2I5FA

Crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,5,6)p5
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
99
Chain Sequence
b'FTGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pleckstrin
publication title Structural analysis of the carboxy terminal PH domain of pleckstrin bound to D-myo-inositol 1,2,3,5,6-pentakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 20
structure length 99
sequence length 107
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2i5fA00
3GYOA 2K2JA 3PSCA 1XCGA 4HAXB 1UNPA 2RNRB 4PQ0A 2YS5A 2COFA 5KCVA 1N3HA 2EMTA 2UZSA 2NMBA 5C6RA 2ROZB 2UVMA 1SGHA 1PLSA 2GCLA 1MKEA 3P7ZA 1NU2A 1M7RA 1Z87A 1XODA 1E5WA 1WVHA 1W1GA 5JLJB 1EVHA 1UNRA 1PMSA 3A8QA 2D9YA 2G35A 1WJMA 5CLLB 4DXAB 2MDXA 3PP2A 1I7AA 2I5CA 4HB2B 3RCPA 1FAOA 1UNQA 5J3QA 2GS0A 2HE7A 3PG7A 5LONB 2DHIA 5D27A 3PEGA 1EGXA 1U5FA 4Y94A 1WI1A 3VOQA 2D2QA 2V76A 2RSGA 1X05A 2D11A 4GMXB 4K81A 2D9VA 3D8EA 5DHFB 1U27A 3QIJA 1B55A 2CY4A 3DXDA 1AWEA 4GXBA 1UEFA 3VIAA 5C16A 3LJUX 1UPRA 3MPXA 1FOEA 3FM8C 3QWMA 2RGNB 3U7DA 2EJ8A 3G9WA 2ELBA 4ZRKA 2RLOA 2L2IA 4B6HA 1U5DA 5C5BA 2DFKA 2YSZA 5HE3A 3KSYA 5DH9B 1GC6A 2DA0A 3P6AA 1MAIA 1WJ1A 2EC1A 2ADZA 3OANA 3ZVRA 2D9WA 2DYNA 2OTXA 3PZDA 1P5TA 2W2XC 3WYFB 1XR0B 1OMWA 2D10A 1NTYA 4HDQA 2LG1A 3DXCA 2M38A 4WVFB 4EJNA 2H7EA 1OQNA 3N7CA 5D3VA 2N23A 3UZTA 4YL8A 2Q13A 1KZ7A 2H7DA 4F7HA 2MFQA 4IAPA 2GCJA 1TXDA 1XX0A 3NSUA 2L1CA 4CHJA 1X1GA 2XQNM 4HB0B 2DX5A 1MK9B 5HE0A 4WJ7A 3F0WA 4K17A 3D8DA 4HAZB 2R09A 5GOWB 1DDMA 1WGUA 2N0YA 1WG7A 4A6FA 4KAXB 1FGZA 5DIFB 4TYZA 2QKMA 1TJ6A 4GMVA 2HTHB 2QKLA 2IYBA 4KHOA 5FI1A 2J0MA 3SNHA 2Y8FA 2I5FA 4CHMA 4A6HA 2D9ZA 1J0WA 1RJ2A 1BWNA 1ISNA 1EAZA 4HAVB 2DKPA 1NTVA 1I2HA 5C5BB 3SUZA 2VRWB 2K2UA 1TQZA 3M1IB 2X18A 1MPHA 1GC7A 3TO1A 3PVWA 4KHBB 4ZRIA 1XKEA 1BAKA 1DDWA 3ODXA 1ZM0A 3BINA 3ODWA 1LB1A 4DBBA 3HK0A 4HAUB 4HB4B 4XWXA 1FHOA 1P3RA 2FJLA 1ZC3B 1P6SA 4EMOA 1X86A 2NZ8B 1V89A 1DROA 2DKQA 1IRSA 2YS1A 5KQ1A 1V88A 4HHVA 2M14A 3X23A 4ZRJA 2YVCA 4D0NB 2YRYA 1H10A 4HATB 2DN6A 1K5DB 5HE2A 1W1DA 3KZ1A 1RRPB 2ZPYA 2ROVA 3AU4A 1V5MA 2YT1A 1MIZB 4K2OA 3DXEA 3T06A 4F7GA 3HW2B 2W2XD 4KHAA 1QC6A 5KQ4A 2DHKA 3BJIA 3IVFA 5JHHA 4HAYB 4F7UP 1DBHA 3GYPA 2GJYA 3FEHA 1WGQA 3O96A 1J19A 1DDVA 5D3XA 1ZSQA 5CLQB 4A6KA 1Q67A 3MDBC 5EFXA 1AQCA 2Y7BA 2DX1A 1XD4A 4Z2NA 1V5UA 2VSZA 4L6EA 3PVUA 2CRFA 2COCA 3F5RA 2COAA 5DI9B 1U5EA 4MK0A 1W1HA 1KI1B 1V61A 3TFMA 4IFSA 2P0DA 1ZC4B 1FB8A 2LYDA 2EMSA 3TVVA 4DX90 3SV1A 1EF1A 4NSWA 3ML4A 4PNKA 1BTKA 1X1FA 4KVGB 1M7EA 3KRXA 1U29A 2VKIA 5J3TA 4TKNA 3SO6A 2UZRA 2KGXB 1SHCA 1BTNA 2RUKB 2Z0QA 2LOZA 4GN1A 3WA0A 2AL6A 4P7IA 1LW3A 3ULBA 2DTCA 2MWNB 2P0HA 2KUPA 2DHJA 3ODOA 3CIKA 5FI0A 2AEHA 4NY0A 5D3WA 1K5GB 3TW1A 2Z0OA 3AU5A 2KCJA 1PFJA 2LKOA 2LULA 2W2WA 1H4RA 5JHGA 2P0FA 4BBKA 1MK7B 2Y8GA 4DX8A 1ZVRA 5DHAB 2CODA 3HQCA 1FHWA 3KRWA 4WSFA 3AJ4A 3U8ZA 3A98B 4K2PA 3SYXA 2ELAA 3ULCA 4A5KA 2J59M 5L81A 2R0DA 4IOYX 1Y5OA 2YS3A 4H8SA 2CY5A 3ZDTA 4MT7A 2J0KA 2OQBA 4YONA 2D9XA 5HE1A 4CYEA 1U2BA 2DLWA 4A6FB 4GZUA 2MKRA 1QQGA 3D8FA 5D3YA 4HDOA 1OY2A 4MY6A 5C79A 5LOPB 1U5GA 2I1JA 1FGYA 2YT0A 2I1KA 3FSSA 1DYNA 1NI2A 2Z0PA 2BCJA 2CAYA 2DYQA 1UPQA 4Z2MB 2RVBB 1GG3A 2IFSA 3A8PA 3QBVB 1MIXA 4HAWB 3TCAA 2J0JA 1X11A 1Y19B 4EKUA 1FHXA 4HB3B 2YF0A 3V5WA 4C0AA 1KZGA 3KY9A 3CXBB 4GPTB 2PZ1A 5JP4A 2P8VA 5J3YA 2E2XA 2LOXA 2D4QA 2JP2A 1V5PA 3PVLA 2K00A
chains in the Genus database with same CATH superfamily
3GYOA 2K2JA 5M4YB 3PSCA 1XCGA 4HAXB 1UNPA 2RNRB 4PQ0A 2YS5A 2COFA 2Z4DA 5KCVA 1N3HA 2EMTA 2UZSA 2NMBA 5C6RA 2ROZB 2UVMA 1SGHA 1PLSA 2GCLA 1MKEA 2FJUB 3P7ZA 4GOUA 1NU2A 1M7RA 1Z87A 1XODA 1E5WA 1WVHA 1W1GA 5JLJB 4GNKB 1EVHA 1UNRA 1PMSA 3A8QA 2D9YA 2G35A 1WJMA 5CLLB 4DXAB 2MDXA 3PP2A 1I7AA 4DIXA 2I5CA 4HB2B 3RCPA 1FAOA 1UNQA 5J3QA 2GS0A 2HE7A 3PG7A 5LONB 2ZKMX 2DHIA 5D27A 3PEGA 1EGXA 1U5FA 4Y94A 1WI1A 3VOQA 2D2QA 2V76A 2RSGA 1X05A 2D11A 4GMXB 4K81A 2D9VA 3D8EA 4CSQA 5DHFB 1U27A 3QIJA 1B55A 2CY4A 3DXDA 2KUQA 1AWEA 4GXBA 1UEFA 3VIAA 5C16A 3LJUX 1UPRA 3MPXA 1FOEA 3FM8C 3QWMA 2RGNB 2NBVA 3U7DA 2EJ8A 3G9WA 2ELBA 4ZRKA 2RLOA 2L2IA 4B6HA 1U5DA 5C5BA 2DFKA 2YSZA 5HE3A 3KSYA 5DH9B 1GC6A 2DA0A 3P6AA 4KHBA 1MAIA 1WJ1A 2EC1A 2ADZA 3OANA 2R2YA 3ZVRA 2D9WA 2DYNA 2OTXA 3PZDA 1P5TA 2W2XC 3WYFB 1XR0B 1OMWA 3FVCA 2D10A 1NTYA 4HDQA 2LG1A 3DXCA 2M38A 1T77A 4WVFB 4L1RA 4EJNA 5I2MA 2H7EA 1OQNA 2K49A 3N7CA 5D3VA 2N23A 3UZTA 4YL8A 3NWAA 2Q13A 1KZ7A 2H7DA 4F7HA 2MFQA 4IAPA 2GCJA 1TXDA 1XX0A 4HSIA 3NSUA 2L1CA 4CHJA 1X1GA 2XQNM 4HB0B 2DX5A 1MK9B 5HE0A 4WJ7A 3F0WA 4K17A 3D8DA 4HAZB 2R09A 5GOWB 1DDMA 1WGUA 2N0YA 1WG7A 4A6FA 4KAXB 1FGZA 5DIFB 4TYZA 2QKMA 1TJ6A 4GMVA 2HTHB 2QKLA 2IYBA 2RRFA 4KHOA 2J0MA 5FI1A 3SNHA 2Y8FA 2I5FA 4CHMA 4A6HA 2D9ZA 1J0WA 1RJ2A 1BWNA 1ISNA 1EAZA 4HAVB 2DKPA 1NTVA 1I2HA 5C5BB 3SUZA 2VRWB 2K2UA 4OT1A 1TQZA 3M1IB 2X18A 1MPHA 1GC7A 3TO1A 3PVWA 4KHBB 4ZRIA 1XKEA 1BAKA 3HIEA 1DDWA 3ODXA 1ZM0A 3BINA 3ODWA 1LB1A 4DBBA 3HK0A 4HAUB 4HB4B 4XWXA 3NWFA 1FHOA 1P3RA 2FJLA 1ZC3B 4QJ5B 1P6SA 4EMOA 1X86A 2NZ8B 1V89A 3A58A 1DROA 2DKQA 1IRSA 2YS1A 5KQ1A 1V88A 4HHVA 2M14A 3X23A 4ZRJA 2YVCA 4D0NB 2YRYA 1H10A 4HATB 2DN6A 1K5DB 5HE2A 1W1DA 3KZ1A 1RRPB 2ZPYA 2ROVA 3AU4A 1V5MA 2YT1A 1MIZB 4K2OA 3DXEA 3T06A 4F7GA 3HW2B 2W2XD 4KHAA 1QC6A 5KQ4A 2DHKA 3BJIA 3IVFA 3DCXA 5JHHA 5IRSA 4HAYB 4F7UP 1DBHA 3NWDA 3GYPA 3HSAA 2GJYA 3FEHA 1WGQA 2Z59A 3O96A 1J19A 1DDVA 5D3XA 1ZSQA 5CLQB 4A6KA 1Q67A 3MDBC 5EFXA 1AQCA 2Y7BA 2DX1A 1XD4A 4Z2NA 1V5UA 2VSZA 2Z13A 4L6EA 3PVUA 2CRFA 2COCA 3F5RA 2COAA 5DI9B 1U5EA 4MK0A 1W1HA 1KI1B 1V61A 3TFMA 4IFSA 2P0DA 1ZC4B 1FB8A 3U12A 2LYDA 2GUMA 2EMSA 3TVVA 4DX90 3OHMB 3SV1A 1EF1A 4NSWA 3ML4A 4PNKA 1BTKA 1X1FA 4KVGB 1M7EA 2KIEA 3KRXA 1U29A 2VKIA 5J3TA 4TKNA 3SO6A 2UZRA 2KGXB 1SHCA 1BTNA 2RUKB 2Z0QA 2LOZA 4QJ3B 3B77A 4GN1A 3WA0A 2AL6A 4P7IA 1LW3A 3ULBA 2DTCA 2MWNB 2P0HA 2KUPA 2DHJA 3ODOA 3CIKA 5FI0A 2AEHA 4NY0A 5D3WA 4QXAB 1K5GB 3TW1A 2Z0OA 3AU5A 2KCJA 1PFJA 4OSNA 2LKOA 2LULA 2W2WA 1H4RA 5JHGA 2P0FA 4BBKA 1MK7B 2Y8GA 4DX8A 1ZVRA 5DHAB 2CODA 3HQCA 1FHWA 3KRWA 4WSFA 3AJ4A 3U8ZA 3A98B 4K2PA 3SYXA 2ELAA 3ULCA 4A5KA 2J59M 5L81A 2KIGA 2R0DA 2KR0A 4IOYX 1Y5OA 2YS3A 4H8SA 2CY5A 3ZDTA 4MT7A 2J0KA 2OQBA 4YONA 2D9XA 5HE1A 4CYEA 1U2BA 1MI1A 2DLWA 4A6FB 4GZUA 2MKRA 2Z14A 1QQGA 3D8FA 5D3YA 4HDOA 1OY2A 4MY6A 5C79A 5LOPB 1U5GA 2I1JA 1FGYA 2YT0A 4D6WA 5I2SA 2I1KA 3FSSA 4QJ4B 1DYNA 1NI2A 2K8EA 2Z0PA 2BCJA 5LG4B 2CAYA 3NW8A 2DYQA 1UPQA 4Z2MB 2RVBB 1GG3A 2IFSA 3A8PA 3QBVB 1MIXA 1ZYIA 2YT2A 4HAWB 3TCAA 2J0JA 1X11A 1Y19B 4EKUA 1FHXA 4HB3B 2YF0A 3V5WA 4C0AA 1KZGA 3KY9A 3CXBB 4GPTB 2PZ1A 5JP4A 2P8VA 5J3YA 2E2XA 2LOXA 2D4QA 2JP2A 1V5PA 3PVLA 2K00A
chains in the Genus database with same CATH topology
3GYOA 2K2JA 3PSCA 1XCGA 4HAXB 1UNPA 2RNRB 4PQ0A 2YS5A 2COFA 5KCVA 1N3HA 2EMTA 2UZSA 2NMBA 5C6RA 2ROZB 2UVMA 1SGHA 1PLSA 2GCLA 1MKEA 3P7ZA 1NU2A 1M7RA 1Z87A 1XODA 1E5WA 1WVHA 1W1GA 5JLJB 1EVHA 1UNRA 1PMSA 3A8QA 2D9YA 2G35A 1WJMA 5CLLB 4DXAB 2MDXA 3PP2A 1I7AA 2I5CA 4HB2B 3RCPA 1FAOA 1UNQA 5J3QA 2GS0A 2HE7A 3PG7A 5LONB 2DHIA 5D27A 3PEGA 1EGXA 1U5FA 4Y94A 1WI1A 3VOQA 2D2QA 2V76A 2RSGA 1X05A 2D11A 4GMXB 4K81A 2D9VA 3D8EA 5DHFB 1U27A 3QIJA 1B55A 2CY4A 3DXDA 1AWEA 4GXBA 1UEFA 3VIAA 5C16A 3LJUX 1UPRA 3MPXA 1FOEA 3FM8C 3QWMA 2RGNB 3U7DA 2EJ8A 3G9WA 2ELBA 4ZRKA 2RLOA 2L2IA 4B6HA 1U5DA 5C5BA 2DFKA 2YSZA 5HE3A 3KSYA 5DH9B 1GC6A 2DA0A 3P6AA 1MAIA 1WJ1A 2EC1A 2ADZA 3OANA 3ZVRA 2D9WA 2DYNA 2OTXA 3PZDA 1P5TA 2W2XC 3WYFB 1XR0B 1OMWA 2D10A 1NTYA 4HDQA 2LG1A 3DXCA 2M38A 4WVFB 4EJNA 2H7EA 1OQNA 3N7CA 5D3VA 2N23A 3UZTA 4YL8A 2Q13A 1KZ7A 2H7DA 4F7HA 2MFQA 4IAPA 2GCJA 1TXDA 1XX0A 3NSUA 2L1CA 4CHJA 1X1GA 2XQNM 4HB0B 2DX5A 1MK9B 5HE0A 4WJ7A 3F0WA 4K17A 3D8DA 4HAZB 2R09A 5GOWB 1DDMA 1WGUA 2N0YA 1WG7A 4A6FA 4KAXB 1FGZA 5DIFB 4TYZA 2QKMA 1TJ6A 4GMVA 2HTHB 2QKLA 2IYBA 4KHOA 5FI1A 2J0MA 3SNHA 2Y8FA 2I5FA 4CHMA 4A6HA 2D9ZA 1J0WA 1RJ2A 1BWNA 1ISNA 1EAZA 4HAVB 2DKPA 1NTVA 1I2HA 5C5BB 3SUZA 2VRWB 2K2UA 1TQZA 3M1IB 2X18A 1MPHA 1GC7A 3TO1A 3PVWA 4KHBB 4ZRIA 1XKEA 1BAKA 1DDWA 3ODXA 1ZM0A 3BINA 3ODWA 1LB1A 4DBBA 3HK0A 4HAUB 4HB4B 4XWXA 1FHOA 1P3RA 2FJLA 1ZC3B 1P6SA 4EMOA 1X86A 2NZ8B 1V89A 1DROA 2DKQA 1IRSA 2YS1A 5KQ1A 1V88A 4HHVA 2M14A 3X23A 4ZRJA 2YVCA 4D0NB 2YRYA 1H10A 4HATB 2DN6A 1K5DB 5HE2A 1W1DA 3KZ1A 1RRPB 2ZPYA 2ROVA 3AU4A 1V5MA 2YT1A 1MIZB 4K2OA 3DXEA 3T06A 4F7GA 3HW2B 2W2XD 4KHAA 1QC6A 5KQ4A 2DHKA 3BJIA 3IVFA 5JHHA 4HAYB 4F7UP 1DBHA 3GYPA 2GJYA 3FEHA 1WGQA 3O96A 1J19A 1DDVA 5D3XA 1ZSQA 5CLQB 4A6KA 1Q67A 3MDBC 5EFXA 1AQCA 2Y7BA 2DX1A 1XD4A 4Z2NA 1V5UA 2VSZA 4L6EA 3PVUA 2CRFA 2COCA 3F5RA 2COAA 5DI9B 1U5EA 4MK0A 1W1HA 1KI1B 1V61A 3TFMA 4IFSA 2P0DA 1ZC4B 1FB8A 2LYDA 2EMSA 3TVVA 4DX90 3SV1A 1EF1A 4NSWA 3ML4A 4PNKA 1BTKA 1X1FA 4KVGB 1M7EA 3KRXA 1U29A 2VKIA 5J3TA 4TKNA 3SO6A 2UZRA 2KGXB 1SHCA 1BTNA 2RUKB 2Z0QA 2LOZA 4GN1A 3WA0A 2AL6A 4P7IA 1LW3A 3ULBA 2DTCA 2MWNB 2P0HA 2KUPA 2DHJA 3ODOA 3CIKA 5FI0A 2AEHA 4NY0A 5D3WA 1K5GB 3TW1A 2Z0OA 3AU5A 2KCJA 1PFJA 2LKOA 2LULA 2W2WA 1H4RA 5JHGA 2P0FA 4BBKA 1MK7B 2Y8GA 4DX8A 1ZVRA 5DHAB 2CODA 3HQCA 1FHWA 3KRWA 4WSFA 3AJ4A 3U8ZA 3A98B 4K2PA 3SYXA 2ELAA 3ULCA 4A5KA 2J59M 5L81A 2R0DA 4IOYX 1Y5OA 2YS3A 4H8SA 2CY5A 3ZDTA 4MT7A 2J0KA 2OQBA 4YONA 2D9XA 5HE1A 4CYEA 1U2BA 2DLWA 4A6FB 4GZUA 2MKRA 1QQGA 3D8FA 5D3YA 4HDOA 1OY2A 4MY6A 5C79A 5LOPB 1U5GA 2I1JA 1FGYA 2YT0A 2I1KA 3FSSA 1DYNA 1NI2A 2Z0PA 2BCJA 2CAYA 2DYQA 1UPQA 4Z2MB 2RVBB 1GG3A 2IFSA 3A8PA 3QBVB 1MIXA 4HAWB 3TCAA 2J0JA 1X11A 1Y19B 4EKUA 1FHXA 4HB3B 2YF0A 3V5WA 4C0AA 1KZGA 3KY9A 3CXBB 4GPTB 2PZ1A 5JP4A 2P8VA 5J3YA 2E2XA 2LOXA 2D4QA 2JP2A 1V5PA 3PVLA 2K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYO A;  2K2J A;  3PSC A;  1XCG A;  4HAX B;  1UNP A;  2RNR B;  4PQ0 A;  2YS5 A;  2COF A;  5KCV A;  1N3H A;  2EMT A;  2UZS A;  2NMB A;  5C6R A;  2ROZ B;  2UVM A;  1SGH A;  1PLS A;  2GCL A;  1MKE A;  3P7Z A;  1NU2 A;  1M7R A;  1Z87 A;  1XOD A;  1E5W A;  1WVH A;  1W1G A;  5JLJ B;  1EVH A;  1UNR A;  1PMS A;  3A8Q A;  2D9Y A;  2G35 A;  1WJM A;  5CLL B;  4DXA B;  2MDX A;  3PP2 A;  1I7A A;  2I5C A;  4HB2 B;  3RCP A;  1FAO A;  1UNQ A;  5J3Q A;  2GS0 A;  2HE7 A;  3PG7 A;  5LON B;  2DHI A;  5D27 A;  3PEG A;  1EGX A;  1U5F A;  4Y94 A;  1WI1 A;  3VOQ A;  2D2Q A;  2V76 A;  2RSG A;  1X05 A;  2D11 A;  4GMX B;  4K81 A;  2D9V A;  3D8E A;  5DHF B;  1U27 A;  3QIJ A;  1B55 A;  2CY4 A;  3DXD A;  1AWE A;  4GXB A;  1UEF A;  3VIA A;  5C16 A;  3LJU X;  1UPR A;  3MPX A;  1FOE A;  3FM8 C;  3QWM A;  2RGN B;  3U7D A;  2EJ8 A;  3G9W A;  2ELB A;  4ZRK A;  2RLO A;  2L2I A;  4B6H A;  1U5D A;  5C5B A;  2DFK A;  2YSZ A;  5HE3 A;  3KSY A;  5DH9 B;  1GC6 A;  2DA0 A;  3P6A A;  1MAI A;  1WJ1 A;  2EC1 A;  2ADZ A;  3OAN A;  3ZVR A;  2D9W A;  2DYN A;  2OTX A;  3PZD A;  1P5T A;  2W2X C;  3WYF B;  1XR0 B;  1OMW A;  2D10 A;  1NTY A;  4HDQ A;  2LG1 A;  3DXC A;  2M38 A;  4WVF B;  4EJN A;  2H7E A;  1OQN A;  3N7C A;  5D3V A;  2N23 A;  3UZT A;  4YL8 A;  2Q13 A;  1KZ7 A;  2H7D A;  4F7H A;  2MFQ A;  4IAP A;  2GCJ A;  1TXD A;  1XX0 A;  3NSU A;  2L1C A;  4CHJ A;  1X1G A;  2XQN M;  4HB0 B;  2DX5 A;  1MK9 B;  5HE0 A;  4WJ7 A;  3F0W A;  4K17 A;  3D8D A;  4HAZ B;  2R09 A;  5GOW B;  1DDM A;  1WGU A;  2N0Y A;  1WG7 A;  4A6F A;  4KAX B;  1FGZ A;  5DIF B;  4TYZ A;  2QKM A;  1TJ6 A;  4GMV A;  2HTH B;  2QKL A;  2IYB A;  4KHO A;  5FI1 A;  2J0M A;  3SNH A;  2Y8F A;  2I5F A;  4CHM A;  4A6H A;  2D9Z A;  1J0W A;  1RJ2 A;  1BWN A;  1ISN A;  1EAZ A;  4HAV B;  2DKP A;  1NTV A;  1I2H A;  5C5B B;  3SUZ A;  2VRW B;  2K2U A;  1TQZ A;  3M1I B;  2X18 A;  1MPH A;  1GC7 A;  3TO1 A;  3PVW A;  4KHB B;  4ZRI A;  1XKE A;  1BAK A;  1DDW A;  3ODX A;  1ZM0 A;  3BIN A;  3ODW A;  1LB1 A;  4DBB A;  3HK0 A;  4HAU B;  4HB4 B;  4XWX A;  1FHO A;  1P3R A;  2FJL A;  1ZC3 B;  1P6S A;  4EMO A;  1X86 A;  2NZ8 B;  1V89 A;  1DRO A;  2DKQ A;  1IRS A;  2YS1 A;  5KQ1 A;  1V88 A;  4HHV A;  2M14 A;  3X23 A;  4ZRJ A;  2YVC A;  4D0N B;  2YRY A;  1H10 A;  4HAT B;  2DN6 A;  1K5D B;  5HE2 A;  1W1D A;  3KZ1 A;  1RRP B;  2ZPY A;  2ROV A;  3AU4 A;  1V5M A;  2YT1 A;  1MIZ B;  4K2O A;  3DXE A;  3T06 A;  4F7G A;  3HW2 B;  2W2X D;  4KHA A;  1QC6 A;  5KQ4 A;  2DHK A;  3BJI A;  3IVF A;  5JHH A;  4HAY B;  4F7U P;  1DBH A;  3GYP A;  2GJY A;  3FEH A;  1WGQ A;  3O96 A;  1J19 A;  1DDV A;  5D3X A;  1ZSQ A;  5CLQ B;  4A6K A;  1Q67 A;  3MDB C;  5EFX A;  1AQC A;  2Y7B A;  2DX1 A;  1XD4 A;  4Z2N A;  1V5U A;  2VSZ A;  4L6E A;  3PVU A;  2CRF A;  2COC A;  3F5R A;  2COA A;  5DI9 B;  1U5E A;  4MK0 A;  1W1H A;  1KI1 B;  1V61 A;  3TFM A;  4IFS A;  2P0D A;  1ZC4 B;  1FB8 A;  2LYD A;  2EMS A;  3TVV A;  4DX9 0;  3SV1 A;  1EF1 A;  4NSW A;  3ML4 A;  4PNK A;  1BTK A;  1X1F A;  4KVG B;  1M7E A;  3KRX A;  1U29 A;  2VKI A;  5J3T A;  4TKN A;  3SO6 A;  2UZR A;  2KGX B;  1SHC A;  1BTN A;  2RUK B;  2Z0Q A;  2LOZ A;  4GN1 A;  3WA0 A;  2AL6 A;  4P7I A;  1LW3 A;  3ULB A;  2DTC A;  2MWN B;  2P0H A;  2KUP A;  2DHJ A;  3ODO A;  3CIK A;  5FI0 A;  2AEH A;  4NY0 A;  5D3W A;  1K5G B;  3TW1 A;  2Z0O A;  3AU5 A;  2KCJ A;  1PFJ A;  2LKO A;  2LUL A;  2W2W A;  1H4R A;  5JHG A;  2P0F A;  4BBK A;  1MK7 B;  2Y8G A;  4DX8 A;  1ZVR A;  5DHA B;  2COD A;  3HQC A;  1FHW A;  3KRW A;  4WSF A;  3AJ4 A;  3U8Z A;  3A98 B;  4K2P A;  3SYX A;  2ELA A;  3ULC A;  4A5K A;  2J59 M;  5L81 A;  2R0D A;  4IOY X;  1Y5O A;  2YS3 A;  4H8S A;  2CY5 A;  3ZDT A;  4MT7 A;  2J0K A;  2OQB A;  4YON A;  2D9X A;  5HE1 A;  4CYE A;  1U2B A;  2DLW A;  4A6F B;  4GZU A;  2MKR A;  1QQG A;  3D8F A;  5D3Y A;  4HDO A;  1OY2 A;  4MY6 A;  5C79 A;  5LOP B;  1U5G A;  2I1J A;  1FGY A;  2YT0 A;  2I1K A;  3FSS A;  1DYN A;  1NI2 A;  2Z0P A;  2BCJ A;  2CAY A;  2DYQ A;  1UPQ A;  4Z2M B;  2RVB B;  1GG3 A;  2IFS A;  3A8P A;  3QBV B;  1MIX A;  4HAW B;  3TCA A;  2J0J A;  1X11 A;  1Y19 B;  4EKU A;  1FHX A;  4HB3 B;  2YF0 A;  3V5W A;  4C0A A;  1KZG A;  3KY9 A;  3CXB B;  4GPT B;  2PZ1 A;  5JP4 A;  2P8V A;  5J3Y A;  2E2X A;  2LOX A;  2D4Q A;  2JP2 A;  1V5P A;  3PVL A;  2K00 A; 
#chains in the Genus database with same CATH topology
 3GYO A;  2K2J A;  5M4Y B;  3PSC A;  1XCG A;  4HAX B;  1UNP A;  2RNR B;  4PQ0 A;  2YS5 A;  2COF A;  2Z4D A;  5KCV A;  1N3H A;  2EMT A;  2UZS A;  2NMB A;  5C6R A;  2ROZ B;  2UVM A;  1SGH A;  1PLS A;  2GCL A;  1MKE A;  2FJU B;  3P7Z A;  4GOU A;  1NU2 A;  1M7R A;  1Z87 A;  1XOD A;  1E5W A;  1WVH A;  1W1G A;  5JLJ B;  4GNK B;  1EVH A;  1UNR A;  1PMS A;  3A8Q A;  2D9Y A;  2G35 A;  1WJM A;  5CLL B;  4DXA B;  2MDX A;  3PP2 A;  1I7A A;  4DIX A;  2I5C A;  4HB2 B;  3RCP A;  1FAO A;  1UNQ A;  5J3Q A;  2GS0 A;  2HE7 A;  3PG7 A;  5LON B;  2ZKM X;  2DHI A;  5D27 A;  3PEG A;  1EGX A;  1U5F A;  4Y94 A;  1WI1 A;  3VOQ A;  2D2Q A;  2V76 A;  2RSG A;  1X05 A;  2D11 A;  4GMX B;  4K81 A;  2D9V A;  3D8E A;  4CSQ A;  5DHF B;  1U27 A;  3QIJ A;  1B55 A;  2CY4 A;  3DXD A;  2KUQ A;  1AWE A;  4GXB A;  1UEF A;  3VIA A;  5C16 A;  3LJU X;  1UPR A;  3MPX A;  1FOE A;  3FM8 C;  3QWM A;  2RGN B;  2NBV A;  3U7D A;  2EJ8 A;  3G9W A;  2ELB A;  4ZRK A;  2RLO A;  2L2I A;  4B6H A;  1U5D A;  5C5B A;  2DFK A;  2YSZ A;  5HE3 A;  3KSY A;  5DH9 B;  1GC6 A;  2DA0 A;  3P6A A;  4KHB A;  1MAI A;  1WJ1 A;  2EC1 A;  2ADZ A;  3OAN A;  2R2Y A;  3ZVR A;  2D9W A;  2DYN A;  2OTX A;  3PZD A;  1P5T A;  2W2X C;  3WYF B;  1XR0 B;  1OMW A;  3FVC A;  2D10 A;  1NTY A;  4HDQ A;  2LG1 A;  3DXC A;  2M38 A;  1T77 A;  4WVF B;  4L1R A;  4EJN A;  5I2M A;  2H7E A;  1OQN A;  2K49 A;  3N7C A;  5D3V A;  2N23 A;  3UZT A;  4YL8 A;  3NWA A;  2Q13 A;  1KZ7 A;  2H7D A;  4F7H A;  2MFQ A;  4IAP A;  2GCJ A;  1TXD A;  1XX0 A;  4HSI A;  3NSU A;  2L1C A;  4CHJ A;  1X1G A;  2XQN M;  4HB0 B;  2DX5 A;  1MK9 B;  5HE0 A;  4WJ7 A;  3F0W A;  4K17 A;  3D8D A;  4HAZ B;  2R09 A;  5GOW B;  1DDM A;  1WGU A;  2N0Y A;  1WG7 A;  4A6F A;  4KAX B;  1FGZ A;  5DIF B;  4TYZ A;  2QKM A;  1TJ6 A;  4GMV A;  2HTH B;  2QKL A;  2IYB A;  2RRF A;  4KHO A;  2J0M A;  5FI1 A;  3SNH A;  2Y8F A;  2I5F A;  4CHM A;  4A6H A;  2D9Z A;  1J0W A;  1RJ2 A;  1BWN A;  1ISN A;  1EAZ A;  4HAV B;  2DKP A;  1NTV A;  1I2H A;  5C5B B;  3SUZ A;  2VRW B;  2K2U A;  4OT1 A;  1TQZ A;  3M1I B;  2X18 A;  1MPH A;  1GC7 A;  3TO1 A;  3PVW A;  4KHB B;  4ZRI A;  1XKE A;  1BAK A;  3HIE A;  1DDW A;  3ODX A;  1ZM0 A;  3BIN A;  3ODW A;  1LB1 A;  4DBB A;  3HK0 A;  4HAU B;  4HB4 B;  4XWX A;  3NWF A;  1FHO A;  1P3R A;  2FJL A;  1ZC3 B;  4QJ5 B;  1P6S A;  4EMO A;  1X86 A;  2NZ8 B;  1V89 A;  3A58 A;  1DRO A;  2DKQ A;  1IRS A;  2YS1 A;  5KQ1 A;  1V88 A;  4HHV A;  2M14 A;  3X23 A;  4ZRJ A;  2YVC A;  4D0N B;  2YRY A;  1H10 A;  4HAT B;  2DN6 A;  1K5D B;  5HE2 A;  1W1D A;  3KZ1 A;  1RRP B;  2ZPY A;  2ROV A;  3AU4 A;  1V5M A;  2YT1 A;  1MIZ B;  4K2O A;  3DXE A;  3T06 A;  4F7G A;  3HW2 B;  2W2X D;  4KHA A;  1QC6 A;  5KQ4 A;  2DHK A;  3BJI A;  3IVF A;  3DCX A;  5JHH A;  5IRS A;  4HAY B;  4F7U P;  1DBH A;  3NWD A;  3GYP A;  3HSA A;  2GJY A;  3FEH A;  1WGQ A;  2Z59 A;  3O96 A;  1J19 A;  1DDV A;  5D3X A;  1ZSQ A;  5CLQ B;  4A6K A;  1Q67 A;  3MDB C;  5EFX A;  1AQC A;  2Y7B A;  2DX1 A;  1XD4 A;  4Z2N A;  1V5U A;  2VSZ A;  2Z13 A;  4L6E A;  3PVU A;  2CRF A;  2COC A;  3F5R A;  2COA A;  5DI9 B;  1U5E A;  4MK0 A;  1W1H A;  1KI1 B;  1V61 A;  3TFM A;  4IFS A;  2P0D A;  1ZC4 B;  1FB8 A;  3U12 A;  2LYD A;  2GUM A;  2EMS A;  3TVV A;  4DX9 0;  3OHM B;  3SV1 A;  1EF1 A;  4NSW A;  3ML4 A;  4PNK A;  1BTK A;  1X1F A;  4KVG B;  1M7E A;  2KIE A;  3KRX A;  1U29 A;  2VKI A;  5J3T A;  4TKN A;  3SO6 A;  2UZR A;  2KGX B;  1SHC A;  1BTN A;  2RUK B;  2Z0Q A;  2LOZ A;  4QJ3 B;  3B77 A;  4GN1 A;  3WA0 A;  2AL6 A;  4P7I A;  1LW3 A;  3ULB A;  2DTC A;  2MWN B;  2P0H A;  2KUP A;  2DHJ A;  3ODO A;  3CIK A;  5FI0 A;  2AEH A;  4NY0 A;  5D3W A;  4QXA B;  1K5G B;  3TW1 A;  2Z0O A;  3AU5 A;  2KCJ A;  1PFJ A;  4OSN A;  2LKO A;  2LUL A;  2W2W A;  1H4R A;  5JHG A;  2P0F A;  4BBK A;  1MK7 B;  2Y8G A;  4DX8 A;  1ZVR A;  5DHA B;  2COD A;  3HQC A;  1FHW A;  3KRW A;  4WSF A;  3AJ4 A;  3U8Z A;  3A98 B;  4K2P A;  3SYX A;  2ELA A;  3ULC A;  4A5K A;  2J59 M;  5L81 A;  2KIG A;  2R0D A;  2KR0 A;  4IOY X;  1Y5O A;  2YS3 A;  4H8S A;  2CY5 A;  3ZDT A;  4MT7 A;  2J0K A;  2OQB A;  4YON A;  2D9X A;  5HE1 A;  4CYE A;  1U2B A;  1MI1 A;  2DLW A;  4A6F B;  4GZU A;  2MKR A;  2Z14 A;  1QQG A;  3D8F A;  5D3Y A;  4HDO A;  1OY2 A;  4MY6 A;  5C79 A;  5LOP B;  1U5G A;  2I1J A;  1FGY A;  2YT0 A;  4D6W A;  5I2S A;  2I1K A;  3FSS A;  4QJ4 B;  1DYN A;  1NI2 A;  2K8E A;  2Z0P A;  2BCJ A;  5LG4 B;  2CAY A;  3NW8 A;  2DYQ A;  1UPQ A;  4Z2M B;  2RVB B;  1GG3 A;  2IFS A;  3A8P A;  3QBV B;  1MIX A;  1ZYI A;  2YT2 A;  4HAW B;  3TCA A;  2J0J A;  1X11 A;  1Y19 B;  4EKU A;  1FHX A;  4HB3 B;  2YF0 A;  3V5W A;  4C0A A;  1KZG A;  3KY9 A;  3CXB B;  4GPT B;  2PZ1 A;  5JP4 A;  2P8V A;  5J3Y A;  2E2X A;  2LOX A;  2D4Q A;  2JP2 A;  1V5P A;  3PVL A;  2K00 A; 
#chains in the Genus database with same CATH homology
 3GYO A;  2K2J A;  3PSC A;  1XCG A;  4HAX B;  1UNP A;  2RNR B;  4PQ0 A;  2YS5 A;  2COF A;  5KCV A;  1N3H A;  2EMT A;  2UZS A;  2NMB A;  5C6R A;  2ROZ B;  2UVM A;  1SGH A;  1PLS A;  2GCL A;  1MKE A;  3P7Z A;  1NU2 A;  1M7R A;  1Z87 A;  1XOD A;  1E5W A;  1WVH A;  1W1G A;  5JLJ B;  1EVH A;  1UNR A;  1PMS A;  3A8Q A;  2D9Y A;  2G35 A;  1WJM A;  5CLL B;  4DXA B;  2MDX A;  3PP2 A;  1I7A A;  2I5C A;  4HB2 B;  3RCP A;  1FAO A;  1UNQ A;  5J3Q A;  2GS0 A;  2HE7 A;  3PG7 A;  5LON B;  2DHI A;  5D27 A;  3PEG A;  1EGX A;  1U5F A;  4Y94 A;  1WI1 A;  3VOQ A;  2D2Q A;  2V76 A;  2RSG A;  1X05 A;  2D11 A;  4GMX B;  4K81 A;  2D9V A;  3D8E A;  5DHF B;  1U27 A;  3QIJ A;  1B55 A;  2CY4 A;  3DXD A;  1AWE A;  4GXB A;  1UEF A;  3VIA A;  5C16 A;  3LJU X;  1UPR A;  3MPX A;  1FOE A;  3FM8 C;  3QWM A;  2RGN B;  3U7D A;  2EJ8 A;  3G9W A;  2ELB A;  4ZRK A;  2RLO A;  2L2I A;  4B6H A;  1U5D A;  5C5B A;  2DFK A;  2YSZ A;  5HE3 A;  3KSY A;  5DH9 B;  1GC6 A;  2DA0 A;  3P6A A;  1MAI A;  1WJ1 A;  2EC1 A;  2ADZ A;  3OAN A;  3ZVR A;  2D9W A;  2DYN A;  2OTX A;  3PZD A;  1P5T A;  2W2X C;  3WYF B;  1XR0 B;  1OMW A;  2D10 A;  1NTY A;  4HDQ A;  2LG1 A;  3DXC A;  2M38 A;  4WVF B;  4EJN A;  2H7E A;  1OQN A;  3N7C A;  5D3V A;  2N23 A;  3UZT A;  4YL8 A;  2Q13 A;  1KZ7 A;  2H7D A;  4F7H A;  2MFQ A;  4IAP A;  2GCJ A;  1TXD A;  1XX0 A;  3NSU A;  2L1C A;  4CHJ A;  1X1G A;  2XQN M;  4HB0 B;  2DX5 A;  1MK9 B;  5HE0 A;  4WJ7 A;  3F0W A;  4K17 A;  3D8D A;  4HAZ B;  2R09 A;  5GOW B;  1DDM A;  1WGU A;  2N0Y A;  1WG7 A;  4A6F A;  4KAX B;  1FGZ A;  5DIF B;  4TYZ A;  2QKM A;  1TJ6 A;  4GMV A;  2HTH B;  2QKL A;  2IYB A;  4KHO A;  5FI1 A;  2J0M A;  3SNH A;  2Y8F A;  2I5F A;  4CHM A;  4A6H A;  2D9Z A;  1J0W A;  1RJ2 A;  1BWN A;  1ISN A;  1EAZ A;  4HAV B;  2DKP A;  1NTV A;  1I2H A;  5C5B B;  3SUZ A;  2VRW B;  2K2U A;  1TQZ A;  3M1I B;  2X18 A;  1MPH A;  1GC7 A;  3TO1 A;  3PVW A;  4KHB B;  4ZRI A;  1XKE A;  1BAK A;  1DDW A;  3ODX A;  1ZM0 A;  3BIN A;  3ODW A;  1LB1 A;  4DBB A;  3HK0 A;  4HAU B;  4HB4 B;  4XWX A;  1FHO A;  1P3R A;  2FJL A;  1ZC3 B;  1P6S A;  4EMO A;  1X86 A;  2NZ8 B;  1V89 A;  1DRO A;  2DKQ A;  1IRS A;  2YS1 A;  5KQ1 A;  1V88 A;  4HHV A;  2M14 A;  3X23 A;  4ZRJ A;  2YVC A;  4D0N B;  2YRY A;  1H10 A;  4HAT B;  2DN6 A;  1K5D B;  5HE2 A;  1W1D A;  3KZ1 A;  1RRP B;  2ZPY A;  2ROV A;  3AU4 A;  1V5M A;  2YT1 A;  1MIZ B;  4K2O A;  3DXE A;  3T06 A;  4F7G A;  3HW2 B;  2W2X D;  4KHA A;  1QC6 A;  5KQ4 A;  2DHK A;  3BJI A;  3IVF A;  5JHH A;  4HAY B;  4F7U P;  1DBH A;  3GYP A;  2GJY A;  3FEH A;  1WGQ A;  3O96 A;  1J19 A;  1DDV A;  5D3X A;  1ZSQ A;  5CLQ B;  4A6K A;  1Q67 A;  3MDB C;  5EFX A;  1AQC A;  2Y7B A;  2DX1 A;  1XD4 A;  4Z2N A;  1V5U A;  2VSZ A;  4L6E A;  3PVU A;  2CRF A;  2COC A;  3F5R A;  2COA A;  5DI9 B;  1U5E A;  4MK0 A;  1W1H A;  1KI1 B;  1V61 A;  3TFM A;  4IFS A;  2P0D A;  1ZC4 B;  1FB8 A;  2LYD A;  2EMS A;  3TVV A;  4DX9 0;  3SV1 A;  1EF1 A;  4NSW A;  3ML4 A;  4PNK A;  1BTK A;  1X1F A;  4KVG B;  1M7E A;  3KRX A;  1U29 A;  2VKI A;  5J3T A;  4TKN A;  3SO6 A;  2UZR A;  2KGX B;  1SHC A;  1BTN A;  2RUK B;  2Z0Q A;  2LOZ A;  4GN1 A;  3WA0 A;  2AL6 A;  4P7I A;  1LW3 A;  3ULB A;  2DTC A;  2MWN B;  2P0H A;  2KUP A;  2DHJ A;  3ODO A;  3CIK A;  5FI0 A;  2AEH A;  4NY0 A;  5D3W A;  1K5G B;  3TW1 A;  2Z0O A;  3AU5 A;  2KCJ A;  1PFJ A;  2LKO A;  2LUL A;  2W2W A;  1H4R A;  5JHG A;  2P0F A;  4BBK A;  1MK7 B;  2Y8G A;  4DX8 A;  1ZVR A;  5DHA B;  2COD A;  3HQC A;  1FHW A;  3KRW A;  4WSF A;  3AJ4 A;  3U8Z A;  3A98 B;  4K2P A;  3SYX A;  2ELA A;  3ULC A;  4A5K A;  2J59 M;  5L81 A;  2R0D A;  4IOY X;  1Y5O A;  2YS3 A;  4H8S A;  2CY5 A;  3ZDT A;  4MT7 A;  2J0K A;  2OQB A;  4YON A;  2D9X A;  5HE1 A;  4CYE A;  1U2B A;  2DLW A;  4A6F B;  4GZU A;  2MKR A;  1QQG A;  3D8F A;  5D3Y A;  4HDO A;  1OY2 A;  4MY6 A;  5C79 A;  5LOP B;  1U5G A;  2I1J A;  1FGY A;  2YT0 A;  2I1K A;  3FSS A;  1DYN A;  1NI2 A;  2Z0P A;  2BCJ A;  2CAY A;  2DYQ A;  1UPQ A;  4Z2M B;  2RVB B;  1GG3 A;  2IFS A;  3A8P A;  3QBV B;  1MIX A;  4HAW B;  3TCA A;  2J0J A;  1X11 A;  1Y19 B;  4EKU A;  1FHX A;  4HB3 B;  2YF0 A;  3V5W A;  4C0A A;  1KZG A;  3KY9 A;  3CXB B;  4GPT B;  2PZ1 A;  5JP4 A;  2P8V A;  5J3Y A;  2E2X A;  2LOX A;  2D4Q A;  2JP2 A;  1V5P A;  3PVL A;  2K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...