2DTCA

Crystal structure of ms0666
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'PTMEGPLRRKTLLKEGRKPALSSWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
publication title Crystal structure of MS0666
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dtcA00
2YF0A 1BAKA 1V5UA 2UZRA 3ODWA 2DLWA 2DYNA 1BWNA 1U5EA 1K5DB 1X1GA 4HB4B 4PNKA 5JHHA 4TKNA 5JHGA 2K00A 2R0DA 3ULBA 4IOYX 1OQNA 5J3QA 1GC7A 2NZ8B 4K2PA 1I2HA 4GMXB 5D3WA 5LOPB 1MK9B 2L2IA 5EFXA 2MKRA 3ZDTA 1MK7B 4KHOA 1AWEA 1X11A 2UZSA 2E2XA 3VOQA 5J3YA 4HDQA 2DX1A 4F7UP 2XQNM 2Z0OA 2OTXA 2W2WA 1BTNA 1M7RA 1XR0B 1U5FA 3SNHA 2KGXB 1KZGA 3BINA 1LB1A 1PFJA 1EF1A 1V89A 3D8EA 3U8ZA 2LOXA 5GOWB 4HAZB 2LYDA 4KHBB 5L81A 1QQGA 1P6SA 2DKPA 5FI1A 2I5FA 1FGZA 2CY5A 4KAXB 2RSGA 4HB3B 3TO1A 1V88A 1WI1A 5KCVA 4ZRIA 1H4RA 1ZSQA 2CAYA 1FOEA 2P0HA 4A6KA 1N3HA 2CODA 4A6FB 2FJLA 4K81A 4WJ7A 4DX90 2COAA 1TXDA 2VKIA 4ZRKA 1P3RA 3FEHA 1WJ1A 1W1HA 4XWXA 2DA0A 3WYFB 1V5PA 2OQBA 2VSZA 3PVUA 3AJ4A 2D9WA 5KQ1A 1M7EA 4KHAA 2RGNB 2I1KA 1EAZA 2UVMA 4GMVA 2I5CA 1U2BA 1H10A 5C5BB 1XKEA 5C6RA 2DHKA 3ZVRA 5C79A 2DYQA 5C16A 1NU2A 1ZC3B 3ODOA 3P6AA 2D10A 1Y19B 2RUKB 2GJYA 2R09A 4A6HA 4MT7A 3CIKA 1UNRA 1E5WA 2Q13A 3GYPA 5DH9B 4KVGB 5LONB 4HAUB 3PEGA 2Z0PA 2AEHA 3PVLA 2K2JA 3F5RA 3HW2B 1MKEA 1NI2A 3KSYA 1UPQA 1WG7A 2RVBB 2GCLA 4TYZA 5FI0A 3NSUA 5D3XA 2P0DA 4H8SA 4HB0B 1SGHA 2ELAA 4B6HA 3IVFA 2CY4A 2YS5A 2HTHB 4F7GA 2J0KA 3RCPA 1WJMA 1GC6A 2D9VA 5HE1A 2L1CA 4Z2MB 4NY0A 4HATB 3SYXA 5JLJB 4IAPA 5DI9B 5D3VA 2W2XD 1DROA 3KZ1A 1TJ6A 3P7ZA 3VIAA 4DX8A 3CXBB 3FM8C 4C0AA 3TFMA 2DHIA 5J3TA 4MY6A 4HAXB 3TW1A 2ELBA 1PLSA 2YVCA 1AQCA 2JP2A 2I1JA 1XCGA 3AU5A 2D2QA 5HE2A 3OANA 2NMBA 1WVHA 3PP2A 2X18A 4HAVB 1MIXA 3A8QA 1DBHA 1MIZB 2GCJA 4D0NB 3AU4A 3PZDA 2N0YA 4EMOA 3A8PA 1K5GB 2D9YA 4ZRJA 2N23A 3TVVA 4CHMA 4WVFB 3KY9A 4WSFA 4F7HA 1OMWA 2IFSA 2Y7BA 1RJ2A 4GN1A 3HQCA 4Y94A 1LW3A 3FSSA 2RNRB 2QKMA 5D27A 2YT1A 3PVWA 1X05A 1DYNA 2YS1A 3ML4A 4EKUA 3KRXA 1Q67A 4PQ0A 1X86A 3SO6A 4A6FA 2ZPYA 1W1DA 4GPTB 2COFA 3F0WA 5CLQB 1OY2A 2H7EA 4GZUA 1ZM0A 4BBKA 3UZTA 4YL8A 3D8FA 1PMSA 2MFQA 4DBBA 4K2OA 1KZ7A 2D9ZA 2DX5A 2VRWB 1U29A 2DKQA 4CYEA 5DHFB 4NSWA 2HE7A 1XX0A 1IRSA 2M14A 3QIJA 1X1FA 5C5BA 2YS3A 3ULCA 1U5DA 2J0MA 4HAYB 1QC6A 2ROZB 2ROVA 3SV1A 2V76A 1UNQA 3MPXA 3U7DA 1FHXA 3BJIA 1XODA 2LOZA 3T06A 2EC1A 2J59M 3HK0A 2RLOA 4MK0A 2YSZA 3M1IB 2GS0A 1NTVA 4A5KA 2Y8GA 2BCJA 1NTYA 1DDMA 1RRPB 5HE0A 3X23A 2W2XC 3N7CA 1W1GA 1XD4A 3PG7A 1WGQA 4EJNA 1V5MA 2YRYA 2Y8FA 2COCA 3G9WA 4GXBA 4K17A 3LJUX 2EJ8A 2IYBA 4HAWB 1U5GA 2MWNB 2G35A 4YONA 2J0JA 1BTKA 1Y5OA 2KCJA 3WA0A 1FHOA 3ODXA 1U27A 1FAOA 2P0FA 3QWMA 1DDWA 5JP4A 2YT0A 1MAIA 3PSCA 2H7DA 4IFSA 3V5WA 1MPHA 1B55A 2D11A 3GYOA 1EGXA 1EVHA 3DXCA 1Z87A 4P7IA 2LG1A 3DXEA 2EMSA 2P8VA 4HDOA 2D4QA 3TCAA 1FHWA 2QKLA 2EMTA 3MDBC 1FB8A 1ISNA 2AL6A 3D8DA 2DHJA 3KRWA 1J19A 4L6EA 5D3YA 1P5TA 2CRFA 3SUZA 4HHVA 2K2UA 5CLLB 2LULA 2DTCA 5DIFB 2LKOA 2PZ1A 1ZC4B 2D9XA 1J0WA 1TQZA 1I7AA 1UPRA 2ADZA 3A98B 4DXAB 1DDVA 1GG3A 5DHAB 2MDXA 3O96A 1UEFA 2Z0QA 4Z2NA 1FGYA 4CHJA 1SHCA 1V61A 2DN6A 1UNPA 5KQ4A 3QBVB 3DXDA 1ZVRA 1WGUA 2KUPA 4HB2B 2M38A 2DFKA 1KI1B 5HE3A
chains in the Genus database with same CATH superfamily
2YF0A 1BAKA 1V5UA 4D6WA 2UZRA 3ODWA 2DLWA 2DYNA 3OHMB 1BWNA 1U5EA 1K5DB 1X1GA 4HB4B 4PNKA 5JHHA 4TKNA 5JHGA 5M4YB 2K00A 4L1RA 2R0DA 3ULBA 4IOYX 3A58A 1OQNA 5J3QA 4OSNA 1GC7A 2NZ8B 4K2PA 1I2HA 4GMXB 5D3WA 4QJ4B 4HSIA 5LOPB 1MK9B 2Z14A 2L2IA 5EFXA 2MKRA 3ZDTA 1MK7B 4KHOA 1AWEA 1X11A 2UZSA 2E2XA 3VOQA 5J3YA 4HDQA 2DX1A 4F7UP 3FVCA 2XQNM 2Z0OA 3NWAA 2OTXA 2W2WA 5I2MA 1BTNA 1M7RA 1XR0B 1U5FA 3SNHA 2FJUB 2KGXB 1KZGA 3BINA 1LB1A 1ZYIA 4OT1A 1PFJA 2YT2A 1EF1A 2Z4DA 1V89A 3D8EA 3U8ZA 2LOXA 5GOWB 4HAZB 2LYDA 4KHBB 5L81A 1QQGA 3DCXA 1P6SA 2DKPA 5FI1A 2I5FA 1FGZA 2CY5A 4KAXB 2RSGA 4HB3B 3TO1A 1V88A 1WI1A 5KCVA 4ZRIA 1H4RA 1ZSQA 2CAYA 1FOEA 2P0HA 2R2YA 1N3HA 2CODA 4A6KA 4A6FB 2FJLA 4K81A 4WJ7A 4DX90 2COAA 1TXDA 2KUQA 2VKIA 4ZRKA 1P3RA 3FEHA 1WJ1A 1W1HA 4XWXA 2DA0A 3WYFB 1V5PA 2OQBA 2VSZA 2NBVA 3PVUA 3AJ4A 2D9WA 2GUMA 5KQ1A 1M7EA 3U12A 4KHAA 2RGNB 2I1KA 1EAZA 2UVMA 4GMVA 2I5CA 1U2BA 1H10A 5C5BB 1XKEA 5C6RA 2DHKA 3ZVRA 5C79A 2DYQA 5C16A 1NU2A 1ZC3B 3ODOA 3P6AA 2D10A 1Y19B 2RUKB 2GJYA 2R09A 4A6HA 4MT7A 3CIKA 1UNRA 1E5WA 2ZKMX 2Q13A 3GYPA 5DH9B 4KVGB 5LONB 4HAUB 3PEGA 2Z0PA 2AEHA 3PVLA 2K2JA 3F5RA 2KIEA 3HW2B 4GNKB 1MKEA 1NI2A 3KSYA 3NWDA 1UPQA 1WG7A 2RVBB 2GCLA 4TYZA 5FI0A 3NSUA 5D3XA 2P0DA 4H8SA 4HB0B 1SGHA 2ELAA 4B6HA 3IVFA 4DIXA 2CY4A 2YS5A 5I2SA 2HTHB 4F7GA 2J0KA 3RCPA 1WJMA 1GC6A 2D9VA 5HE1A 2L1CA 4Z2MB 4NY0A 4HATB 3SYXA 5JLJB 4IAPA 5DI9B 5D3VA 2W2XD 1DROA 3KZ1A 1TJ6A 3P7ZA 3VIAA 4DX8A 3CXBB 3FM8C 4C0AA 3TFMA 2DHIA 4QJ3B 5J3TA 4MY6A 4HAXB 3TW1A 2ELBA 1PLSA 2YVCA 1AQCA 2JP2A 2I1JA 1XCGA 4QJ5B 3AU5A 2D2QA 5HE2A 3OANA 2NMBA 1WVHA 3PP2A 2X18A 4HAVB 1MIXA 3A8QA 1DBHA 1MIZB 2GCJA 4D0NB 3AU4A 3PZDA 2N0YA 4EMOA 3A8PA 1K5GB 2D9YA 4ZRJA 2N23A 3TVVA 4CHMA 4WVFB 3KY9A 5IRSA 4KHBA 4WSFA 4F7HA 1OMWA 2IFSA 2Y7BA 1RJ2A 4GN1A 3HQCA 4Y94A 1LW3A 3FSSA 2RNRB 2QKMA 5D27A 2YT1A 3PVWA 1X05A 1DYNA 2YS1A 3ML4A 4EKUA 3KRXA 1Q67A 4PQ0A 1X86A 3SO6A 4A6FA 2ZPYA 1W1DA 4GPTB 2COFA 3F0WA 5CLQB 1OY2A 2H7EA 4GZUA 1ZM0A 4BBKA 3UZTA 4YL8A 3D8FA 1PMSA 2MFQA 4DBBA 4K2OA 1KZ7A 2D9ZA 2DX5A 2VRWB 4GOUA 1U29A 2DKQA 4CYEA 5DHFB 4NSWA 2HE7A 2Z13A 1XX0A 1IRSA 2M14A 4CSQA 3QIJA 1X1FA 5C5BA 2YS3A 2KIGA 1U5DA 3ULCA 2J0MA 4HAYB 1QC6A 2RRFA 2ROZB 2ROVA 3SV1A 2V76A 1UNQA 4QXAB 3MPXA 3U7DA 1FHXA 3BJIA 1XODA 3NWFA 2LOZA 3T06A 2EC1A 2J59M 3HK0A 1MI1A 2RLOA 4MK0A 2YSZA 3M1IB 2GS0A 1NTVA 4A5KA 2Y8GA 2BCJA 1NTYA 1DDMA 1RRPB 5HE0A 3X23A 2W2XC 3N7CA 1W1GA 1XD4A 3PG7A 1WGQA 4EJNA 1V5MA 2YRYA 2Y8FA 2COCA 3G9WA 4GXBA 4K17A 3LJUX 2EJ8A 2IYBA 2Z59A 4HAWB 1U5GA 2MWNB 2G35A 4YONA 2J0JA 2KR0A 1BTKA 1Y5OA 2KCJA 3WA0A 1FHOA 1T77A 3ODXA 1U27A 1FAOA 2P0FA 3QWMA 1DDWA 5JP4A 2YT0A 1MAIA 3PSCA 2H7DA 4IFSA 3V5WA 1MPHA 1B55A 3NW8A 2D11A 3HIEA 3HSAA 3GYOA 2K49A 1EGXA 1EVHA 3DXCA 1Z87A 4P7IA 2LG1A 3DXEA 2EMSA 2P8VA 4HDOA 2D4QA 3TCAA 1FHWA 2QKLA 2EMTA 3MDBC 1FB8A 1ISNA 2AL6A 3D8DA 2DHJA 3KRWA 1J19A 4L6EA 5D3YA 1P5TA 2CRFA 3SUZA 4HHVA 2K2UA 5CLLB 2LULA 2DTCA 5DIFB 2LKOA 2PZ1A 1ZC4B 2K8EA 2D9XA 1J0WA 1TQZA 1I7AA 1UPRA 2ADZA 3A98B 4DXAB 1DDVA 1GG3A 5DHAB 2MDXA 3O96A 1UEFA 2Z0QA 4Z2NA 1FGYA 4CHJA 1SHCA 1V61A 2DN6A 1UNPA 5KQ4A 3QBVB 3DXDA 1ZVRA 5LG4B 1WGUA 2KUPA 4HB2B 2M38A 2DFKA 1KI1B 5HE3A 3B77A
chains in the Genus database with same CATH topology
2YF0A 1BAKA 1V5UA 2UZRA 3ODWA 2DLWA 2DYNA 1BWNA 1U5EA 1K5DB 1X1GA 4HB4B 4PNKA 5JHHA 4TKNA 5JHGA 2K00A 2R0DA 3ULBA 4IOYX 1OQNA 5J3QA 1GC7A 2NZ8B 4K2PA 1I2HA 4GMXB 5D3WA 5LOPB 1MK9B 2L2IA 5EFXA 2MKRA 3ZDTA 1MK7B 4KHOA 1AWEA 1X11A 2UZSA 2E2XA 3VOQA 5J3YA 4HDQA 2DX1A 4F7UP 2XQNM 2Z0OA 2OTXA 2W2WA 1BTNA 1M7RA 1XR0B 1U5FA 3SNHA 2KGXB 1KZGA 3BINA 1LB1A 1PFJA 1EF1A 1V89A 3D8EA 3U8ZA 2LOXA 5GOWB 4HAZB 2LYDA 4KHBB 5L81A 1QQGA 1P6SA 2DKPA 5FI1A 2I5FA 1FGZA 2CY5A 4KAXB 2RSGA 4HB3B 3TO1A 1V88A 1WI1A 5KCVA 4ZRIA 1H4RA 1ZSQA 2CAYA 1FOEA 2P0HA 4A6KA 1N3HA 2CODA 4A6FB 2FJLA 4K81A 4WJ7A 4DX90 2COAA 1TXDA 2VKIA 4ZRKA 1P3RA 3FEHA 1WJ1A 1W1HA 4XWXA 2DA0A 3WYFB 1V5PA 2OQBA 2VSZA 3PVUA 3AJ4A 2D9WA 5KQ1A 1M7EA 4KHAA 2RGNB 2I1KA 1EAZA 2UVMA 4GMVA 2I5CA 1U2BA 1H10A 5C5BB 1XKEA 5C6RA 2DHKA 3ZVRA 5C79A 2DYQA 5C16A 1NU2A 1ZC3B 3ODOA 3P6AA 2D10A 1Y19B 2RUKB 2GJYA 2R09A 4A6HA 4MT7A 3CIKA 1UNRA 1E5WA 2Q13A 3GYPA 5DH9B 4KVGB 5LONB 4HAUB 3PEGA 2Z0PA 2AEHA 3PVLA 2K2JA 3F5RA 3HW2B 1MKEA 1NI2A 3KSYA 1UPQA 1WG7A 2RVBB 2GCLA 4TYZA 5FI0A 3NSUA 5D3XA 2P0DA 4H8SA 4HB0B 1SGHA 2ELAA 4B6HA 3IVFA 2CY4A 2YS5A 2HTHB 4F7GA 2J0KA 3RCPA 1WJMA 1GC6A 2D9VA 5HE1A 2L1CA 4Z2MB 4NY0A 4HATB 3SYXA 5JLJB 4IAPA 5DI9B 5D3VA 2W2XD 1DROA 3KZ1A 1TJ6A 3P7ZA 3VIAA 4DX8A 3CXBB 3FM8C 4C0AA 3TFMA 2DHIA 5J3TA 4MY6A 4HAXB 3TW1A 2ELBA 1PLSA 2YVCA 1AQCA 2JP2A 2I1JA 1XCGA 3AU5A 2D2QA 5HE2A 3OANA 2NMBA 1WVHA 3PP2A 2X18A 4HAVB 1MIXA 3A8QA 1DBHA 1MIZB 2GCJA 4D0NB 3AU4A 3PZDA 2N0YA 4EMOA 3A8PA 1K5GB 2D9YA 4ZRJA 2N23A 3TVVA 4CHMA 4WVFB 3KY9A 4WSFA 4F7HA 1OMWA 2IFSA 2Y7BA 1RJ2A 4GN1A 3HQCA 4Y94A 1LW3A 3FSSA 2RNRB 2QKMA 5D27A 2YT1A 3PVWA 1X05A 1DYNA 2YS1A 3ML4A 4EKUA 3KRXA 1Q67A 4PQ0A 1X86A 3SO6A 4A6FA 2ZPYA 1W1DA 4GPTB 2COFA 3F0WA 5CLQB 1OY2A 2H7EA 4GZUA 1ZM0A 4BBKA 3UZTA 4YL8A 3D8FA 1PMSA 2MFQA 4DBBA 4K2OA 1KZ7A 2D9ZA 2DX5A 2VRWB 1U29A 2DKQA 4CYEA 5DHFB 4NSWA 2HE7A 1XX0A 1IRSA 2M14A 3QIJA 1X1FA 5C5BA 2YS3A 3ULCA 1U5DA 2J0MA 4HAYB 1QC6A 2ROZB 2ROVA 3SV1A 2V76A 1UNQA 3MPXA 3U7DA 1FHXA 3BJIA 1XODA 2LOZA 3T06A 2EC1A 2J59M 3HK0A 2RLOA 4MK0A 2YSZA 3M1IB 2GS0A 1NTVA 4A5KA 2Y8GA 2BCJA 1NTYA 1DDMA 1RRPB 5HE0A 3X23A 2W2XC 3N7CA 1W1GA 1XD4A 3PG7A 1WGQA 4EJNA 1V5MA 2YRYA 2Y8FA 2COCA 3G9WA 4GXBA 4K17A 3LJUX 2EJ8A 2IYBA 4HAWB 1U5GA 2MWNB 2G35A 4YONA 2J0JA 1BTKA 1Y5OA 2KCJA 3WA0A 1FHOA 3ODXA 1U27A 1FAOA 2P0FA 3QWMA 1DDWA 5JP4A 2YT0A 1MAIA 3PSCA 2H7DA 4IFSA 3V5WA 1MPHA 1B55A 2D11A 3GYOA 1EGXA 1EVHA 3DXCA 1Z87A 4P7IA 2LG1A 3DXEA 2EMSA 2P8VA 4HDOA 2D4QA 3TCAA 1FHWA 2QKLA 2EMTA 3MDBC 1FB8A 1ISNA 2AL6A 3D8DA 2DHJA 3KRWA 1J19A 4L6EA 5D3YA 1P5TA 2CRFA 3SUZA 4HHVA 2K2UA 5CLLB 2LULA 2DTCA 5DIFB 2LKOA 2PZ1A 1ZC4B 2D9XA 1J0WA 1TQZA 1I7AA 1UPRA 2ADZA 3A98B 4DXAB 1DDVA 1GG3A 5DHAB 2MDXA 3O96A 1UEFA 2Z0QA 4Z2NA 1FGYA 4CHJA 1SHCA 1V61A 2DN6A 1UNPA 5KQ4A 3QBVB 3DXDA 1ZVRA 1WGUA 2KUPA 4HB2B 2M38A 2DFKA 1KI1B 5HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YF0 A;  1BAK A;  1V5U A;  2UZR A;  3ODW A;  2DLW A;  2DYN A;  1BWN A;  1U5E A;  1K5D B;  1X1G A;  4HB4 B;  4PNK A;  5JHH A;  4TKN A;  5JHG A;  2K00 A;  2R0D A;  3ULB A;  4IOY X;  1OQN A;  5J3Q A;  1GC7 A;  2NZ8 B;  4K2P A;  1I2H A;  4GMX B;  5D3W A;  5LOP B;  1MK9 B;  2L2I A;  5EFX A;  2MKR A;  3ZDT A;  1MK7 B;  4KHO A;  1AWE A;  1X11 A;  2UZS A;  2E2X A;  3VOQ A;  5J3Y A;  4HDQ A;  2DX1 A;  4F7U P;  2XQN M;  2Z0O A;  2OTX A;  2W2W A;  1BTN A;  1M7R A;  1XR0 B;  1U5F A;  3SNH A;  2KGX B;  1KZG A;  3BIN A;  1LB1 A;  1PFJ A;  1EF1 A;  1V89 A;  3D8E A;  3U8Z A;  2LOX A;  5GOW B;  4HAZ B;  2LYD A;  4KHB B;  5L81 A;  1QQG A;  1P6S A;  2DKP A;  5FI1 A;  2I5F A;  1FGZ A;  2CY5 A;  4KAX B;  2RSG A;  4HB3 B;  3TO1 A;  1V88 A;  1WI1 A;  5KCV A;  4ZRI A;  1H4R A;  1ZSQ A;  2CAY A;  1FOE A;  2P0H A;  4A6K A;  1N3H A;  2COD A;  4A6F B;  2FJL A;  4K81 A;  4WJ7 A;  4DX9 0;  2COA A;  1TXD A;  2VKI A;  4ZRK A;  1P3R A;  3FEH A;  1WJ1 A;  1W1H A;  4XWX A;  2DA0 A;  3WYF B;  1V5P A;  2OQB A;  2VSZ A;  3PVU A;  3AJ4 A;  2D9W A;  5KQ1 A;  1M7E A;  4KHA A;  2RGN B;  2I1K A;  1EAZ A;  2UVM A;  4GMV A;  2I5C A;  1U2B A;  1H10 A;  5C5B B;  1XKE A;  5C6R A;  2DHK A;  3ZVR A;  5C79 A;  2DYQ A;  5C16 A;  1NU2 A;  1ZC3 B;  3ODO A;  3P6A A;  2D10 A;  1Y19 B;  2RUK B;  2GJY A;  2R09 A;  4A6H A;  4MT7 A;  3CIK A;  1UNR A;  1E5W A;  2Q13 A;  3GYP A;  5DH9 B;  4KVG B;  5LON B;  4HAU B;  3PEG A;  2Z0P A;  2AEH A;  3PVL A;  2K2J A;  3F5R A;  3HW2 B;  1MKE A;  1NI2 A;  3KSY A;  1UPQ A;  1WG7 A;  2RVB B;  2GCL A;  4TYZ A;  5FI0 A;  3NSU A;  5D3X A;  2P0D A;  4H8S A;  4HB0 B;  1SGH A;  2ELA A;  4B6H A;  3IVF A;  2CY4 A;  2YS5 A;  2HTH B;  4F7G A;  2J0K A;  3RCP A;  1WJM A;  1GC6 A;  2D9V A;  5HE1 A;  2L1C A;  4Z2M B;  4NY0 A;  4HAT B;  3SYX A;  5JLJ B;  4IAP A;  5DI9 B;  5D3V A;  2W2X D;  1DRO A;  3KZ1 A;  1TJ6 A;  3P7Z A;  3VIA A;  4DX8 A;  3CXB B;  3FM8 C;  4C0A A;  3TFM A;  2DHI A;  5J3T A;  4MY6 A;  4HAX B;  3TW1 A;  2ELB A;  1PLS A;  2YVC A;  1AQC A;  2JP2 A;  2I1J A;  1XCG A;  3AU5 A;  2D2Q A;  5HE2 A;  3OAN A;  2NMB A;  1WVH A;  3PP2 A;  2X18 A;  4HAV B;  1MIX A;  3A8Q A;  1DBH A;  1MIZ B;  2GCJ A;  4D0N B;  3AU4 A;  3PZD A;  2N0Y A;  4EMO A;  3A8P A;  1K5G B;  2D9Y A;  4ZRJ A;  2N23 A;  3TVV A;  4CHM A;  4WVF B;  3KY9 A;  4WSF A;  4F7H A;  1OMW A;  2IFS A;  2Y7B A;  1RJ2 A;  4GN1 A;  3HQC A;  4Y94 A;  1LW3 A;  3FSS A;  2RNR B;  2QKM A;  5D27 A;  2YT1 A;  3PVW A;  1X05 A;  1DYN A;  2YS1 A;  3ML4 A;  4EKU A;  3KRX A;  1Q67 A;  4PQ0 A;  1X86 A;  3SO6 A;  4A6F A;  2ZPY A;  1W1D A;  4GPT B;  2COF A;  3F0W A;  5CLQ B;  1OY2 A;  2H7E A;  4GZU A;  1ZM0 A;  4BBK A;  3UZT A;  4YL8 A;  3D8F A;  1PMS A;  2MFQ A;  4DBB A;  4K2O A;  1KZ7 A;  2D9Z A;  2DX5 A;  2VRW B;  1U29 A;  2DKQ A;  4CYE A;  5DHF B;  4NSW A;  2HE7 A;  1XX0 A;  1IRS A;  2M14 A;  3QIJ A;  1X1F A;  5C5B A;  2YS3 A;  3ULC A;  1U5D A;  2J0M A;  4HAY B;  1QC6 A;  2ROZ B;  2ROV A;  3SV1 A;  2V76 A;  1UNQ A;  3MPX A;  3U7D A;  1FHX A;  3BJI A;  1XOD A;  2LOZ A;  3T06 A;  2EC1 A;  2J59 M;  3HK0 A;  2RLO A;  4MK0 A;  2YSZ A;  3M1I B;  2GS0 A;  1NTV A;  4A5K A;  2Y8G A;  2BCJ A;  1NTY A;  1DDM A;  1RRP B;  5HE0 A;  3X23 A;  2W2X C;  3N7C A;  1W1G A;  1XD4 A;  3PG7 A;  1WGQ A;  4EJN A;  1V5M A;  2YRY A;  2Y8F A;  2COC A;  3G9W A;  4GXB A;  4K17 A;  3LJU X;  2EJ8 A;  2IYB A;  4HAW B;  1U5G A;  2MWN B;  2G35 A;  4YON A;  2J0J A;  1BTK A;  1Y5O A;  2KCJ A;  3WA0 A;  1FHO A;  3ODX A;  1U27 A;  1FAO A;  2P0F A;  3QWM A;  1DDW A;  5JP4 A;  2YT0 A;  1MAI A;  3PSC A;  2H7D A;  4IFS A;  3V5W A;  1MPH A;  1B55 A;  2D11 A;  3GYO A;  1EGX A;  1EVH A;  3DXC A;  1Z87 A;  4P7I A;  2LG1 A;  3DXE A;  2EMS A;  2P8V A;  4HDO A;  2D4Q A;  3TCA A;  1FHW A;  2QKL A;  2EMT A;  3MDB C;  1FB8 A;  1ISN A;  2AL6 A;  3D8D A;  2DHJ A;  3KRW A;  1J19 A;  4L6E A;  5D3Y A;  1P5T A;  2CRF A;  3SUZ A;  4HHV A;  2K2U A;  5CLL B;  2LUL A;  2DTC A;  5DIF B;  2LKO A;  2PZ1 A;  1ZC4 B;  2D9X A;  1J0W A;  1TQZ A;  1I7A A;  1UPR A;  2ADZ A;  3A98 B;  4DXA B;  1DDV A;  1GG3 A;  5DHA B;  2MDX A;  3O96 A;  1UEF A;  2Z0Q A;  4Z2N A;  1FGY A;  4CHJ A;  1SHC A;  1V61 A;  2DN6 A;  1UNP A;  5KQ4 A;  3QBV B;  3DXD A;  1ZVR A;  1WGU A;  2KUP A;  4HB2 B;  2M38 A;  2DFK A;  1KI1 B;  5HE3 A; 
#chains in the Genus database with same CATH topology
 2YF0 A;  1BAK A;  1V5U A;  4D6W A;  2UZR A;  3ODW A;  2DLW A;  2DYN A;  3OHM B;  1BWN A;  1U5E A;  1K5D B;  1X1G A;  4HB4 B;  4PNK A;  5JHH A;  4TKN A;  5JHG A;  5M4Y B;  2K00 A;  4L1R A;  2R0D A;  3ULB A;  4IOY X;  3A58 A;  1OQN A;  5J3Q A;  4OSN A;  1GC7 A;  2NZ8 B;  4K2P A;  1I2H A;  4GMX B;  5D3W A;  4QJ4 B;  4HSI A;  5LOP B;  1MK9 B;  2Z14 A;  2L2I A;  5EFX A;  2MKR A;  3ZDT A;  1MK7 B;  4KHO A;  1AWE A;  1X11 A;  2UZS A;  2E2X A;  3VOQ A;  5J3Y A;  4HDQ A;  2DX1 A;  4F7U P;  3FVC A;  2XQN M;  2Z0O A;  3NWA A;  2OTX A;  2W2W A;  5I2M A;  1BTN A;  1M7R A;  1XR0 B;  1U5F A;  3SNH A;  2FJU B;  2KGX B;  1KZG A;  3BIN A;  1LB1 A;  1ZYI A;  4OT1 A;  1PFJ A;  2YT2 A;  1EF1 A;  2Z4D A;  1V89 A;  3D8E A;  3U8Z A;  2LOX A;  5GOW B;  4HAZ B;  2LYD A;  4KHB B;  5L81 A;  1QQG A;  3DCX A;  1P6S A;  2DKP A;  5FI1 A;  2I5F A;  1FGZ A;  2CY5 A;  4KAX B;  2RSG A;  4HB3 B;  3TO1 A;  1V88 A;  1WI1 A;  5KCV A;  4ZRI A;  1H4R A;  1ZSQ A;  2CAY A;  1FOE A;  2P0H A;  2R2Y A;  1N3H A;  2COD A;  4A6K A;  4A6F B;  2FJL A;  4K81 A;  4WJ7 A;  4DX9 0;  2COA A;  1TXD A;  2KUQ A;  2VKI A;  4ZRK A;  1P3R A;  3FEH A;  1WJ1 A;  1W1H A;  4XWX A;  2DA0 A;  3WYF B;  1V5P A;  2OQB A;  2VSZ A;  2NBV A;  3PVU A;  3AJ4 A;  2D9W A;  2GUM A;  5KQ1 A;  1M7E A;  3U12 A;  4KHA A;  2RGN B;  2I1K A;  1EAZ A;  2UVM A;  4GMV A;  2I5C A;  1U2B A;  1H10 A;  5C5B B;  1XKE A;  5C6R A;  2DHK A;  3ZVR A;  5C79 A;  2DYQ A;  5C16 A;  1NU2 A;  1ZC3 B;  3ODO A;  3P6A A;  2D10 A;  1Y19 B;  2RUK B;  2GJY A;  2R09 A;  4A6H A;  4MT7 A;  3CIK A;  1UNR A;  1E5W A;  2ZKM X;  2Q13 A;  3GYP A;  5DH9 B;  4KVG B;  5LON B;  4HAU B;  3PEG A;  2Z0P A;  2AEH A;  3PVL A;  2K2J A;  3F5R A;  2KIE A;  3HW2 B;  4GNK B;  1MKE A;  1NI2 A;  3KSY A;  3NWD A;  1UPQ A;  1WG7 A;  2RVB B;  2GCL A;  4TYZ A;  5FI0 A;  3NSU A;  5D3X A;  2P0D A;  4H8S A;  4HB0 B;  1SGH A;  2ELA A;  4B6H A;  3IVF A;  4DIX A;  2CY4 A;  2YS5 A;  5I2S A;  2HTH B;  4F7G A;  2J0K A;  3RCP A;  1WJM A;  1GC6 A;  2D9V A;  5HE1 A;  2L1C A;  4Z2M B;  4NY0 A;  4HAT B;  3SYX A;  5JLJ B;  4IAP A;  5DI9 B;  5D3V A;  2W2X D;  1DRO A;  3KZ1 A;  1TJ6 A;  3P7Z A;  3VIA A;  4DX8 A;  3CXB B;  3FM8 C;  4C0A A;  3TFM A;  2DHI A;  4QJ3 B;  5J3T A;  4MY6 A;  4HAX B;  3TW1 A;  2ELB A;  1PLS A;  2YVC A;  1AQC A;  2JP2 A;  2I1J A;  1XCG A;  4QJ5 B;  3AU5 A;  2D2Q A;  5HE2 A;  3OAN A;  2NMB A;  1WVH A;  3PP2 A;  2X18 A;  4HAV B;  1MIX A;  3A8Q A;  1DBH A;  1MIZ B;  2GCJ A;  4D0N B;  3AU4 A;  3PZD A;  2N0Y A;  4EMO A;  3A8P A;  1K5G B;  2D9Y A;  4ZRJ A;  2N23 A;  3TVV A;  4CHM A;  4WVF B;  3KY9 A;  5IRS A;  4KHB A;  4WSF A;  4F7H A;  1OMW A;  2IFS A;  2Y7B A;  1RJ2 A;  4GN1 A;  3HQC A;  4Y94 A;  1LW3 A;  3FSS A;  2RNR B;  2QKM A;  5D27 A;  2YT1 A;  3PVW A;  1X05 A;  1DYN A;  2YS1 A;  3ML4 A;  4EKU A;  3KRX A;  1Q67 A;  4PQ0 A;  1X86 A;  3SO6 A;  4A6F A;  2ZPY A;  1W1D A;  4GPT B;  2COF A;  3F0W A;  5CLQ B;  1OY2 A;  2H7E A;  4GZU A;  1ZM0 A;  4BBK A;  3UZT A;  4YL8 A;  3D8F A;  1PMS A;  2MFQ A;  4DBB A;  4K2O A;  1KZ7 A;  2D9Z A;  2DX5 A;  2VRW B;  4GOU A;  1U29 A;  2DKQ A;  4CYE A;  5DHF B;  4NSW A;  2HE7 A;  2Z13 A;  1XX0 A;  1IRS A;  2M14 A;  4CSQ A;  3QIJ A;  1X1F A;  5C5B A;  2YS3 A;  2KIG A;  1U5D A;  3ULC A;  2J0M A;  4HAY B;  1QC6 A;  2RRF A;  2ROZ B;  2ROV A;  3SV1 A;  2V76 A;  1UNQ A;  4QXA B;  3MPX A;  3U7D A;  1FHX A;  3BJI A;  1XOD A;  3NWF A;  2LOZ A;  3T06 A;  2EC1 A;  2J59 M;  3HK0 A;  1MI1 A;  2RLO A;  4MK0 A;  2YSZ A;  3M1I B;  2GS0 A;  1NTV A;  4A5K A;  2Y8G A;  2BCJ A;  1NTY A;  1DDM A;  1RRP B;  5HE0 A;  3X23 A;  2W2X C;  3N7C A;  1W1G A;  1XD4 A;  3PG7 A;  1WGQ A;  4EJN A;  1V5M A;  2YRY A;  2Y8F A;  2COC A;  3G9W A;  4GXB A;  4K17 A;  3LJU X;  2EJ8 A;  2IYB A;  2Z59 A;  4HAW B;  1U5G A;  2MWN B;  2G35 A;  4YON A;  2J0J A;  2KR0 A;  1BTK A;  1Y5O A;  2KCJ A;  3WA0 A;  1FHO A;  1T77 A;  3ODX A;  1U27 A;  1FAO A;  2P0F A;  3QWM A;  1DDW A;  5JP4 A;  2YT0 A;  1MAI A;  3PSC A;  2H7D A;  4IFS A;  3V5W A;  1MPH A;  1B55 A;  3NW8 A;  2D11 A;  3HIE A;  3HSA A;  3GYO A;  2K49 A;  1EGX A;  1EVH A;  3DXC A;  1Z87 A;  4P7I A;  2LG1 A;  3DXE A;  2EMS A;  2P8V A;  4HDO A;  2D4Q A;  3TCA A;  1FHW A;  2QKL A;  2EMT A;  3MDB C;  1FB8 A;  1ISN A;  2AL6 A;  3D8D A;  2DHJ A;  3KRW A;  1J19 A;  4L6E A;  5D3Y A;  1P5T A;  2CRF A;  3SUZ A;  4HHV A;  2K2U A;  5CLL B;  2LUL A;  2DTC A;  5DIF B;  2LKO A;  2PZ1 A;  1ZC4 B;  2K8E A;  2D9X A;  1J0W A;  1TQZ A;  1I7A A;  1UPR A;  2ADZ A;  3A98 B;  4DXA B;  1DDV A;  1GG3 A;  5DHA B;  2MDX A;  3O96 A;  1UEF A;  2Z0Q A;  4Z2N A;  1FGY A;  4CHJ A;  1SHC A;  1V61 A;  2DN6 A;  1UNP A;  5KQ4 A;  3QBV B;  3DXD A;  1ZVR A;  5LG4 B;  1WGU A;  2KUP A;  4HB2 B;  2M38 A;  2DFK A;  1KI1 B;  5HE3 A;  3B77 A; 
#chains in the Genus database with same CATH homology
 2YF0 A;  1BAK A;  1V5U A;  2UZR A;  3ODW A;  2DLW A;  2DYN A;  1BWN A;  1U5E A;  1K5D B;  1X1G A;  4HB4 B;  4PNK A;  5JHH A;  4TKN A;  5JHG A;  2K00 A;  2R0D A;  3ULB A;  4IOY X;  1OQN A;  5J3Q A;  1GC7 A;  2NZ8 B;  4K2P A;  1I2H A;  4GMX B;  5D3W A;  5LOP B;  1MK9 B;  2L2I A;  5EFX A;  2MKR A;  3ZDT A;  1MK7 B;  4KHO A;  1AWE A;  1X11 A;  2UZS A;  2E2X A;  3VOQ A;  5J3Y A;  4HDQ A;  2DX1 A;  4F7U P;  2XQN M;  2Z0O A;  2OTX A;  2W2W A;  1BTN A;  1M7R A;  1XR0 B;  1U5F A;  3SNH A;  2KGX B;  1KZG A;  3BIN A;  1LB1 A;  1PFJ A;  1EF1 A;  1V89 A;  3D8E A;  3U8Z A;  2LOX A;  5GOW B;  4HAZ B;  2LYD A;  4KHB B;  5L81 A;  1QQG A;  1P6S A;  2DKP A;  5FI1 A;  2I5F A;  1FGZ A;  2CY5 A;  4KAX B;  2RSG A;  4HB3 B;  3TO1 A;  1V88 A;  1WI1 A;  5KCV A;  4ZRI A;  1H4R A;  1ZSQ A;  2CAY A;  1FOE A;  2P0H A;  4A6K A;  1N3H A;  2COD A;  4A6F B;  2FJL A;  4K81 A;  4WJ7 A;  4DX9 0;  2COA A;  1TXD A;  2VKI A;  4ZRK A;  1P3R A;  3FEH A;  1WJ1 A;  1W1H A;  4XWX A;  2DA0 A;  3WYF B;  1V5P A;  2OQB A;  2VSZ A;  3PVU A;  3AJ4 A;  2D9W A;  5KQ1 A;  1M7E A;  4KHA A;  2RGN B;  2I1K A;  1EAZ A;  2UVM A;  4GMV A;  2I5C A;  1U2B A;  1H10 A;  5C5B B;  1XKE A;  5C6R A;  2DHK A;  3ZVR A;  5C79 A;  2DYQ A;  5C16 A;  1NU2 A;  1ZC3 B;  3ODO A;  3P6A A;  2D10 A;  1Y19 B;  2RUK B;  2GJY A;  2R09 A;  4A6H A;  4MT7 A;  3CIK A;  1UNR A;  1E5W A;  2Q13 A;  3GYP A;  5DH9 B;  4KVG B;  5LON B;  4HAU B;  3PEG A;  2Z0P A;  2AEH A;  3PVL A;  2K2J A;  3F5R A;  3HW2 B;  1MKE A;  1NI2 A;  3KSY A;  1UPQ A;  1WG7 A;  2RVB B;  2GCL A;  4TYZ A;  5FI0 A;  3NSU A;  5D3X A;  2P0D A;  4H8S A;  4HB0 B;  1SGH A;  2ELA A;  4B6H A;  3IVF A;  2CY4 A;  2YS5 A;  2HTH B;  4F7G A;  2J0K A;  3RCP A;  1WJM A;  1GC6 A;  2D9V A;  5HE1 A;  2L1C A;  4Z2M B;  4NY0 A;  4HAT B;  3SYX A;  5JLJ B;  4IAP A;  5DI9 B;  5D3V A;  2W2X D;  1DRO A;  3KZ1 A;  1TJ6 A;  3P7Z A;  3VIA A;  4DX8 A;  3CXB B;  3FM8 C;  4C0A A;  3TFM A;  2DHI A;  5J3T A;  4MY6 A;  4HAX B;  3TW1 A;  2ELB A;  1PLS A;  2YVC A;  1AQC A;  2JP2 A;  2I1J A;  1XCG A;  3AU5 A;  2D2Q A;  5HE2 A;  3OAN A;  2NMB A;  1WVH A;  3PP2 A;  2X18 A;  4HAV B;  1MIX A;  3A8Q A;  1DBH A;  1MIZ B;  2GCJ A;  4D0N B;  3AU4 A;  3PZD A;  2N0Y A;  4EMO A;  3A8P A;  1K5G B;  2D9Y A;  4ZRJ A;  2N23 A;  3TVV A;  4CHM A;  4WVF B;  3KY9 A;  4WSF A;  4F7H A;  1OMW A;  2IFS A;  2Y7B A;  1RJ2 A;  4GN1 A;  3HQC A;  4Y94 A;  1LW3 A;  3FSS A;  2RNR B;  2QKM A;  5D27 A;  2YT1 A;  3PVW A;  1X05 A;  1DYN A;  2YS1 A;  3ML4 A;  4EKU A;  3KRX A;  1Q67 A;  4PQ0 A;  1X86 A;  3SO6 A;  4A6F A;  2ZPY A;  1W1D A;  4GPT B;  2COF A;  3F0W A;  5CLQ B;  1OY2 A;  2H7E A;  4GZU A;  1ZM0 A;  4BBK A;  3UZT A;  4YL8 A;  3D8F A;  1PMS A;  2MFQ A;  4DBB A;  4K2O A;  1KZ7 A;  2D9Z A;  2DX5 A;  2VRW B;  1U29 A;  2DKQ A;  4CYE A;  5DHF B;  4NSW A;  2HE7 A;  1XX0 A;  1IRS A;  2M14 A;  3QIJ A;  1X1F A;  5C5B A;  2YS3 A;  3ULC A;  1U5D A;  2J0M A;  4HAY B;  1QC6 A;  2ROZ B;  2ROV A;  3SV1 A;  2V76 A;  1UNQ A;  3MPX A;  3U7D A;  1FHX A;  3BJI A;  1XOD A;  2LOZ A;  3T06 A;  2EC1 A;  2J59 M;  3HK0 A;  2RLO A;  4MK0 A;  2YSZ A;  3M1I B;  2GS0 A;  1NTV A;  4A5K A;  2Y8G A;  2BCJ A;  1NTY A;  1DDM A;  1RRP B;  5HE0 A;  3X23 A;  2W2X C;  3N7C A;  1W1G A;  1XD4 A;  3PG7 A;  1WGQ A;  4EJN A;  1V5M A;  2YRY A;  2Y8F A;  2COC A;  3G9W A;  4GXB A;  4K17 A;  3LJU X;  2EJ8 A;  2IYB A;  4HAW B;  1U5G A;  2MWN B;  2G35 A;  4YON A;  2J0J A;  1BTK A;  1Y5O A;  2KCJ A;  3WA0 A;  1FHO A;  3ODX A;  1U27 A;  1FAO A;  2P0F A;  3QWM A;  1DDW A;  5JP4 A;  2YT0 A;  1MAI A;  3PSC A;  2H7D A;  4IFS A;  3V5W A;  1MPH A;  1B55 A;  2D11 A;  3GYO A;  1EGX A;  1EVH A;  3DXC A;  1Z87 A;  4P7I A;  2LG1 A;  3DXE A;  2EMS A;  2P8V A;  4HDO A;  2D4Q A;  3TCA A;  1FHW A;  2QKL A;  2EMT A;  3MDB C;  1FB8 A;  1ISN A;  2AL6 A;  3D8D A;  2DHJ A;  3KRW A;  1J19 A;  4L6E A;  5D3Y A;  1P5T A;  2CRF A;  3SUZ A;  4HHV A;  2K2U A;  5CLL B;  2LUL A;  2DTC A;  5DIF B;  2LKO A;  2PZ1 A;  1ZC4 B;  2D9X A;  1J0W A;  1TQZ A;  1I7A A;  1UPR A;  2ADZ A;  3A98 B;  4DXA B;  1DDV A;  1GG3 A;  5DHA B;  2MDX A;  3O96 A;  1UEF A;  2Z0Q A;  4Z2N A;  1FGY A;  4CHJ A;  1SHC A;  1V61 A;  2DN6 A;  1UNP A;  5KQ4 A;  3QBV B;  3DXD A;  1ZVR A;  1WGU A;  2KUP A;  4HB2 B;  2M38 A;  2DFK A;  1KI1 B;  5HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...