V5P A;  3DXE A;  3GYP A;  2COF A;  2YS5 A;  5D3V A;  4EJN A;  4HDO A;  1GC7 A;  1EGX A;  1KZG A;  3D8F A;  3TFM A;  4TKN A;  1FAO A;  1W1H A;  5HE2 A;  2RGN B;  3PP2 A;  1MAI A;  1U27 A;  3ULB A;  2COA A;  1U5D A;  2L2I A;  1FHX A;  1ZC3 B;  2EJ8 A;  5J3Y A;  3ODW A;  4KHA A;  1X1G A;  4DX9 0;  1DYN A;  4PNK A;  2I5F A;  5JP4 A;  3G9W A;  1DRO A;  5C5B B;  2P0D A;  2D9W A;  4HAX B;  2DFK A;  3HK0 A;  3IVF A;  5D3Y A;  1MIX A;  3T06 A;  4HAU B;  1EF1 A;  1TJ6 A;  1ZVR A;  5HE0 A;  2MWN B;  2PZ1 A;  2H7E A;  1Q67 A;  1V5M A;  2DHJ A;  2CAY A;  3FSS A;  1DBH A;  1WVH A;  4B6H A;  4IFS A;  4K2P A;  4CHJ A;  2J59 M;  1MK9 B;  1NI2 A;  2K2J A;  1V89 A;  2R09 A;  3TVV A;  4HAZ B;  5EFX A;  4HAY B;  4EKU A;  1KI1 B;  4EMO A;  5CLL B;  4F7G A;  2Y8F A;  1FHO A;  2YSZ A;  2Z0Q A;  2Z0P A;  5D27 A;  1TQZ A;  1V88 A;  1BTK A;  1GC6 A;  2DTC A;  4DXA B;  2GS0 A;  3F0W A;  2VKI A;  1E5W A;  1W1D A;  1OMW A;  2W2X D;  3QBV B;  1K5D B;  2Z0O A;  2DHI A;  1UNP A;  4H8S A;  4A6H A;  1PMS A;  3PG7 A;  4HB2 B;  2J0K A;  4YL8 A;  2RSG A;  4TYZ A;  1MK7 B;  3M1I B;  3VIA A;  1X11 A;  2J0J A;  3WYF B;  2D4Q A;  4A6K A;  2UZS A;  1PFJ A;  5J3Q A;  3FEH A;  4HDQ A;  1NTV A;  3TO1 A;  2D9Z A;  2P0H A;  1SGH A;  3V5W A;  3FM8 C;  2Y8G A;  3BIN A;  1J19 A;  2VRW B;  5CLQ B;  5KQ4 A;  2N23 A;  1UNR A;  1P3R A;  2G35 A;  5D3W A;  1J0W A;  3SYX A;  1K5G B;  3DXC A;  1X1F A;  3MPX A;  3SO6 A;  4Z2M B;  1UNQ A;  2GCL A;  1RJ2 A;  2V76 A;  1U5F A;  4HB0 B;  4KHB B;  2RLO A;  1W1G A;  3A8P A;  2DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...