2DTCA

Crystal structure of ms0666
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
PTMEGPLRRKTLLKEGRKPALSSWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
publication title Crystal structure of MS0666
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dtcA00
5DHAB 3BJIA 5DIFB 4HB3B 3AJ4A 1QQGA 1AWEA 4HAWB 2LOXA 3DXDA 2GS0A 2I5CA 2YS1A 1DDVA 1P3RA 2G35A 2IYBA 5HE0A 4TYZA 3AU4A 3SO6A 4HATB 3PVUA 3RCPA 3LJUX 1X1GA 5D3WA 3ODWA 2VRWB 3TVVA 2DHKA 2K2UA 1MAIA 1XKEA 1LB1A 1EF1A 1ZM0A 2DKPA 2J0JA 2UZSA 5EFXA 1V89A 3F0WA 2W2XC 1WG7A 2Y7BA 4K2PA 2COFA 3VIAA 4GZUA 1LW3A 3P6AA 3SNHA 1KI1B 5D27A 3TW1A 3FEHA 3VOQA 1DBHA 1FGZA 1P6SA 1ZSQA 5DH9B 2W2XD 5D3VA 1V5MA 3PEGA 4IOYX 2VKIA 3IVFA 3QWMA 3FSSA 1W1HA 2LG1A 2FJLA 1TQZA 5J3QA 2Z0QA 1X1FA 2OTXA 4L6EA 1XX0A 4XWXA 3PP2A 2GJYA 1M7EA 2LYDA 2RGNB 2RLOA 3GYPA 1K5GB 3OANA 3G9WA 4ZRIA 1I7AA 4EJNA 4Z2NA 2IFSA 3GYOA 1NTVA 1WGQA 2Z0PA 1E5WA 1ZVRA 1FOEA 1U27A 3T06A 1TJ6A 3M1IB 2RUKB 2DN6A 1UNQA 3KY9A 2ROVA 1H10A 5FI0A 2X18A 5DHFB 3SUZA 2D9YA 1BTNA 4Z2MB 2NMBA 4HB2B 3HQCA 3ZDTA 4HAZB 1DDMA 2EJ8A 2DX1A 2COCA 5CLQB 5J3YA 5JHHA 3WYFB 2E2XA 2L2IA 1M7RA 1FHXA 1MPHA 4IAPA 5D3XA 1EAZA 1EVHA 3AU5A 1NTYA 2YS3A 1UEFA 2D9VA 1WVHA 2JP2A 2P0HA 2R0DA 3U7DA 4A6FA 1UPQA 1BWNA 1FAOA 2AL6A 5JLJB 3KZ1A 4GMXB 4P7IA 4YONA 1XODA 2MWNB 3KRXA 2LOZA 3CIKA 4WVFB 4EKUA 2J59M 4MT7A 4Y94A 4KHBB 4TKNA 5JP4A 1J19A 2V76A 4ZRJA 4CHMA 3TO1A 2KCJA 5KQ4A 1U5EA 3MDBC 1ZC3B 2AEHA 2CY5A 1KZGA 3P7ZA 4KHAA 1MK7B 2UZRA 1SHCA 2M38A 3QIJA 5DI9B 2GCLA 2ZPYA 2D4QA 3X23A 4HAVB 2DHJA 2KUPA 1ZC4B 4A6FB 1Y5OA 2N0YA 1U5FA 5HE3A 2J0KA 3UZTA 2XQNM 3TCAA 4EMOA 4GN1A 5HE2A 2PZ1A 3D8FA 1UPRA 1NU2A 2MFQA 2YT0A 3A8PA 1GC6A 1V5UA 4F7UP 4HAXB 4DBBA 3FM8C 5CLLB 1W1GA 3BINA 2K2JA 1QC6A 2YT1A 5C16A 2UVMA 4DXAB 2D2QA 2NZ8B 2RSGA 1U29A 1Z87A 1V61A 1RJ2A 1U5DA 2RNRB 1J0WA 3ULBA 5C79A 2EC1A 3ULCA 2ROZB 2CAYA 3ML4A 3KRWA 2QKMA 3O96A 1K5DB 1OY2A 2DLWA 3N7CA 3ODOA 4NY0A 4HDOA 1WI1A 1H4RA 4GXBA 5C5BB 2I5FA 1Q67A 5L81A 2D10A 2Y8FA 5D3YA 4KHOA 3HW2B 5J3TA 2D11A 1PFJA 2P8VA 1N3HA 4K81A 2OQBA 4C0AA 1FB8A 1PLSA 4F7HA 4MK0A 4CHJA 1BTKA 2MDXA 2K00A 1EGXA 3PZDA 2N23A 4GPTB 2P0FA 1BAKA 1V5PA 4F7GA 1XR0B 3PSCA 2LKOA 3WA0A 2BCJA 1IRSA 2L1CA 2CY4A 5LONB 1MK9B 3A8QA 5KQ1A 4HHVA 3D8EA 3NSUA 3F5RA 2DYNA 3ODXA 4K17A 5JHGA 2ELAA 4K2OA 2P0DA 2EMSA 2CRFA 4CYEA 3SYXA 2D9ZA 4WJ7A 4PNKA 2GCJA 2H7EA 1W1DA 2QKLA 2DFKA 3CXBB 2ELBA 4HB0B 2W2WA 3A98B 3TFMA 3V5WA 2ADZA 5FI1A 3PVWA 4HAYB 1AQCA 3MPXA 1V88A 2LULA 5C5BA 1TXDA 2YS5A 2YRYA 3DXCA 1KZ7A 4H8SA 1SGHA 1XCGA 2COAA 2RVBB 2HE7A 4D0NB 4BBKA 2YSZA 1FHOA 1NI2A 1DROA 2Q13A 3KSYA 2R09A 1OQNA 1XD4A 4NSWA 3PG7A 2YVCA 1WJMA 4DX90 4WSFA 2DX5A 1MIXA 2H7DA 4KVGB 4DX8A 1GG3A 1FGYA 3PVLA 1X05A 2DTCA 1U5GA 1P5TA 2CODA 1UNPA 2MKRA 4HDQA 3ZVRA 1U2BA 2D9WA 1MKEA 4HB4B 1X86A 1FHWA 2Z0OA 3QBVB 1GC7A 1RRPB 2KGXB 4B6HA 2EMTA 3HK0A 2J0MA 1WGUA 1OMWA 4KAXB 1MIZB 4A6HA 2DYQA 3SV1A 5LOPB 2YF0A 1I2HA 2HTHB 1ISNA 4A5KA 2VSZA 1UNRA 1DDWA 1X11A 1PMSA 2Y8GA 2DHIA 2I1KA 1DYNA 4A6KA 2I1JA 2D9XA 5KCVA 1B55A 4HAUB 5C6RA 4YL8A 2DKQA 1Y19B 4ZRKA 3D8DA 2DA0A 3DXEA 5GOWB 4IFSA 4MY6A 4PQ0A 2M14A 4GMVA 3U8ZA 1WJ1A 5HE1A
chains in the Genus database with same CATH superfamily
5DHAB 3BJIA 5DIFB 4HB3B 3AJ4A 1MI1A 1QQGA 1AWEA 4HAWB 2LOXA 3DXDA 2GS0A 2I5CA 2YS1A 1DDVA 3U12A 1P3RA 2G35A 2IYBA 5HE0A 4TYZA 3AU4A 3SO6A 4OSNA 3FVCA 4HATB 3PVUA 3RCPA 3LJUX 1X1GA 5D3WA 3ODWA 2VRWB 3TVVA 2DHKA 2K2UA 1MAIA 1XKEA 1LB1A 1EF1A 1ZM0A 2DKPA 2J0JA 2UZSA 5EFXA 1V89A 3F0WA 2W2XC 1WG7A 2Y7BA 4K2PA 2COFA 3VIAA 4GZUA 1LW3A 3P6AA 3SNHA 1KI1B 5D27A 5I2SA 3TW1A 3FEHA 3VOQA 1DBHA 1FGZA 1P6SA 1ZSQA 2R2YA 5DH9B 2W2XD 2ZKMX 5D3VA 1V5MA 4QJ5B 3A58A 3PEGA 2KUQA 4IOYX 2VKIA 4GOUA 3IVFA 3QWMA 3FSSA 1W1HA 2LG1A 2FJLA 1TQZA 5J3QA 2Z0QA 4L1RA 1X1FA 2OTXA 4L6EA 1XX0A 4XWXA 3PP2A 2GJYA 1M7EA 2LYDA 2RGNB 2RLOA 3GYPA 1K5GB 3OANA 3G9WA 4ZRIA 1I7AA 4EJNA 4Z2NA 2IFSA 3GYOA 1NTVA 3B77A 1WGQA 2Z0PA 1E5WA 1ZVRA 1FOEA 1U27A 3T06A 1TJ6A 2KIGA 3M1IB 2RUKB 2DN6A 1UNQA 2K49A 3KY9A 2ROVA 1H10A 5FI0A 2X18A 5DHFB 3SUZA 3NWFA 2D9YA 1BTNA 4Z2MB 2NMBA 4HB2B 3HQCA 3ZDTA 4HAZB 1DDMA 2YT2A 2EJ8A 2DX1A 2COCA 5CLQB 5J3YA 5JHHA 3WYFB 2E2XA 2L2IA 1M7RA 1FHXA 1MPHA 4IAPA 5D3XA 3AU5A 1EAZA 1EVHA 1NTYA 2YS3A 1UEFA 3NW8A 2D9VA 1WVHA 2JP2A 2P0HA 2R0DA 3U7DA 4A6FA 1UPQA 1BWNA 1ZYIA 1FAOA 2AL6A 5M4YB 5JLJB 3KZ1A 4GMXB 4P7IA 4YONA 1XODA 2MWNB 3KRXA 2LOZA 3CIKA 4WVFB 4EKUA 2J59M 4MT7A 4Y94A 4KHBB 4TKNA 5JP4A 1J19A 2V76A 4ZRJA 4CHMA 3TO1A 2KCJA 5KQ4A 1U5EA 3MDBC 1ZC3B 2AEHA 2CY5A 5IRSA 1KZGA 3P7ZA 4KHAA 1MK7B 2UZRA 1SHCA 2M38A 3QIJA 5DI9B 2GCLA 2ZPYA 2D4QA 3X23A 4HAVB 2DHJA 2KUPA 1ZC4B 4A6FB 1Y5OA 2N0YA 1U5FA 5HE3A 2J0KA 3UZTA 2XQNM 3TCAA 4EMOA 4GN1A 5HE2A 2PZ1A 3D8FA 1UPRA 1NU2A 4GNKB 2MFQA 2YT0A 3A8PA 1GC6A 1V5UA 4F7UP 4HAXB 4DBBA 3FM8C 5CLLB 1W1GA 3BINA 2K2JA 1QC6A 2YT1A 5C16A 2UVMA 4DXAB 2D2QA 2NZ8B 2RSGA 1U29A 1Z87A 1V61A 1RJ2A 1U5DA 5LG4B 2RNRB 1J0WA 3ULBA 5C79A 2EC1A 3ULCA 2ROZB 2CAYA 3ML4A 5I2MA 3HSAA 3KRWA 2QKMA 3O96A 1K5DB 2Z59A 1OY2A 2DLWA 3N7CA 3ODOA 4NY0A 4KHBA 4HDOA 1WI1A 1H4RA 4GXBA 5C5BB 2I5FA 1Q67A 5L81A 4OT1A 2D10A 2Y8FA 5D3YA 4KHOA 3HW2B 5J3TA 2D11A 2K8EA 1PFJA 2P8VA 1N3HA 4K81A 2OQBA 4C0AA 1FB8A 1PLSA 4F7HA 4MK0A 4CHJA 1BTKA 2MDXA 2K00A 4QJ4B 1EGXA 1T77A 3PZDA 2N23A 4GPTB 2P0FA 1BAKA 1V5PA 2RRFA 4F7GA 1XR0B 3PSCA 2LKOA 3WA0A 2BCJA 4D6WA 1IRSA 2L1CA 2CY4A 5LONB 1MK9B 3A8QA 5KQ1A 3NWAA 3D8EA 3NSUA 3F5RA 4HHVA 2DYNA 3ODXA 4K17A 5JHGA 2GUMA 2ELAA 4K2OA 3NWDA 2P0DA 2EMSA 2CRFA 4CYEA 3SYXA 2D9ZA 4WJ7A 4DIXA 4PNKA 2GCJA 2H7EA 1W1DA 2QKLA 2DFKA 3CXBB 2ELBA 4HB0B 2W2WA 3A98B 3TFMA 3V5WA 2ADZA 2NBVA 5FI1A 3PVWA 4HAYB 1AQCA 3MPXA 1V88A 2LULA 5C5BA 1TXDA 2YS5A 2YRYA 3DXCA 1KZ7A 4H8SA 1SGHA 1XCGA 2COAA 2RVBB 2HE7A 4D0NB 2FJUB 4BBKA 2YSZA 1FHOA 4CSQA 1NI2A 1DROA 2Z13A 2KIEA 3HIEA 2Q13A 3KSYA 2R09A 4QJ3B 1OQNA 1XD4A 2KR0A 4NSWA 3PG7A 2YVCA 1WJMA 4DX90 4WSFA 2DX5A 1MIXA 2H7DA 4KVGB 4DX8A 1GG3A 1FGYA 3PVLA 1X05A 3DCXA 2DTCA 1U5GA 2Z14A 1P5TA 2CODA 1UNPA 2MKRA 4HDQA 3ZVRA 2Z4DA 1U2BA 2D9WA 1MKEA 4HB4B 1X86A 1FHWA 2Z0OA 3QBVB 4HSIA 1GC7A 1RRPB 2KGXB 4B6HA 2EMTA 3HK0A 2J0MA 1WGUA 1OMWA 4KAXB 1MIZB 4A6HA 2DYQA 3SV1A 5LOPB 2YF0A 1I2HA 3OHMB 2HTHB 4QXAB 1ISNA 4A5KA 2VSZA 1UNRA 1DDWA 1X11A 1PMSA 2Y8GA 2DHIA 2I1KA 1DYNA 4A6KA 2I1JA 2D9XA 5KCVA 1B55A 4HAUB 5C6RA 4YL8A 2DKQA 1Y19B 4ZRKA 3D8DA 2DA0A 3DXEA 5GOWB 4IFSA 4MY6A 4PQ0A 2M14A 4GMVA 3U8ZA 1WJ1A 5HE1A
chains in the Genus database with same CATH topology
5DHAB 3BJIA 5DIFB 4HB3B 3AJ4A 1QQGA 1AWEA 4HAWB 2LOXA 3DXDA 2GS0A 2I5CA 2YS1A 1DDVA 1P3RA 2G35A 2IYBA 5HE0A 4TYZA 3AU4A 3SO6A 4HATB 3PVUA 3RCPA 3LJUX 1X1GA 5D3WA 3ODWA 2VRWB 3TVVA 2DHKA 2K2UA 1MAIA 1XKEA 1LB1A 1EF1A 1ZM0A 2DKPA 2J0JA 2UZSA 5EFXA 1V89A 3F0WA 2W2XC 1WG7A 2Y7BA 4K2PA 2COFA 3VIAA 4GZUA 1LW3A 3P6AA 3SNHA 1KI1B 5D27A 3TW1A 3FEHA 3VOQA 1DBHA 1FGZA 1P6SA 1ZSQA 5DH9B 2W2XD 5D3VA 1V5MA 3PEGA 4IOYX 2VKIA 3IVFA 3QWMA 3FSSA 1W1HA 2LG1A 2FJLA 1TQZA 5J3QA 2Z0QA 1X1FA 2OTXA 4L6EA 1XX0A 4XWXA 3PP2A 2GJYA 1M7EA 2LYDA 2RGNB 2RLOA 3GYPA 1K5GB 3OANA 3G9WA 4ZRIA 1I7AA 4EJNA 4Z2NA 2IFSA 3GYOA 1NTVA 1WGQA 2Z0PA 1E5WA 1ZVRA 1FOEA 1U27A 3T06A 1TJ6A 3M1IB 2RUKB 2DN6A 1UNQA 3KY9A 2ROVA 1H10A 5FI0A 2X18A 5DHFB 3SUZA 2D9YA 1BTNA 4Z2MB 2NMBA 4HB2B 3HQCA 3ZDTA 4HAZB 1DDMA 2EJ8A 2DX1A 2COCA 5CLQB 5J3YA 5JHHA 3WYFB 2E2XA 2L2IA 1M7RA 1FHXA 1MPHA 4IAPA 5D3XA 1EAZA 1EVHA 3AU5A 1NTYA 2YS3A 1UEFA 2D9VA 1WVHA 2JP2A 2P0HA 2R0DA 3U7DA 4A6FA 1UPQA 1BWNA 1FAOA 2AL6A 5JLJB 3KZ1A 4GMXB 4P7IA 4YONA 1XODA 2MWNB 3KRXA 2LOZA 3CIKA 4WVFB 4EKUA 2J59M 4MT7A 4Y94A 4KHBB 4TKNA 5JP4A 1J19A 2V76A 4ZRJA 4CHMA 3TO1A 2KCJA 5KQ4A 1U5EA 3MDBC 1ZC3B 2AEHA 2CY5A 1KZGA 3P7ZA 4KHAA 1MK7B 2UZRA 1SHCA 2M38A 3QIJA 5DI9B 2GCLA 2ZPYA 2D4QA 3X23A 4HAVB 2DHJA 2KUPA 1ZC4B 4A6FB 1Y5OA 2N0YA 1U5FA 5HE3A 2J0KA 3UZTA 2XQNM 3TCAA 4EMOA 4GN1A 5HE2A 2PZ1A 3D8FA 1UPRA 1NU2A 2MFQA 2YT0A 3A8PA 1GC6A 1V5UA 4F7UP 4HAXB 4DBBA 3FM8C 5CLLB 1W1GA 3BINA 2K2JA 1QC6A 2YT1A 5C16A 2UVMA 4DXAB 2D2QA 2NZ8B 2RSGA 1U29A 1Z87A 1V61A 1RJ2A 1U5DA 2RNRB 1J0WA 3ULBA 5C79A 2EC1A 3ULCA 2ROZB 2CAYA 3ML4A 3KRWA 2QKMA 3O96A 1K5DB 1OY2A 2DLWA 3N7CA 3ODOA 4NY0A 4HDOA 1WI1A 1H4RA 4GXBA 5C5BB 2I5FA 1Q67A 5L81A 2D10A 2Y8FA 5D3YA 4KHOA 3HW2B 5J3TA 2D11A 1PFJA 2P8VA 1N3HA 4K81A 2OQBA 4C0AA 1FB8A 1PLSA 4F7HA 4MK0A 4CHJA 1BTKA 2MDXA 2K00A 1EGXA 3PZDA 2N23A 4GPTB 2P0FA 1BAKA 1V5PA 4F7GA 1XR0B 3PSCA 2LKOA 3WA0A 2BCJA 1IRSA 2L1CA 2CY4A 5LONB 1MK9B 3A8QA 5KQ1A 4HHVA 3D8EA 3NSUA 3F5RA 2DYNA 3ODXA 4K17A 5JHGA 2ELAA 4K2OA 2P0DA 2EMSA 2CRFA 4CYEA 3SYXA 2D9ZA 4WJ7A 4PNKA 2GCJA 2H7EA 1W1DA 2QKLA 2DFKA 3CXBB 2ELBA 4HB0B 2W2WA 3A98B 3TFMA 3V5WA 2ADZA 5FI1A 3PVWA 4HAYB 1AQCA 3MPXA 1V88A 2LULA 5C5BA 1TXDA 2YS5A 2YRYA 3DXCA 1KZ7A 4H8SA 1SGHA 1XCGA 2COAA 2RVBB 2HE7A 4D0NB 4BBKA 2YSZA 1FHOA 1NI2A 1DROA 2Q13A 3KSYA 2R09A 1OQNA 1XD4A 4NSWA 3PG7A 2YVCA 1WJMA 4DX90 4WSFA 2DX5A 1MIXA 2H7DA 4KVGB 4DX8A 1GG3A 1FGYA 3PVLA 1X05A 2DTCA 1U5GA 1P5TA 2CODA 1UNPA 2MKRA 4HDQA 3ZVRA 1U2BA 2D9WA 1MKEA 4HB4B 1X86A 1FHWA 2Z0OA 3QBVB 1GC7A 1RRPB 2KGXB 4B6HA 2EMTA 3HK0A 2J0MA 1WGUA 1OMWA 4KAXB 1MIZB 4A6HA 2DYQA 3SV1A 5LOPB 2YF0A 1I2HA 2HTHB 1ISNA 4A5KA 2VSZA 1UNRA 1DDWA 1X11A 1PMSA 2Y8GA 2DHIA 2I1KA 1DYNA 4A6KA 2I1JA 2D9XA 5KCVA 1B55A 4HAUB 5C6RA 4YL8A 2DKQA 1Y19B 4ZRKA 3D8DA 2DA0A 3DXEA 5GOWB 4IFSA 4MY6A 4PQ0A 2M14A 4GMVA 3U8ZA 1WJ1A 5HE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHA B;  3BJI A;  5DIF B;  4HB3 B;  3AJ4 A;  1QQG A;  1AWE A;  4HAW B;  2LOX A;  3DXD A;  2GS0 A;  2I5C A;  2YS1 A;  1DDV A;  1P3R A;  2G35 A;  2IYB A;  5HE0 A;  4TYZ A;  3AU4 A;  3SO6 A;  4HAT B;  3PVU A;  3RCP A;  3LJU X;  1X1G A;  5D3W A;  3ODW A;  2VRW B;  3TVV A;  2DHK A;  2K2U A;  1MAI A;  1XKE A;  1LB1 A;  1EF1 A;  1ZM0 A;  2DKP A;  2J0J A;  2UZS A;  5EFX A;  1V89 A;  3F0W A;  2W2X C;  1WG7 A;  2Y7B A;  4K2P A;  2COF A;  3VIA A;  4GZU A;  1LW3 A;  3P6A A;  3SNH A;  1KI1 B;  5D27 A;  3TW1 A;  3FEH A;  3VOQ A;  1DBH A;  1FGZ A;  1P6S A;  1ZSQ A;  5DH9 B;  2W2X D;  5D3V A;  1V5M A;  3PEG A;  4IOY X;  2VKI A;  3IVF A;  3QWM A;  3FSS A;  1W1H A;  2LG1 A;  2FJL A;  1TQZ A;  5J3Q A;  2Z0Q A;  1X1F A;  2OTX A;  4L6E A;  1XX0 A;  4XWX A;  3PP2 A;  2GJY A;  1M7E A;  2LYD A;  2RGN B;  2RLO A;  3GYP A;  1K5G B;  3OAN A;  3G9W A;  4ZRI A;  1I7A A;  4EJN A;  4Z2N A;  2IFS A;  3GYO A;  1NTV A;  1WGQ A;  2Z0P A;  1E5W A;  1ZVR A;  1FOE A;  1U27 A;  3T06 A;  1TJ6 A;  3M1I B;  2RUK B;  2DN6 A;  1UNQ A;  3KY9 A;  2ROV A;  1H10 A;  5FI0 A;  2X18 A;  5DHF B;  3SUZ A;  2D9Y A;  1BTN A;  4Z2M B;  2NMB A;  4HB2 B;  3HQC A;  3ZDT A;  4HAZ B;  1DDM A;  2EJ8 A;  2DX1 A;  2COC A;  5CLQ B;  5J3Y A;  5JHH A;  3WYF B;  2E2X A;  2L2I A;  1M7R A;  1FHX A;  1MPH A;  4IAP A;  5D3X A;  1EAZ A;  1EVH A;  3AU5 A;  1NTY A;  2YS3 A;  1UEF A;  2D9V A;  1WVH A;  2JP2 A;  2P0H A;  2R0D A;  3U7D A;  4A6F A;  1UPQ A;  1BWN A;  1FAO A;  2AL6 A;  5JLJ B;  3KZ1 A;  4GMX B;  4P7I A;  4YON A;  1XOD A;  2MWN B;  3KRX A;  2LOZ A;  3CIK A;  4WVF B;  4EKU A;  2J59 M;  4MT7 A;  4Y94 A;  4KHB B;  4TKN A;  5JP4 A;  1J19 A;  2V76 A;  4ZRJ A;  4CHM A;  3TO1 A;  2KCJ A;  5KQ4 A;  1U5E A;  3MDB C;  1ZC3 B;  2AEH A;  2CY5 A;  1KZG A;  3P7Z A;  4KHA A;  1MK7 B;  2UZR A;  1SHC A;  2M38 A;  3QIJ A;  5DI9 B;  2GCL A;  2ZPY A;  2D4Q A;  3X23 A;  4HAV B;  2DHJ A;  2KUP A;  1ZC4 B;  4A6F B;  1Y5O A;  2N0Y A;  1U5F A;  5HE3 A;  2J0K A;  3UZT A;  2XQN M;  3TCA A;  4EMO A;  4GN1 A;  5HE2 A;  2PZ1 A;  3D8F A;  1UPR A;  1NU2 A;  2MFQ A;  2YT0 A;  3A8P A;  1GC6 A;  1V5U A;  4F7U P;  4HAX B;  4DBB A;  3FM8 C;  5CLL B;  1W1G A;  3BIN A;  2K2J A;  1QC6 A;  2YT1 A;  5C16 A;  2UVM A;  4DXA B;  2D2Q A;  2NZ8 B;  2RSG A;  1U29 A;  1Z87 A;  1V61 A;  1RJ2 A;  1U5D A;  2RNR B;  1J0W A;  3ULB A;  5C79 A;  2EC1 A;  3ULC A;  2ROZ B;  2CAY A;  3ML4 A;  3KRW A;  2QKM A;  3O96 A;  1K5D B;  1OY2 A;  2DLW A;  3N7C A;  3ODO A;  4NY0 A;  4HDO A;  1WI1 A;  1H4R A;  4GXB A;  5C5B B;  2I5F A;  1Q67 A;  5L81 A;  2D10 A;  2Y8F A;  5D3Y A;  4KHO A;  3HW2 B;  5J3T A;  2D11 A;  1PFJ A;  2P8V A;  1N3H A;  4K81 A;  2OQB A;  4C0A A;  1FB8 A;  1PLS A;  4F7H A;  4MK0 A;  4CHJ A;  1BTK A;  2MDX A;  2K00 A;  1EGX A;  3PZD A;  2N23 A;  4GPT B;  2P0F A;  1BAK A;  1V5P A;  4F7G A;  1XR0 B;  3PSC A;  2LKO A;  3WA0 A;  2BCJ A;  1IRS A;  2L1C A;  2CY4 A;  5LON B;  1MK9 B;  3A8Q A;  5KQ1 A;  4HHV A;  3D8E A;  3NSU A;  3F5R A;  2DYN A;  3ODX A;  4K17 A;  5JHG A;  2ELA A;  4K2O A;  2P0D A;  2EMS A;  2CRF A;  4CYE A;  3SYX A;  2D9Z A;  4WJ7 A;  4PNK A;  2GCJ A;  2H7E A;  1W1D A;  2QKL A;  2DFK A;  3CXB B;  2ELB A;  4HB0 B;  2W2W A;  3A98 B;  3TFM A;  3V5W A;  2ADZ A;  5FI1 A;  3PVW A;  4HAY B;  1AQC A;  3MPX A;  1V88 A;  2LUL A;  5C5B A;  1TXD A;  2YS5 A;  2YRY A;  3DXC A;  1KZ7 A;  4H8S A;  1SGH A;  1XCG A;  2COA A;  2RVB B;  2HE7 A;  4D0N B;  4BBK A;  2YSZ A;  1FHO A;  1NI2 A;  1DRO A;  2Q13 A;  3KSY A;  2R09 A;  1OQN A;  1XD4 A;  4NSW A;  3PG7 A;  2YVC A;  1WJM A;  4DX9 0;  4WSF A;  2DX5 A;  1MIX A;  2H7D A;  4KVG B;  4DX8 A;  1GG3 A;  1FGY A;  3PVL A;  1X05 A;  2DTC A;  1U5G A;  1P5T A;  2COD A;  1UNP A;  2MKR A;  4HDQ A;  3ZVR A;  1U2B A;  2D9W A;  1MKE A;  4HB4 B;  1X86 A;  1FHW A;  2Z0O A;  3QBV B;  1GC7 A;  1RRP B;  2KGX B;  4B6H A;  2EMT A;  3HK0 A;  2J0M A;  1WGU A;  1OMW A;  4KAX B;  1MIZ B;  4A6H A;  2DYQ A;  3SV1 A;  5LOP B;  2YF0 A;  1I2H A;  2HTH B;  1ISN A;  4A5K A;  2VSZ A;  1UNR A;  1DDW A;  1X11 A;  1PMS A;  2Y8G A;  2DHI A;  2I1K A;  1DYN A;  4A6K A;  2I1J A;  2D9X A;  5KCV A;  1B55 A;  4HAU B;  5C6R A;  4YL8 A;  2DKQ A;  1Y19 B;  4ZRK A;  3D8D A;  2DA0 A;  3DXE A;  5GOW B;  4IFS A;  4MY6 A;  4PQ0 A;  2M14 A;  4GMV A;  3U8Z A;  1WJ1 A;  5HE1 A; 
#chains in the Genus database with same CATH topology
 5DHA B;  3BJI A;  5DIF B;  4HB3 B;  3AJ4 A;  1MI1 A;  1QQG A;  1AWE A;  4HAW B;  2LOX A;  3DXD A;  2GS0 A;  2I5C A;  2YS1 A;  1DDV A;  3U12 A;  1P3R A;  2G35 A;  2IYB A;  5HE0 A;  4TYZ A;  3AU4 A;  3SO6 A;  4OSN A;  3FVC A;  4HAT B;  3PVU A;  3RCP A;  3LJU X;  1X1G A;  5D3W A;  3ODW A;  2VRW B;  3TVV A;  2DHK A;  2K2U A;  1MAI A;  1XKE A;  1LB1 A;  1EF1 A;  1ZM0 A;  2DKP A;  2J0J A;  2UZS A;  5EFX A;  1V89 A;  3F0W A;  2W2X C;  1WG7 A;  2Y7B A;  4K2P A;  2COF A;  3VIA A;  4GZU A;  1LW3 A;  3P6A A;  3SNH A;  1KI1 B;  5D27 A;  5I2S A;  3TW1 A;  3FEH A;  3VOQ A;  1DBH A;  1FGZ A;  1P6S A;  1ZSQ A;  2R2Y A;  5DH9 B;  2W2X D;  2ZKM X;  5D3V A;  1V5M A;  4QJ5 B;  3A58 A;  3PEG A;  2KUQ A;  4IOY X;  2VKI A;  4GOU A;  3IVF A;  3QWM A;  3FSS A;  1W1H A;  2LG1 A;  2FJL A;  1TQZ A;  5J3Q A;  2Z0Q A;  4L1R A;  1X1F A;  2OTX A;  4L6E A;  1XX0 A;  4XWX A;  3PP2 A;  2GJY A;  1M7E A;  2LYD A;  2RGN B;  2RLO A;  3GYP A;  1K5G B;  3OAN A;  3G9W A;  4ZRI A;  1I7A A;  4EJN A;  4Z2N A;  2IFS A;  3GYO A;  1NTV A;  3B77 A;  1WGQ A;  2Z0P A;  1E5W A;  1ZVR A;  1FOE A;  1U27 A;  3T06 A;  1TJ6 A;  2KIG A;  3M1I B;  2RUK B;  2DN6 A;  1UNQ A;  2K49 A;  3KY9 A;  2ROV A;  1H10 A;  5FI0 A;  2X18 A;  5DHF B;  3SUZ A;  3NWF A;  2D9Y A;  1BTN A;  4Z2M B;  2NMB A;  4HB2 B;  3HQC A;  3ZDT A;  4HAZ B;  1DDM A;  2YT2 A;  2EJ8 A;  2DX1 A;  2COC A;  5CLQ B;  5J3Y A;  5JHH A;  3WYF B;  2E2X A;  2L2I A;  1M7R A;  1FHX A;  1MPH A;  4IAP A;  5D3X A;  3AU5 A;  1EAZ A;  1EVH A;  1NTY A;  2YS3 A;  1UEF A;  3NW8 A;  2D9V A;  1WVH A;  2JP2 A;  2P0H A;  2R0D A;  3U7D A;  4A6F A;  1UPQ A;  1BWN A;  1ZYI A;  1FAO A;  2AL6 A;  5M4Y B;  5JLJ B;  3KZ1 A;  4GMX B;  4P7I A;  4YON A;  1XOD A;  2MWN B;  3KRX A;  2LOZ A;  3CIK A;  4WVF B;  4EKU A;  2J59 M;  4MT7 A;  4Y94 A;  4KHB B;  4TKN A;  5JP4 A;  1J19 A;  2V76 A;  4ZRJ A;  4CHM A;  3TO1 A;  2KCJ A;  5KQ4 A;  1U5E A;  3MDB C;  1ZC3 B;  2AEH A;  2CY5 A;  5IRS A;  1KZG A;  3P7Z A;  4KHA A;  1MK7 B;  2UZR A;  1SHC A;  2M38 A;  3QIJ A;  5DI9 B;  2GCL A;  2ZPY A;  2D4Q A;  3X23 A;  4HAV B;  2DHJ A;  2KUP A;  1ZC4 B;  4A6F B;  1Y5O A;  2N0Y A;  1U5F A;  5HE3 A;  2J0K A;  3UZT A;  2XQN M;  3TCA A;  4EMO A;  4GN1 A;  5HE2 A;  2PZ1 A;  3D8F A;  1UPR A;  1NU2 A;  4GNK B;  2MFQ A;  2YT0 A;  3A8P A;  1GC6 A;  1V5U A;  4F7U P;  4HAX B;  4DBB A;  3FM8 C;  5CLL B;  1W1G A;  3BIN A;  2K2J A;  1QC6 A;  2YT1 A;  5C16 A;  2UVM A;  4DXA B;  2D2Q A;  2NZ8 B;  2RSG A;  1U29 A;  1Z87 A;  1V61 A;  1RJ2 A;  1U5D A;  5LG4 B;  2RNR B;  1J0W A;  3ULB A;  5C79 A;  2EC1 A;  3ULC A;  2ROZ B;  2CAY A;  3ML4 A;  5I2M A;  3HSA A;  3KRW A;  2QKM A;  3O96 A;  1K5D B;  2Z59 A;  1OY2 A;  2DLW A;  3N7C A;  3ODO A;  4NY0 A;  4KHB A;  4HDO A;  1WI1 A;  1H4R A;  4GXB A;  5C5B B;  2I5F A;  1Q67 A;  5L81 A;  4OT1 A;  2D10 A;  2Y8F A;  5D3Y A;  4KHO A;  3HW2 B;  5J3T A;  2D11 A;  2K8E A;  1PFJ A;  2P8V A;  1N3H A;  4K81 A;  2OQB A;  4C0A A;  1FB8 A;  1PLS A;  4F7H A;  4MK0 A;  4CHJ A;  1BTK A;  2MDX A;  2K00 A;  4QJ4 B;  1EGX A;  1T77 A;  3PZD A;  2N23 A;  4GPT B;  2P0F A;  1BAK A;  1V5P A;  2RRF A;  4F7G A;  1XR0 B;  3PSC A;  2LKO A;  3WA0 A;  2BCJ A;  4D6W A;  1IRS A;  2L1C A;  2CY4 A;  5LON B;  1MK9 B;  3A8Q A;  5KQ1 A;  3NWA A;  3D8E A;  3NSU A;  3F5R A;  4HHV A;  2DYN A;  3ODX A;  4K17 A;  5JHG A;  2GUM A;  2ELA A;  4K2O A;  3NWD A;  2P0D A;  2EMS A;  2CRF A;  4CYE A;  3SYX A;  2D9Z A;  4WJ7 A;  4DIX A;  4PNK A;  2GCJ A;  2H7E A;  1W1D A;  2QKL A;  2DFK A;  3CXB B;  2ELB A;  4HB0 B;  2W2W A;  3A98 B;  3TFM A;  3V5W A;  2ADZ A;  2NBV A;  5FI1 A;  3PVW A;  4HAY B;  1AQC A;  3MPX A;  1V88 A;  2LUL A;  5C5B A;  1TXD A;  2YS5 A;  2YRY A;  3DXC A;  1KZ7 A;  4H8S A;  1SGH A;  1XCG A;  2COA A;  2RVB B;  2HE7 A;  4D0N B;  2FJU B;  4BBK A;  2YSZ A;  1FHO A;  4CSQ A;  1NI2 A;  1DRO A;  2Z13 A;  2KIE A;  3HIE A;  2Q13 A;  3KSY A;  2R09 A;  4QJ3 B;  1OQN A;  1XD4 A;  2KR0 A;  4NSW A;  3PG7 A;  2YVC A;  1WJM A;  4DX9 0;  4WSF A;  2DX5 A;  1MIX A;  2H7D A;  4KVG B;  4DX8 A;  1GG3 A;  1FGY A;  3PVL A;  1X05 A;  3DCX A;  2DTC A;  1U5G A;  2Z14 A;  1P5T A;  2COD A;  1UNP A;  2MKR A;  4HDQ A;  3ZVR A;  2Z4D A;  1U2B A;  2D9W A;  1MKE A;  4HB4 B;  1X86 A;  1FHW A;  2Z0O A;  3QBV B;  4HSI A;  1GC7 A;  1RRP B;  2KGX B;  4B6H A;  2EMT A;  3HK0 A;  2J0M A;  1WGU A;  1OMW A;  4KAX B;  1MIZ B;  4A6H A;  2DYQ A;  3SV1 A;  5LOP B;  2YF0 A;  1I2H A;  3OHM B;  2HTH B;  4QXA B;  1ISN A;  4A5K A;  2VSZ A;  1UNR A;  1DDW A;  1X11 A;  1PMS A;  2Y8G A;  2DHI A;  2I1K A;  1DYN A;  4A6K A;  2I1J A;  2D9X A;  5KCV A;  1B55 A;  4HAU B;  5C6R A;  4YL8 A;  2DKQ A;  1Y19 B;  4ZRK A;  3D8D A;  2DA0 A;  3DXE A;  5GOW B;  4IFS A;  4MY6 A;  4PQ0 A;  2M14 A;  4GMV A;  3U8Z A;  1WJ1 A;  5HE1 A; 
#chains in the Genus database with same CATH homology
 5DHA B;  3BJI A;  5DIF B;  4HB3 B;  3AJ4 A;  1QQG A;  1AWE A;  4HAW B;  2LOX A;  3DXD A;  2GS0 A;  2I5C A;  2YS1 A;  1DDV A;  1P3R A;  2G35 A;  2IYB A;  5HE0 A;  4TYZ A;  3AU4 A;  3SO6 A;  4HAT B;  3PVU A;  3RCP A;  3LJU X;  1X1G A;  5D3W A;  3ODW A;  2VRW B;  3TVV A;  2DHK A;  2K2U A;  1MAI A;  1XKE A;  1LB1 A;  1EF1 A;  1ZM0 A;  2DKP A;  2J0J A;  2UZS A;  5EFX A;  1V89 A;  3F0W A;  2W2X C;  1WG7 A;  2Y7B A;  4K2P A;  2COF A;  3VIA A;  4GZU A;  1LW3 A;  3P6A A;  3SNH A;  1KI1 B;  5D27 A;  3TW1 A;  3FEH A;  3VOQ A;  1DBH A;  1FGZ A;  1P6S A;  1ZSQ A;  5DH9 B;  2W2X D;  5D3V A;  1V5M A;  3PEG A;  4IOY X;  2VKI A;  3IVF A;  3QWM A;  3FSS A;  1W1H A;  2LG1 A;  2FJL A;  1TQZ A;  5J3Q A;  2Z0Q A;  1X1F A;  2OTX A;  4L6E A;  1XX0 A;  4XWX A;  3PP2 A;  2GJY A;  1M7E A;  2LYD A;  2RGN B;  2RLO A;  3GYP A;  1K5G B;  3OAN A;  3G9W A;  4ZRI A;  1I7A A;  4EJN A;  4Z2N A;  2IFS A;  3GYO A;  1NTV A;  1WGQ A;  2Z0P A;  1E5W A;  1ZVR A;  1FOE A;  1U27 A;  3T06 A;  1TJ6 A;  3M1I B;  2RUK B;  2DN6 A;  1UNQ A;  3KY9 A;  2ROV A;  1H10 A;  5FI0 A;  2X18 A;  5DHF B;  3SUZ A;  2D9Y A;  1BTN A;  4Z2M B;  2NMB A;  4HB2 B;  3HQC A;  3ZDT A;  4HAZ B;  1DDM A;  2EJ8 A;  2DX1 A;  2COC A;  5CLQ B;  5J3Y A;  5JHH A;  3WYF B;  2E2X A;  2L2I A;  1M7R A;  1FHX A;  1MPH A;  4IAP A;  5D3X A;  1EAZ A;  1EVH A;  3AU5 A;  1NTY A;  2YS3 A;  1UEF A;  2D9V A;  1WVH A;  2JP2 A;  2P0H A;  2R0D A;  3U7D A;  4A6F A;  1UPQ A;  1BWN A;  1FAO A;  2AL6 A;  5JLJ B;  3KZ1 A;  4GMX B;  4P7I A;  4YON A;  1XOD A;  2MWN B;  3KRX A;  2LOZ A;  3CIK A;  4WVF B;  4EKU A;  2J59 M;  4MT7 A;  4Y94 A;  4KHB B;  4TKN A;  5JP4 A;  1J19 A;  2V76 A;  4ZRJ A;  4CHM A;  3TO1 A;  2KCJ A;  5KQ4 A;  1U5E A;  3MDB C;  1ZC3 B;  2AEH A;  2CY5 A;  1KZG A;  3P7Z A;  4KHA A;  1MK7 B;  2UZR A;  1SHC A;  2M38 A;  3QIJ A;  5DI9 B;  2GCL A;  2ZPY A;  2D4Q A;  3X23 A;  4HAV B;  2DHJ A;  2KUP A;  1ZC4 B;  4A6F B;  1Y5O A;  2N0Y A;  1U5F A;  5HE3 A;  2J0K A;  3UZT A;  2XQN M;  3TCA A;  4EMO A;  4GN1 A;  5HE2 A;  2PZ1 A;  3D8F A;  1UPR A;  1NU2 A;  2MFQ A;  2YT0 A;  3A8P A;  1GC6 A;  1V5U A;  4F7U P;  4HAX B;  4DBB A;  3FM8 C;  5CLL B;  1W1G A;  3BIN A;  2K2J A;  1QC6 A;  2YT1 A;  5C16 A;  2UVM A;  4DXA B;  2D2Q A;  2NZ8 B;  2RSG A;  1U29 A;  1Z87 A;  1V61 A;  1RJ2 A;  1U5D A;  2RNR B;  1J0W A;  3ULB A;  5C79 A;  2EC1 A;  3ULC A;  2ROZ B;  2CAY A;  3ML4 A;  3KRW A;  2QKM A;  3O96 A;  1K5D B;  1OY2 A;  2DLW A;  3N7C A;  3ODO A;  4NY0 A;  4HDO A;  1WI1 A;  1H4R A;  4GXB A;  5C5B B;  2I5F A;  1Q67 A;  5L81 A;  2D10 A;  2Y8F A;  5D3Y A;  4KHO A;  3HW2 B;  5J3T A;  2D11 A;  1PFJ A;  2P8V A;  1N3H A;  4K81 A;  2OQB A;  4C0A A;  1FB8 A;  1PLS A;  4F7H A;  4MK0 A;  4CHJ A;  1BTK A;  2MDX A;  2K00 A;  1EGX A;  3PZD A;  2N23 A;  4GPT B;  2P0F A;  1BAK A;  1V5P A;  4F7G A;  1XR0 B;  3PSC A;  2LKO A;  3WA0 A;  2BCJ A;  1IRS A;  2L1C A;  2CY4 A;  5LON B;  1MK9 B;  3A8Q A;  5KQ1 A;  4HHV A;  3D8E A;  3NSU A;  3F5R A;  2DYN A;  3ODX A;  4K17 A;  5JHG A;  2ELA A;  4K2O A;  2P0D A;  2EMS A;  2CRF A;  4CYE A;  3SYX A;  2D9Z A;  4WJ7 A;  4PNK A;  2GCJ A;  2H7E A;  1W1D A;  2QKL A;  2DFK A;  3CXB B;  2ELB A;  4HB0 B;  2W2W A;  3A98 B;  3TFM A;  3V5W A;  2ADZ A;  5FI1 A;  3PVW A;  4HAY B;  1AQC A;  3MPX A;  1V88 A;  2LUL A;  5C5B A;  1TXD A;  2YS5 A;  2YRY A;  3DXC A;  1KZ7 A;  4H8S A;  1SGH A;  1XCG A;  2COA A;  2RVB B;  2HE7 A;  4D0N B;  4BBK A;  2YSZ A;  1FHO A;  1NI2 A;  1DRO A;  2Q13 A;  3KSY A;  2R09 A;  1OQN A;  1XD4 A;  4NSW A;  3PG7 A;  2YVC A;  1WJM A;  4DX9 0;  4WSF A;  2DX5 A;  1MIX A;  2H7D A;  4KVG B;  4DX8 A;  1GG3 A;  1FGY A;  3PVL A;  1X05 A;  2DTC A;  1U5G A;  1P5T A;  2COD A;  1UNP A;  2MKR A;  4HDQ A;  3ZVR A;  1U2B A;  2D9W A;  1MKE A;  4HB4 B;  1X86 A;  1FHW A;  2Z0O A;  3QBV B;  1GC7 A;  1RRP B;  2KGX B;  4B6H A;  2EMT A;  3HK0 A;  2J0M A;  1WGU A;  1OMW A;  4KAX B;  1MIZ B;  4A6H A;  2DYQ A;  3SV1 A;  5LOP B;  2YF0 A;  1I2H A;  2HTH B;  1ISN A;  4A5K A;  2VSZ A;  1UNR A;  1DDW A;  1X11 A;  1PMS A;  2Y8G A;  2DHI A;  2I1K A;  1DYN A;  4A6K A;  2I1J A;  2D9X A;  5KCV A;  1B55 A;  4HAU B;  5C6R A;  4YL8 A;  2DKQ A;  1Y19 B;  4ZRK A;  3D8D A;  2DA0 A;  3DXE A;  5GOW B;  4IFS A;  4MY6 A;  4PQ0 A;  2M14 A;  4GMV A;  3U8Z A;  1WJ1 A;  5HE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...