5LONB

Structure of /k. lactis/ dcp1-dcp2 decapping complex.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
174
Chain Sequence
STETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KLLA0F23980p
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
total genus 36
structure length 174
sequence length 185
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lonB01
5JHHA 4IOYX 4GZUA 1J0WA 4K2PA 2G35A 2RSGA 3O96A 4D0NB 5DIFB 2DX5A 2IFSA 2CRFA 5C16A 1B55A 3AU5A 5CLQB 1NI2A 1WGUA 2YVCA 2VSZA 3ULCA 1WI1A 4IAPA 4TKNA 1X1GA 1V89A 1WG7A 1P6SA 3A8QA 1UNPA 1P5TA 2DTCA 2GCLA 4PNKA 3G9WA 2K2UA 3TFMA 4GMVA 2COCA 4F7GA 2GCJA 2Q13A 4GXBA 2M14A 1XR0B 4EJNA 2J0MA 5JHGA 1FHWA 3QBVB 2EMTA 5KQ4A 2MFQA 3SO6A 3PZDA 3PVLA 4H8SA 1TQZA 4K2OA 4A6HA 2Z0PA 2I1JA 2N0YA 3F5RA 4KAXB 1Z87A 4DX8A 2LG1A 1XKEA 1X86A 1DROA 3SYXA 1KZGA 2J59M 3BJIA 5HE3A 3VIAA 5C5BA 2ELBA 5C5BB 2PZ1A 2KGXB 1N3HA 3FM8C 1ZC3B 1V5PA 1FHXA 1AWEA 1PMSA 2MWNB 3D8EA 4EMOA 2UZSA 3ODWA 1OY2A 2EJ8A 3WYFB 2UZRA 2N23A 1BTKA 3IVFA 2ADZA 1DDMA 1V88A 4DXAB 2MKRA 1ISNA 1UPQA 2DYNA 1GG3A 2NMBA 4XWXA 1ZM0A 2RGNB 3U8ZA 4HB4B 4HAZB 1LB1A 1FB8A 3QWMA 4HB0B 5D3XA 2W2XD 2DKQA 4MT7A 4KHAA 1M7RA 1U29A 2P8VA 4HB3B 3KZ1A 2QKMA 2OQBA 5DHFB 1U5EA 1X1FA 2VKIA 3MPXA 1EAZA 3ML4A 1FGYA 2COAA 2W2WA 2DFKA 2DLWA 3KSYA 3DXDA 3A98B 4A5KA 5FI0A 2P0FA 3KRXA 3ODOA 4Y94A 1BTNA 1M7EA 3RCPA 3FEHA 1K5DB 4K17A 2BCJA 2D9WA 2D10A 4MY6A 5LONB 1TJ6A 2P0HA 2K2JA 3PG7A 2D9VA 1E5WA 3P7ZA 2LOXA 1SGHA 4A6FB 1FHOA 1Y19B 2D11A 5EFXA 3CIKA 3GYOA 3A8PA 4YONA 3BINA 2AL6A 2Y8GA 4ZRJA 2D9YA 4WJ7A 5FI1A 1H10A 1KZ7A 4HDOA 2D2QA 4F7UP 1K5GB 3X23A 1QC6A 3LJUX 2RUKB 1H4RA 2LOZA 4GN1A 1V61A 4KHBB 1UEFA 1LW3A 4Z2NA 2IYBA 1UPRA 2VRWB 1U5GA 1AQCA 1MK9B 1NTVA 3HK0A 1RJ2A 1V5UA 1Y5OA 3ZDTA 4L6EA 1WVHA 3D8FA 3QIJA 1FAOA 1I7AA 2CY4A 1XODA 4IFSA 2DN6A 2UVMA 2YS3A 1IRSA 2XQNM 4CHMA 1W1GA 2YF0A 2D9XA 1UNQA 2Y8FA 3DXEA 4GMXB 1NU2A 3UZTA 4DBBA 1FOEA 2AEHA 2FJLA 3OANA 1MIXA 2Z0OA 2RLOA 1V5MA 2KUPA 3PP2A 2EMSA 3P6AA 2I5FA 2OTXA 1NTYA 3HW2B 4EKUA 5LOPB 2ROVA 1WJ1A 4GPTB 3AJ4A 5CLLB 1EF1A 1W1DA 2ROZB 5HE0A 2J0KA 1X05A 2NZ8B 3TW1A 4BBKA 1P3RA 4PQ0A 4DX90 2ELAA 4CYEA 2W2XC 3N7CA 4HAUB 1U27A 3TCAA 2YS5A 3KRWA 5KCVA 5D3YA 1U5DA 1ZC4B 1BAKA 4A6FA 2EC1A 3M1IB 3PSCA 2JP2A 1MK7B 2MDXA 4KVGB 2H7DA 3DXCA 1DYNA 5J3YA 1I2HA 2YS1A 2KCJA 1GC6A 3ZVRA 4P7IA 1MPHA 1RRPB 3ULBA 2DHKA 3F0WA 5D3VA 4A6KA 1Q67A 2DX1A 1WJMA 1FGZA 4CHJA 2L2IA 4K81A 1OMWA 1W1HA 1OQNA 3WA0A 4MK0A 2CAYA 4HB2B 1BWNA 2K00A 1ZVRA 2P0DA 1DBHA 5GOWB 4C0AA 2LKOA 2GJYA 5J3TA 2H7EA 2RVBB 3PVUA 2YSZA 4NY0A 4ZRKA 3HQCA 2YT0A 2DKPA 5JP4A 3GYPA 2M38A 1SHCA 5HE2A 2DHIA 5C79A 2L1CA 2HE7A 2ZPYA 4B6HA 3KY9A 3NSUA 4HAXB 4Z2MB 1MAIA 2Y7BA 5C6RA 1U2BA 1UNRA 5J3QA 2R09A 3TVVA 5HE1A 4TYZA 4HAVB 2D4QA 1EVHA 2D9ZA 3AU4A 1XCGA 1X11A 2J0JA 4YL8A 4KHOA 3SNHA 1GC7A 5DHAB 5JLJB 2LYDA 2QKLA 3ODXA 2LULA 1MKEA 5L81A 5DH9B 1PFJA 4WSFA 1DDVA 1XX0A 5DI9B 1DDWA 2DYQA 2HTHB 1ZSQA 1MIZB 1KI1B 2I5CA 4HDQA 4NSWA 4WVFB 3FSSA 2E2XA 3T06A 2CY5A 4F7HA 2GS0A 2X18A 1TXDA 3SUZA 3TO1A 3V5WA 1WGQA 3VOQA 5KQ1A 2DA0A 2I1KA 4HHVA 2R0DA 3SV1A 1J19A 3CXBB 2V76A 5D27A 2RNRB 1EGXA 3D8DA 1XD4A 4ZRIA 1U5FA 4HATB 2Z0QA 2YRYA 2CODA 3MDBC 1QQGA 2YT1A 2DHJA 2COFA 3PVWA 5D3WA 3U7DA 1PLSA 4HAWB 4HAYB 3PEGA
chains in the Genus database with same CATH superfamily
5JHHA 4IOYX 4GZUA 1J0WA 4K2PA 3NWDA 4OSNA 2G35A 2RSGA 3O96A 2KUQA 4D0NB 5DIFB 2DX5A 2IFSA 2CRFA 2RRFA 5C16A 4QJ3B 1B55A 3AU5A 5CLQB 1NI2A 1WGUA 2YVCA 2VSZA 3ULCA 1WI1A 4IAPA 3U12A 4TKNA 1X1GA 1V89A 1WG7A 1P6SA 2Z4DA 3A8QA 1UNPA 1P5TA 2DTCA 2GCLA 4PNKA 3G9WA 2K2UA 3TFMA 4GMVA 2COCA 4F7GA 2GCJA 2Q13A 3NWAA 4GXBA 2M14A 1XR0B 4EJNA 2J0MA 5JHGA 1FHWA 3QBVB 2EMTA 5KQ4A 2MFQA 3SO6A 3PZDA 3PVLA 4H8SA 1TQZA 4K2OA 4A6HA 2Z0PA 2I1JA 2N0YA 3F5RA 4KAXB 1Z87A 4QXAB 4DX8A 2LG1A 1XKEA 1X86A 1DROA 3SYXA 1KZGA 2J59M 3BJIA 5HE3A 3VIAA 5C5BA 2ELBA 5C5BB 2PZ1A 2KGXB 1N3HA 3FM8C 1ZC3B 1V5PA 1FHXA 1AWEA 1PMSA 2MWNB 3D8EA 4EMOA 2UZSA 3ODWA 1OY2A 2EJ8A 3WYFB 2UZRA 2N23A 1BTKA 3IVFA 2ADZA 1DDMA 1V88A 4DXAB 2MKRA 1ISNA 1UPQA 2DYNA 1GG3A 2NMBA 4XWXA 1ZM0A 2RGNB 3U8ZA 4HB4B 4HAZB 1LB1A 1FB8A 3QWMA 4HB0B 5D3XA 2W2XD 2DKQA 4MT7A 4KHAA 1M7RA 1U29A 2P8VA 2KR0A 4HB3B 3KZ1A 2QKMA 2OQBA 5DHFB 1U5EA 1X1FA 2VKIA 3MPXA 1EAZA 3ML4A 1FGYA 2COAA 4HSIA 2W2WA 2DFKA 2DLWA 3KSYA 3DXDA 3A98B 4A5KA 5FI0A 2P0FA 3HIEA 3KRXA 3ODOA 4Y94A 1BTNA 1M7EA 3RCPA 3FEHA 1K5DB 1T77A 4K17A 2BCJA 2D9WA 2D10A 4MY6A 5LONB 1TJ6A 2P0HA 2K2JA 3PG7A 2D9VA 1E5WA 3P7ZA 2LOXA 1SGHA 4A6FB 1FHOA 1Y19B 2D11A 5EFXA 3CIKA 3GYOA 3A8PA 4YONA 3BINA 2AL6A 2Y8GA 4ZRJA 5M4YB 2D9YA 4WJ7A 5FI1A 1H10A 1KZ7A 4HDOA 2D2QA 4F7UP 1K5GB 3FVCA 1QC6A 3X23A 3LJUX 2RUKB 1H4RA 2ZKMX 2LOZA 4GN1A 4KHBA 1V61A 4KHBB 1UEFA 1LW3A 2Z59A 4Z2NA 2IYBA 1UPRA 2VRWB 3DCXA 1U5GA 1AQCA 1MK9B 5I2SA 1NTVA 3HK0A 1RJ2A 1V5UA 1Y5OA 3ZDTA 4L6EA 1WVHA 3D8FA 3QIJA 1FAOA 1I7AA 2CY4A 1XODA 4IFSA 2DN6A 2UVMA 2YS3A 1IRSA 2XQNM 4CHMA 1W1GA 2YF0A 2D9XA 1UNQA 2KIEA 2Y8FA 3DXEA 4GMXB 1NU2A 3UZTA 4DBBA 1FOEA 2AEHA 2FJLA 3OANA 1MIXA 2Z0OA 2RLOA 1V5MA 2KUPA 3PP2A 2EMSA 3P6AA 2I5FA 2OTXA 1NTYA 3HW2B 4EKUA 4GNKB 5LOPB 2ROVA 1WJ1A 4GPTB 3AJ4A 5CLLB 4OT1A 1EF1A 1W1DA 2ROZB 5HE0A 2J0KA 5IRSA 1X05A 2NZ8B 3TW1A 4BBKA 1P3RA 3NW8A 4PQ0A 4DX90 2ELAA 4CYEA 2W2XC 3N7CA 4HAUB 1U27A 3TCAA 2YS5A 3KRWA 5KCVA 3OHMB 5D3YA 1U5DA 1ZC4B 1BAKA 4A6FA 2EC1A 3HSAA 3M1IB 3PSCA 2JP2A 1MK7B 2MDXA 2NBVA 4KVGB 2H7DA 3DXCA 1DYNA 5J3YA 1I2HA 2YS1A 2KCJA 1GC6A 3B77A 3ZVRA 4P7IA 4GOUA 1MPHA 1RRPB 3ULBA 2DHKA 3F0WA 5D3VA 4A6KA 1Q67A 2DX1A 1WJMA 2KIGA 1FGZA 4CHJA 5I2MA 2L2IA 4K81A 1OMWA 1W1HA 1OQNA 3WA0A 4DIXA 4MK0A 2CAYA 4HB2B 1BWNA 2K00A 1ZVRA 1MI1A 2P0DA 1DBHA 5GOWB 4C0AA 2LKOA 2GJYA 5J3TA 2H7EA 2RVBB 4D6WA 3PVUA 2YSZA 4NY0A 4ZRKA 3HQCA 2YT0A 1ZYIA 2DKPA 3GYPA 5JP4A 2M38A 4QJ5B 1SHCA 5HE2A 2DHIA 5C79A 2L1CA 2HE7A 2ZPYA 4B6HA 2R2YA 3KY9A 3NSUA 4HAXB 4Z2MB 1MAIA 2GUMA 2Y7BA 5C6RA 1U2BA 1UNRA 5J3QA 2R09A 2K8EA 3TVVA 5HE1A 4TYZA 4HAVB 2D4QA 1EVHA 2D9ZA 3AU4A 1XCGA 1X11A 2J0JA 4YL8A 4KHOA 3SNHA 1GC7A 5DHAB 5JLJB 2LYDA 2QKLA 3ODXA 2LULA 1MKEA 5L81A 5DH9B 1PFJA 4WSFA 1DDVA 1XX0A 5DI9B 1DDWA 2DYQA 2HTHB 1ZSQA 1MIZB 1KI1B 2I5CA 4HDQA 4NSWA 4WVFB 3FSSA 4QJ4B 2E2XA 2K49A 2CY5A 3T06A 4F7HA 2GS0A 2X18A 1TXDA 3SUZA 3TO1A 3V5WA 1WGQA 3VOQA 5KQ1A 2DA0A 2I1KA 4HHVA 2R0DA 3SV1A 4CSQA 2YT2A 1J19A 3CXBB 2V76A 5D27A 2RNRB 2Z13A 1EGXA 3D8DA 1XD4A 3NWFA 4ZRIA 1U5FA 5LG4B 4HATB 2FJUB 2Z0QA 2YRYA 4L1RA 2CODA 3MDBC 2Z14A 1QQGA 2YT1A 3A58A 2DHJA 2COFA 3PVWA 5D3WA 3U7DA 1PLSA 4HAWB 4HAYB 3PEGA
chains in the Genus database with same CATH topology
5JHHA 4IOYX 4GZUA 1J0WA 4K2PA 2G35A 2RSGA 3O96A 4D0NB 5DIFB 2DX5A 2IFSA 2CRFA 5C16A 1B55A 3AU5A 5CLQB 1NI2A 1WGUA 2YVCA 2VSZA 3ULCA 1WI1A 4IAPA 4TKNA 1X1GA 1V89A 1WG7A 1P6SA 3A8QA 1UNPA 1P5TA 2DTCA 2GCLA 4PNKA 3G9WA 2K2UA 3TFMA 4GMVA 2COCA 4F7GA 2GCJA 2Q13A 4GXBA 2M14A 1XR0B 4EJNA 2J0MA 5JHGA 1FHWA 3QBVB 2EMTA 5KQ4A 2MFQA 3SO6A 3PZDA 3PVLA 4H8SA 1TQZA 4K2OA 4A6HA 2Z0PA 2I1JA 2N0YA 3F5RA 4KAXB 1Z87A 4DX8A 2LG1A 1XKEA 1X86A 1DROA 3SYXA 1KZGA 2J59M 3BJIA 5HE3A 3VIAA 5C5BA 2ELBA 5C5BB 2PZ1A 2KGXB 1N3HA 3FM8C 1ZC3B 1V5PA 1FHXA 1AWEA 1PMSA 2MWNB 3D8EA 4EMOA 2UZSA 3ODWA 1OY2A 2EJ8A 3WYFB 2UZRA 2N23A 1BTKA 3IVFA 2ADZA 1DDMA 1V88A 4DXAB 2MKRA 1ISNA 1UPQA 2DYNA 1GG3A 2NMBA 4XWXA 1ZM0A 2RGNB 3U8ZA 4HB4B 4HAZB 1LB1A 1FB8A 3QWMA 4HB0B 5D3XA 2W2XD 2DKQA 4MT7A 4KHAA 1M7RA 1U29A 2P8VA 4HB3B 3KZ1A 2QKMA 2OQBA 5DHFB 1U5EA 1X1FA 2VKIA 3MPXA 1EAZA 3ML4A 1FGYA 2COAA 2W2WA 2DFKA 2DLWA 3KSYA 3DXDA 3A98B 4A5KA 5FI0A 2P0FA 3KRXA 3ODOA 4Y94A 1BTNA 1M7EA 3RCPA 3FEHA 1K5DB 4K17A 2BCJA 2D9WA 2D10A 4MY6A 5LONB 1TJ6A 2P0HA 2K2JA 3PG7A 2D9VA 1E5WA 3P7ZA 2LOXA 1SGHA 4A6FB 1FHOA 1Y19B 2D11A 5EFXA 3CIKA 3GYOA 3A8PA 4YONA 3BINA 2AL6A 2Y8GA 4ZRJA 2D9YA 4WJ7A 5FI1A 1H10A 1KZ7A 4HDOA 2D2QA 4F7UP 1K5GB 3X23A 1QC6A 3LJUX 2RUKB 1H4RA 2LOZA 4GN1A 1V61A 4KHBB 1UEFA 1LW3A 4Z2NA 2IYBA 1UPRA 2VRWB 1U5GA 1AQCA 1MK9B 1NTVA 3HK0A 1RJ2A 1V5UA 1Y5OA 3ZDTA 4L6EA 1WVHA 3D8FA 3QIJA 1FAOA 1I7AA 2CY4A 1XODA 4IFSA 2DN6A 2UVMA 2YS3A 1IRSA 2XQNM 4CHMA 1W1GA 2YF0A 2D9XA 1UNQA 2Y8FA 3DXEA 4GMXB 1NU2A 3UZTA 4DBBA 1FOEA 2AEHA 2FJLA 3OANA 1MIXA 2Z0OA 2RLOA 1V5MA 2KUPA 3PP2A 2EMSA 3P6AA 2I5FA 2OTXA 1NTYA 3HW2B 4EKUA 5LOPB 2ROVA 1WJ1A 4GPTB 3AJ4A 5CLLB 1EF1A 1W1DA 2ROZB 5HE0A 2J0KA 1X05A 2NZ8B 3TW1A 4BBKA 1P3RA 4PQ0A 4DX90 2ELAA 4CYEA 2W2XC 3N7CA 4HAUB 1U27A 3TCAA 2YS5A 3KRWA 5KCVA 5D3YA 1U5DA 1ZC4B 1BAKA 4A6FA 2EC1A 3M1IB 3PSCA 2JP2A 1MK7B 2MDXA 4KVGB 2H7DA 3DXCA 1DYNA 5J3YA 1I2HA 2YS1A 2KCJA 1GC6A 3ZVRA 4P7IA 1MPHA 1RRPB 3ULBA 2DHKA 3F0WA 5D3VA 4A6KA 1Q67A 2DX1A 1WJMA 1FGZA 4CHJA 2L2IA 4K81A 1OMWA 1W1HA 1OQNA 3WA0A 4MK0A 2CAYA 4HB2B 1BWNA 2K00A 1ZVRA 2P0DA 1DBHA 5GOWB 4C0AA 2LKOA 2GJYA 5J3TA 2H7EA 2RVBB 3PVUA 2YSZA 4NY0A 4ZRKA 3HQCA 2YT0A 2DKPA 5JP4A 3GYPA 2M38A 1SHCA 5HE2A 2DHIA 5C79A 2L1CA 2HE7A 2ZPYA 4B6HA 3KY9A 3NSUA 4HAXB 4Z2MB 1MAIA 2Y7BA 5C6RA 1U2BA 1UNRA 5J3QA 2R09A 3TVVA 5HE1A 4TYZA 4HAVB 2D4QA 1EVHA 2D9ZA 3AU4A 1XCGA 1X11A 2J0JA 4YL8A 4KHOA 3SNHA 1GC7A 5DHAB 5JLJB 2LYDA 2QKLA 3ODXA 2LULA 1MKEA 5L81A 5DH9B 1PFJA 4WSFA 1DDVA 1XX0A 5DI9B 1DDWA 2DYQA 2HTHB 1ZSQA 1MIZB 1KI1B 2I5CA 4HDQA 4NSWA 4WVFB 3FSSA 2E2XA 3T06A 2CY5A 4F7HA 2GS0A 2X18A 1TXDA 3SUZA 3TO1A 3V5WA 1WGQA 3VOQA 5KQ1A 2DA0A 2I1KA 4HHVA 2R0DA 3SV1A 1J19A 3CXBB 2V76A 5D27A 2RNRB 1EGXA 3D8DA 1XD4A 4ZRIA 1U5FA 4HATB 2Z0QA 2YRYA 2CODA 3MDBC 1QQGA 2YT1A 2DHJA 2COFA 3PVWA 5D3WA 3U7DA 1PLSA 4HAWB 4HAYB 3PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHH A;  4IOY X;  4GZU A;  1J0W A;  4K2P A;  2G35 A;  2RSG A;  3O96 A;  4D0N B;  5DIF B;  2DX5 A;  2IFS A;  2CRF A;  5C16 A;  1B55 A;  3AU5 A;  5CLQ B;  1NI2 A;  1WGU A;  2YVC A;  2VSZ A;  3ULC A;  1WI1 A;  4IAP A;  4TKN A;  1X1G A;  1V89 A;  1WG7 A;  1P6S A;  3A8Q A;  1UNP A;  1P5T A;  2DTC A;  2GCL A;  4PNK A;  3G9W A;  2K2U A;  3TFM A;  4GMV A;  2COC A;  4F7G A;  2GCJ A;  2Q13 A;  4GXB A;  2M14 A;  1XR0 B;  4EJN A;  2J0M A;  5JHG A;  1FHW A;  3QBV B;  2EMT A;  5KQ4 A;  2MFQ A;  3SO6 A;  3PZD A;  3PVL A;  4H8S A;  1TQZ A;  4K2O A;  4A6H A;  2Z0P A;  2I1J A;  2N0Y A;  3F5R A;  4KAX B;  1Z87 A;  4DX8 A;  2LG1 A;  1XKE A;  1X86 A;  1DRO A;  3SYX A;  1KZG A;  2J59 M;  3BJI A;  5HE3 A;  3VIA A;  5C5B A;  2ELB A;  5C5B B;  2PZ1 A;  2KGX B;  1N3H A;  3FM8 C;  1ZC3 B;  1V5P A;  1FHX A;  1AWE A;  1PMS A;  2MWN B;  3D8E A;  4EMO A;  2UZS A;  3ODW A;  1OY2 A;  2EJ8 A;  3WYF B;  2UZR A;  2N23 A;  1BTK A;  3IVF A;  2ADZ A;  1DDM A;  1V88 A;  4DXA B;  2MKR A;  1ISN A;  1UPQ A;  2DYN A;  1GG3 A;  2NMB A;  4XWX A;  1ZM0 A;  2RGN B;  3U8Z A;  4HB4 B;  4HAZ B;  1LB1 A;  1FB8 A;  3QWM A;  4HB0 B;  5D3X A;  2W2X D;  2DKQ A;  4MT7 A;  4KHA A;  1M7R A;  1U29 A;  2P8V A;  4HB3 B;  3KZ1 A;  2QKM A;  2OQB A;  5DHF B;  1U5E A;  1X1F A;  2VKI A;  3MPX A;  1EAZ A;  3ML4 A;  1FGY A;  2COA A;  2W2W A;  2DFK A;  2DLW A;  3KSY A;  3DXD A;  3A98 B;  4A5K A;  5FI0 A;  2P0F A;  3KRX A;  3ODO A;  4Y94 A;  1BTN A;  1M7E A;  3RCP A;  3FEH A;  1K5D B;  4K17 A;  2BCJ A;  2D9W A;  2D10 A;  4MY6 A;  5LON B;  1TJ6 A;  2P0H A;  2K2J A;  3PG7 A;  2D9V A;  1E5W A;  3P7Z A;  2LOX A;  1SGH A;  4A6F B;  1FHO A;  1Y19 B;  2D11 A;  5EFX A;  3CIK A;  3GYO A;  3A8P A;  4YON A;  3BIN A;  2AL6 A;  2Y8G A;  4ZRJ A;  2D9Y A;  4WJ7 A;  5FI1 A;  1H10 A;  1KZ7 A;  4HDO A;  2D2Q A;  4F7U P;  1K5G B;  3X23 A;  1QC6 A;  3LJU X;  2RUK B;  1H4R A;  2LOZ A;  4GN1 A;  1V61 A;  4KHB B;  1UEF A;  1LW3 A;  4Z2N A;  2IYB A;  1UPR A;  2VRW B;  1U5G A;  1AQC A;  1MK9 B;  1NTV A;  3HK0 A;  1RJ2 A;  1V5U A;  1Y5O A;  3ZDT A;  4L6E A;  1WVH A;  3D8F A;  3QIJ A;  1FAO A;  1I7A A;  2CY4 A;  1XOD A;  4IFS A;  2DN6 A;  2UVM A;  2YS3 A;  1IRS A;  2XQN M;  4CHM A;  1W1G A;  2YF0 A;  2D9X A;  1UNQ A;  2Y8F A;  3DXE A;  4GMX B;  1NU2 A;  3UZT A;  4DBB A;  1FOE A;  2AEH A;  2FJL A;  3OAN A;  1MIX A;  2Z0O A;  2RLO A;  1V5M A;  2KUP A;  3PP2 A;  2EMS A;  3P6A A;  2I5F A;  2OTX A;  1NTY A;  3HW2 B;  4EKU A;  5LOP B;  2ROV A;  1WJ1 A;  4GPT B;  3AJ4 A;  5CLL B;  1EF1 A;  1W1D A;  2ROZ B;  5HE0 A;  2J0K A;  1X05 A;  2NZ8 B;  3TW1 A;  4BBK A;  1P3R A;  4PQ0 A;  4DX9 0;  2ELA A;  4CYE A;  2W2X C;  3N7C A;  4HAU B;  1U27 A;  3TCA A;  2YS5 A;  3KRW A;  5KCV A;  5D3Y A;  1U5D A;  1ZC4 B;  1BAK A;  4A6F A;  2EC1 A;  3M1I B;  3PSC A;  2JP2 A;  1MK7 B;  2MDX A;  4KVG B;  2H7D A;  3DXC A;  1DYN A;  5J3Y A;  1I2H A;  2YS1 A;  2KCJ A;  1GC6 A;  3ZVR A;  4P7I A;  1MPH A;  1RRP B;  3ULB A;  2DHK A;  3F0W A;  5D3V A;  4A6K A;  1Q67 A;  2DX1 A;  1WJM A;  1FGZ A;  4CHJ A;  2L2I A;  4K81 A;  1OMW A;  1W1H A;  1OQN A;  3WA0 A;  4MK0 A;  2CAY A;  4HB2 B;  1BWN A;  2K00 A;  1ZVR A;  2P0D A;  1DBH A;  5GOW B;  4C0A A;  2LKO A;  2GJY A;  5J3T A;  2H7E A;  2RVB B;  3PVU A;  2YSZ A;  4NY0 A;  4ZRK A;  3HQC A;  2YT0 A;  2DKP A;  5JP4 A;  3GYP A;  2M38 A;  1SHC A;  5HE2 A;  2DHI A;  5C79 A;  2L1C A;  2HE7 A;  2ZPY A;  4B6H A;  3KY9 A;  3NSU A;  4HAX B;  4Z2M B;  1MAI A;  2Y7B A;  5C6R A;  1U2B A;  1UNR A;  5J3Q A;  2R09 A;  3TVV A;  5HE1 A;  4TYZ A;  4HAV B;  2D4Q A;  1EVH A;  2D9Z A;  3AU4 A;  1XCG A;  1X11 A;  2J0J A;  4YL8 A;  4KHO A;  3SNH A;  1GC7 A;  5DHA B;  5JLJ B;  2LYD A;  2QKL A;  3ODX A;  2LUL A;  1MKE A;  5L81 A;  5DH9 B;  1PFJ A;  4WSF A;  1DDV A;  1XX0 A;  5DI9 B;  1DDW A;  2DYQ A;  2HTH B;  1ZSQ A;  1MIZ B;  1KI1 B;  2I5C A;  4HDQ A;  4NSW A;  4WVF B;  3FSS A;  2E2X A;  3T06 A;  2CY5 A;  4F7H A;  2GS0 A;  2X18 A;  1TXD A;  3SUZ A;  3TO1 A;  3V5W A;  1WGQ A;  3VOQ A;  5KQ1 A;  2DA0 A;  2I1K A;  4HHV A;  2R0D A;  3SV1 A;  1J19 A;  3CXB B;  2V76 A;  5D27 A;  2RNR B;  1EGX A;  3D8D A;  1XD4 A;  4ZRI A;  1U5F A;  4HAT B;  2Z0Q A;  2YRY A;  2COD A;  3MDB C;  1QQG A;  2YT1 A;  2DHJ A;  2COF A;  3PVW A;  5D3W A;  3U7D A;  1PLS A;  4HAW B;  4HAY B;  3PEG A; 
#chains in the Genus database with same CATH topology
 5JHH A;  4IOY X;  4GZU A;  1J0W A;  4K2P A;  3NWD A;  4OSN A;  2G35 A;  2RSG A;  3O96 A;  2KUQ A;  4D0N B;  5DIF B;  2DX5 A;  2IFS A;  2CRF A;  2RRF A;  5C16 A;  4QJ3 B;  1B55 A;  3AU5 A;  5CLQ B;  1NI2 A;  1WGU A;  2YVC A;  2VSZ A;  3ULC A;  1WI1 A;  4IAP A;  3U12 A;  4TKN A;  1X1G A;  1V89 A;  1WG7 A;  1P6S A;  2Z4D A;  3A8Q A;  1UNP A;  1P5T A;  2DTC A;  2GCL A;  4PNK A;  3G9W A;  2K2U A;  3TFM A;  4GMV A;  2COC A;  4F7G A;  2GCJ A;  2Q13 A;  3NWA A;  4GXB A;  2M14 A;  1XR0 B;  4EJN A;  2J0M A;  5JHG A;  1FHW A;  3QBV B;  2EMT A;  5KQ4 A;  2MFQ A;  3SO6 A;  3PZD A;  3PVL A;  4H8S A;  1TQZ A;  4K2O A;  4A6H A;  2Z0P A;  2I1J A;  2N0Y A;  3F5R A;  4KAX B;  1Z87 A;  4QXA B;  4DX8 A;  2LG1 A;  1XKE A;  1X86 A;  1DRO A;  3SYX A;  1KZG A;  2J59 M;  3BJI A;  5HE3 A;  3VIA A;  5C5B A;  2ELB A;  5C5B B;  2PZ1 A;  2KGX B;  1N3H A;  3FM8 C;  1ZC3 B;  1V5P A;  1FHX A;  1AWE A;  1PMS A;  2MWN B;  3D8E A;  4EMO A;  2UZS A;  3ODW A;  1OY2 A;  2EJ8 A;  3WYF B;  2UZR A;  2N23 A;  1BTK A;  3IVF A;  2ADZ A;  1DDM A;  1V88 A;  4DXA B;  2MKR A;  1ISN A;  1UPQ A;  2DYN A;  1GG3 A;  2NMB A;  4XWX A;  1ZM0 A;  2RGN B;  3U8Z A;  4HB4 B;  4HAZ B;  1LB1 A;  1FB8 A;  3QWM A;  4HB0 B;  5D3X A;  2W2X D;  2DKQ A;  4MT7 A;  4KHA A;  1M7R A;  1U29 A;  2P8V A;  2KR0 A;  4HB3 B;  3KZ1 A;  2QKM A;  2OQB A;  5DHF B;  1U5E A;  1X1F A;  2VKI A;  3MPX A;  1EAZ A;  3ML4 A;  1FGY A;  2COA A;  4HSI A;  2W2W A;  2DFK A;  2DLW A;  3KSY A;  3DXD A;  3A98 B;  4A5K A;  5FI0 A;  2P0F A;  3HIE A;  3KRX A;  3ODO A;  4Y94 A;  1BTN A;  1M7E A;  3RCP A;  3FEH A;  1K5D B;  1T77 A;  4K17 A;  2BCJ A;  2D9W A;  2D10 A;  4MY6 A;  5LON B;  1TJ6 A;  2P0H A;  2K2J A;  3PG7 A;  2D9V A;  1E5W A;  3P7Z A;  2LOX A;  1SGH A;  4A6F B;  1FHO A;  1Y19 B;  2D11 A;  5EFX A;  3CIK A;  3GYO A;  3A8P A;  4YON A;  3BIN A;  2AL6 A;  2Y8G A;  4ZRJ A;  5M4Y B;  2D9Y A;  4WJ7 A;  5FI1 A;  1H10 A;  1KZ7 A;  4HDO A;  2D2Q A;  4F7U P;  1K5G B;  3FVC A;  1QC6 A;  3X23 A;  3LJU X;  2RUK B;  1H4R A;  2ZKM X;  2LOZ A;  4GN1 A;  4KHB A;  1V61 A;  4KHB B;  1UEF A;  1LW3 A;  2Z59 A;  4Z2N A;  2IYB A;  1UPR A;  2VRW B;  3DCX A;  1U5G A;  1AQC A;  1MK9 B;  5I2S A;  1NTV A;  3HK0 A;  1RJ2 A;  1V5U A;  1Y5O A;  3ZDT A;  4L6E A;  1WVH A;  3D8F A;  3QIJ A;  1FAO A;  1I7A A;  2CY4 A;  1XOD A;  4IFS A;  2DN6 A;  2UVM A;  2YS3 A;  1IRS A;  2XQN M;  4CHM A;  1W1G A;  2YF0 A;  2D9X A;  1UNQ A;  2KIE A;  2Y8F A;  3DXE A;  4GMX B;  1NU2 A;  3UZT A;  4DBB A;  1FOE A;  2AEH A;  2FJL A;  3OAN A;  1MIX A;  2Z0O A;  2RLO A;  1V5M A;  2KUP A;  3PP2 A;  2EMS A;  3P6A A;  2I5F A;  2OTX A;  1NTY A;  3HW2 B;  4EKU A;  4GNK B;  5LOP B;  2ROV A;  1WJ1 A;  4GPT B;  3AJ4 A;  5CLL B;  4OT1 A;  1EF1 A;  1W1D A;  2ROZ B;  5HE0 A;  2J0K A;  5IRS A;  1X05 A;  2NZ8 B;  3TW1 A;  4BBK A;  1P3R A;  3NW8 A;  4PQ0 A;  4DX9 0;  2ELA A;  4CYE A;  2W2X C;  3N7C A;  4HAU B;  1U27 A;  3TCA A;  2YS5 A;  3KRW A;  5KCV A;  3OHM B;  5D3Y A;  1U5D A;  1ZC4 B;  1BAK A;  4A6F A;  2EC1 A;  3HSA A;  3M1I B;  3PSC A;  2JP2 A;  1MK7 B;  2MDX A;  2NBV A;  4KVG B;  2H7D A;  3DXC A;  1DYN A;  5J3Y A;  1I2H A;  2YS1 A;  2KCJ A;  1GC6 A;  3B77 A;  3ZVR A;  4P7I A;  4GOU A;  1MPH A;  1RRP B;  3ULB A;  2DHK A;  3F0W A;  5D3V A;  4A6K A;  1Q67 A;  2DX1 A;  1WJM A;  2KIG A;  1FGZ A;  4CHJ A;  5I2M A;  2L2I A;  4K81 A;  1OMW A;  1W1H A;  1OQN A;  3WA0 A;  4DIX A;  4MK0 A;  2CAY A;  4HB2 B;  1BWN A;  2K00 A;  1ZVR A;  1MI1 A;  2P0D A;  1DBH A;  5GOW B;  4C0A A;  2LKO A;  2GJY A;  5J3T A;  2H7E A;  2RVB B;  4D6W A;  3PVU A;  2YSZ A;  4NY0 A;  4ZRK A;  3HQC A;  2YT0 A;  1ZYI A;  2DKP A;  3GYP A;  5JP4 A;  2M38 A;  4QJ5 B;  1SHC A;  5HE2 A;  2DHI A;  5C79 A;  2L1C A;  2HE7 A;  2ZPY A;  4B6H A;  2R2Y A;  3KY9 A;  3NSU A;  4HAX B;  4Z2M B;  1MAI A;  2GUM A;  2Y7B A;  5C6R A;  1U2B A;  1UNR A;  5J3Q A;  2R09 A;  2K8E A;  3TVV A;  5HE1 A;  4TYZ A;  4HAV B;  2D4Q A;  1EVH A;  2D9Z A;  3AU4 A;  1XCG A;  1X11 A;  2J0J A;  4YL8 A;  4KHO A;  3SNH A;  1GC7 A;  5DHA B;  5JLJ B;  2LYD A;  2QKL A;  3ODX A;  2LUL A;  1MKE A;  5L81 A;  5DH9 B;  1PFJ A;  4WSF A;  1DDV A;  1XX0 A;  5DI9 B;  1DDW A;  2DYQ A;  2HTH B;  1ZSQ A;  1MIZ B;  1KI1 B;  2I5C A;  4HDQ A;  4NSW A;  4WVF B;  3FSS A;  4QJ4 B;  2E2X A;  2K49 A;  2CY5 A;  3T06 A;  4F7H A;  2GS0 A;  2X18 A;  1TXD A;  3SUZ A;  3TO1 A;  3V5W A;  1WGQ A;  3VOQ A;  5KQ1 A;  2DA0 A;  2I1K A;  4HHV A;  2R0D A;  3SV1 A;  4CSQ A;  2YT2 A;  1J19 A;  3CXB B;  2V76 A;  5D27 A;  2RNR B;  2Z13 A;  1EGX A;  3D8D A;  1XD4 A;  3NWF A;  4ZRI A;  1U5F A;  5LG4 B;  4HAT B;  2FJU B;  2Z0Q A;  2YRY A;  4L1R A;  2COD A;  3MDB C;  2Z14 A;  1QQG A;  2YT1 A;  3A58 A;  2DHJ A;  2COF A;  3PVW A;  5D3W A;  3U7D A;  1PLS A;  4HAW B;  4HAY B;  3PEG A; 
#chains in the Genus database with same CATH homology
 5JHH A;  4IOY X;  4GZU A;  1J0W A;  4K2P A;  2G35 A;  2RSG A;  3O96 A;  4D0N B;  5DIF B;  2DX5 A;  2IFS A;  2CRF A;  5C16 A;  1B55 A;  3AU5 A;  5CLQ B;  1NI2 A;  1WGU A;  2YVC A;  2VSZ A;  3ULC A;  1WI1 A;  4IAP A;  4TKN A;  1X1G A;  1V89 A;  1WG7 A;  1P6S A;  3A8Q A;  1UNP A;  1P5T A;  2DTC A;  2GCL A;  4PNK A;  3G9W A;  2K2U A;  3TFM A;  4GMV A;  2COC A;  4F7G A;  2GCJ A;  2Q13 A;  4GXB A;  2M14 A;  1XR0 B;  4EJN A;  2J0M A;  5JHG A;  1FHW A;  3QBV B;  2EMT A;  5KQ4 A;  2MFQ A;  3SO6 A;  3PZD A;  3PVL A;  4H8S A;  1TQZ A;  4K2O A;  4A6H A;  2Z0P A;  2I1J A;  2N0Y A;  3F5R A;  4KAX B;  1Z87 A;  4DX8 A;  2LG1 A;  1XKE A;  1X86 A;  1DRO A;  3SYX A;  1KZG A;  2J59 M;  3BJI A;  5HE3 A;  3VIA A;  5C5B A;  2ELB A;  5C5B B;  2PZ1 A;  2KGX B;  1N3H A;  3FM8 C;  1ZC3 B;  1V5P A;  1FHX A;  1AWE A;  1PMS A;  2MWN B;  3D8E A;  4EMO A;  2UZS A;  3ODW A;  1OY2 A;  2EJ8 A;  3WYF B;  2UZR A;  2N23 A;  1BTK A;  3IVF A;  2ADZ A;  1DDM A;  1V88 A;  4DXA B;  2MKR A;  1ISN A;  1UPQ A;  2DYN A;  1GG3 A;  2NMB A;  4XWX A;  1ZM0 A;  2RGN B;  3U8Z A;  4HB4 B;  4HAZ B;  1LB1 A;  1FB8 A;  3QWM A;  4HB0 B;  5D3X A;  2W2X D;  2DKQ A;  4MT7 A;  4KHA A;  1M7R A;  1U29 A;  2P8V A;  4HB3 B;  3KZ1 A;  2QKM A;  2OQB A;  5DHF B;  1U5E A;  1X1F A;  2VKI A;  3MPX A;  1EAZ A;  3ML4 A;  1FGY A;  2COA A;  2W2W A;  2DFK A;  2DLW A;  3KSY A;  3DXD A;  3A98 B;  4A5K A;  5FI0 A;  2P0F A;  3KRX A;  3ODO A;  4Y94 A;  1BTN A;  1M7E A;  3RCP A;  3FEH A;  1K5D B;  4K17 A;  2BCJ A;  2D9W A;  2D10 A;  4MY6 A;  5LON B;  1TJ6 A;  2P0H A;  2K2J A;  3PG7 A;  2D9V A;  1E5W A;  3P7Z A;  2LOX A;  1SGH A;  4A6F B;  1FHO A;  1Y19 B;  2D11 A;  5EFX A;  3CIK A;  3GYO A;  3A8P A;  4YON A;  3BIN A;  2AL6 A;  2Y8G A;  4ZRJ A;  2D9Y A;  4WJ7 A;  5FI1 A;  1H10 A;  1KZ7 A;  4HDO A;  2D2Q A;  4F7U P;  1K5G B;  3X23 A;  1QC6 A;  3LJU X;  2RUK B;  1H4R A;  2LOZ A;  4GN1 A;  1V61 A;  4KHB B;  1UEF A;  1LW3 A;  4Z2N A;  2IYB A;  1UPR A;  2VRW B;  1U5G A;  1AQC A;  1MK9 B;  1NTV A;  3HK0 A;  1RJ2 A;  1V5U A;  1Y5O A;  3ZDT A;  4L6E A;  1WVH A;  3D8F A;  3QIJ A;  1FAO A;  1I7A A;  2CY4 A;  1XOD A;  4IFS A;  2DN6 A;  2UVM A;  2YS3 A;  1IRS A;  2XQN M;  4CHM A;  1W1G A;  2YF0 A;  2D9X A;  1UNQ A;  2Y8F A;  3DXE A;  4GMX B;  1NU2 A;  3UZT A;  4DBB A;  1FOE A;  2AEH A;  2FJL A;  3OAN A;  1MIX A;  2Z0O A;  2RLO A;  1V5M A;  2KUP A;  3PP2 A;  2EMS A;  3P6A A;  2I5F A;  2OTX A;  1NTY A;  3HW2 B;  4EKU A;  5LOP B;  2ROV A;  1WJ1 A;  4GPT B;  3AJ4 A;  5CLL B;  1EF1 A;  1W1D A;  2ROZ B;  5HE0 A;  2J0K A;  1X05 A;  2NZ8 B;  3TW1 A;  4BBK A;  1P3R A;  4PQ0 A;  4DX9 0;  2ELA A;  4CYE A;  2W2X C;  3N7C A;  4HAU B;  1U27 A;  3TCA A;  2YS5 A;  3KRW A;  5KCV A;  5D3Y A;  1U5D A;  1ZC4 B;  1BAK A;  4A6F A;  2EC1 A;  3M1I B;  3PSC A;  2JP2 A;  1MK7 B;  2MDX A;  4KVG B;  2H7D A;  3DXC A;  1DYN A;  5J3Y A;  1I2H A;  2YS1 A;  2KCJ A;  1GC6 A;  3ZVR A;  4P7I A;  1MPH A;  1RRP B;  3ULB A;  2DHK A;  3F0W A;  5D3V A;  4A6K A;  1Q67 A;  2DX1 A;  1WJM A;  1FGZ A;  4CHJ A;  2L2I A;  4K81 A;  1OMW A;  1W1H A;  1OQN A;  3WA0 A;  4MK0 A;  2CAY A;  4HB2 B;  1BWN A;  2K00 A;  1ZVR A;  2P0D A;  1DBH A;  5GOW B;  4C0A A;  2LKO A;  2GJY A;  5J3T A;  2H7E A;  2RVB B;  3PVU A;  2YSZ A;  4NY0 A;  4ZRK A;  3HQC A;  2YT0 A;  2DKP A;  5JP4 A;  3GYP A;  2M38 A;  1SHC A;  5HE2 A;  2DHI A;  5C79 A;  2L1C A;  2HE7 A;  2ZPY A;  4B6H A;  3KY9 A;  3NSU A;  4HAX B;  4Z2M B;  1MAI A;  2Y7B A;  5C6R A;  1U2B A;  1UNR A;  5J3Q A;  2R09 A;  3TVV A;  5HE1 A;  4TYZ A;  4HAV B;  2D4Q A;  1EVH A;  2D9Z A;  3AU4 A;  1XCG A;  1X11 A;  2J0J A;  4YL8 A;  4KHO A;  3SNH A;  1GC7 A;  5DHA B;  5JLJ B;  2LYD A;  2QKL A;  3ODX A;  2LUL A;  1MKE A;  5L81 A;  5DH9 B;  1PFJ A;  4WSF A;  1DDV A;  1XX0 A;  5DI9 B;  1DDW A;  2DYQ A;  2HTH B;  1ZSQ A;  1MIZ B;  1KI1 B;  2I5C A;  4HDQ A;  4NSW A;  4WVF B;  3FSS A;  2E2X A;  3T06 A;  2CY5 A;  4F7H A;  2GS0 A;  2X18 A;  1TXD A;  3SUZ A;  3TO1 A;  3V5W A;  1WGQ A;  3VOQ A;  5KQ1 A;  2DA0 A;  2I1K A;  4HHV A;  2R0D A;  3SV1 A;  1J19 A;  3CXB B;  2V76 A;  5D27 A;  2RNR B;  1EGX A;  3D8D A;  1XD4 A;  4ZRI A;  1U5F A;  4HAT B;  2Z0Q A;  2YRY A;  2COD A;  3MDB C;  1QQG A;  2YT1 A;  2DHJ A;  2COF A;  3PVW A;  5D3W A;  3U7D A;  1PLS A;  4HAW B;  4HAY B;  3PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...