5LONB

Structure of /k. lactis/ dcp1-dcp2 decapping complex.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
185
structure length
174
Chain Sequence
STETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KLLA0F23980p
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Rna binding protein
total genus 36
structure length 174
sequence length 185
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lonB01
1H10A 2HE7A 2EC1A 1XD4A 4HB3B 4WVFB 2N0YA 3KY9A 1UNPA 1Q67A 3AU5A 1U5EA 1FOEA 4F7GA 1ZVRA 2LG1A 2Z0QA 3D8EA 4BBKA 5D3YA 2LULA 5JHGA 4WSFA 4H8SA 1Y5OA 5LONB 1X1FA 2X18A 2E2XA 2AL6A 2EMSA 3V5WA 4CYEA 3FM8C 4KVGB 4MY6A 2QKMA 4DX90 1U5DA 2RVBB 3RCPA 4EKUA 2LOZA 4A6FB 2HTHB 1FHXA 2J59M 3ODXA 2M38A 4XWXA 4ZRIA 4GN1A 5C6RA 1WJMA 2W2WA 2DHJA 3SUZA 3ODWA 2YS5A 5JP4A 3PVLA 1FHWA 2YVCA 1W1HA 3PP2A 4HHVA 2MWNB 1N3HA 1E5WA 2ROZB 1SGHA 2DFKA 4HAUB 4A6KA 2ADZA 5DH9B 1W1GA 3CIKA 1DROA 4PNKA 2L1CA 1DDVA 1UPQA 2DYQA 1P3RA 4K17A 3PZDA 2VRWB 2OQBA 5J3TA 2AEHA 4F7HA 2CRFA 1M7RA 1PMSA 4DBBA 2K2JA 3PEGA 2K00A 1RJ2A 2I1JA 4K2OA 2D9WA 1SHCA 3A8PA 4EJNA 1RRPB 1AQCA 2V76A 1PFJA 1ZM0A 3U7DA 2MKRA 5HE0A 1UNRA 1V5PA 2CY4A 3QBVB 3WA0A 3NSUA 1XKEA 2GCJA 4CHMA 1X1GA 4KAXB 4P7IA 5DHAB 2YS1A 2KGXB 4YONA 5DIFB 4TKNA 3AJ4A 1WGUA 3ML4A 1OQNA 1TJ6A 3SYXA 3A8QA 2IYBA 5KQ4A 4DX8A 1MKEA 1QC6A 5J3YA 2D11A 3ZDTA 1NTYA 3D8FA 2DHKA 2LOXA 2YS3A 1V89A 2DX1A 1LB1A 2Z0PA 2H7DA 3M1IB 1B55A 2VKIA 1FHOA 5D3XA 4HATB 1GC6A 5KQ1A 3TFMA 3F5RA 1BTKA 3ZVRA 3TO1A 2L2IA 4MT7A 3DXCA 1GG3A 4F7UP 2CODA 4GXBA 3KZ1A 2M14A 3ULBA 3PSCA 5J3QA 3BINA 2J0KA 4Z2MB 2D2QA 2D9XA 4HDOA 1FB8A 1V88A 5JHHA 2YSZA 5DHFB 2MDXA 1V5UA 2COCA 3CXBB 4HB2B 4A6FA 4Z2NA 3AU4A 2DTCA 1KI1B 3VOQA 1X05A 4IFSA 2LYDA 1XX0A 4C0AA 2CY5A 5CLQB 1FGYA 2D10A 5FI0A 1BTNA 2Z0OA 1MPHA 1KZ7A 1U29A 4D0NB 3ODOA 3GYPA 2P0FA 2DHIA 2IFSA 3MDBC 3QIJA 4HAXB 4K2PA 2ROVA 3O96A 4B6HA 3OANA 2Y8FA 1MAIA 1TQZA 2NMBA 4ZRJA 2OTXA 2GJYA 4HAYB 4NSWA 2RSGA 3TCAA 2EMTA 1FAOA 3KSYA 1DDWA 3GYOA 2G35A 4PQ0A 4KHAA 1I2HA 3TW1A 1EGXA 2J0MA 1ISNA 2I1KA 3LJUX 2PZ1A 3UZTA 1EF1A 1MK7B 3T06A 2NZ8B 2UZRA 2D9YA 2JP2A 2YT0A 1AWEA 5D27A 1EVHA 1NTVA 3FEHA 1V5MA 1OY2A 1LW3A 1GC7A 2YF0A 1IRSA 3SNHA 3PVUA 1K5GB 1NI2A 3VIAA 1ZC3B 2RLOA 3G9WA 4HB0B 1BWNA 1M7EA 2W2XD 5L81A 1K5DB 2DX5A 2RUKB 4IAPA 3KRWA 5HE1A 4MK0A 3D8DA 1WG7A 5FI1A 3FSSA 4EMOA 3A98B 2UVMA 5C5BB 4WJ7A 1W1DA 1I7AA 4HDQA 5D3VA 1XR0B 3TVVA 1KZGA 3P7ZA 1MIXA 4NY0A 2ELAA 3DXEA 1QQGA 5CLLB 1U2BA 4CHJA 5EFXA 2LKOA 3IVFA 1FGZA 2COAA 2ELBA 1WVHA 2P0HA 4KHBB 4HAZB 1X86A 4L6EA 3SV1A 3DXDA 2FJLA 2Q13A 2Y8GA 3U8ZA 1XCGA 1Y19B 3KRXA 3F0WA 1ZC4B 2RGNB 1WGQA 3HK0A 1Z87A 3PG7A 4TYZA 3QWMA 4Y94A 1X11A 4HAWB 5C79A 5JLJB 5LOPB 1U5FA 1U27A 1U5GA 1NU2A 4ZRKA 1MK9B 2R0DA 2W2XC 4YL8A 2D9ZA 2DYNA 2CAYA 2P8VA 1UEFA 4GZUA 1XODA 2MFQA 2UZSA 1EAZA 2GS0A 2D9VA 2KCJA 1ZSQA 2KUPA 4A5KA 3PVWA 3SO6A 1H4RA 3MPXA 2XQNM 1PLSA 1J0WA 2H7EA 2ZPYA 2DA0A 2GCLA 3N7CA 1J19A 3ULCA 1P6SA 2D4QA 3BJIA 4A6HA 4GMXB 2J0JA 2P0DA 1DDMA 1MIZB 4K81A 2DLWA 3WYFB 2YRYA 1DYNA 1DBHA 1WJ1A 3HW2B 4IOYX 1P5TA 2N23A 4DXAB 2Y7BA 4HAVB 3X23A 2K2UA 2R09A 2RNRB 2BCJA 5C16A 2DN6A 1UPRA 1TXDA 5C5BA 1BAKA 4HB4B 5HE3A 3HQCA 5DI9B 5HE2A 4GMVA 4GPTB 2COFA 2DKPA 2QKLA 2YT1A 2EJ8A 5KCVA 2I5FA 5D3WA 4KHOA 5GOWB 3P6AA 1V61A 1OMWA 1UNQA 2DKQA 2VSZA 1WI1A 2I5CA
chains in the Genus database with same CATH superfamily
1H10A 2HE7A 2EC1A 1XD4A 4HB3B 4WVFB 2N0YA 3KY9A 3OHMB 1UNPA 1Q67A 3AU5A 1U5EA 1FOEA 4F7GA 1ZVRA 2LG1A 2Z0QA 3D8EA 4BBKA 5D3YA 2LULA 5JHGA 4WSFA 4H8SA 1Y5OA 1MI1A 5LONB 4GOUA 1X1FA 2X18A 2E2XA 2Z13A 3DCXA 2AL6A 2EMSA 3V5WA 4CYEA 3FM8C 4QJ3B 4KVGB 4MY6A 2QKMA 4DX90 1U5DA 2RVBB 3RCPA 4EKUA 2LOZA 4A6FB 2HTHB 1FHXA 2J59M 3ODXA 2M38A 2KR0A 2KIEA 4XWXA 4ZRIA 4GN1A 3NWDA 5C6RA 1WJMA 3U12A 2W2WA 2DHJA 3SUZA 3ODWA 2YS5A 5JP4A 3PVLA 1FHWA 2YVCA 1W1HA 3PP2A 4HHVA 2MWNB 5M4YB 1N3HA 1E5WA 2ROZB 1SGHA 2NBVA 2DFKA 4HAUB 4A6KA 2ADZA 5LG4B 5DH9B 1W1GA 3CIKA 1DROA 4PNKA 2L1CA 1DDVA 1UPQA 2DYQA 1P3RA 3NWAA 4K17A 3PZDA 2VRWB 2OQBA 5J3TA 2AEHA 4F7HA 2CRFA 1M7RA 1PMSA 4DBBA 2K2JA 3PEGA 2K00A 1RJ2A 2I1JA 4K2OA 2D9WA 1SHCA 3A8PA 4EJNA 1RRPB 1AQCA 2V76A 1PFJA 1ZM0A 3U7DA 2MKRA 5HE0A 1UNRA 1V5PA 2CY4A 3QBVB 3WA0A 3NSUA 1XKEA 2GCJA 4CHMA 1X1GA 4KAXB 4P7IA 5DHAB 2GUMA 2YS1A 2KGXB 4YONA 5DIFB 4TKNA 3AJ4A 1WGUA 3ML4A 1OQNA 1TJ6A 3SYXA 3A8QA 2IYBA 5KQ4A 4DX8A 1MKEA 1QC6A 5J3YA 2D11A 3ZDTA 1NTYA 3D8FA 2DHKA 2LOXA 2YS3A 1V89A 2DX1A 1LB1A 2Z0PA 2H7DA 2ZKMX 3M1IB 4CSQA 1B55A 2VKIA 1FHOA 5D3XA 4HATB 1GC6A 5KQ1A 3TFMA 3F5RA 1BTKA 4GNKB 3TO1A 3ZVRA 2L2IA 4MT7A 2K8EA 2Z14A 3DXCA 1GG3A 4F7UP 2CODA 4GXBA 3KZ1A 2M14A 3ULBA 3PSCA 5J3QA 3BINA 2J0KA 4Z2MB 2R2YA 2D2QA 2D9XA 4HDOA 1FB8A 1V88A 5JHHA 2YSZA 5DHFB 2MDXA 1V5UA 2COCA 3CXBB 4HB2B 4A6FA 2KIGA 5I2MA 4D6WA 4Z2NA 3AU4A 2DTCA 1KI1B 3VOQA 1X05A 4IFSA 2LYDA 3HSAA 1XX0A 4C0AA 2CY5A 5CLQB 1FGYA 2D10A 5FI0A 1BTNA 2Z0OA 1MPHA 1KZ7A 1U29A 4D0NB 3ODOA 4HSIA 3GYPA 2P0FA 1T77A 2DHIA 4QXAB 2IFSA 3MDBC 3QIJA 4HAXB 4K2PA 2ROVA 3O96A 4QJ5B 4B6HA 3OANA 2Y8FA 1MAIA 1TQZA 2NMBA 4ZRJA 2OTXA 2GJYA 2YT2A 4HAYB 2RSGA 4NSWA 3TCAA 2EMTA 1FAOA 3KSYA 1DDWA 3GYOA 2G35A 4PQ0A 4KHAA 1I2HA 3TW1A 2Z59A 1EGXA 2J0MA 1ISNA 2I1KA 3LJUX 2PZ1A 3UZTA 1EF1A 1MK7B 3T06A 2NZ8B 2UZRA 2D9YA 2JP2A 2YT0A 1AWEA 5I2SA 2K49A 5D27A 1EVHA 1NTVA 2KUQA 3FEHA 1V5MA 1OY2A 1LW3A 1GC7A 2YF0A 1IRSA 3SNHA 3PVUA 1K5GB 1NI2A 3VIAA 1ZC3B 2RLOA 3G9WA 4HB0B 1BWNA 1M7EA 2W2XD 5L81A 1K5DB 2DX5A 2RUKB 4IAPA 3KRWA 5HE1A 4MK0A 3D8DA 1WG7A 5FI1A 3FSSA 4EMOA 3A98B 2UVMA 5C5BB 4WJ7A 4OT1A 1W1DA 1I7AA 4HDQA 5D3VA 1XR0B 3TVVA 1KZGA 3P7ZA 1MIXA 4NY0A 2ELAA 3DXEA 1QQGA 5CLLB 1U2BA 4CHJA 5EFXA 2LKOA 3IVFA 1FGZA 2COAA 2ELBA 1WVHA 2P0HA 4KHBB 4HAZB 1X86A 4L6EA 3SV1A 3DXDA 2FJLA 2Q13A 2Y8GA 3U8ZA 1XCGA 1Y19B 3KRXA 3F0WA 1ZC4B 2RGNB 1WGQA 3HK0A 1Z87A 3PG7A 4TYZA 3QWMA 4Y94A 1X11A 4HAWB 2FJUB 5C79A 5JLJB 1U5FA 5LOPB 1U27A 1U5GA 1NU2A 4ZRKA 1MK9B 4QJ4B 2Z4DA 2R0DA 2W2XC 4YL8A 2D9ZA 2DYNA 2CAYA 2P8VA 1UEFA 4GZUA 1XODA 2MFQA 2RRFA 3A58A 2UZSA 1EAZA 2GS0A 2D9VA 2KCJA 1ZSQA 2KUPA 4A5KA 3PVWA 5IRSA 3SO6A 1H4RA 3MPXA 2XQNM 1PLSA 3FVCA 1J0WA 2H7EA 3NWFA 2ZPYA 2DA0A 2GCLA 4OSNA 3N7CA 1J19A 1ZYIA 3ULCA 1P6SA 2D4QA 3NW8A 3BJIA 4A6HA 4GMXB 2J0JA 2P0DA 1DDMA 1MIZB 4DIXA 4K81A 2DLWA 3WYFB 2YRYA 1DYNA 1DBHA 1WJ1A 3HW2B 4IOYX 1P5TA 2N23A 4DXAB 2Y7BA 4HAVB 4L1RA 3X23A 2K2UA 2R09A 2RNRB 2BCJA 5C16A 2DN6A 1UPRA 1TXDA 5C5BA 1BAKA 4HB4B 3B77A 5HE3A 3HQCA 5DI9B 5HE2A 4GMVA 4GPTB 2COFA 2DKPA 2QKLA 2YT1A 2EJ8A 5KCVA 2I5FA 5D3WA 4KHOA 5GOWB 3P6AA 1V61A 1OMWA 1UNQA 2DKQA 2VSZA 1WI1A 2I5CA 3HIEA 4KHBA
chains in the Genus database with same CATH topology
1H10A 2HE7A 2EC1A 1XD4A 4HB3B 4WVFB 2N0YA 3KY9A 1UNPA 1Q67A 3AU5A 1U5EA 1FOEA 4F7GA 1ZVRA 2LG1A 2Z0QA 3D8EA 4BBKA 5D3YA 2LULA 5JHGA 4WSFA 4H8SA 1Y5OA 5LONB 1X1FA 2X18A 2E2XA 2AL6A 2EMSA 3V5WA 4CYEA 3FM8C 4KVGB 4MY6A 2QKMA 4DX90 1U5DA 2RVBB 3RCPA 4EKUA 2LOZA 4A6FB 2HTHB 1FHXA 2J59M 3ODXA 2M38A 4XWXA 4ZRIA 4GN1A 5C6RA 1WJMA 2W2WA 2DHJA 3SUZA 3ODWA 2YS5A 5JP4A 3PVLA 1FHWA 2YVCA 1W1HA 3PP2A 4HHVA 2MWNB 1N3HA 1E5WA 2ROZB 1SGHA 2DFKA 4HAUB 4A6KA 2ADZA 5DH9B 1W1GA 3CIKA 1DROA 4PNKA 2L1CA 1DDVA 1UPQA 2DYQA 1P3RA 4K17A 3PZDA 2VRWB 2OQBA 5J3TA 2AEHA 4F7HA 2CRFA 1M7RA 1PMSA 4DBBA 2K2JA 3PEGA 2K00A 1RJ2A 2I1JA 4K2OA 2D9WA 1SHCA 3A8PA 4EJNA 1RRPB 1AQCA 2V76A 1PFJA 1ZM0A 3U7DA 2MKRA 5HE0A 1UNRA 1V5PA 2CY4A 3QBVB 3WA0A 3NSUA 1XKEA 2GCJA 4CHMA 1X1GA 4KAXB 4P7IA 5DHAB 2YS1A 2KGXB 4YONA 5DIFB 4TKNA 3AJ4A 1WGUA 3ML4A 1OQNA 1TJ6A 3SYXA 3A8QA 2IYBA 5KQ4A 4DX8A 1MKEA 1QC6A 5J3YA 2D11A 3ZDTA 1NTYA 3D8FA 2DHKA 2LOXA 2YS3A 1V89A 2DX1A 1LB1A 2Z0PA 2H7DA 3M1IB 1B55A 2VKIA 1FHOA 5D3XA 4HATB 1GC6A 5KQ1A 3TFMA 3F5RA 1BTKA 3ZVRA 3TO1A 2L2IA 4MT7A 3DXCA 1GG3A 4F7UP 2CODA 4GXBA 3KZ1A 2M14A 3ULBA 3PSCA 5J3QA 3BINA 2J0KA 4Z2MB 2D2QA 2D9XA 4HDOA 1FB8A 1V88A 5JHHA 2YSZA 5DHFB 2MDXA 1V5UA 2COCA 3CXBB 4HB2B 4A6FA 4Z2NA 3AU4A 2DTCA 1KI1B 3VOQA 1X05A 4IFSA 2LYDA 1XX0A 4C0AA 2CY5A 5CLQB 1FGYA 2D10A 5FI0A 1BTNA 2Z0OA 1MPHA 1KZ7A 1U29A 4D0NB 3ODOA 3GYPA 2P0FA 2DHIA 2IFSA 3MDBC 3QIJA 4HAXB 4K2PA 2ROVA 3O96A 4B6HA 3OANA 2Y8FA 1MAIA 1TQZA 2NMBA 4ZRJA 2OTXA 2GJYA 4HAYB 4NSWA 2RSGA 3TCAA 2EMTA 1FAOA 3KSYA 1DDWA 3GYOA 2G35A 4PQ0A 4KHAA 1I2HA 3TW1A 1EGXA 2J0MA 1ISNA 2I1KA 3LJUX 2PZ1A 3UZTA 1EF1A 1MK7B 3T06A 2NZ8B 2UZRA 2D9YA 2JP2A 2YT0A 1AWEA 5D27A 1EVHA 1NTVA 3FEHA 1V5MA 1OY2A 1LW3A 1GC7A 2YF0A 1IRSA 3SNHA 3PVUA 1K5GB 1NI2A 3VIAA 1ZC3B 2RLOA 3G9WA 4HB0B 1BWNA 1M7EA 2W2XD 5L81A 1K5DB 2DX5A 2RUKB 4IAPA 3KRWA 5HE1A 4MK0A 3D8DA 1WG7A 5FI1A 3FSSA 4EMOA 3A98B 2UVMA 5C5BB 4WJ7A 1W1DA 1I7AA 4HDQA 5D3VA 1XR0B 3TVVA 1KZGA 3P7ZA 1MIXA 4NY0A 2ELAA 3DXEA 1QQGA 5CLLB 1U2BA 4CHJA 5EFXA 2LKOA 3IVFA 1FGZA 2COAA 2ELBA 1WVHA 2P0HA 4KHBB 4HAZB 1X86A 4L6EA 3SV1A 3DXDA 2FJLA 2Q13A 2Y8GA 3U8ZA 1XCGA 1Y19B 3KRXA 3F0WA 1ZC4B 2RGNB 1WGQA 3HK0A 1Z87A 3PG7A 4TYZA 3QWMA 4Y94A 1X11A 4HAWB 5C79A 5JLJB 5LOPB 1U5FA 1U27A 1U5GA 1NU2A 4ZRKA 1MK9B 2R0DA 2W2XC 4YL8A 2D9ZA 2DYNA 2CAYA 2P8VA 1UEFA 4GZUA 1XODA 2MFQA 2UZSA 1EAZA 2GS0A 2D9VA 2KCJA 1ZSQA 2KUPA 4A5KA 3PVWA 3SO6A 1H4RA 3MPXA 2XQNM 1PLSA 1J0WA 2H7EA 2ZPYA 2DA0A 2GCLA 3N7CA 1J19A 3ULCA 1P6SA 2D4QA 3BJIA 4A6HA 4GMXB 2J0JA 2P0DA 1DDMA 1MIZB 4K81A 2DLWA 3WYFB 2YRYA 1DYNA 1DBHA 1WJ1A 3HW2B 4IOYX 1P5TA 2N23A 4DXAB 2Y7BA 4HAVB 3X23A 2K2UA 2R09A 2RNRB 2BCJA 5C16A 2DN6A 1UPRA 1TXDA 5C5BA 1BAKA 4HB4B 5HE3A 3HQCA 5DI9B 5HE2A 4GMVA 4GPTB 2COFA 2DKPA 2QKLA 2YT1A 2EJ8A 5KCVA 2I5FA 5D3WA 4KHOA 5GOWB 3P6AA 1V61A 1OMWA 1UNQA 2DKQA 2VSZA 1WI1A 2I5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H10 A;  2HE7 A;  2EC1 A;  1XD4 A;  4HB3 B;  4WVF B;  2N0Y A;  3KY9 A;  1UNP A;  1Q67 A;  3AU5 A;  1U5E A;  1FOE A;  4F7G A;  1ZVR A;  2LG1 A;  2Z0Q A;  3D8E A;  4BBK A;  5D3Y A;  2LUL A;  5JHG A;  4WSF A;  4H8S A;  1Y5O A;  5LON B;  1X1F A;  2X18 A;  2E2X A;  2AL6 A;  2EMS A;  3V5W A;  4CYE A;  3FM8 C;  4KVG B;  4MY6 A;  2QKM A;  4DX9 0;  1U5D A;  2RVB B;  3RCP A;  4EKU A;  2LOZ A;  4A6F B;  2HTH B;  1FHX A;  2J59 M;  3ODX A;  2M38 A;  4XWX A;  4ZRI A;  4GN1 A;  5C6R A;  1WJM A;  2W2W A;  2DHJ A;  3SUZ A;  3ODW A;  2YS5 A;  5JP4 A;  3PVL A;  1FHW A;  2YVC A;  1W1H A;  3PP2 A;  4HHV A;  2MWN B;  1N3H A;  1E5W A;  2ROZ B;  1SGH A;  2DFK A;  4HAU B;  4A6K A;  2ADZ A;  5DH9 B;  1W1G A;  3CIK A;  1DRO A;  4PNK A;  2L1C A;  1DDV A;  1UPQ A;  2DYQ A;  1P3R A;  4K17 A;  3PZD A;  2VRW B;  2OQB A;  5J3T A;  2AEH A;  4F7H A;  2CRF A;  1M7R A;  1PMS A;  4DBB A;  2K2J A;  3PEG A;  2K00 A;  1RJ2 A;  2I1J A;  4K2O A;  2D9W A;  1SHC A;  3A8P A;  4EJN A;  1RRP B;  1AQC A;  2V76 A;  1PFJ A;  1ZM0 A;  3U7D A;  2MKR A;  5HE0 A;  1UNR A;  1V5P A;  2CY4 A;  3QBV B;  3WA0 A;  3NSU A;  1XKE A;  2GCJ A;  4CHM A;  1X1G A;  4KAX B;  4P7I A;  5DHA B;  2YS1 A;  2KGX B;  4YON A;  5DIF B;  4TKN A;  3AJ4 A;  1WGU A;  3ML4 A;  1OQN A;  1TJ6 A;  3SYX A;  3A8Q A;  2IYB A;  5KQ4 A;  4DX8 A;  1MKE A;  1QC6 A;  5J3Y A;  2D11 A;  3ZDT A;  1NTY A;  3D8F A;  2DHK A;  2LOX A;  2YS3 A;  1V89 A;  2DX1 A;  1LB1 A;  2Z0P A;  2H7D A;  3M1I B;  1B55 A;  2VKI A;  1FHO A;  5D3X A;  4HAT B;  1GC6 A;  5KQ1 A;  3TFM A;  3F5R A;  1BTK A;  3ZVR A;  3TO1 A;  2L2I A;  4MT7 A;  3DXC A;  1GG3 A;  4F7U P;  2COD A;  4GXB A;  3KZ1 A;  2M14 A;  3ULB A;  3PSC A;  5J3Q A;  3BIN A;  2J0K A;  4Z2M B;  2D2Q A;  2D9X A;  4HDO A;  1FB8 A;  1V88 A;  5JHH A;  2YSZ A;  5DHF B;  2MDX A;  1V5U A;  2COC A;  3CXB B;  4HB2 B;  4A6F A;  4Z2N A;  3AU4 A;  2DTC A;  1KI1 B;  3VOQ A;  1X05 A;  4IFS A;  2LYD A;  1XX0 A;  4C0A A;  2CY5 A;  5CLQ B;  1FGY A;  2D10 A;  5FI0 A;  1BTN A;  2Z0O A;  1MPH A;  1KZ7 A;  1U29 A;  4D0N B;  3ODO A;  3GYP A;  2P0F A;  2DHI A;  2IFS A;  3MDB C;  3QIJ A;  4HAX B;  4K2P A;  2ROV A;  3O96 A;  4B6H A;  3OAN A;  2Y8F A;  1MAI A;  1TQZ A;  2NMB A;  4ZRJ A;  2OTX A;  2GJY A;  4HAY B;  4NSW A;  2RSG A;  3TCA A;  2EMT A;  1FAO A;  3KSY A;  1DDW A;  3GYO A;  2G35 A;  4PQ0 A;  4KHA A;  1I2H A;  3TW1 A;  1EGX A;  2J0M A;  1ISN A;  2I1K A;  3LJU X;  2PZ1 A;  3UZT A;  1EF1 A;  1MK7 B;  3T06 A;  2NZ8 B;  2UZR A;  2D9Y A;  2JP2 A;  2YT0 A;  1AWE A;  5D27 A;  1EVH A;  1NTV A;  3FEH A;  1V5M A;  1OY2 A;  1LW3 A;  1GC7 A;  2YF0 A;  1IRS A;  3SNH A;  3PVU A;  1K5G B;  1NI2 A;  3VIA A;  1ZC3 B;  2RLO A;  3G9W A;  4HB0 B;  1BWN A;  1M7E A;  2W2X D;  5L81 A;  1K5D B;  2DX5 A;  2RUK B;  4IAP A;  3KRW A;  5HE1 A;  4MK0 A;  3D8D A;  1WG7 A;  5FI1 A;  3FSS A;  4EMO A;  3A98 B;  2UVM A;  5C5B B;  4WJ7 A;  1W1D A;  1I7A A;  4HDQ A;  5D3V A;  1XR0 B;  3TVV A;  1KZG A;  3P7Z A;  1MIX A;  4NY0 A;  2ELA A;  3DXE A;  1QQG A;  5CLL B;  1U2B A;  4CHJ A;  5EFX A;  2LKO A;  3IVF A;  1FGZ A;  2COA A;  2ELB A;  1WVH A;  2P0H A;  4KHB B;  4HAZ B;  1X86 A;  4L6E A;  3SV1 A;  3DXD A;  2FJL A;  2Q13 A;  2Y8G A;  3U8Z A;  1XCG A;  1Y19 B;  3KRX A;  3F0W A;  1ZC4 B;  2RGN B;  1WGQ A;  3HK0 A;  1Z87 A;  3PG7 A;  4TYZ A;  3QWM A;  4Y94 A;  1X11 A;  4HAW B;  5C79 A;  5JLJ B;  5LOP B;  1U5F A;  1U27 A;  1U5G A;  1NU2 A;  4ZRK A;  1MK9 B;  2R0D A;  2W2X C;  4YL8 A;  2D9Z A;  2DYN A;  2CAY A;  2P8V A;  1UEF A;  4GZU A;  1XOD A;  2MFQ A;  2UZS A;  1EAZ A;  2GS0 A;  2D9V A;  2KCJ A;  1ZSQ A;  2KUP A;  4A5K A;  3PVW A;  3SO6 A;  1H4R A;  3MPX A;  2XQN M;  1PLS A;  1J0W A;  2H7E A;  2ZPY A;  2DA0 A;  2GCL A;  3N7C A;  1J19 A;  3ULC A;  1P6S A;  2D4Q A;  3BJI A;  4A6H A;  4GMX B;  2J0J A;  2P0D A;  1DDM A;  1MIZ B;  4K81 A;  2DLW A;  3WYF B;  2YRY A;  1DYN A;  1DBH A;  1WJ1 A;  3HW2 B;  4IOY X;  1P5T A;  2N23 A;  4DXA B;  2Y7B A;  4HAV B;  3X23 A;  2K2U A;  2R09 A;  2RNR B;  2BCJ A;  5C16 A;  2DN6 A;  1UPR A;  1TXD A;  5C5B A;  1BAK A;  4HB4 B;  5HE3 A;  3HQC A;  5DI9 B;  5HE2 A;  4GMV A;  4GPT B;  2COF A;  2DKP A;  2QKL A;  2YT1 A;  2EJ8 A;  5KCV A;  2I5F A;  5D3W A;  4KHO A;  5GOW B;  3P6A A;  1V61 A;  1OMW A;  1UNQ A;  2DKQ A;  2VSZ A;  1WI1 A;  2I5C A; 
#chains in the Genus database with same CATH topology
 1H10 A;  2HE7 A;  2EC1 A;  1XD4 A;  4HB3 B;  4WVF B;  2N0Y A;  3KY9 A;  3OHM B;  1UNP A;  1Q67 A;  3AU5 A;  1U5E A;  1FOE A;  4F7G A;  1ZVR A;  2LG1 A;  2Z0Q A;  3D8E A;  4BBK A;  5D3Y A;  2LUL A;  5JHG A;  4WSF A;  4H8S A;  1Y5O A;  1MI1 A;  5LON B;  4GOU A;  1X1F A;  2X18 A;  2E2X A;  2Z13 A;  3DCX A;  2AL6 A;  2EMS A;  3V5W A;  4CYE A;  3FM8 C;  4QJ3 B;  4KVG B;  4MY6 A;  2QKM A;  4DX9 0;  1U5D A;  2RVB B;  3RCP A;  4EKU A;  2LOZ A;  4A6F B;  2HTH B;  1FHX A;  2J59 M;  3ODX A;  2M38 A;  2KR0 A;  2KIE A;  4XWX A;  4ZRI A;  4GN1 A;  3NWD A;  5C6R A;  1WJM A;  3U12 A;  2W2W A;  2DHJ A;  3SUZ A;  3ODW A;  2YS5 A;  5JP4 A;  3PVL A;  1FHW A;  2YVC A;  1W1H A;  3PP2 A;  4HHV A;  2MWN B;  5M4Y B;  1N3H A;  1E5W A;  2ROZ B;  1SGH A;  2NBV A;  2DFK A;  4HAU B;  4A6K A;  2ADZ A;  5LG4 B;  5DH9 B;  1W1G A;  3CIK A;  1DRO A;  4PNK A;  2L1C A;  1DDV A;  1UPQ A;  2DYQ A;  1P3R A;  3NWA A;  4K17 A;  3PZD A;  2VRW B;  2OQB A;  5J3T A;  2AEH A;  4F7H A;  2CRF A;  1M7R A;  1PMS A;  4DBB A;  2K2J A;  3PEG A;  2K00 A;  1RJ2 A;  2I1J A;  4K2O A;  2D9W A;  1SHC A;  3A8P A;  4EJN A;  1RRP B;  1AQC A;  2V76 A;  1PFJ A;  1ZM0 A;  3U7D A;  2MKR A;  5HE0 A;  1UNR A;  1V5P A;  2CY4 A;  3QBV B;  3WA0 A;  3NSU A;  1XKE A;  2GCJ A;  4CHM A;  1X1G A;  4KAX B;  4P7I A;  5DHA B;  2GUM A;  2YS1 A;  2KGX B;  4YON A;  5DIF B;  4TKN A;  3AJ4 A;  1WGU A;  3ML4 A;  1OQN A;  1TJ6 A;  3SYX A;  3A8Q A;  2IYB A;  5KQ4 A;  4DX8 A;  1MKE A;  1QC6 A;  5J3Y A;  2D11 A;  3ZDT A;  1NTY A;  3D8F A;  2DHK A;  2LOX A;  2YS3 A;  1V89 A;  2DX1 A;  1LB1 A;  2Z0P A;  2H7D A;  2ZKM X;  3M1I B;  4CSQ A;  1B55 A;  2VKI A;  1FHO A;  5D3X A;  4HAT B;  1GC6 A;  5KQ1 A;  3TFM A;  3F5R A;  1BTK A;  4GNK B;  3TO1 A;  3ZVR A;  2L2I A;  4MT7 A;  2K8E A;  2Z14 A;  3DXC A;  1GG3 A;  4F7U P;  2COD A;  4GXB A;  3KZ1 A;  2M14 A;  3ULB A;  3PSC A;  5J3Q A;  3BIN A;  2J0K A;  4Z2M B;  2R2Y A;  2D2Q A;  2D9X A;  4HDO A;  1FB8 A;  1V88 A;  5JHH A;  2YSZ A;  5DHF B;  2MDX A;  1V5U A;  2COC A;  3CXB B;  4HB2 B;  4A6F A;  2KIG A;  5I2M A;  4D6W A;  4Z2N A;  3AU4 A;  2DTC A;  1KI1 B;  3VOQ A;  1X05 A;  4IFS A;  2LYD A;  3HSA A;  1XX0 A;  4C0A A;  2CY5 A;  5CLQ B;  1FGY A;  2D10 A;  5FI0 A;  1BTN A;  2Z0O A;  1MPH A;  1KZ7 A;  1U29 A;  4D0N B;  3ODO A;  4HSI A;  3GYP A;  2P0F A;  1T77 A;  2DHI A;  4QXA B;  2IFS A;  3MDB C;  3QIJ A;  4HAX B;  4K2P A;  2ROV A;  3O96 A;  4QJ5 B;  4B6H A;  3OAN A;  2Y8F A;  1MAI A;  1TQZ A;  2NMB A;  4ZRJ A;  2OTX A;  2GJY A;  2YT2 A;  4HAY B;  2RSG A;  4NSW A;  3TCA A;  2EMT A;  1FAO A;  3KSY A;  1DDW A;  3GYO A;  2G35 A;  4PQ0 A;  4KHA A;  1I2H A;  3TW1 A;  2Z59 A;  1EGX A;  2J0M A;  1ISN A;  2I1K A;  3LJU X;  2PZ1 A;  3UZT A;  1EF1 A;  1MK7 B;  3T06 A;  2NZ8 B;  2UZR A;  2D9Y A;  2JP2 A;  2YT0 A;  1AWE A;  5I2S A;  2K49 A;  5D27 A;  1EVH A;  1NTV A;  2KUQ A;  3FEH A;  1V5M A;  1OY2 A;  1LW3 A;  1GC7 A;  2YF0 A;  1IRS A;  3SNH A;  3PVU A;  1K5G B;  1NI2 A;  3VIA A;  1ZC3 B;  2RLO A;  3G9W A;  4HB0 B;  1BWN A;  1M7E A;  2W2X D;  5L81 A;  1K5D B;  2DX5 A;  2RUK B;  4IAP A;  3KRW A;  5HE1 A;  4MK0 A;  3D8D A;  1WG7 A;  5FI1 A;  3FSS A;  4EMO A;  3A98 B;  2UVM A;  5C5B B;  4WJ7 A;  4OT1 A;  1W1D A;  1I7A A;  4HDQ A;  5D3V A;  1XR0 B;  3TVV A;  1KZG A;  3P7Z A;  1MIX A;  4NY0 A;  2ELA A;  3DXE A;  1QQG A;  5CLL B;  1U2B A;  4CHJ A;  5EFX A;  2LKO A;  3IVF A;  1FGZ A;  2COA A;  2ELB A;  1WVH A;  2P0H A;  4KHB B;  4HAZ B;  1X86 A;  4L6E A;  3SV1 A;  3DXD A;  2FJL A;  2Q13 A;  2Y8G A;  3U8Z A;  1XCG A;  1Y19 B;  3KRX A;  3F0W A;  1ZC4 B;  2RGN B;  1WGQ A;  3HK0 A;  1Z87 A;  3PG7 A;  4TYZ A;  3QWM A;  4Y94 A;  1X11 A;  4HAW B;  2FJU B;  5C79 A;  5JLJ B;  1U5F A;  5LOP B;  1U27 A;  1U5G A;  1NU2 A;  4ZRK A;  1MK9 B;  4QJ4 B;  2Z4D A;  2R0D A;  2W2X C;  4YL8 A;  2D9Z A;  2DYN A;  2CAY A;  2P8V A;  1UEF A;  4GZU A;  1XOD A;  2MFQ A;  2RRF A;  3A58 A;  2UZS A;  1EAZ A;  2GS0 A;  2D9V A;  2KCJ A;  1ZSQ A;  2KUP A;  4A5K A;  3PVW A;  5IRS A;  3SO6 A;  1H4R A;  3MPX A;  2XQN M;  1PLS A;  3FVC A;  1J0W A;  2H7E A;  3NWF A;  2ZPY A;  2DA0 A;  2GCL A;  4OSN A;  3N7C A;  1J19 A;  1ZYI A;  3ULC A;  1P6S A;  2D4Q A;  3NW8 A;  3BJI A;  4A6H A;  4GMX B;  2J0J A;  2P0D A;  1DDM A;  1MIZ B;  4DIX A;  4K81 A;  2DLW A;  3WYF B;  2YRY A;  1DYN A;  1DBH A;  1WJ1 A;  3HW2 B;  4IOY X;  1P5T A;  2N23 A;  4DXA B;  2Y7B A;  4HAV B;  4L1R A;  3X23 A;  2K2U A;  2R09 A;  2RNR B;  2BCJ A;  5C16 A;  2DN6 A;  1UPR A;  1TXD A;  5C5B A;  1BAK A;  4HB4 B;  3B77 A;  5HE3 A;  3HQC A;  5DI9 B;  5HE2 A;  4GMV A;  4GPT B;  2COF A;  2DKP A;  2QKL A;  2YT1 A;  2EJ8 A;  5KCV A;  2I5F A;  5D3W A;  4KHO A;  5GOW B;  3P6A A;  1V61 A;  1OMW A;  1UNQ A;  2DKQ A;  2VSZ A;  1WI1 A;  2I5C A;  3HIE A;  4KHB A; 
#chains in the Genus database with same CATH homology
 1H10 A;  2HE7 A;  2EC1 A;  1XD4 A;  4HB3 B;  4WVF B;  2N0Y A;  3KY9 A;  1UNP A;  1Q67 A;  3AU5 A;  1U5E A;  1FOE A;  4F7G A;  1ZVR A;  2LG1 A;  2Z0Q A;  3D8E A;  4BBK A;  5D3Y A;  2LUL A;  5JHG A;  4WSF A;  4H8S A;  1Y5O A;  5LON B;  1X1F A;  2X18 A;  2E2X A;  2AL6 A;  2EMS A;  3V5W A;  4CYE A;  3FM8 C;  4KVG B;  4MY6 A;  2QKM A;  4DX9 0;  1U5D A;  2RVB B;  3RCP A;  4EKU A;  2LOZ A;  4A6F B;  2HTH B;  1FHX A;  2J59 M;  3ODX A;  2M38 A;  4XWX A;  4ZRI A;  4GN1 A;  5C6R A;  1WJM A;  2W2W A;  2DHJ A;  3SUZ A;  3ODW A;  2YS5 A;  5JP4 A;  3PVL A;  1FHW A;  2YVC A;  1W1H A;  3PP2 A;  4HHV A;  2MWN B;  1N3H A;  1E5W A;  2ROZ B;  1SGH A;  2DFK A;  4HAU B;  4A6K A;  2ADZ A;  5DH9 B;  1W1G A;  3CIK A;  1DRO A;  4PNK A;  2L1C A;  1DDV A;  1UPQ A;  2DYQ A;  1P3R A;  4K17 A;  3PZD A;  2VRW B;  2OQB A;  5J3T A;  2AEH A;  4F7H A;  2CRF A;  1M7R A;  1PMS A;  4DBB A;  2K2J A;  3PEG A;  2K00 A;  1RJ2 A;  2I1J A;  4K2O A;  2D9W A;  1SHC A;  3A8P A;  4EJN A;  1RRP B;  1AQC A;  2V76 A;  1PFJ A;  1ZM0 A;  3U7D A;  2MKR A;  5HE0 A;  1UNR A;  1V5P A;  2CY4 A;  3QBV B;  3WA0 A;  3NSU A;  1XKE A;  2GCJ A;  4CHM A;  1X1G A;  4KAX B;  4P7I A;  5DHA B;  2YS1 A;  2KGX B;  4YON A;  5DIF B;  4TKN A;  3AJ4 A;  1WGU A;  3ML4 A;  1OQN A;  1TJ6 A;  3SYX A;  3A8Q A;  2IYB A;  5KQ4 A;  4DX8 A;  1MKE A;  1QC6 A;  5J3Y A;  2D11 A;  3ZDT A;  1NTY A;  3D8F A;  2DHK A;  2LOX A;  2YS3 A;  1V89 A;  2DX1 A;  1LB1 A;  2Z0P A;  2H7D A;  3M1I B;  1B55 A;  2VKI A;  1FHO A;  5D3X A;  4HAT B;  1GC6 A;  5KQ1 A;  3TFM A;  3F5R A;  1BTK A;  3ZVR A;  3TO1 A;  2L2I A;  4MT7 A;  3DXC A;  1GG3 A;  4F7U P;  2COD A;  4GXB A;  3KZ1 A;  2M14 A;  3ULB A;  3PSC A;  5J3Q A;  3BIN A;  2J0K A;  4Z2M B;  2D2Q A;  2D9X A;  4HDO A;  1FB8 A;  1V88 A;  5JHH A;  2YSZ A;  5DHF B;  2MDX A;  1V5U A;  2COC A;  3CXB B;  4HB2 B;  4A6F A;  4Z2N A;  3AU4 A;  2DTC A;  1KI1 B;  3VOQ A;  1X05 A;  4IFS A;  2LYD A;  1XX0 A;  4C0A A;  2CY5 A;  5CLQ B;  1FGY A;  2D10 A;  5FI0 A;  1BTN A;  2Z0O A;  1MPH A;  1KZ7 A;  1U29 A;  4D0N B;  3ODO A;  3GYP A;  2P0F A;  2DHI A;  2IFS A;  3MDB C;  3QIJ A;  4HAX B;  4K2P A;  2ROV A;  3O96 A;  4B6H A;  3OAN A;  2Y8F A;  1MAI A;  1TQZ A;  2NMB A;  4ZRJ A;  2OTX A;  2GJY A;  4HAY B;  4NSW A;  2RSG A;  3TCA A;  2EMT A;  1FAO A;  3KSY A;  1DDW A;  3GYO A;  2G35 A;  4PQ0 A;  4KHA A;  1I2H A;  3TW1 A;  1EGX A;  2J0M A;  1ISN A;  2I1K A;  3LJU X;  2PZ1 A;  3UZT A;  1EF1 A;  1MK7 B;  3T06 A;  2NZ8 B;  2UZR A;  2D9Y A;  2JP2 A;  2YT0 A;  1AWE A;  5D27 A;  1EVH A;  1NTV A;  3FEH A;  1V5M A;  1OY2 A;  1LW3 A;  1GC7 A;  2YF0 A;  1IRS A;  3SNH A;  3PVU A;  1K5G B;  1NI2 A;  3VIA A;  1ZC3 B;  2RLO A;  3G9W A;  4HB0 B;  1BWN A;  1M7E A;  2W2X D;  5L81 A;  1K5D B;  2DX5 A;  2RUK B;  4IAP A;  3KRW A;  5HE1 A;  4MK0 A;  3D8D A;  1WG7 A;  5FI1 A;  3FSS A;  4EMO A;  3A98 B;  2UVM A;  5C5B B;  4WJ7 A;  1W1D A;  1I7A A;  4HDQ A;  5D3V A;  1XR0 B;  3TVV A;  1KZG A;  3P7Z A;  1MIX A;  4NY0 A;  2ELA A;  3DXE A;  1QQG A;  5CLL B;  1U2B A;  4CHJ A;  5EFX A;  2LKO A;  3IVF A;  1FGZ A;  2COA A;  2ELB A;  1WVH A;  2P0H A;  4KHB B;  4HAZ B;  1X86 A;  4L6E A;  3SV1 A;  3DXD A;  2FJL A;  2Q13 A;  2Y8G A;  3U8Z A;  1XCG A;  1Y19 B;  3KRX A;  3F0W A;  1ZC4 B;  2RGN B;  1WGQ A;  3HK0 A;  1Z87 A;  3PG7 A;  4TYZ A;  3QWM A;  4Y94 A;  1X11 A;  4HAW B;  5C79 A;  5JLJ B;  5LOP B;  1U5F A;  1U27 A;  1U5G A;  1NU2 A;  4ZRK A;  1MK9 B;  2R0D A;  2W2X C;  4YL8 A;  2D9Z A;  2DYN A;  2CAY A;  2P8V A;  1UEF A;  4GZU A;  1XOD A;  2MFQ A;  2UZS A;  1EAZ A;  2GS0 A;  2D9V A;  2KCJ A;  1ZSQ A;  2KUP A;  4A5K A;  3PVW A;  3SO6 A;  1H4R A;  3MPX A;  2XQN M;  1PLS A;  1J0W A;  2H7E A;  2ZPY A;  2DA0 A;  2GCL A;  3N7C A;  1J19 A;  3ULC A;  1P6S A;  2D4Q A;  3BJI A;  4A6H A;  4GMX B;  2J0J A;  2P0D A;  1DDM A;  1MIZ B;  4K81 A;  2DLW A;  3WYF B;  2YRY A;  1DYN A;  1DBH A;  1WJ1 A;  3HW2 B;  4IOY X;  1P5T A;  2N23 A;  4DXA B;  2Y7B A;  4HAV B;  3X23 A;  2K2U A;  2R09 A;  2RNR B;  2BCJ A;  5C16 A;  2DN6 A;  1UPR A;  1TXD A;  5C5B A;  1BAK A;  4HB4 B;  5HE3 A;  3HQC A;  5DI9 B;  5HE2 A;  4GMV A;  4GPT B;  2COF A;  2DKP A;  2QKL A;  2YT1 A;  2EJ8 A;  5KCV A;  2I5F A;  5D3W A;  4KHO A;  5GOW B;  3P6A A;  1V61 A;  1OMW A;  1UNQ A;  2DKQ A;  2VSZ A;  1WI1 A;  2I5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...