2I5FA

Crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,5,6)p5
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
99
Chain Sequence
FTGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the carboxy terminal PH domain of pleckstrin bound to D-myo-inositol 1,2,3,5,6-pentakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Pleckstrin
total genus 20
structure length 99
sequence length 107
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2i5fA00
1X1GA 4K17A 1DDVA 1GG3A 2D11A 2I1KA 4HB4B 2P8VA 2DKQA 2RLOA 1NTVA 3GYPA 5DHFB 2IFSA 5D27A 3PVLA 2DHKA 1Q67A 2I5FA 5HE3A 2ADZA 1SHCA 2OTXA 4PQ0A 4MK0A 2VKIA 1PMSA 2EC1A 3HW2B 1H10A 4HB2B 2RSGA 1DYNA 1N3HA 2J0KA 1U27A 1NTYA 2OQBA 2ROVA 2YT1A 1XODA 2HE7A 3TVVA 5C6RA 1IRSA 3M1IB 1W1DA 1OY2A 4WSFA 1PLSA 4B6HA 3X23A 2COCA 3A8QA 1U5FA 2ROZB 4CYEA 2K2JA 1XKEA 3PVWA 4F7GA 2RVBB 2MDXA 3G9WA 2D9YA 2Y8FA 3ML4A 1H4RA 4HAVB 3PEGA 2LG1A 5C79A 5DIFB 4MT7A 1UPRA 2Y8GA 4K2PA 1FHWA 2DN6A 2YT0A 3ULCA 2QKLA 2Z0QA 4DX90 1W1GA 1WJ1A 1K5GB 2M14A 5LONB 1U29A 1SGHA 3SUZA 3DXCA 3N7CA 4A5KA 1I2HA 4K81A 4A6FB 3KSYA 4IOYX 5CLQB 3PSCA 2KUPA 1EF1A 1WI1A 2DYQA 3D8EA 4H8SA 1UPQA 3KZ1A 4PNKA 4KVGB 1M7RA 4ZRIA 1WVHA 4Z2MB 1QQGA 2Q13A 2YRYA 4KHOA 1MKEA 2D2QA 1EAZA 2YF0A 2CRFA 2AL6A 1ZM0A 2AEHA 3SO6A 3WA0A 2UVMA 5FI0A 2H7EA 2GCJA 1EGXA 2COFA 1ISNA 1KI1B 4D0NB 4YL8A 4WVFB 2RNRB 1Y5OA 4EKUA 1B55A 5J3YA 1UNQA 2NZ8B 5JHHA 5HE0A 2W2XD 2MWNB 2E2XA 1J0WA 2LOZA 2NMBA 1UNRA 4P7IA 2N23A 3PZDA 2BCJA 4KHBB 3FSSA 1XX0A 2W2XC 3F5RA 2FJLA 1XD4A 1LB1A 2QKMA 3QBVB 1XR0B 3LJUX 2YS3A 2DTCA 1OMWA 5CLLB 1EVHA 2MKRA 1GC6A 1DDWA 4A6KA 1WGQA 2D10A 3OANA 1PFJA 1P5TA 3P7ZA 4WJ7A 5LOPB 4GZUA 3P6AA 1Y19B 4HAUB 4HAXB 3SNHA 3U7DA 2D4QA 1OQNA 2CODA 4C0AA 1X86A 2COAA 5D3VA 4CHMA 4EJNA 5KCVA 5FI1A 5EFXA 2R09A 1X1FA 2CAYA 2EMTA 4IFSA 2H7DA 2DFKA 1TXDA 2JP2A 4F7HA 1U5EA 1U2BA 1MPHA 1MK7B 2D9XA 4TKNA 2YS1A 4GN1A 3RCPA 4HB3B 5J3QA 2GJYA 5DI9B 2IYBA 3A8PA 1X11A 1MAIA 2XQNM 2CY5A 2YSZA 2RGNB 4HATB 5C5BB 1FGZA 5JP4A 1UEFA 2P0DA 1BAKA 4F7UP 1FHXA 3KY9A 4XWXA 1U5GA 1KZ7A 3HQCA 2GS0A 3T06A 2YVCA 2N0YA 3VOQA 2KGXB 3VIAA 5JLJB 2G35A 1ZC3B 2L2IA 4HAYB 3FM8C 1BTNA 2R0DA 1RJ2A 3PG7A 1ZC4B 4GXBA 2V76A 4HAWB 1WG7A 4K2OA 1NI2A 1TQZA 1U5DA 4A6FA 1Z87A 2I1JA 2ELAA 3TO1A 3TW1A 3ZVRA 1DBHA 2LYDA 1K5DB 3HK0A 1W1HA 3BJIA 1UNPA 3PP2A 5J3TA 3UZTA 1FHOA 2GCLA 1DDMA 3IVFA 4GPTB 4ZRJA 2D9ZA 2M38A 1MIZB 4BBKA 4NY0A 1FOEA 2UZSA 1WGUA 3KRWA 4ZRKA 4A6HA 1FGYA 3U8ZA 1V61A 3ODOA 2ELBA 5KQ1A 1MK9B 3KRXA 4DXAB 3MDBC 2DHJA 1FB8A 5JHGA 1AQCA 1KZGA 2DKPA 2P0FA 2X18A 2YS5A 3DXEA 2J59M 4YONA 2MFQA 3TFMA 1TJ6A 3F0WA 1FAOA 3O96A 3A98B 1V5UA 1ZSQA 3ZDTA 3WYFB 3AU5A 2DX5A 3SV1A 1QC6A 1LW3A 3D8FA 3GYOA 1XCGA 4Y94A 2K2UA 2PZ1A 3NSUA 2LULA 3D8DA 4L6EA 3TCAA 2VRWB 3CXBB 3SYXA 3MPXA 2Y7BA 5DH9B 1DROA 4IAPA 4HDQA 5D3WA 4Z2NA 4EMOA 2Z0PA 3AU4A 5L81A 1J19A 3AJ4A 3CIKA 4HB0B 3ULBA 2D9WA 5HE1A 2RUKB 3PVUA 2LKOA 3BINA 1V88A 2DYNA 2VSZA 1ZVRA 4MY6A 2KCJA 1V89A 1MIXA 5D3XA 1I7AA 2ZPYA 1AWEA 1X05A 2DA0A 2EMSA 3ODXA 1E5WA 3ODWA 3QIJA 4HHVA 3FEHA 5C5BA 2DHIA 2J0MA 2P0HA 4GMVA 2I5CA 2LOXA 1BTKA 1RRPB 3DXDA 4GMXB 5DHAB 4DBBA 1P6SA 3QWMA 1P3RA 4TYZA 5C16A 5HE2A 2W2WA 1GC7A 4NSWA 2DX1A 2K00A 2Z0OA 1WJMA 2J0JA 1M7EA 4HAZB 3V5WA 2HTHB 5KQ4A 5GOWB 4CHJA 1BWNA 2EJ8A 2D9VA 1NU2A 2DLWA 5D3YA 1V5PA 4KHAA 2L1CA 2CY4A 4DX8A 4HDOA 4KAXB 2UZRA 1V5MA
chains in the Genus database with same CATH superfamily
2KUQA 1X1GA 4K17A 2RRFA 1DDVA 1GG3A 2D11A 2I1KA 4HB4B 2P8VA 2DKQA 2RLOA 1NTVA 3GYPA 5DHFB 2IFSA 5D27A 3HSAA 3PVLA 2DHKA 1Q67A 2I5FA 5HE3A 2ADZA 1SHCA 2OTXA 4PQ0A 4MK0A 2VKIA 1PMSA 2EC1A 3HW2B 1H10A 4HB2B 2RSGA 1DYNA 1N3HA 2J0KA 1U27A 1NTYA 2OQBA 2KR0A 2ROVA 2YT1A 1XODA 2HE7A 3TVVA 5C6RA 1IRSA 3M1IB 1W1DA 1OY2A 4WSFA 1PLSA 5LG4B 4B6HA 3X23A 2COCA 3A8QA 1U5FA 2ROZB 4CYEA 2K2JA 1XKEA 3PVWA 4F7GA 2RVBB 2MDXA 3G9WA 4DIXA 2D9YA 2Y8FA 3ML4A 1H4RA 4HAVB 3PEGA 2LG1A 5C79A 5DIFB 4MT7A 1UPRA 3U12A 2Y8GA 4K2PA 1FHWA 2DN6A 4GNKB 2YT0A 3ULCA 1MI1A 2QKLA 2Z0QA 4DX90 1W1GA 1WJ1A 1K5GB 2M14A 5LONB 1U29A 1SGHA 3SUZA 3DXCA 3N7CA 4A5KA 4L1RA 1I2HA 4K81A 4A6FB 3KSYA 4CSQA 4IOYX 5CLQB 3PSCA 2KUPA 1EF1A 1WI1A 2DYQA 3D8EA 4H8SA 1UPQA 3KZ1A 2K8EA 4PNKA 4OSNA 4KVGB 1M7RA 4ZRIA 1WVHA 4Z2MB 1QQGA 2Q13A 3NWAA 2YRYA 4KHOA 1MKEA 2D2QA 1EAZA 2YF0A 2CRFA 2AL6A 1ZM0A 2AEHA 3SO6A 3WA0A 2UVMA 5FI0A 2H7EA 2GCJA 1EGXA 2COFA 1ISNA 1KI1B 4D0NB 4YL8A 4WVFB 2RNRB 1Y5OA 4EKUA 1B55A 5J3YA 1UNQA 2NZ8B 5JHHA 5HE0A 2W2XD 2MWNB 2E2XA 1J0WA 2LOZA 4QJ3B 2NMBA 1UNRA 4P7IA 2KIGA 2N23A 3PZDA 2BCJA 4KHBB 3FSSA 3HIEA 1XX0A 2W2XC 3F5RA 2GUMA 2FJLA 1XD4A 1LB1A 2QKMA 3QBVB 1XR0B 3LJUX 2YS3A 2DTCA 1OMWA 5CLLB 1ZYIA 1EVHA 2MKRA 1GC6A 1DDWA 4A6KA 1WGQA 2D10A 3OANA 1PFJA 1P5TA 3P7ZA 4WJ7A 2YT2A 5LOPB 4GZUA 3P6AA 2Z4DA 1Y19B 4HAUB 4HAXB 3SNHA 3U7DA 2D4QA 1OQNA 2CODA 4C0AA 1X86A 2COAA 5D3VA 4CHMA 4EJNA 5KCVA 5FI1A 5EFXA 2R09A 1X1FA 2CAYA 2EMTA 4IFSA 1T77A 2H7DA 2FJUB 2DFKA 1TXDA 2JP2A 4F7HA 1U5EA 1U2BA 1MPHA 1MK7B 2D9XA 4TKNA 2YS1A 4GN1A 3RCPA 4HB3B 5J3QA 2GJYA 2ZKMX 5DI9B 2IYBA 3A8PA 1X11A 1MAIA 2XQNM 2CY5A 2YSZA 2RGNB 4HATB 5C5BB 1FGZA 2R2YA 5JP4A 1UEFA 2P0DA 1BAKA 4F7UP 3A58A 1FHXA 3KY9A 4XWXA 1U5GA 1KZ7A 3HQCA 2GS0A 3T06A 2YVCA 3B77A 2N0YA 3VOQA 2KGXB 4OT1A 3VIAA 5JLJB 2G35A 1ZC3B 2L2IA 4HAYB 3FM8C 1BTNA 2R0DA 1RJ2A 3PG7A 1ZC4B 4GXBA 2V76A 4HSIA 1WG7A 4HAWB 4K2OA 1NI2A 1TQZA 1U5DA 4A6FA 1Z87A 2Z13A 2I1JA 2ELAA 3TO1A 3TW1A 4GOUA 3ZVRA 1DBHA 2LYDA 1K5DB 3HK0A 1W1HA 3BJIA 1UNPA 3PP2A 5J3TA 4KHBA 4QJ4B 2K49A 3UZTA 1FHOA 2GCLA 1DDMA 3IVFA 4GPTB 4ZRJA 2D9ZA 2M38A 1MIZB 4BBKA 4NY0A 1FOEA 2UZSA 1WGUA 3KRWA 3NWDA 4ZRKA 4A6HA 3OHMB 1FGYA 3U8ZA 1V61A 3ODOA 3DCXA 2ELBA 5KQ1A 1MK9B 3KRXA 4DXAB 3MDBC 2DHJA 1FB8A 5JHGA 1AQCA 1KZGA 2DKPA 2P0FA 2X18A 5M4YB 2YS5A 3DXEA 2J59M 4YONA 2MFQA 3TFMA 1TJ6A 3F0WA 1FAOA 3O96A 3A98B 1V5UA 1ZSQA 3ZDTA 3WYFB 3AU5A 2DX5A 3SV1A 1QC6A 1LW3A 3D8FA 5I2SA 3GYOA 1XCGA 4Y94A 3NWFA 2K2UA 2PZ1A 3NSUA 2LULA 3D8DA 4L6EA 3TCAA 2VRWB 3CXBB 2KIEA 3SYXA 3MPXA 2Y7BA 5DH9B 1DROA 4IAPA 4HDQA 5D3WA 4Z2NA 4EMOA 4D6WA 2Z0PA 3AU4A 5L81A 1J19A 3AJ4A 3CIKA 4HB0B 3ULBA 2D9WA 5HE1A 2RUKB 3PVUA 2LKOA 3BINA 1V88A 2DYNA 2VSZA 1ZVRA 4MY6A 2KCJA 1V89A 1MIXA 5D3XA 1I7AA 2ZPYA 1AWEA 1X05A 2DA0A 5I2MA 2EMSA 3ODXA 1E5WA 3ODWA 3QIJA 4HHVA 3FEHA 5C5BA 2DHIA 3FVCA 2J0MA 2P0HA 4GMVA 2I5CA 2LOXA 1BTKA 2Z14A 1RRPB 3DXDA 3NW8A 4GMXB 5IRSA 5DHAB 4DBBA 1P6SA 3QWMA 1P3RA 4QXAB 4TYZA 5C16A 5HE2A 2W2WA 1GC7A 4NSWA 2DX1A 2K00A 2Z0OA 2Z59A 1WJMA 2NBVA 2J0JA 1M7EA 4HAZB 3V5WA 2HTHB 5KQ4A 5GOWB 4CHJA 1BWNA 2EJ8A 2D9VA 1NU2A 2DLWA 5D3YA 1V5PA 4KHAA 2L1CA 2CY4A 4QJ5B 4DX8A 4HDOA 4KAXB 2UZRA 1V5MA
chains in the Genus database with same CATH topology
1X1GA 4K17A 1DDVA 1GG3A 2D11A 2I1KA 4HB4B 2P8VA 2DKQA 2RLOA 1NTVA 3GYPA 5DHFB 2IFSA 5D27A 3PVLA 2DHKA 1Q67A 2I5FA 5HE3A 2ADZA 1SHCA 2OTXA 4PQ0A 4MK0A 2VKIA 1PMSA 2EC1A 3HW2B 1H10A 4HB2B 2RSGA 1DYNA 1N3HA 2J0KA 1U27A 1NTYA 2OQBA 2ROVA 2YT1A 1XODA 2HE7A 3TVVA 5C6RA 1IRSA 3M1IB 1W1DA 1OY2A 4WSFA 1PLSA 4B6HA 3X23A 2COCA 3A8QA 1U5FA 2ROZB 4CYEA 2K2JA 1XKEA 3PVWA 4F7GA 2RVBB 2MDXA 3G9WA 2D9YA 2Y8FA 3ML4A 1H4RA 4HAVB 3PEGA 2LG1A 5C79A 5DIFB 4MT7A 1UPRA 2Y8GA 4K2PA 1FHWA 2DN6A 2YT0A 3ULCA 2QKLA 2Z0QA 4DX90 1W1GA 1WJ1A 1K5GB 2M14A 5LONB 1U29A 1SGHA 3SUZA 3DXCA 3N7CA 4A5KA 1I2HA 4K81A 4A6FB 3KSYA 4IOYX 5CLQB 3PSCA 2KUPA 1EF1A 1WI1A 2DYQA 3D8EA 4H8SA 1UPQA 3KZ1A 4PNKA 4KVGB 1M7RA 4ZRIA 1WVHA 4Z2MB 1QQGA 2Q13A 2YRYA 4KHOA 1MKEA 2D2QA 1EAZA 2YF0A 2CRFA 2AL6A 1ZM0A 2AEHA 3SO6A 3WA0A 2UVMA 5FI0A 2H7EA 2GCJA 1EGXA 2COFA 1ISNA 1KI1B 4D0NB 4YL8A 4WVFB 2RNRB 1Y5OA 4EKUA 1B55A 5J3YA 1UNQA 2NZ8B 5JHHA 5HE0A 2W2XD 2MWNB 2E2XA 1J0WA 2LOZA 2NMBA 1UNRA 4P7IA 2N23A 3PZDA 2BCJA 4KHBB 3FSSA 1XX0A 2W2XC 3F5RA 2FJLA 1XD4A 1LB1A 2QKMA 3QBVB 1XR0B 3LJUX 2YS3A 2DTCA 1OMWA 5CLLB 1EVHA 2MKRA 1GC6A 1DDWA 4A6KA 1WGQA 2D10A 3OANA 1PFJA 1P5TA 3P7ZA 4WJ7A 5LOPB 4GZUA 3P6AA 1Y19B 4HAUB 4HAXB 3SNHA 3U7DA 2D4QA 1OQNA 2CODA 4C0AA 1X86A 2COAA 5D3VA 4CHMA 4EJNA 5KCVA 5FI1A 5EFXA 2R09A 1X1FA 2CAYA 2EMTA 4IFSA 2H7DA 2DFKA 1TXDA 2JP2A 4F7HA 1U5EA 1U2BA 1MPHA 1MK7B 2D9XA 4TKNA 2YS1A 4GN1A 3RCPA 4HB3B 5J3QA 2GJYA 5DI9B 2IYBA 3A8PA 1X11A 1MAIA 2XQNM 2CY5A 2YSZA 2RGNB 4HATB 5C5BB 1FGZA 5JP4A 1UEFA 2P0DA 1BAKA 4F7UP 1FHXA 3KY9A 4XWXA 1U5GA 1KZ7A 3HQCA 2GS0A 3T06A 2YVCA 2N0YA 3VOQA 2KGXB 3VIAA 5JLJB 2G35A 1ZC3B 2L2IA 4HAYB 3FM8C 1BTNA 2R0DA 1RJ2A 3PG7A 1ZC4B 4GXBA 2V76A 4HAWB 1WG7A 4K2OA 1NI2A 1TQZA 1U5DA 4A6FA 1Z87A 2I1JA 2ELAA 3TO1A 3TW1A 3ZVRA 1DBHA 2LYDA 1K5DB 3HK0A 1W1HA 3BJIA 1UNPA 3PP2A 5J3TA 3UZTA 1FHOA 2GCLA 1DDMA 3IVFA 4GPTB 4ZRJA 2D9ZA 2M38A 1MIZB 4BBKA 4NY0A 1FOEA 2UZSA 1WGUA 3KRWA 4ZRKA 4A6HA 1FGYA 3U8ZA 1V61A 3ODOA 2ELBA 5KQ1A 1MK9B 3KRXA 4DXAB 3MDBC 2DHJA 1FB8A 5JHGA 1AQCA 1KZGA 2DKPA 2P0FA 2X18A 2YS5A 3DXEA 2J59M 4YONA 2MFQA 3TFMA 1TJ6A 3F0WA 1FAOA 3O96A 3A98B 1V5UA 1ZSQA 3ZDTA 3WYFB 3AU5A 2DX5A 3SV1A 1QC6A 1LW3A 3D8FA 3GYOA 1XCGA 4Y94A 2K2UA 2PZ1A 3NSUA 2LULA 3D8DA 4L6EA 3TCAA 2VRWB 3CXBB 3SYXA 3MPXA 2Y7BA 5DH9B 1DROA 4IAPA 4HDQA 5D3WA 4Z2NA 4EMOA 2Z0PA 3AU4A 5L81A 1J19A 3AJ4A 3CIKA 4HB0B 3ULBA 2D9WA 5HE1A 2RUKB 3PVUA 2LKOA 3BINA 1V88A 2DYNA 2VSZA 1ZVRA 4MY6A 2KCJA 1V89A 1MIXA 5D3XA 1I7AA 2ZPYA 1AWEA 1X05A 2DA0A 2EMSA 3ODXA 1E5WA 3ODWA 3QIJA 4HHVA 3FEHA 5C5BA 2DHIA 2J0MA 2P0HA 4GMVA 2I5CA 2LOXA 1BTKA 1RRPB 3DXDA 4GMXB 5DHAB 4DBBA 1P6SA 3QWMA 1P3RA 4TYZA 5C16A 5HE2A 2W2WA 1GC7A 4NSWA 2DX1A 2K00A 2Z0OA 1WJMA 2J0JA 1M7EA 4HAZB 3V5WA 2HTHB 5KQ4A 5GOWB 4CHJA 1BWNA 2EJ8A 2D9VA 1NU2A 2DLWA 5D3YA 1V5PA 4KHAA 2L1CA 2CY4A 4DX8A 4HDOA 4KAXB 2UZRA 1V5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1G A;  4K17 A;  1DDV A;  1GG3 A;  2D11 A;  2I1K A;  4HB4 B;  2P8V A;  2DKQ A;  2RLO A;  1NTV A;  3GYP A;  5DHF B;  2IFS A;  5D27 A;  3PVL A;  2DHK A;  1Q67 A;  2I5F A;  5HE3 A;  2ADZ A;  1SHC A;  2OTX A;  4PQ0 A;  4MK0 A;  2VKI A;  1PMS A;  2EC1 A;  3HW2 B;  1H10 A;  4HB2 B;  2RSG A;  1DYN A;  1N3H A;  2J0K A;  1U27 A;  1NTY A;  2OQB A;  2ROV A;  2YT1 A;  1XOD A;  2HE7 A;  3TVV A;  5C6R A;  1IRS A;  3M1I B;  1W1D A;  1OY2 A;  4WSF A;  1PLS A;  4B6H A;  3X23 A;  2COC A;  3A8Q A;  1U5F A;  2ROZ B;  4CYE A;  2K2J A;  1XKE A;  3PVW A;  4F7G A;  2RVB B;  2MDX A;  3G9W A;  2D9Y A;  2Y8F A;  3ML4 A;  1H4R A;  4HAV B;  3PEG A;  2LG1 A;  5C79 A;  5DIF B;  4MT7 A;  1UPR A;  2Y8G A;  4K2P A;  1FHW A;  2DN6 A;  2YT0 A;  3ULC A;  2QKL A;  2Z0Q A;  4DX9 0;  1W1G A;  1WJ1 A;  1K5G B;  2M14 A;  5LON B;  1U29 A;  1SGH A;  3SUZ A;  3DXC A;  3N7C A;  4A5K A;  1I2H A;  4K81 A;  4A6F B;  3KSY A;  4IOY X;  5CLQ B;  3PSC A;  2KUP A;  1EF1 A;  1WI1 A;  2DYQ A;  3D8E A;  4H8S A;  1UPQ A;  3KZ1 A;  4PNK A;  4KVG B;  1M7R A;  4ZRI A;  1WVH A;  4Z2M B;  1QQG A;  2Q13 A;  2YRY A;  4KHO A;  1MKE A;  2D2Q A;  1EAZ A;  2YF0 A;  2CRF A;  2AL6 A;  1ZM0 A;  2AEH A;  3SO6 A;  3WA0 A;  2UVM A;  5FI0 A;  2H7E A;  2GCJ A;  1EGX A;  2COF A;  1ISN A;  1KI1 B;  4D0N B;  4YL8 A;  4WVF B;  2RNR B;  1Y5O A;  4EKU A;  1B55 A;  5J3Y A;  1UNQ A;  2NZ8 B;  5JHH A;  5HE0 A;  2W2X D;  2MWN B;  2E2X A;  1J0W A;  2LOZ A;  2NMB A;  1UNR A;  4P7I A;  2N23 A;  3PZD A;  2BCJ A;  4KHB B;  3FSS A;  1XX0 A;  2W2X C;  3F5R A;  2FJL A;  1XD4 A;  1LB1 A;  2QKM A;  3QBV B;  1XR0 B;  3LJU X;  2YS3 A;  2DTC A;  1OMW A;  5CLL B;  1EVH A;  2MKR A;  1GC6 A;  1DDW A;  4A6K A;  1WGQ A;  2D10 A;  3OAN A;  1PFJ A;  1P5T A;  3P7Z A;  4WJ7 A;  5LOP B;  4GZU A;  3P6A A;  1Y19 B;  4HAU B;  4HAX B;  3SNH A;  3U7D A;  2D4Q A;  1OQN A;  2COD A;  4C0A A;  1X86 A;  2COA A;  5D3V A;  4CHM A;  4EJN A;  5KCV A;  5FI1 A;  5EFX A;  2R09 A;  1X1F A;  2CAY A;  2EMT A;  4IFS A;  2H7D A;  2DFK A;  1TXD A;  2JP2 A;  4F7H A;  1U5E A;  1U2B A;  1MPH A;  1MK7 B;  2D9X A;  4TKN A;  2YS1 A;  4GN1 A;  3RCP A;  4HB3 B;  5J3Q A;  2GJY A;  5DI9 B;  2IYB A;  3A8P A;  1X11 A;  1MAI A;  2XQN M;  2CY5 A;  2YSZ A;  2RGN B;  4HAT B;  5C5B B;  1FGZ A;  5JP4 A;  1UEF A;  2P0D A;  1BAK A;  4F7U P;  1FHX A;  3KY9 A;  4XWX A;  1U5G A;  1KZ7 A;  3HQC A;  2GS0 A;  3T06 A;  2YVC A;  2N0Y A;  3VOQ A;  2KGX B;  3VIA A;  5JLJ B;  2G35 A;  1ZC3 B;  2L2I A;  4HAY B;  3FM8 C;  1BTN A;  2R0D A;  1RJ2 A;  3PG7 A;  1ZC4 B;  4GXB A;  2V76 A;  4HAW B;  1WG7 A;  4K2O A;  1NI2 A;  1TQZ A;  1U5D A;  4A6F A;  1Z87 A;  2I1J A;  2ELA A;  3TO1 A;  3TW1 A;  3ZVR A;  1DBH A;  2LYD A;  1K5D B;  3HK0 A;  1W1H A;  3BJI A;  1UNP A;  3PP2 A;  5J3T A;  3UZT A;  1FHO A;  2GCL A;  1DDM A;  3IVF A;  4GPT B;  4ZRJ A;  2D9Z A;  2M38 A;  1MIZ B;  4BBK A;  4NY0 A;  1FOE A;  2UZS A;  1WGU A;  3KRW A;  4ZRK A;  4A6H A;  1FGY A;  3U8Z A;  1V61 A;  3ODO A;  2ELB A;  5KQ1 A;  1MK9 B;  3KRX A;  4DXA B;  3MDB C;  2DHJ A;  1FB8 A;  5JHG A;  1AQC A;  1KZG A;  2DKP A;  2P0F A;  2X18 A;  2YS5 A;  3DXE A;  2J59 M;  4YON A;  2MFQ A;  3TFM A;  1TJ6 A;  3F0W A;  1FAO A;  3O96 A;  3A98 B;  1V5U A;  1ZSQ A;  3ZDT A;  3WYF B;  3AU5 A;  2DX5 A;  3SV1 A;  1QC6 A;  1LW3 A;  3D8F A;  3GYO A;  1XCG A;  4Y94 A;  2K2U A;  2PZ1 A;  3NSU A;  2LUL A;  3D8D A;  4L6E A;  3TCA A;  2VRW B;  3CXB B;  3SYX A;  3MPX A;  2Y7B A;  5DH9 B;  1DRO A;  4IAP A;  4HDQ A;  5D3W A;  4Z2N A;  4EMO A;  2Z0P A;  3AU4 A;  5L81 A;  1J19 A;  3AJ4 A;  3CIK A;  4HB0 B;  3ULB A;  2D9W A;  5HE1 A;  2RUK B;  3PVU A;  2LKO A;  3BIN A;  1V88 A;  2DYN A;  2VSZ A;  1ZVR A;  4MY6 A;  2KCJ A;  1V89 A;  1MIX A;  5D3X A;  1I7A A;  2ZPY A;  1AWE A;  1X05 A;  2DA0 A;  2EMS A;  3ODX A;  1E5W A;  3ODW A;  3QIJ A;  4HHV A;  3FEH A;  5C5B A;  2DHI A;  2J0M A;  2P0H A;  4GMV A;  2I5C A;  2LOX A;  1BTK A;  1RRP B;  3DXD A;  4GMX B;  5DHA B;  4DBB A;  1P6S A;  3QWM A;  1P3R A;  4TYZ A;  5C16 A;  5HE2 A;  2W2W A;  1GC7 A;  4NSW A;  2DX1 A;  2K00 A;  2Z0O A;  1WJM A;  2J0J A;  1M7E A;  4HAZ B;  3V5W A;  2HTH B;  5KQ4 A;  5GOW B;  4CHJ A;  1BWN A;  2EJ8 A;  2D9V A;  1NU2 A;  2DLW A;  5D3Y A;  1V5P A;  4KHA A;  2L1C A;  2CY4 A;  4DX8 A;  4HDO A;  4KAX B;  2UZR A;  1V5M A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  1X1G A;  4K17 A;  2RRF A;  1DDV A;  1GG3 A;  2D11 A;  2I1K A;  4HB4 B;  2P8V A;  2DKQ A;  2RLO A;  1NTV A;  3GYP A;  5DHF B;  2IFS A;  5D27 A;  3HSA A;  3PVL A;  2DHK A;  1Q67 A;  2I5F A;  5HE3 A;  2ADZ A;  1SHC A;  2OTX A;  4PQ0 A;  4MK0 A;  2VKI A;  1PMS A;  2EC1 A;  3HW2 B;  1H10 A;  4HB2 B;  2RSG A;  1DYN A;  1N3H A;  2J0K A;  1U27 A;  1NTY A;  2OQB A;  2KR0 A;  2ROV A;  2YT1 A;  1XOD A;  2HE7 A;  3TVV A;  5C6R A;  1IRS A;  3M1I B;  1W1D A;  1OY2 A;  4WSF A;  1PLS A;  5LG4 B;  4B6H A;  3X23 A;  2COC A;  3A8Q A;  1U5F A;  2ROZ B;  4CYE A;  2K2J A;  1XKE A;  3PVW A;  4F7G A;  2RVB B;  2MDX A;  3G9W A;  4DIX A;  2D9Y A;  2Y8F A;  3ML4 A;  1H4R A;  4HAV B;  3PEG A;  2LG1 A;  5C79 A;  5DIF B;  4MT7 A;  1UPR A;  3U12 A;  2Y8G A;  4K2P A;  1FHW A;  2DN6 A;  4GNK B;  2YT0 A;  3ULC A;  1MI1 A;  2QKL A;  2Z0Q A;  4DX9 0;  1W1G A;  1WJ1 A;  1K5G B;  2M14 A;  5LON B;  1U29 A;  1SGH A;  3SUZ A;  3DXC A;  3N7C A;  4A5K A;  4L1R A;  1I2H A;  4K81 A;  4A6F B;  3KSY A;  4CSQ A;  4IOY X;  5CLQ B;  3PSC A;  2KUP A;  1EF1 A;  1WI1 A;  2DYQ A;  3D8E A;  4H8S A;  1UPQ A;  3KZ1 A;  2K8E A;  4PNK A;  4OSN A;  4KVG B;  1M7R A;  4ZRI A;  1WVH A;  4Z2M B;  1QQG A;  2Q13 A;  3NWA A;  2YRY A;  4KHO A;  1MKE A;  2D2Q A;  1EAZ A;  2YF0 A;  2CRF A;  2AL6 A;  1ZM0 A;  2AEH A;  3SO6 A;  3WA0 A;  2UVM A;  5FI0 A;  2H7E A;  2GCJ A;  1EGX A;  2COF A;  1ISN A;  1KI1 B;  4D0N B;  4YL8 A;  4WVF B;  2RNR B;  1Y5O A;  4EKU A;  1B55 A;  5J3Y A;  1UNQ A;  2NZ8 B;  5JHH A;  5HE0 A;  2W2X D;  2MWN B;  2E2X A;  1J0W A;  2LOZ A;  4QJ3 B;  2NMB A;  1UNR A;  4P7I A;  2KIG A;  2N23 A;  3PZD A;  2BCJ A;  4KHB B;  3FSS A;  3HIE A;  1XX0 A;  2W2X C;  3F5R A;  2GUM A;  2FJL A;  1XD4 A;  1LB1 A;  2QKM A;  3QBV B;  1XR0 B;  3LJU X;  2YS3 A;  2DTC A;  1OMW A;  5CLL B;  1ZYI A;  1EVH A;  2MKR A;  1GC6 A;  1DDW A;  4A6K A;  1WGQ A;  2D10 A;  3OAN A;  1PFJ A;  1P5T A;  3P7Z A;  4WJ7 A;  2YT2 A;  5LOP B;  4GZU A;  3P6A A;  2Z4D A;  1Y19 B;  4HAU B;  4HAX B;  3SNH A;  3U7D A;  2D4Q A;  1OQN A;  2COD A;  4C0A A;  1X86 A;  2COA A;  5D3V A;  4CHM A;  4EJN A;  5KCV A;  5FI1 A;  5EFX A;  2R09 A;  1X1F A;  2CAY A;  2EMT A;  4IFS A;  1T77 A;  2H7D A;  2FJU B;  2DFK A;  1TXD A;  2JP2 A;  4F7H A;  1U5E A;  1U2B A;  1MPH A;  1MK7 B;  2D9X A;  4TKN A;  2YS1 A;  4GN1 A;  3RCP A;  4HB3 B;  5J3Q A;  2GJY A;  2ZKM X;  5DI9 B;  2IYB A;  3A8P A;  1X11 A;  1MAI A;  2XQN M;  2CY5 A;  2YSZ A;  2RGN B;  4HAT B;  5C5B B;  1FGZ A;  2R2Y A;  5JP4 A;  1UEF A;  2P0D A;  1BAK A;  4F7U P;  3A58 A;  1FHX A;  3KY9 A;  4XWX A;  1U5G A;  1KZ7 A;  3HQC A;  2GS0 A;  3T06 A;  2YVC A;  3B77 A;  2N0Y A;  3VOQ A;  2KGX B;  4OT1 A;  3VIA A;  5JLJ B;  2G35 A;  1ZC3 B;  2L2I A;  4HAY B;  3FM8 C;  1BTN A;  2R0D A;  1RJ2 A;  3PG7 A;  1ZC4 B;  4GXB A;  2V76 A;  4HSI A;  1WG7 A;  4HAW B;  4K2O A;  1NI2 A;  1TQZ A;  1U5D A;  4A6F A;  1Z87 A;  2Z13 A;  2I1J A;  2ELA A;  3TO1 A;  3TW1 A;  4GOU A;  3ZVR A;  1DBH A;  2LYD A;  1K5D B;  3HK0 A;  1W1H A;  3BJI A;  1UNP A;  3PP2 A;  5J3T A;  4KHB A;  4QJ4 B;  2K49 A;  3UZT A;  1FHO A;  2GCL A;  1DDM A;  3IVF A;  4GPT B;  4ZRJ A;  2D9Z A;  2M38 A;  1MIZ B;  4BBK A;  4NY0 A;  1FOE A;  2UZS A;  1WGU A;  3KRW A;  3NWD A;  4ZRK A;  4A6H A;  3OHM B;  1FGY A;  3U8Z A;  1V61 A;  3ODO A;  3DCX A;  2ELB A;  5KQ1 A;  1MK9 B;  3KRX A;  4DXA B;  3MDB C;  2DHJ A;  1FB8 A;  5JHG A;  1AQC A;  1KZG A;  2DKP A;  2P0F A;  2X18 A;  5M4Y B;  2YS5 A;  3DXE A;  2J59 M;  4YON A;  2MFQ A;  3TFM A;  1TJ6 A;  3F0W A;  1FAO A;  3O96 A;  3A98 B;  1V5U A;  1ZSQ A;  3ZDT A;  3WYF B;  3AU5 A;  2DX5 A;  3SV1 A;  1QC6 A;  1LW3 A;  3D8F A;  5I2S A;  3GYO A;  1XCG A;  4Y94 A;  3NWF A;  2K2U A;  2PZ1 A;  3NSU A;  2LUL A;  3D8D A;  4L6E A;  3TCA A;  2VRW B;  3CXB B;  2KIE A;  3SYX A;  3MPX A;  2Y7B A;  5DH9 B;  1DRO A;  4IAP A;  4HDQ A;  5D3W A;  4Z2N A;  4EMO A;  4D6W A;  2Z0P A;  3AU4 A;  5L81 A;  1J19 A;  3AJ4 A;  3CIK A;  4HB0 B;  3ULB A;  2D9W A;  5HE1 A;  2RUK B;  3PVU A;  2LKO A;  3BIN A;  1V88 A;  2DYN A;  2VSZ A;  1ZVR A;  4MY6 A;  2KCJ A;  1V89 A;  1MIX A;  5D3X A;  1I7A A;  2ZPY A;  1AWE A;  1X05 A;  2DA0 A;  5I2M A;  2EMS A;  3ODX A;  1E5W A;  3ODW A;  3QIJ A;  4HHV A;  3FEH A;  5C5B A;  2DHI A;  3FVC A;  2J0M A;  2P0H A;  4GMV A;  2I5C A;  2LOX A;  1BTK A;  2Z14 A;  1RRP B;  3DXD A;  3NW8 A;  4GMX B;  5IRS A;  5DHA B;  4DBB A;  1P6S A;  3QWM A;  1P3R A;  4QXA B;  4TYZ A;  5C16 A;  5HE2 A;  2W2W A;  1GC7 A;  4NSW A;  2DX1 A;  2K00 A;  2Z0O A;  2Z59 A;  1WJM A;  2NBV A;  2J0J A;  1M7E A;  4HAZ B;  3V5W A;  2HTH B;  5KQ4 A;  5GOW B;  4CHJ A;  1BWN A;  2EJ8 A;  2D9V A;  1NU2 A;  2DLW A;  5D3Y A;  1V5P A;  4KHA A;  2L1C A;  2CY4 A;  4QJ5 B;  4DX8 A;  4HDO A;  4KAX B;  2UZR A;  1V5M A; 
#chains in the Genus database with same CATH homology
 1X1G A;  4K17 A;  1DDV A;  1GG3 A;  2D11 A;  2I1K A;  4HB4 B;  2P8V A;  2DKQ A;  2RLO A;  1NTV A;  3GYP A;  5DHF B;  2IFS A;  5D27 A;  3PVL A;  2DHK A;  1Q67 A;  2I5F A;  5HE3 A;  2ADZ A;  1SHC A;  2OTX A;  4PQ0 A;  4MK0 A;  2VKI A;  1PMS A;  2EC1 A;  3HW2 B;  1H10 A;  4HB2 B;  2RSG A;  1DYN A;  1N3H A;  2J0K A;  1U27 A;  1NTY A;  2OQB A;  2ROV A;  2YT1 A;  1XOD A;  2HE7 A;  3TVV A;  5C6R A;  1IRS A;  3M1I B;  1W1D A;  1OY2 A;  4WSF A;  1PLS A;  4B6H A;  3X23 A;  2COC A;  3A8Q A;  1U5F A;  2ROZ B;  4CYE A;  2K2J A;  1XKE A;  3PVW A;  4F7G A;  2RVB B;  2MDX A;  3G9W A;  2D9Y A;  2Y8F A;  3ML4 A;  1H4R A;  4HAV B;  3PEG A;  2LG1 A;  5C79 A;  5DIF B;  4MT7 A;  1UPR A;  2Y8G A;  4K2P A;  1FHW A;  2DN6 A;  2YT0 A;  3ULC A;  2QKL A;  2Z0Q A;  4DX9 0;  1W1G A;  1WJ1 A;  1K5G B;  2M14 A;  5LON B;  1U29 A;  1SGH A;  3SUZ A;  3DXC A;  3N7C A;  4A5K A;  1I2H A;  4K81 A;  4A6F B;  3KSY A;  4IOY X;  5CLQ B;  3PSC A;  2KUP A;  1EF1 A;  1WI1 A;  2DYQ A;  3D8E A;  4H8S A;  1UPQ A;  3KZ1 A;  4PNK A;  4KVG B;  1M7R A;  4ZRI A;  1WVH A;  4Z2M B;  1QQG A;  2Q13 A;  2YRY A;  4KHO A;  1MKE A;  2D2Q A;  1EAZ A;  2YF0 A;  2CRF A;  2AL6 A;  1ZM0 A;  2AEH A;  3SO6 A;  3WA0 A;  2UVM A;  5FI0 A;  2H7E A;  2GCJ A;  1EGX A;  2COF A;  1ISN A;  1KI1 B;  4D0N B;  4YL8 A;  4WVF B;  2RNR B;  1Y5O A;  4EKU A;  1B55 A;  5J3Y A;  1UNQ A;  2NZ8 B;  5JHH A;  5HE0 A;  2W2X D;  2MWN B;  2E2X A;  1J0W A;  2LOZ A;  2NMB A;  1UNR A;  4P7I A;  2N23 A;  3PZD A;  2BCJ A;  4KHB B;  3FSS A;  1XX0 A;  2W2X C;  3F5R A;  2FJL A;  1XD4 A;  1LB1 A;  2QKM A;  3QBV B;  1XR0 B;  3LJU X;  2YS3 A;  2DTC A;  1OMW A;  5CLL B;  1EVH A;  2MKR A;  1GC6 A;  1DDW A;  4A6K A;  1WGQ A;  2D10 A;  3OAN A;  1PFJ A;  1P5T A;  3P7Z A;  4WJ7 A;  5LOP B;  4GZU A;  3P6A A;  1Y19 B;  4HAU B;  4HAX B;  3SNH A;  3U7D A;  2D4Q A;  1OQN A;  2COD A;  4C0A A;  1X86 A;  2COA A;  5D3V A;  4CHM A;  4EJN A;  5KCV A;  5FI1 A;  5EFX A;  2R09 A;  1X1F A;  2CAY A;  2EMT A;  4IFS A;  2H7D A;  2DFK A;  1TXD A;  2JP2 A;  4F7H A;  1U5E A;  1U2B A;  1MPH A;  1MK7 B;  2D9X A;  4TKN A;  2YS1 A;  4GN1 A;  3RCP A;  4HB3 B;  5J3Q A;  2GJY A;  5DI9 B;  2IYB A;  3A8P A;  1X11 A;  1MAI A;  2XQN M;  2CY5 A;  2YSZ A;  2RGN B;  4HAT B;  5C5B B;  1FGZ A;  5JP4 A;  1UEF A;  2P0D A;  1BAK A;  4F7U P;  1FHX A;  3KY9 A;  4XWX A;  1U5G A;  1KZ7 A;  3HQC A;  2GS0 A;  3T06 A;  2YVC A;  2N0Y A;  3VOQ A;  2KGX B;  3VIA A;  5JLJ B;  2G35 A;  1ZC3 B;  2L2I A;  4HAY B;  3FM8 C;  1BTN A;  2R0D A;  1RJ2 A;  3PG7 A;  1ZC4 B;  4GXB A;  2V76 A;  4HAW B;  1WG7 A;  4K2O A;  1NI2 A;  1TQZ A;  1U5D A;  4A6F A;  1Z87 A;  2I1J A;  2ELA A;  3TO1 A;  3TW1 A;  3ZVR A;  1DBH A;  2LYD A;  1K5D B;  3HK0 A;  1W1H A;  3BJI A;  1UNP A;  3PP2 A;  5J3T A;  3UZT A;  1FHO A;  2GCL A;  1DDM A;  3IVF A;  4GPT B;  4ZRJ A;  2D9Z A;  2M38 A;  1MIZ B;  4BBK A;  4NY0 A;  1FOE A;  2UZS A;  1WGU A;  3KRW A;  4ZRK A;  4A6H A;  1FGY A;  3U8Z A;  1V61 A;  3ODO A;  2ELB A;  5KQ1 A;  1MK9 B;  3KRX A;  4DXA B;  3MDB C;  2DHJ A;  1FB8 A;  5JHG A;  1AQC A;  1KZG A;  2DKP A;  2P0F A;  2X18 A;  2YS5 A;  3DXE A;  2J59 M;  4YON A;  2MFQ A;  3TFM A;  1TJ6 A;  3F0W A;  1FAO A;  3O96 A;  3A98 B;  1V5U A;  1ZSQ A;  3ZDT A;  3WYF B;  3AU5 A;  2DX5 A;  3SV1 A;  1QC6 A;  1LW3 A;  3D8F A;  3GYO A;  1XCG A;  4Y94 A;  2K2U A;  2PZ1 A;  3NSU A;  2LUL A;  3D8D A;  4L6E A;  3TCA A;  2VRW B;  3CXB B;  3SYX A;  3MPX A;  2Y7B A;  5DH9 B;  1DRO A;  4IAP A;  4HDQ A;  5D3W A;  4Z2N A;  4EMO A;  2Z0P A;  3AU4 A;  5L81 A;  1J19 A;  3AJ4 A;  3CIK A;  4HB0 B;  3ULB A;  2D9W A;  5HE1 A;  2RUK B;  3PVU A;  2LKO A;  3BIN A;  1V88 A;  2DYN A;  2VSZ A;  1ZVR A;  4MY6 A;  2KCJ A;  1V89 A;  1MIX A;  5D3X A;  1I7A A;  2ZPY A;  1AWE A;  1X05 A;  2DA0 A;  2EMS A;  3ODX A;  1E5W A;  3ODW A;  3QIJ A;  4HHV A;  3FEH A;  5C5B A;  2DHI A;  2J0M A;  2P0H A;  4GMV A;  2I5C A;  2LOX A;  1BTK A;  1RRP B;  3DXD A;  4GMX B;  5DHA B;  4DBB A;  1P6S A;  3QWM A;  1P3R A;  4TYZ A;  5C16 A;  5HE2 A;  2W2W A;  1GC7 A;  4NSW A;  2DX1 A;  2K00 A;  2Z0O A;  1WJM A;  2J0J A;  1M7E A;  4HAZ B;  3V5W A;  2HTH B;  5KQ4 A;  5GOW B;  4CHJ A;  1BWN A;  2EJ8 A;  2D9V A;  1NU2 A;  2DLW A;  5D3Y A;  1V5P A;  4KHA A;  2L1C A;  2CY4 A;  4DX8 A;  4HDO A;  4KAX B;  2UZR A;  1V5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...