2I5FA

Crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,5,6)p5
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
99
Chain Sequence
FTGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the carboxy terminal PH domain of pleckstrin bound to D-myo-inositol 1,2,3,5,6-pentakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Pleckstrin
total genus 20
structure length 99
sequence length 107
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2i5fA00
2L1CA 5JP4A 3BJIA 1V89A 5C5BB 4A5KA 1ZC4B 1MKEA 3SV1A 1W1DA 4K2OA 1WG7A 4HDQA 1U29A 1X05A 1FB8A 3SUZA 2P0DA 3F0WA 4MK0A 4HAYB 2ELBA 2CRFA 1IRSA 1UNPA 3ULCA 4ZRJA 4MT7A 3OANA 1EF1A 5FI0A 3WA0A 2RVBB 3VIAA 4F7UP 1BAKA 3ULBA 3PVUA 4WVFB 1DYNA 1FHXA 2ZPYA 2AL6A 2DX1A 2I1JA 5J3YA 2CY5A 3A98B 2GJYA 2R09A 4IOYX 2K2UA 1BTNA 4DX90 4KHBB 3M1IB 1MAIA 1WGQA 1FAOA 1LW3A 4C0AA 2ADZA 3D8EA 2KUPA 4WSFA 4HAVB 4HATB 1X1GA 2CY4A 3DXEA 2D2QA 1XCGA 1U5GA 2DYNA 4MY6A 1EVHA 2EMTA 1XKEA 4YL8A 1P3RA 4L6EA 4NY0A 1MIZB 2Y7BA 2HE7A 1Y19B 1V61A 2FJLA 3HQCA 2NMBA 2L2IA 5KQ4A 1AWEA 1UNQA 3KZ1A 3VOQA 5HE2A 2CODA 2LOZA 1OMWA 4KVGB 4TKNA 4TYZA 3SNHA 1NTYA 1J0WA 2E2XA 1OQNA 1V5UA 2IFSA 5JLJB 1DROA 4EMOA 3DXDA 4A6HA 1PLSA 2MWNB 1WJ1A 4DXAB 1ZC3B 5CLLB 2ROZB 2YS3A 3GYOA 2D11A 2YS5A 1E5WA 4HAWB 2YT1A 1UEFA 1XX0A 3V5WA 5D3WA 2MDXA 4GMVA 1B55A 2COCA 4GPTB 4F7HA 4CHMA 3G9WA 3PVLA 5KQ1A 1MIXA 3TFMA 3KSYA 3QBVB 3KRXA 5DIFB 1WVHA 1Y5OA 2KGXB 1DBHA 2EMSA 3CIKA 1GC6A 3SYXA 2LKOA 3P6AA 3PG7A 1FGZA 2IYBA 3X23A 5JHGA 4P7IA 1V5MA 2RSGA 2D4QA 1SHCA 3MDBC 4A6FA 2K2JA 2VSZA 2LOXA 2HTHB 1U5EA 2J0JA 1WGUA 3KRWA 1K5GB 3ODXA 1BTKA 5KCVA 1FOEA 4Y94A 3TW1A 4A6FB 2UZRA 4BBKA 1FHWA 1ZSQA 2DA0A 1LB1A 1K5DB 1V5PA 4A6KA 1U27A 1PMSA 1GG3A 2DLWA 4ZRIA 5HE1A 2K00A 2D10A 2ROVA 5HE3A 3N7CA 1RRPB 1NTVA 5D3VA 2Q13A 2GS0A 2DX5A 2DHJA 2X18A 2DHIA 1KI1B 4HDOA 3QIJA 2RLOA 4KHAA 3U7DA 2YRYA 3ODOA 3T06A 2M14A 5CLQB 5C79A 2GCJA 2N0YA 3ML4A 1U5FA 2MKRA 3AU5A 4ZRKA 5D27A 1U5DA 2UZSA 1H10A 1NI2A 5JHHA 1UPQA 1KZGA 1EGXA 2LG1A 1GC7A 2RUKB 2Y8GA 4EKUA 5C5BA 1V88A 4F7GA 4GMXB 4YONA 5HE0A 1TJ6A 3PVWA 1X86A 3ZVRA 4PNKA 4K17A 2CAYA 1X1FA 1QC6A 2Z0PA 3HK0A 5J3QA 2P0HA 1J19A 2D9ZA 1ZVRA 5DH9B 2LYDA 3A8QA 3UZTA 1DDVA 3SO6A 1Q67A 1TQZA 4H8SA 5LOPB 2G35A 4DX8A 1MK7B 3HW2B 4K2PA 5C16A 1SGHA 1RJ2A 1MK9B 3AU4A 2DYQA 4K81A 1W1GA 2RNRB 3MPXA 1DDMA 1I7AA 4CHJA 1MPHA 5GOWB 3P7ZA 4HB4B 3AJ4A 2OQBA 2J59M 2GCLA 1XD4A 2V76A 2DTCA 4HB3B 3RCPA 4CYEA 3A8PA 2YT0A 2DN6A 2NZ8B 2MFQA 1ZM0A 1N3HA 2N23A 2D9VA 3QWMA 2EJ8A 3O96A 5EFXA 2P8VA 3GYPA 4HAXB 1Z87A 2I5FA 4WJ7A 4D0NB 4HAZB 2J0KA 1M7EA 3ZDTA 2YSZA 4GN1A 2ELAA 5DHFB 2H7EA 4GXBA 1XR0B 2COFA 3DXCA 3U8ZA 1QQGA 2M38A 5DHAB 4IAPA 2J0MA 1H4RA 1FGYA 1M7RA 3TO1A 3FM8C 3LJUX 4NSWA 2BCJA 2R0DA 5D3YA 3IVFA 3WYFB 1TXDA 4GZUA 1UNRA 2D9WA 4KHOA 2KCJA 2VRWB 3KY9A 1P6SA 4B6HA 3PZDA 2QKLA 2Y8FA 5C6RA 2XQNM 1BWNA 2PZ1A 2I1KA 3PEGA 1XODA 2I5CA 3TVVA 3NSUA 2JP2A 1I2HA 1EAZA 2DFKA 1OY2A 2D9YA 4DBBA 4PQ0A 2YS1A 3TCAA 3F5RA 3ODWA 2DKPA 1X11A 2DHKA 2DKQA 4HAUB 2OTXA 2LULA 3D8FA 5L81A 3FEHA 3PP2A 1W1HA 2H7DA 2P0FA 2Z0OA 4HB2B 2W2XD 1P5TA 1PFJA 2COAA 2W2WA 4IFSA 2UVMA 1DDWA 4EJNA 2W2XC 3BINA 2YF0A 2EC1A 2QKMA 2RGNB 5D3XA 4KAXB 3D8DA 4Z2MB 1FHOA 1KZ7A 2AEHA 2VKIA 5LONB 5DI9B 1UPRA 1AQCA 4Z2NA 1WJMA 4HHVA 5FI1A 1ISNA 4XWXA 5J3TA 3FSSA 2YVCA 1U2BA 2Z0QA 4HB0B 1WI1A 2D9XA 1NU2A 3PSCA 3CXBB
chains in the Genus database with same CATH superfamily
2L1CA 5JP4A 3BJIA 1V89A 5C5BB 4A5KA 1ZC4B 2FJUB 1MKEA 3SV1A 1W1DA 4K2OA 1WG7A 4GOUA 4HDQA 3U12A 1U29A 1X05A 1FB8A 3SUZA 2P0DA 3F0WA 4MK0A 4HAYB 2ELBA 2CRFA 1IRSA 1UNPA 3ULCA 4ZRJA 4MT7A 3OANA 1EF1A 5FI0A 3WA0A 2Z59A 2RVBB 3VIAA 4F7UP 1BAKA 3ULBA 3NW8A 3PVUA 4WVFB 1DYNA 1FHXA 2ZPYA 2AL6A 2DX1A 2I1JA 5J3YA 2CY5A 3A98B 2GJYA 2R09A 4IOYX 2K2UA 1BTNA 4DX90 4KHBB 3M1IB 1MAIA 2KIEA 1WGQA 1FAOA 1LW3A 2Z13A 4C0AA 2ADZA 3D8EA 2KUPA 4WSFA 4HAVB 4HATB 1X1GA 5LG4B 2CY4A 3DXEA 2D2QA 1XCGA 1U5GA 2DYNA 4MY6A 1EVHA 3DCXA 2EMTA 1XKEA 4YL8A 1P3RA 4L6EA 4NY0A 1MIZB 2Y7BA 2HE7A 1Y19B 1V61A 2FJLA 3HQCA 2NMBA 2L2IA 5KQ4A 1AWEA 1UNQA 3HSAA 3KZ1A 3VOQA 5HE2A 2CODA 2LOZA 1OMWA 4KVGB 4TKNA 4TYZA 5M4YB 3OHMB 3SNHA 1NTYA 1J0WA 2E2XA 1OQNA 1V5UA 2IFSA 5JLJB 1DROA 4EMOA 3DXDA 4A6HA 1PLSA 2MWNB 1WJ1A 4DXAB 1ZC3B 5CLLB 2ROZB 2YS3A 3GYOA 2D11A 2YS5A 1E5WA 4HAWB 2YT1A 4QJ5B 1UEFA 1XX0A 3V5WA 5D3WA 2MDXA 4GMVA 2GUMA 4D6WA 2K49A 1B55A 2COCA 4GPTB 4F7HA 4CHMA 3G9WA 3PVLA 5KQ1A 1MIXA 3TFMA 3KSYA 3QBVB 3KRXA 5DIFB 1WVHA 1Y5OA 2KGXB 1DBHA 2EMSA 3CIKA 1GC6A 3SYXA 2LKOA 3P6AA 3PG7A 1FGZA 2IYBA 3X23A 5JHGA 4L1RA 4P7IA 1V5MA 2RSGA 2D4QA 1SHCA 3MDBC 4A6FA 2K2JA 2VSZA 2LOXA 2HTHB 1U5EA 2J0JA 1WGUA 3NWFA 3KRWA 1K5GB 3ODXA 1BTKA 5KCVA 1FOEA 4Y94A 3TW1A 4A6FB 2UZRA 4BBKA 1FHWA 1ZSQA 2DA0A 1LB1A 1K5DB 1V5PA 2Z4DA 4A6KA 1U27A 1PMSA 2YT2A 1GG3A 2DLWA 4ZRIA 1MI1A 5HE1A 2K00A 2D10A 2ROVA 5HE3A 3N7CA 1RRPB 2Z14A 1NTVA 5D3VA 2Q13A 2GS0A 2DX5A 2NBVA 2DHJA 2X18A 2DHIA 1KI1B 4HDOA 3QIJA 2RLOA 4KHAA 3U7DA 2YRYA 3ODOA 3T06A 2M14A 5CLQB 5C79A 2GCJA 2N0YA 3ML4A 4OSNA 1U5FA 2MKRA 3AU5A 4ZRKA 5D27A 1U5DA 2UZSA 5I2MA 1H10A 1NI2A 5JHHA 1UPQA 1KZGA 1EGXA 2LG1A 1GC7A 2RUKB 2Y8GA 4EKUA 5C5BA 1V88A 4F7GA 4GMXB 4YONA 5HE0A 1TJ6A 3PVWA 1X86A 3ZVRA 4PNKA 4K17A 2CAYA 1X1FA 1QC6A 2Z0PA 3HK0A 5J3QA 2P0HA 1J19A 2D9ZA 5I2SA 1ZVRA 5DH9B 2LYDA 3A8QA 3UZTA 1DDVA 3SO6A 1Q67A 1TQZA 4H8SA 3HIEA 5LOPB 2G35A 4DX8A 1MK7B 3HW2B 4K2PA 5C16A 1SGHA 1RJ2A 1MK9B 4KHBA 3AU4A 2DYQA 4K81A 1W1GA 2RNRB 3MPXA 1DDMA 1I7AA 4CHJA 3NWDA 1MPHA 2ZKMX 5GOWB 3P7ZA 4HB4B 3AJ4A 3B77A 2OQBA 4QJ4B 2J59M 2GCLA 1XD4A 2V76A 2DTCA 4HB3B 3RCPA 4CYEA 3A8PA 2YT0A 2DN6A 3NWAA 4QXAB 2NZ8B 2MFQA 1ZM0A 1N3HA 2K8EA 2N23A 2KIGA 2D9VA 1T77A 2R2YA 4DIXA 3QWMA 2EJ8A 3O96A 5EFXA 2P8VA 3GYPA 3A58A 4HAXB 1Z87A 2I5FA 4WJ7A 4OT1A 4D0NB 4HAZB 2J0KA 1M7EA 3ZDTA 2YSZA 2KR0A 4GN1A 2ELAA 5DHFB 2RRFA 4CSQA 2H7EA 4GXBA 1XR0B 2COFA 3DXCA 3U8ZA 1QQGA 2M38A 5DHAB 4IAPA 2J0MA 1H4RA 1FGYA 1M7RA 3TO1A 3FM8C 3LJUX 4NSWA 2BCJA 2R0DA 5D3YA 3IVFA 3WYFB 1TXDA 4GZUA 1UNRA 2D9WA 4KHOA 2KCJA 2VRWB 3KY9A 1P6SA 4B6HA 3PZDA 2QKLA 5IRSA 2Y8FA 5C6RA 2XQNM 1BWNA 2PZ1A 2I1KA 3PEGA 1XODA 2I5CA 3TVVA 3NSUA 2JP2A 1I2HA 1EAZA 2DFKA 1OY2A 2D9YA 2KUQA 4DBBA 4PQ0A 2YS1A 3TCAA 3F5RA 3ODWA 2DKPA 1X11A 2DHKA 2DKQA 4HAUB 2OTXA 2LULA 3D8FA 5L81A 3FEHA 1ZYIA 3PP2A 1W1HA 2H7DA 2P0FA 2Z0OA 4HB2B 2W2XD 1P5TA 1PFJA 2COAA 2W2WA 4IFSA 4QJ3B 2UVMA 1DDWA 4EJNA 2W2XC 3BINA 4GNKB 2YF0A 2EC1A 2QKMA 2RGNB 5D3XA 4KAXB 3D8DA 4Z2MB 1FHOA 1KZ7A 2AEHA 2VKIA 5LONB 5DI9B 4HSIA 1UPRA 1AQCA 4Z2NA 1WJMA 3FVCA 4HHVA 5FI1A 1ISNA 4XWXA 5J3TA 3FSSA 2YVCA 1U2BA 2Z0QA 4HB0B 1WI1A 2D9XA 1NU2A 3PSCA 3CXBB
chains in the Genus database with same CATH topology
2L1CA 5JP4A 3BJIA 1V89A 5C5BB 4A5KA 1ZC4B 1MKEA 3SV1A 1W1DA 4K2OA 1WG7A 4HDQA 1U29A 1X05A 1FB8A 3SUZA 2P0DA 3F0WA 4MK0A 4HAYB 2ELBA 2CRFA 1IRSA 1UNPA 3ULCA 4ZRJA 4MT7A 3OANA 1EF1A 5FI0A 3WA0A 2RVBB 3VIAA 4F7UP 1BAKA 3ULBA 3PVUA 4WVFB 1DYNA 1FHXA 2ZPYA 2AL6A 2DX1A 2I1JA 5J3YA 2CY5A 3A98B 2GJYA 2R09A 4IOYX 2K2UA 1BTNA 4DX90 4KHBB 3M1IB 1MAIA 1WGQA 1FAOA 1LW3A 4C0AA 2ADZA 3D8EA 2KUPA 4WSFA 4HAVB 4HATB 1X1GA 2CY4A 3DXEA 2D2QA 1XCGA 1U5GA 2DYNA 4MY6A 1EVHA 2EMTA 1XKEA 4YL8A 1P3RA 4L6EA 4NY0A 1MIZB 2Y7BA 2HE7A 1Y19B 1V61A 2FJLA 3HQCA 2NMBA 2L2IA 5KQ4A 1AWEA 1UNQA 3KZ1A 3VOQA 5HE2A 2CODA 2LOZA 1OMWA 4KVGB 4TKNA 4TYZA 3SNHA 1NTYA 1J0WA 2E2XA 1OQNA 1V5UA 2IFSA 5JLJB 1DROA 4EMOA 3DXDA 4A6HA 1PLSA 2MWNB 1WJ1A 4DXAB 1ZC3B 5CLLB 2ROZB 2YS3A 3GYOA 2D11A 2YS5A 1E5WA 4HAWB 2YT1A 1UEFA 1XX0A 3V5WA 5D3WA 2MDXA 4GMVA 1B55A 2COCA 4GPTB 4F7HA 4CHMA 3G9WA 3PVLA 5KQ1A 1MIXA 3TFMA 3KSYA 3QBVB 3KRXA 5DIFB 1WVHA 1Y5OA 2KGXB 1DBHA 2EMSA 3CIKA 1GC6A 3SYXA 2LKOA 3P6AA 3PG7A 1FGZA 2IYBA 3X23A 5JHGA 4P7IA 1V5MA 2RSGA 2D4QA 1SHCA 3MDBC 4A6FA 2K2JA 2VSZA 2LOXA 2HTHB 1U5EA 2J0JA 1WGUA 3KRWA 1K5GB 3ODXA 1BTKA 5KCVA 1FOEA 4Y94A 3TW1A 4A6FB 2UZRA 4BBKA 1FHWA 1ZSQA 2DA0A 1LB1A 1K5DB 1V5PA 4A6KA 1U27A 1PMSA 1GG3A 2DLWA 4ZRIA 5HE1A 2K00A 2D10A 2ROVA 5HE3A 3N7CA 1RRPB 1NTVA 5D3VA 2Q13A 2GS0A 2DX5A 2DHJA 2X18A 2DHIA 1KI1B 4HDOA 3QIJA 2RLOA 4KHAA 3U7DA 2YRYA 3ODOA 3T06A 2M14A 5CLQB 5C79A 2GCJA 2N0YA 3ML4A 1U5FA 2MKRA 3AU5A 4ZRKA 5D27A 1U5DA 2UZSA 1H10A 1NI2A 5JHHA 1UPQA 1KZGA 1EGXA 2LG1A 1GC7A 2RUKB 2Y8GA 4EKUA 5C5BA 1V88A 4F7GA 4GMXB 4YONA 5HE0A 1TJ6A 3PVWA 1X86A 3ZVRA 4PNKA 4K17A 2CAYA 1X1FA 1QC6A 2Z0PA 3HK0A 5J3QA 2P0HA 1J19A 2D9ZA 1ZVRA 5DH9B 2LYDA 3A8QA 3UZTA 1DDVA 3SO6A 1Q67A 1TQZA 4H8SA 5LOPB 2G35A 4DX8A 1MK7B 3HW2B 4K2PA 5C16A 1SGHA 1RJ2A 1MK9B 3AU4A 2DYQA 4K81A 1W1GA 2RNRB 3MPXA 1DDMA 1I7AA 4CHJA 1MPHA 5GOWB 3P7ZA 4HB4B 3AJ4A 2OQBA 2J59M 2GCLA 1XD4A 2V76A 2DTCA 4HB3B 3RCPA 4CYEA 3A8PA 2YT0A 2DN6A 2NZ8B 2MFQA 1ZM0A 1N3HA 2N23A 2D9VA 3QWMA 2EJ8A 3O96A 5EFXA 2P8VA 3GYPA 4HAXB 1Z87A 2I5FA 4WJ7A 4D0NB 4HAZB 2J0KA 1M7EA 3ZDTA 2YSZA 4GN1A 2ELAA 5DHFB 2H7EA 4GXBA 1XR0B 2COFA 3DXCA 3U8ZA 1QQGA 2M38A 5DHAB 4IAPA 2J0MA 1H4RA 1FGYA 1M7RA 3TO1A 3FM8C 3LJUX 4NSWA 2BCJA 2R0DA 5D3YA 3IVFA 3WYFB 1TXDA 4GZUA 1UNRA 2D9WA 4KHOA 2KCJA 2VRWB 3KY9A 1P6SA 4B6HA 3PZDA 2QKLA 2Y8FA 5C6RA 2XQNM 1BWNA 2PZ1A 2I1KA 3PEGA 1XODA 2I5CA 3TVVA 3NSUA 2JP2A 1I2HA 1EAZA 2DFKA 1OY2A 2D9YA 4DBBA 4PQ0A 2YS1A 3TCAA 3F5RA 3ODWA 2DKPA 1X11A 2DHKA 2DKQA 4HAUB 2OTXA 2LULA 3D8FA 5L81A 3FEHA 3PP2A 1W1HA 2H7DA 2P0FA 2Z0OA 4HB2B 2W2XD 1P5TA 1PFJA 2COAA 2W2WA 4IFSA 2UVMA 1DDWA 4EJNA 2W2XC 3BINA 2YF0A 2EC1A 2QKMA 2RGNB 5D3XA 4KAXB 3D8DA 4Z2MB 1FHOA 1KZ7A 2AEHA 2VKIA 5LONB 5DI9B 1UPRA 1AQCA 4Z2NA 1WJMA 4HHVA 5FI1A 1ISNA 4XWXA 5J3TA 3FSSA 2YVCA 1U2BA 2Z0QA 4HB0B 1WI1A 2D9XA 1NU2A 3PSCA 3CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1C A;  5JP4 A;  3BJI A;  1V89 A;  5C5B B;  4A5K A;  1ZC4 B;  1MKE A;  3SV1 A;  1W1D A;  4K2O A;  1WG7 A;  4HDQ A;  1U29 A;  1X05 A;  1FB8 A;  3SUZ A;  2P0D A;  3F0W A;  4MK0 A;  4HAY B;  2ELB A;  2CRF A;  1IRS A;  1UNP A;  3ULC A;  4ZRJ A;  4MT7 A;  3OAN A;  1EF1 A;  5FI0 A;  3WA0 A;  2RVB B;  3VIA A;  4F7U P;  1BAK A;  3ULB A;  3PVU A;  4WVF B;  1DYN A;  1FHX A;  2ZPY A;  2AL6 A;  2DX1 A;  2I1J A;  5J3Y A;  2CY5 A;  3A98 B;  2GJY A;  2R09 A;  4IOY X;  2K2U A;  1BTN A;  4DX9 0;  4KHB B;  3M1I B;  1MAI A;  1WGQ A;  1FAO A;  1LW3 A;  4C0A A;  2ADZ A;  3D8E A;  2KUP A;  4WSF A;  4HAV B;  4HAT B;  1X1G A;  2CY4 A;  3DXE A;  2D2Q A;  1XCG A;  1U5G A;  2DYN A;  4MY6 A;  1EVH A;  2EMT A;  1XKE A;  4YL8 A;  1P3R A;  4L6E A;  4NY0 A;  1MIZ B;  2Y7B A;  2HE7 A;  1Y19 B;  1V61 A;  2FJL A;  3HQC A;  2NMB A;  2L2I A;  5KQ4 A;  1AWE A;  1UNQ A;  3KZ1 A;  3VOQ A;  5HE2 A;  2COD A;  2LOZ A;  1OMW A;  4KVG B;  4TKN A;  4TYZ A;  3SNH A;  1NTY A;  1J0W A;  2E2X A;  1OQN A;  1V5U A;  2IFS A;  5JLJ B;  1DRO A;  4EMO A;  3DXD A;  4A6H A;  1PLS A;  2MWN B;  1WJ1 A;  4DXA B;  1ZC3 B;  5CLL B;  2ROZ B;  2YS3 A;  3GYO A;  2D11 A;  2YS5 A;  1E5W A;  4HAW B;  2YT1 A;  1UEF A;  1XX0 A;  3V5W A;  5D3W A;  2MDX A;  4GMV A;  1B55 A;  2COC A;  4GPT B;  4F7H A;  4CHM A;  3G9W A;  3PVL A;  5KQ1 A;  1MIX A;  3TFM A;  3KSY A;  3QBV B;  3KRX A;  5DIF B;  1WVH A;  1Y5O A;  2KGX B;  1DBH A;  2EMS A;  3CIK A;  1GC6 A;  3SYX A;  2LKO A;  3P6A A;  3PG7 A;  1FGZ A;  2IYB A;  3X23 A;  5JHG A;  4P7I A;  1V5M A;  2RSG A;  2D4Q A;  1SHC A;  3MDB C;  4A6F A;  2K2J A;  2VSZ A;  2LOX A;  2HTH B;  1U5E A;  2J0J A;  1WGU A;  3KRW A;  1K5G B;  3ODX A;  1BTK A;  5KCV A;  1FOE A;  4Y94 A;  3TW1 A;  4A6F B;  2UZR A;  4BBK A;  1FHW A;  1ZSQ A;  2DA0 A;  1LB1 A;  1K5D B;  1V5P A;  4A6K A;  1U27 A;  1PMS A;  1GG3 A;  2DLW A;  4ZRI A;  5HE1 A;  2K00 A;  2D10 A;  2ROV A;  5HE3 A;  3N7C A;  1RRP B;  1NTV A;  5D3V A;  2Q13 A;  2GS0 A;  2DX5 A;  2DHJ A;  2X18 A;  2DHI A;  1KI1 B;  4HDO A;  3QIJ A;  2RLO A;  4KHA A;  3U7D A;  2YRY A;  3ODO A;  3T06 A;  2M14 A;  5CLQ B;  5C79 A;  2GCJ A;  2N0Y A;  3ML4 A;  1U5F A;  2MKR A;  3AU5 A;  4ZRK A;  5D27 A;  1U5D A;  2UZS A;  1H10 A;  1NI2 A;  5JHH A;  1UPQ A;  1KZG A;  1EGX A;  2LG1 A;  1GC7 A;  2RUK B;  2Y8G A;  4EKU A;  5C5B A;  1V88 A;  4F7G A;  4GMX B;  4YON A;  5HE0 A;  1TJ6 A;  3PVW A;  1X86 A;  3ZVR A;  4PNK A;  4K17 A;  2CAY A;  1X1F A;  1QC6 A;  2Z0P A;  3HK0 A;  5J3Q A;  2P0H A;  1J19 A;  2D9Z A;  1ZVR A;  5DH9 B;  2LYD A;  3A8Q A;  3UZT A;  1DDV A;  3SO6 A;  1Q67 A;  1TQZ A;  4H8S A;  5LOP B;  2G35 A;  4DX8 A;  1MK7 B;  3HW2 B;  4K2P A;  5C16 A;  1SGH A;  1RJ2 A;  1MK9 B;  3AU4 A;  2DYQ A;  4K81 A;  1W1G A;  2RNR B;  3MPX A;  1DDM A;  1I7A A;  4CHJ A;  1MPH A;  5GOW B;  3P7Z A;  4HB4 B;  3AJ4 A;  2OQB A;  2J59 M;  2GCL A;  1XD4 A;  2V76 A;  2DTC A;  4HB3 B;  3RCP A;  4CYE A;  3A8P A;  2YT0 A;  2DN6 A;  2NZ8 B;  2MFQ A;  1ZM0 A;  1N3H A;  2N23 A;  2D9V A;  3QWM A;  2EJ8 A;  3O96 A;  5EFX A;  2P8V A;  3GYP A;  4HAX B;  1Z87 A;  2I5F A;  4WJ7 A;  4D0N B;  4HAZ B;  2J0K A;  1M7E A;  3ZDT A;  2YSZ A;  4GN1 A;  2ELA A;  5DHF B;  2H7E A;  4GXB A;  1XR0 B;  2COF A;  3DXC A;  3U8Z A;  1QQG A;  2M38 A;  5DHA B;  4IAP A;  2J0M A;  1H4R A;  1FGY A;  1M7R A;  3TO1 A;  3FM8 C;  3LJU X;  4NSW A;  2BCJ A;  2R0D A;  5D3Y A;  3IVF A;  3WYF B;  1TXD A;  4GZU A;  1UNR A;  2D9W A;  4KHO A;  2KCJ A;  2VRW B;  3KY9 A;  1P6S A;  4B6H A;  3PZD A;  2QKL A;  2Y8F A;  5C6R A;  2XQN M;  1BWN A;  2PZ1 A;  2I1K A;  3PEG A;  1XOD A;  2I5C A;  3TVV A;  3NSU A;  2JP2 A;  1I2H A;  1EAZ A;  2DFK A;  1OY2 A;  2D9Y A;  4DBB A;  4PQ0 A;  2YS1 A;  3TCA A;  3F5R A;  3ODW A;  2DKP A;  1X11 A;  2DHK A;  2DKQ A;  4HAU B;  2OTX A;  2LUL A;  3D8F A;  5L81 A;  3FEH A;  3PP2 A;  1W1H A;  2H7D A;  2P0F A;  2Z0O A;  4HB2 B;  2W2X D;  1P5T A;  1PFJ A;  2COA A;  2W2W A;  4IFS A;  2UVM A;  1DDW A;  4EJN A;  2W2X C;  3BIN A;  2YF0 A;  2EC1 A;  2QKM A;  2RGN B;  5D3X A;  4KAX B;  3D8D A;  4Z2M B;  1FHO A;  1KZ7 A;  2AEH A;  2VKI A;  5LON B;  5DI9 B;  1UPR A;  1AQC A;  4Z2N A;  1WJM A;  4HHV A;  5FI1 A;  1ISN A;  4XWX A;  5J3T A;  3FSS A;  2YVC A;  1U2B A;  2Z0Q A;  4HB0 B;  1WI1 A;  2D9X A;  1NU2 A;  3PSC A;  3CXB B; 
#chains in the Genus database with same CATH topology
 2L1C A;  5JP4 A;  3BJI A;  1V89 A;  5C5B B;  4A5K A;  1ZC4 B;  2FJU B;  1MKE A;  3SV1 A;  1W1D A;  4K2O A;  1WG7 A;  4GOU A;  4HDQ A;  3U12 A;  1U29 A;  1X05 A;  1FB8 A;  3SUZ A;  2P0D A;  3F0W A;  4MK0 A;  4HAY B;  2ELB A;  2CRF A;  1IRS A;  1UNP A;  3ULC A;  4ZRJ A;  4MT7 A;  3OAN A;  1EF1 A;  5FI0 A;  3WA0 A;  2Z59 A;  2RVB B;  3VIA A;  4F7U P;  1BAK A;  3ULB A;  3NW8 A;  3PVU A;  4WVF B;  1DYN A;  1FHX A;  2ZPY A;  2AL6 A;  2DX1 A;  2I1J A;  5J3Y A;  2CY5 A;  3A98 B;  2GJY A;  2R09 A;  4IOY X;  2K2U A;  1BTN A;  4DX9 0;  4KHB B;  3M1I B;  1MAI A;  2KIE A;  1WGQ A;  1FAO A;  1LW3 A;  2Z13 A;  4C0A A;  2ADZ A;  3D8E A;  2KUP A;  4WSF A;  4HAV B;  4HAT B;  1X1G A;  5LG4 B;  2CY4 A;  3DXE A;  2D2Q A;  1XCG A;  1U5G A;  2DYN A;  4MY6 A;  1EVH A;  3DCX A;  2EMT A;  1XKE A;  4YL8 A;  1P3R A;  4L6E A;  4NY0 A;  1MIZ B;  2Y7B A;  2HE7 A;  1Y19 B;  1V61 A;  2FJL A;  3HQC A;  2NMB A;  2L2I A;  5KQ4 A;  1AWE A;  1UNQ A;  3HSA A;  3KZ1 A;  3VOQ A;  5HE2 A;  2COD A;  2LOZ A;  1OMW A;  4KVG B;  4TKN A;  4TYZ A;  5M4Y B;  3OHM B;  3SNH A;  1NTY A;  1J0W A;  2E2X A;  1OQN A;  1V5U A;  2IFS A;  5JLJ B;  1DRO A;  4EMO A;  3DXD A;  4A6H A;  1PLS A;  2MWN B;  1WJ1 A;  4DXA B;  1ZC3 B;  5CLL B;  2ROZ B;  2YS3 A;  3GYO A;  2D11 A;  2YS5 A;  1E5W A;  4HAW B;  2YT1 A;  4QJ5 B;  1UEF A;  1XX0 A;  3V5W A;  5D3W A;  2MDX A;  4GMV A;  2GUM A;  4D6W A;  2K49 A;  1B55 A;  2COC A;  4GPT B;  4F7H A;  4CHM A;  3G9W A;  3PVL A;  5KQ1 A;  1MIX A;  3TFM A;  3KSY A;  3QBV B;  3KRX A;  5DIF B;  1WVH A;  1Y5O A;  2KGX B;  1DBH A;  2EMS A;  3CIK A;  1GC6 A;  3SYX A;  2LKO A;  3P6A A;  3PG7 A;  1FGZ A;  2IYB A;  3X23 A;  5JHG A;  4L1R A;  4P7I A;  1V5M A;  2RSG A;  2D4Q A;  1SHC A;  3MDB C;  4A6F A;  2K2J A;  2VSZ A;  2LOX A;  2HTH B;  1U5E A;  2J0J A;  1WGU A;  3NWF A;  3KRW A;  1K5G B;  3ODX A;  1BTK A;  5KCV A;  1FOE A;  4Y94 A;  3TW1 A;  4A6F B;  2UZR A;  4BBK A;  1FHW A;  1ZSQ A;  2DA0 A;  1LB1 A;  1K5D B;  1V5P A;  2Z4D A;  4A6K A;  1U27 A;  1PMS A;  2YT2 A;  1GG3 A;  2DLW A;  4ZRI A;  1MI1 A;  5HE1 A;  2K00 A;  2D10 A;  2ROV A;  5HE3 A;  3N7C A;  1RRP B;  2Z14 A;  1NTV A;  5D3V A;  2Q13 A;  2GS0 A;  2DX5 A;  2NBV A;  2DHJ A;  2X18 A;  2DHI A;  1KI1 B;  4HDO A;  3QIJ A;  2RLO A;  4KHA A;  3U7D A;  2YRY A;  3ODO A;  3T06 A;  2M14 A;  5CLQ B;  5C79 A;  2GCJ A;  2N0Y A;  3ML4 A;  4OSN A;  1U5F A;  2MKR A;  3AU5 A;  4ZRK A;  5D27 A;  1U5D A;  2UZS A;  5I2M A;  1H10 A;  1NI2 A;  5JHH A;  1UPQ A;  1KZG A;  1EGX A;  2LG1 A;  1GC7 A;  2RUK B;  2Y8G A;  4EKU A;  5C5B A;  1V88 A;  4F7G A;  4GMX B;  4YON A;  5HE0 A;  1TJ6 A;  3PVW A;  1X86 A;  3ZVR A;  4PNK A;  4K17 A;  2CAY A;  1X1F A;  1QC6 A;  2Z0P A;  3HK0 A;  5J3Q A;  2P0H A;  1J19 A;  2D9Z A;  5I2S A;  1ZVR A;  5DH9 B;  2LYD A;  3A8Q A;  3UZT A;  1DDV A;  3SO6 A;  1Q67 A;  1TQZ A;  4H8S A;  3HIE A;  5LOP B;  2G35 A;  4DX8 A;  1MK7 B;  3HW2 B;  4K2P A;  5C16 A;  1SGH A;  1RJ2 A;  1MK9 B;  4KHB A;  3AU4 A;  2DYQ A;  4K81 A;  1W1G A;  2RNR B;  3MPX A;  1DDM A;  1I7A A;  4CHJ A;  3NWD A;  1MPH A;  2ZKM X;  5GOW B;  3P7Z A;  4HB4 B;  3AJ4 A;  3B77 A;  2OQB A;  4QJ4 B;  2J59 M;  2GCL A;  1XD4 A;  2V76 A;  2DTC A;  4HB3 B;  3RCP A;  4CYE A;  3A8P A;  2YT0 A;  2DN6 A;  3NWA A;  4QXA B;  2NZ8 B;  2MFQ A;  1ZM0 A;  1N3H A;  2K8E A;  2N23 A;  2KIG A;  2D9V A;  1T77 A;  2R2Y A;  4DIX A;  3QWM A;  2EJ8 A;  3O96 A;  5EFX A;  2P8V A;  3GYP A;  3A58 A;  4HAX B;  1Z87 A;  2I5F A;  4WJ7 A;  4OT1 A;  4D0N B;  4HAZ B;  2J0K A;  1M7E A;  3ZDT A;  2YSZ A;  2KR0 A;  4GN1 A;  2ELA A;  5DHF B;  2RRF A;  4CSQ A;  2H7E A;  4GXB A;  1XR0 B;  2COF A;  3DXC A;  3U8Z A;  1QQG A;  2M38 A;  5DHA B;  4IAP A;  2J0M A;  1H4R A;  1FGY A;  1M7R A;  3TO1 A;  3FM8 C;  3LJU X;  4NSW A;  2BCJ A;  2R0D A;  5D3Y A;  3IVF A;  3WYF B;  1TXD A;  4GZU A;  1UNR A;  2D9W A;  4KHO A;  2KCJ A;  2VRW B;  3KY9 A;  1P6S A;  4B6H A;  3PZD A;  2QKL A;  5IRS A;  2Y8F A;  5C6R A;  2XQN M;  1BWN A;  2PZ1 A;  2I1K A;  3PEG A;  1XOD A;  2I5C A;  3TVV A;  3NSU A;  2JP2 A;  1I2H A;  1EAZ A;  2DFK A;  1OY2 A;  2D9Y A;  2KUQ A;  4DBB A;  4PQ0 A;  2YS1 A;  3TCA A;  3F5R A;  3ODW A;  2DKP A;  1X11 A;  2DHK A;  2DKQ A;  4HAU B;  2OTX A;  2LUL A;  3D8F A;  5L81 A;  3FEH A;  1ZYI A;  3PP2 A;  1W1H A;  2H7D A;  2P0F A;  2Z0O A;  4HB2 B;  2W2X D;  1P5T A;  1PFJ A;  2COA A;  2W2W A;  4IFS A;  4QJ3 B;  2UVM A;  1DDW A;  4EJN A;  2W2X C;  3BIN A;  4GNK B;  2YF0 A;  2EC1 A;  2QKM A;  2RGN B;  5D3X A;  4KAX B;  3D8D A;  4Z2M B;  1FHO A;  1KZ7 A;  2AEH A;  2VKI A;  5LON B;  5DI9 B;  4HSI A;  1UPR A;  1AQC A;  4Z2N A;  1WJM A;  3FVC A;  4HHV A;  5FI1 A;  1ISN A;  4XWX A;  5J3T A;  3FSS A;  2YVC A;  1U2B A;  2Z0Q A;  4HB0 B;  1WI1 A;  2D9X A;  1NU2 A;  3PSC A;  3CXB B; 
#chains in the Genus database with same CATH homology
 2L1C A;  5JP4 A;  3BJI A;  1V89 A;  5C5B B;  4A5K A;  1ZC4 B;  1MKE A;  3SV1 A;  1W1D A;  4K2O A;  1WG7 A;  4HDQ A;  1U29 A;  1X05 A;  1FB8 A;  3SUZ A;  2P0D A;  3F0W A;  4MK0 A;  4HAY B;  2ELB A;  2CRF A;  1IRS A;  1UNP A;  3ULC A;  4ZRJ A;  4MT7 A;  3OAN A;  1EF1 A;  5FI0 A;  3WA0 A;  2RVB B;  3VIA A;  4F7U P;  1BAK A;  3ULB A;  3PVU A;  4WVF B;  1DYN A;  1FHX A;  2ZPY A;  2AL6 A;  2DX1 A;  2I1J A;  5J3Y A;  2CY5 A;  3A98 B;  2GJY A;  2R09 A;  4IOY X;  2K2U A;  1BTN A;  4DX9 0;  4KHB B;  3M1I B;  1MAI A;  1WGQ A;  1FAO A;  1LW3 A;  4C0A A;  2ADZ A;  3D8E A;  2KUP A;  4WSF A;  4HAV B;  4HAT B;  1X1G A;  2CY4 A;  3DXE A;  2D2Q A;  1XCG A;  1U5G A;  2DYN A;  4MY6 A;  1EVH A;  2EMT A;  1XKE A;  4YL8 A;  1P3R A;  4L6E A;  4NY0 A;  1MIZ B;  2Y7B A;  2HE7 A;  1Y19 B;  1V61 A;  2FJL A;  3HQC A;  2NMB A;  2L2I A;  5KQ4 A;  1AWE A;  1UNQ A;  3KZ1 A;  3VOQ A;  5HE2 A;  2COD A;  2LOZ A;  1OMW A;  4KVG B;  4TKN A;  4TYZ A;  3SNH A;  1NTY A;  1J0W A;  2E2X A;  1OQN A;  1V5U A;  2IFS A;  5JLJ B;  1DRO A;  4EMO A;  3DXD A;  4A6H A;  1PLS A;  2MWN B;  1WJ1 A;  4DXA B;  1ZC3 B;  5CLL B;  2ROZ B;  2YS3 A;  3GYO A;  2D11 A;  2YS5 A;  1E5W A;  4HAW B;  2YT1 A;  1UEF A;  1XX0 A;  3V5W A;  5D3W A;  2MDX A;  4GMV A;  1B55 A;  2COC A;  4GPT B;  4F7H A;  4CHM A;  3G9W A;  3PVL A;  5KQ1 A;  1MIX A;  3TFM A;  3KSY A;  3QBV B;  3KRX A;  5DIF B;  1WVH A;  1Y5O A;  2KGX B;  1DBH A;  2EMS A;  3CIK A;  1GC6 A;  3SYX A;  2LKO A;  3P6A A;  3PG7 A;  1FGZ A;  2IYB A;  3X23 A;  5JHG A;  4P7I A;  1V5M A;  2RSG A;  2D4Q A;  1SHC A;  3MDB C;  4A6F A;  2K2J A;  2VSZ A;  2LOX A;  2HTH B;  1U5E A;  2J0J A;  1WGU A;  3KRW A;  1K5G B;  3ODX A;  1BTK A;  5KCV A;  1FOE A;  4Y94 A;  3TW1 A;  4A6F B;  2UZR A;  4BBK A;  1FHW A;  1ZSQ A;  2DA0 A;  1LB1 A;  1K5D B;  1V5P A;  4A6K A;  1U27 A;  1PMS A;  1GG3 A;  2DLW A;  4ZRI A;  5HE1 A;  2K00 A;  2D10 A;  2ROV A;  5HE3 A;  3N7C A;  1RRP B;  1NTV A;  5D3V A;  2Q13 A;  2GS0 A;  2DX5 A;  2DHJ A;  2X18 A;  2DHI A;  1KI1 B;  4HDO A;  3QIJ A;  2RLO A;  4KHA A;  3U7D A;  2YRY A;  3ODO A;  3T06 A;  2M14 A;  5CLQ B;  5C79 A;  2GCJ A;  2N0Y A;  3ML4 A;  1U5F A;  2MKR A;  3AU5 A;  4ZRK A;  5D27 A;  1U5D A;  2UZS A;  1H10 A;  1NI2 A;  5JHH A;  1UPQ A;  1KZG A;  1EGX A;  2LG1 A;  1GC7 A;  2RUK B;  2Y8G A;  4EKU A;  5C5B A;  1V88 A;  4F7G A;  4GMX B;  4YON A;  5HE0 A;  1TJ6 A;  3PVW A;  1X86 A;  3ZVR A;  4PNK A;  4K17 A;  2CAY A;  1X1F A;  1QC6 A;  2Z0P A;  3HK0 A;  5J3Q A;  2P0H A;  1J19 A;  2D9Z A;  1ZVR A;  5DH9 B;  2LYD A;  3A8Q A;  3UZT A;  1DDV A;  3SO6 A;  1Q67 A;  1TQZ A;  4H8S A;  5LOP B;  2G35 A;  4DX8 A;  1MK7 B;  3HW2 B;  4K2P A;  5C16 A;  1SGH A;  1RJ2 A;  1MK9 B;  3AU4 A;  2DYQ A;  4K81 A;  1W1G A;  2RNR B;  3MPX A;  1DDM A;  1I7A A;  4CHJ A;  1MPH A;  5GOW B;  3P7Z A;  4HB4 B;  3AJ4 A;  2OQB A;  2J59 M;  2GCL A;  1XD4 A;  2V76 A;  2DTC A;  4HB3 B;  3RCP A;  4CYE A;  3A8P A;  2YT0 A;  2DN6 A;  2NZ8 B;  2MFQ A;  1ZM0 A;  1N3H A;  2N23 A;  2D9V A;  3QWM A;  2EJ8 A;  3O96 A;  5EFX A;  2P8V A;  3GYP A;  4HAX B;  1Z87 A;  2I5F A;  4WJ7 A;  4D0N B;  4HAZ B;  2J0K A;  1M7E A;  3ZDT A;  2YSZ A;  4GN1 A;  2ELA A;  5DHF B;  2H7E A;  4GXB A;  1XR0 B;  2COF A;  3DXC A;  3U8Z A;  1QQG A;  2M38 A;  5DHA B;  4IAP A;  2J0M A;  1H4R A;  1FGY A;  1M7R A;  3TO1 A;  3FM8 C;  3LJU X;  4NSW A;  2BCJ A;  2R0D A;  5D3Y A;  3IVF A;  3WYF B;  1TXD A;  4GZU A;  1UNR A;  2D9W A;  4KHO A;  2KCJ A;  2VRW B;  3KY9 A;  1P6S A;  4B6H A;  3PZD A;  2QKL A;  2Y8F A;  5C6R A;  2XQN M;  1BWN A;  2PZ1 A;  2I1K A;  3PEG A;  1XOD A;  2I5C A;  3TVV A;  3NSU A;  2JP2 A;  1I2H A;  1EAZ A;  2DFK A;  1OY2 A;  2D9Y A;  4DBB A;  4PQ0 A;  2YS1 A;  3TCA A;  3F5R A;  3ODW A;  2DKP A;  1X11 A;  2DHK A;  2DKQ A;  4HAU B;  2OTX A;  2LUL A;  3D8F A;  5L81 A;  3FEH A;  3PP2 A;  1W1H A;  2H7D A;  2P0F A;  2Z0O A;  4HB2 B;  2W2X D;  1P5T A;  1PFJ A;  2COA A;  2W2W A;  4IFS A;  2UVM A;  1DDW A;  4EJN A;  2W2X C;  3BIN A;  2YF0 A;  2EC1 A;  2QKM A;  2RGN B;  5D3X A;  4KAX B;  3D8D A;  4Z2M B;  1FHO A;  1KZ7 A;  2AEH A;  2VKI A;  5LON B;  5DI9 B;  1UPR A;  1AQC A;  4Z2N A;  1WJM A;  4HHV A;  5FI1 A;  1ISN A;  4XWX A;  5J3T A;  3FSS A;  2YVC A;  1U2B A;  2Z0Q A;  4HB0 B;  1WI1 A;  2D9X A;  1NU2 A;  3PSC A;  3CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...