2DTCA

Crystal structure of ms0666
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
PTMEGPLRRKTLLKEGRKPALSSWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
publication title Crystal structure of MS0666
rcsb
source organism Mus musculus
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dtcA00
5JHGA 2I1JA 3NSUA 1K5DB 1UNQA 3AU4A 5D3YA 3CXBB 2CRFA 5GOWB 2DKQA 2MFQA 5C79A 1UEFA 2MWNB 3M1IB 5J3TA 3IVFA 3AU5A 2L1CA 3N7CA 2K2UA 4KHOA 4MK0A 2IFSA 2QKMA 3A8QA 1MIXA 3X23A 2D9WA 1X86A 4A5KA 2DHIA 1U5GA 2M14A 1KI1B 1UPQA 5HE1A 2EJ8A 5FI1A 1GG3A 1RJ2A 2N23A 4HAYB 5DH9B 2VRWB 5CLLB 1WG7A 4GPTB 2R09A 2UVMA 4K17A 3QBVB 2Q13A 1LW3A 3PEGA 1XKEA 3PVLA 2OQBA 1FGYA 1PMSA 3ULBA 2YVCA 3OANA 1V89A 5HE3A 2UZSA 1P5TA 1X05A 1K5GB 4CYEA 1MPHA 1NTYA 1XODA 1FAOA 4HAXB 1H10A 1TXDA 1NTVA 3VIAA 4L6EA 2ROVA 1ISNA 4F7GA 4A6HA 3PG7A 2COFA 4IOYX 4KVGB 3TW1A 5JLJB 3G9WA 1XX0A 4ZRJA 2E2XA 1PLSA 5L81A 4HAZB 4HAVB 2P0DA 1U27A 5J3YA 1EF1A 1WI1A 4F7HA 3ZDTA 4H8SA 5HE2A 1TJ6A 3HK0A 4ZRKA 4KHBB 1E5WA 2COCA 5D3VA 3PVWA 2RUKB 1B55A 2D10A 3SV1A 2H7EA 3PSCA 2J0MA 3ML4A 5DIFB 1V5UA 1WJ1A 2ADZA 2EMSA 4K2PA 3T06A 1UPRA 1U2BA 2MKRA 2DA0A 2W2WA 2K2JA 3HW2B 4CHMA 4CHJA 4HAUB 3QWMA 4HDOA 1DDVA 1MAIA 2DTCA 2ELAA 1SGHA 2HE7A 2AEHA 4DX8A 1ZC3B 2PZ1A 1BTKA 4K2OA 2LULA 2D9XA 3AJ4A 3SYXA 4HB2B 1PFJA 1M7EA 1P3RA 2LOXA 1N3HA 3KRXA 2DYQA 2AL6A 2NZ8B 5HE0A 1DDWA 2DYNA 4DBBA 2DN6A 3ZVRA 2Z0OA 5D3XA 1OQNA 3TVVA 5C5BB 5KQ4A 3D8FA 2KCJA 2Z0PA 1XR0B 1W1HA 4BBKA 4WJ7A 5LOPB 2LOZA 4Z2MB 4HDQA 2ELBA 2YS3A 2N0YA 3GYOA 2CODA 4GMXB 1Y5OA 3U7DA 2P8VA 1ZC4B 3PP2A 1I2HA 3KSYA 3WYFB 2CAYA 1EGXA 2NMBA 3V5WA 2DLWA 5DI9B 2LG1A 1QC6A 3O96A 2EMTA 2FJLA 4HATB 4Z2NA 3SO6A 3TFMA 1V5PA 2CY4A 2P0FA 4YL8A 4GN1A 4F7UP 4EKUA 4HHVA 4NY0A 3HQCA 2CY5A 4EMOA 4WSFA 3BJIA 1DYNA 1X1GA 3SNHA 1DBHA 1MK7B 1OMWA 2DKPA 1FOEA 2RSGA 1V5MA 3ODWA 4EJNA 1MKEA 1I7AA 5LONB 1U5FA 1ZVRA 1FGZA 2D9VA 4A6FB 1TQZA 5C6RA 3GYPA 5C5BA 3UZTA 2DX5A 1J19A 3A98B 4GXBA 2VKIA 3ODXA 4GZUA 2IYBA 2YS1A 5D3WA 2BCJA 2J0KA 1EVHA 2D9ZA 2D11A 2J0JA 2YT0A 2DHJA 1LB1A 4DX90 2Z0QA 1P6SA 1GC6A 2UZRA 3TO1A 3P7ZA 2XQNM 5J3QA 1IRSA 1U29A 4C0AA 1MIZB 5JHHA 2VSZA 1ZM0A 3F0WA 3LJUX 4WVFB 2Y8GA 2COAA 3D8DA 2YS5A 2RVBB 2L2IA 3ULCA 2K00A 1WVHA 1ZSQA 4KHAA 1BAKA 1W1GA 1UNPA 2MDXA 1X1FA 2W2XC 1KZGA 1FHXA 1BTNA 4GMVA 2DHKA 5FI0A 3CIKA 2GCJA 1Q67A 2OTXA 4HB4B 3P6AA 4MY6A 2X18A 3DXCA 5D27A 2GCLA 2R0DA 2KUPA 4TYZA 3VOQA 3D8EA 2M38A 2YT1A 3A8PA 3SUZA 2RLOA 2EC1A 3MDBC 4TKNA 1U5EA 1XCGA 1W1DA 1J0WA 3KY9A 3TCAA 5EFXA 1U5DA 3ODOA 2LKOA 4P7IA 4PQ0A 4A6FA 5KCVA 4NSWA 1MK9B 1WGUA 3FSSA 1XD4A 3U8ZA 2J59M 1WGQA 4D0NB 3F5RA 2RGNB 3PVUA 1SHCA 3KZ1A 2ROZB 2GS0A 5KQ1A 1BWNA 2P0HA 2QKLA 1V61A 1V88A 4MT7A 5CLQB 1GC7A 1QQGA 1UNRA 3QIJA 3WA0A 1DDMA 4A6KA 3FEHA 4HB0B 1M7RA 1Z87A 2I5FA 4ZRIA 1FHWA 2YF0A 1NI2A 2DX1A 1AQCA 2G35A 2I1KA 2ZPYA 4XWXA 1RRPB 1KZ7A 4HB3B 3KRWA 1AWEA 2I5CA 4KAXB 2YRYA 1Y19B 2YSZA 3PZDA 3MPXA 4B6HA 2JP2A 1NU2A 2D2QA 5JP4A 2V76A 1FHOA 4HAWB 2DFKA 3FM8C 4IAPA 1DROA 2Y7BA 5C16A 2KGXB 2D9YA 2W2XD 3DXDA 3BINA 4K81A 4YONA 1EAZA 1WJMA 2H7DA 2RNRB 1OY2A 3DXEA 1FB8A 2Y8FA 5DHFB 2GJYA 5DHAB 2HTHB 2D4QA 1X11A 4DXAB 4PNKA 4Y94A 3RCPA 4IFSA 2LYDA 1H4RA
chains in the Genus database with same CATH superfamily
3HSAA 5JHGA 2I1JA 3NSUA 4DIXA 3NWFA 1K5DB 1UNQA 3AU4A 5D3YA 3CXBB 2CRFA 5GOWB 2DKQA 2MFQA 5C79A 1UEFA 2MWNB 3M1IB 5J3TA 3IVFA 2GUMA 3AU5A 2L1CA 3N7CA 2KIEA 2K2UA 2ZKMX 4KHOA 4MK0A 2IFSA 2QKMA 3A8QA 1MIXA 3X23A 2D9WA 1X86A 4A5KA 2DHIA 1U5GA 2M14A 1KI1B 1UPQA 5HE1A 2EJ8A 5FI1A 1GG3A 1RJ2A 2N23A 4GOUA 4HAYB 5DH9B 2VRWB 2FJUB 2KIGA 5CLLB 1WG7A 4GPTB 2R09A 2UVMA 4K17A 3QBVB 2Q13A 1LW3A 3PEGA 1XKEA 3PVLA 2OQBA 1FGYA 1PMSA 3ULBA 2YVCA 3OANA 1V89A 5HE3A 2UZSA 1P5TA 1X05A 1K5GB 4CYEA 1MPHA 1NTYA 4OT1A 1XODA 2RRFA 1FAOA 4HAXB 1H10A 1TXDA 1NTVA 3VIAA 4L6EA 2ROVA 1ISNA 4F7GA 4A6HA 3PG7A 1T77A 2COFA 4IOYX 4KVGB 3TW1A 5JLJB 3G9WA 1XX0A 4ZRJA 2E2XA 1PLSA 5L81A 4HAZB 4HAVB 2P0DA 1U27A 5J3YA 1EF1A 1WI1A 4F7HA 3ZDTA 4H8SA 5HE2A 2Z13A 1TJ6A 3HK0A 4ZRKA 4KHBB 1E5WA 2COCA 5D3VA 3PVWA 2RUKB 1B55A 2D10A 3SV1A 2H7EA 3PSCA 2J0MA 3ML4A 5DIFB 1V5UA 1WJ1A 2ADZA 2EMSA 4K2PA 3T06A 1UPRA 1U2BA 3B77A 2MKRA 2DA0A 2K49A 2W2WA 1ZYIA 4QXAB 2K2JA 3HW2B 4CHMA 4CHJA 4HAUB 3QWMA 4HDOA 1DDVA 1MAIA 2DTCA 2ELAA 1SGHA 2HE7A 2AEHA 4DX8A 1ZC3B 2PZ1A 1BTKA 2R2YA 4K2OA 2LULA 2D9XA 3AJ4A 3SYXA 4HB2B 1PFJA 1M7EA 1P3RA 2LOXA 1N3HA 2Z14A 3KRXA 5LG4B 2DYQA 2AL6A 2NZ8B 3NWDA 1DDWA 5HE0A 2DYNA 4DBBA 2DN6A 3ZVRA 2Z0OA 5D3XA 1OQNA 3TVVA 5C5BB 5KQ4A 3D8FA 2KCJA 2Z0PA 1XR0B 1W1HA 4BBKA 4WJ7A 5LOPB 2LOZA 4Z2MB 4HDQA 2ELBA 2YS3A 2N0YA 3GYOA 2CODA 4GMXB 1Y5OA 3U7DA 2P8VA 1ZC4B 3PP2A 1I2HA 3KSYA 4HSIA 4KHBA 3WYFB 2CAYA 3FVCA 4QJ4B 1EGXA 2NMBA 3V5WA 3HIEA 2DLWA 5DI9B 2NBVA 2LG1A 1QC6A 3O96A 2EMTA 2FJLA 4HATB 4L1RA 4Z2NA 3NWAA 4GNKB 3SO6A 3TFMA 1V5PA 2CY4A 3U12A 2P0FA 4YL8A 1MI1A 4GN1A 4F7UP 4EKUA 4HHVA 4NY0A 3HQCA 2CY5A 4EMOA 4WSFA 3BJIA 1DYNA 1X1GA 3SNHA 1DBHA 1MK7B 1OMWA 2DKPA 1FOEA 2RSGA 1V5MA 3ODWA 4EJNA 1MKEA 1I7AA 5LONB 1U5FA 2YT2A 1ZVRA 2KR0A 1FGZA 2D9VA 2Z4DA 4A6FB 3A58A 1TQZA 5C6RA 3GYPA 5C5BA 3UZTA 2DX5A 1J19A 3A98B 4GXBA 2VKIA 3ODXA 4GZUA 2IYBA 2YS1A 5D3WA 2BCJA 2J0KA 1EVHA 2D9ZA 2D11A 2J0JA 2YT0A 5IRSA 2DHJA 1LB1A 4DX90 3OHMB 2Z0QA 1P6SA 1GC6A 2UZRA 3TO1A 3P7ZA 4OSNA 2XQNM 5J3QA 2Z59A 1IRSA 1U29A 4C0AA 1MIZB 5JHHA 3NW8A 2VSZA 1ZM0A 3F0WA 3LJUX 4WVFB 2Y8GA 2COAA 3D8DA 2YS5A 2RVBB 5M4YB 2L2IA 3ULCA 2K00A 1WVHA 1ZSQA 4KHAA 1BAKA 1W1GA 1UNPA 2MDXA 1X1FA 2W2XC 1KZGA 1FHXA 1BTNA 4GMVA 2DHKA 5FI0A 3CIKA 2GCJA 1Q67A 2OTXA 4HB4B 3P6AA 4MY6A 2X18A 3DXCA 5D27A 2GCLA 2R0DA 2KUPA 4TYZA 3VOQA 4QJ5B 3D8EA 2M38A 2YT1A 3A8PA 3SUZA 2RLOA 2EC1A 3MDBC 4TKNA 1U5EA 1XCGA 1W1DA 1J0WA 3KY9A 3TCAA 5EFXA 1U5DA 3ODOA 2LKOA 4P7IA 4PQ0A 4A6FA 5KCVA 2KUQA 4NSWA 1MK9B 1WGUA 3FSSA 1XD4A 3U8ZA 2J59M 1WGQA 4D0NB 2K8EA 3F5RA 2RGNB 3PVUA 1SHCA 3KZ1A 2ROZB 2GS0A 5KQ1A 1BWNA 2P0HA 2QKLA 1V61A 1V88A 4MT7A 5CLQB 1GC7A 5I2MA 1QQGA 1UNRA 3QIJA 3WA0A 1DDMA 4A6KA 3FEHA 5I2SA 4HB0B 1M7RA 4D6WA 1Z87A 2I5FA 4ZRIA 1FHWA 2YF0A 1NI2A 2DX1A 1AQCA 2G35A 2I1KA 2ZPYA 4XWXA 1RRPB 1KZ7A 4HB3B 3KRWA 1AWEA 2I5CA 4KAXB 2YRYA 1Y19B 2YSZA 4QJ3B 3PZDA 3MPXA 4B6HA 2JP2A 1NU2A 2D2QA 5JP4A 4CSQA 2V76A 1FHOA 4HAWB 2DFKA 3FM8C 4IAPA 1DROA 2Y7BA 5C16A 2KGXB 2D9YA 2W2XD 3DXDA 3BINA 4K81A 4YONA 1EAZA 1WJMA 2H7DA 2RNRB 1OY2A 3DXEA 1FB8A 2Y8FA 5DHFB 2GJYA 5DHAB 2HTHB 2D4QA 1X11A 4DXAB 4PNKA 4Y94A 3RCPA 4IFSA 2LYDA 1H4RA 3DCXA
chains in the Genus database with same CATH topology
5JHGA 2I1JA 3NSUA 1K5DB 1UNQA 3AU4A 5D3YA 3CXBB 2CRFA 5GOWB 2DKQA 2MFQA 5C79A 1UEFA 2MWNB 3M1IB 5J3TA 3IVFA 3AU5A 2L1CA 3N7CA 2K2UA 4KHOA 4MK0A 2IFSA 2QKMA 3A8QA 1MIXA 3X23A 2D9WA 1X86A 4A5KA 2DHIA 1U5GA 2M14A 1KI1B 1UPQA 5HE1A 2EJ8A 5FI1A 1GG3A 1RJ2A 2N23A 4HAYB 5DH9B 2VRWB 5CLLB 1WG7A 4GPTB 2R09A 2UVMA 4K17A 3QBVB 2Q13A 1LW3A 3PEGA 1XKEA 3PVLA 2OQBA 1FGYA 1PMSA 3ULBA 2YVCA 3OANA 1V89A 5HE3A 2UZSA 1P5TA 1X05A 1K5GB 4CYEA 1MPHA 1NTYA 1XODA 1FAOA 4HAXB 1H10A 1TXDA 1NTVA 3VIAA 4L6EA 2ROVA 1ISNA 4F7GA 4A6HA 3PG7A 2COFA 4IOYX 4KVGB 3TW1A 5JLJB 3G9WA 1XX0A 4ZRJA 2E2XA 1PLSA 5L81A 4HAZB 4HAVB 2P0DA 1U27A 5J3YA 1EF1A 1WI1A 4F7HA 3ZDTA 4H8SA 5HE2A 1TJ6A 3HK0A 4ZRKA 4KHBB 1E5WA 2COCA 5D3VA 3PVWA 2RUKB 1B55A 2D10A 3SV1A 2H7EA 3PSCA 2J0MA 3ML4A 5DIFB 1V5UA 1WJ1A 2ADZA 2EMSA 4K2PA 3T06A 1UPRA 1U2BA 2MKRA 2DA0A 2W2WA 2K2JA 3HW2B 4CHMA 4CHJA 4HAUB 3QWMA 4HDOA 1DDVA 1MAIA 2DTCA 2ELAA 1SGHA 2HE7A 2AEHA 4DX8A 1ZC3B 2PZ1A 1BTKA 4K2OA 2LULA 2D9XA 3AJ4A 3SYXA 4HB2B 1PFJA 1M7EA 1P3RA 2LOXA 1N3HA 3KRXA 2DYQA 2AL6A 2NZ8B 5HE0A 1DDWA 2DYNA 4DBBA 2DN6A 3ZVRA 2Z0OA 5D3XA 1OQNA 3TVVA 5C5BB 5KQ4A 3D8FA 2KCJA 2Z0PA 1XR0B 1W1HA 4BBKA 4WJ7A 5LOPB 2LOZA 4Z2MB 4HDQA 2ELBA 2YS3A 2N0YA 3GYOA 2CODA 4GMXB 1Y5OA 3U7DA 2P8VA 1ZC4B 3PP2A 1I2HA 3KSYA 3WYFB 2CAYA 1EGXA 2NMBA 3V5WA 2DLWA 5DI9B 2LG1A 1QC6A 3O96A 2EMTA 2FJLA 4HATB 4Z2NA 3SO6A 3TFMA 1V5PA 2CY4A 2P0FA 4YL8A 4GN1A 4F7UP 4EKUA 4HHVA 4NY0A 3HQCA 2CY5A 4EMOA 4WSFA 3BJIA 1DYNA 1X1GA 3SNHA 1DBHA 1MK7B 1OMWA 2DKPA 1FOEA 2RSGA 1V5MA 3ODWA 4EJNA 1MKEA 1I7AA 5LONB 1U5FA 1ZVRA 1FGZA 2D9VA 4A6FB 1TQZA 5C6RA 3GYPA 5C5BA 3UZTA 2DX5A 1J19A 3A98B 4GXBA 2VKIA 3ODXA 4GZUA 2IYBA 2YS1A 5D3WA 2BCJA 2J0KA 1EVHA 2D9ZA 2D11A 2J0JA 2YT0A 2DHJA 1LB1A 4DX90 2Z0QA 1P6SA 1GC6A 2UZRA 3TO1A 3P7ZA 2XQNM 5J3QA 1IRSA 1U29A 4C0AA 1MIZB 5JHHA 2VSZA 1ZM0A 3F0WA 3LJUX 4WVFB 2Y8GA 2COAA 3D8DA 2YS5A 2RVBB 2L2IA 3ULCA 2K00A 1WVHA 1ZSQA 4KHAA 1BAKA 1W1GA 1UNPA 2MDXA 1X1FA 2W2XC 1KZGA 1FHXA 1BTNA 4GMVA 2DHKA 5FI0A 3CIKA 2GCJA 1Q67A 2OTXA 4HB4B 3P6AA 4MY6A 2X18A 3DXCA 5D27A 2GCLA 2R0DA 2KUPA 4TYZA 3VOQA 3D8EA 2M38A 2YT1A 3A8PA 3SUZA 2RLOA 2EC1A 3MDBC 4TKNA 1U5EA 1XCGA 1W1DA 1J0WA 3KY9A 3TCAA 5EFXA 1U5DA 3ODOA 2LKOA 4P7IA 4PQ0A 4A6FA 5KCVA 4NSWA 1MK9B 1WGUA 3FSSA 1XD4A 3U8ZA 2J59M 1WGQA 4D0NB 3F5RA 2RGNB 3PVUA 1SHCA 3KZ1A 2ROZB 2GS0A 5KQ1A 1BWNA 2P0HA 2QKLA 1V61A 1V88A 4MT7A 5CLQB 1GC7A 1QQGA 1UNRA 3QIJA 3WA0A 1DDMA 4A6KA 3FEHA 4HB0B 1M7RA 1Z87A 2I5FA 4ZRIA 1FHWA 2YF0A 1NI2A 2DX1A 1AQCA 2G35A 2I1KA 2ZPYA 4XWXA 1RRPB 1KZ7A 4HB3B 3KRWA 1AWEA 2I5CA 4KAXB 2YRYA 1Y19B 2YSZA 3PZDA 3MPXA 4B6HA 2JP2A 1NU2A 2D2QA 5JP4A 2V76A 1FHOA 4HAWB 2DFKA 3FM8C 4IAPA 1DROA 2Y7BA 5C16A 2KGXB 2D9YA 2W2XD 3DXDA 3BINA 4K81A 4YONA 1EAZA 1WJMA 2H7DA 2RNRB 1OY2A 3DXEA 1FB8A 2Y8FA 5DHFB 2GJYA 5DHAB 2HTHB 2D4QA 1X11A 4DXAB 4PNKA 4Y94A 3RCPA 4IFSA 2LYDA 1H4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHG A;  2I1J A;  3NSU A;  1K5D B;  1UNQ A;  3AU4 A;  5D3Y A;  3CXB B;  2CRF A;  5GOW B;  2DKQ A;  2MFQ A;  5C79 A;  1UEF A;  2MWN B;  3M1I B;  5J3T A;  3IVF A;  3AU5 A;  2L1C A;  3N7C A;  2K2U A;  4KHO A;  4MK0 A;  2IFS A;  2QKM A;  3A8Q A;  1MIX A;  3X23 A;  2D9W A;  1X86 A;  4A5K A;  2DHI A;  1U5G A;  2M14 A;  1KI1 B;  1UPQ A;  5HE1 A;  2EJ8 A;  5FI1 A;  1GG3 A;  1RJ2 A;  2N23 A;  4HAY B;  5DH9 B;  2VRW B;  5CLL B;  1WG7 A;  4GPT B;  2R09 A;  2UVM A;  4K17 A;  3QBV B;  2Q13 A;  1LW3 A;  3PEG A;  1XKE A;  3PVL A;  2OQB A;  1FGY A;  1PMS A;  3ULB A;  2YVC A;  3OAN A;  1V89 A;  5HE3 A;  2UZS A;  1P5T A;  1X05 A;  1K5G B;  4CYE A;  1MPH A;  1NTY A;  1XOD A;  1FAO A;  4HAX B;  1H10 A;  1TXD A;  1NTV A;  3VIA A;  4L6E A;  2ROV A;  1ISN A;  4F7G A;  4A6H A;  3PG7 A;  2COF A;  4IOY X;  4KVG B;  3TW1 A;  5JLJ B;  3G9W A;  1XX0 A;  4ZRJ A;  2E2X A;  1PLS A;  5L81 A;  4HAZ B;  4HAV B;  2P0D A;  1U27 A;  5J3Y A;  1EF1 A;  1WI1 A;  4F7H A;  3ZDT A;  4H8S A;  5HE2 A;  1TJ6 A;  3HK0 A;  4ZRK A;  4KHB B;  1E5W A;  2COC A;  5D3V A;  3PVW A;  2RUK B;  1B55 A;  2D10 A;  3SV1 A;  2H7E A;  3PSC A;  2J0M A;  3ML4 A;  5DIF B;  1V5U A;  1WJ1 A;  2ADZ A;  2EMS A;  4K2P A;  3T06 A;  1UPR A;  1U2B A;  2MKR A;  2DA0 A;  2W2W A;  2K2J A;  3HW2 B;  4CHM A;  4CHJ A;  4HAU B;  3QWM A;  4HDO A;  1DDV A;  1MAI A;  2DTC A;  2ELA A;  1SGH A;  2HE7 A;  2AEH A;  4DX8 A;  1ZC3 B;  2PZ1 A;  1BTK A;  4K2O A;  2LUL A;  2D9X A;  3AJ4 A;  3SYX A;  4HB2 B;  1PFJ A;  1M7E A;  1P3R A;  2LOX A;  1N3H A;  3KRX A;  2DYQ A;  2AL6 A;  2NZ8 B;  5HE0 A;  1DDW A;  2DYN A;  4DBB A;  2DN6 A;  3ZVR A;  2Z0O A;  5D3X A;  1OQN A;  3TVV A;  5C5B B;  5KQ4 A;  3D8F A;  2KCJ A;  2Z0P A;  1XR0 B;  1W1H A;  4BBK A;  4WJ7 A;  5LOP B;  2LOZ A;  4Z2M B;  4HDQ A;  2ELB A;  2YS3 A;  2N0Y A;  3GYO A;  2COD A;  4GMX B;  1Y5O A;  3U7D A;  2P8V A;  1ZC4 B;  3PP2 A;  1I2H A;  3KSY A;  3WYF B;  2CAY A;  1EGX A;  2NMB A;  3V5W A;  2DLW A;  5DI9 B;  2LG1 A;  1QC6 A;  3O96 A;  2EMT A;  2FJL A;  4HAT B;  4Z2N A;  3SO6 A;  3TFM A;  1V5P A;  2CY4 A;  2P0F A;  4YL8 A;  4GN1 A;  4F7U P;  4EKU A;  4HHV A;  4NY0 A;  3HQC A;  2CY5 A;  4EMO A;  4WSF A;  3BJI A;  1DYN A;  1X1G A;  3SNH A;  1DBH A;  1MK7 B;  1OMW A;  2DKP A;  1FOE A;  2RSG A;  1V5M A;  3ODW A;  4EJN A;  1MKE A;  1I7A A;  5LON B;  1U5F A;  1ZVR A;  1FGZ A;  2D9V A;  4A6F B;  1TQZ A;  5C6R A;  3GYP A;  5C5B A;  3UZT A;  2DX5 A;  1J19 A;  3A98 B;  4GXB A;  2VKI A;  3ODX A;  4GZU A;  2IYB A;  2YS1 A;  5D3W A;  2BCJ A;  2J0K A;  1EVH A;  2D9Z A;  2D11 A;  2J0J A;  2YT0 A;  2DHJ A;  1LB1 A;  4DX9 0;  2Z0Q A;  1P6S A;  1GC6 A;  2UZR A;  3TO1 A;  3P7Z A;  2XQN M;  5J3Q A;  1IRS A;  1U29 A;  4C0A A;  1MIZ B;  5JHH A;  2VSZ A;  1ZM0 A;  3F0W A;  3LJU X;  4WVF B;  2Y8G A;  2COA A;  3D8D A;  2YS5 A;  2RVB B;  2L2I A;  3ULC A;  2K00 A;  1WVH A;  1ZSQ A;  4KHA A;  1BAK A;  1W1G A;  1UNP A;  2MDX A;  1X1F A;  2W2X C;  1KZG A;  1FHX A;  1BTN A;  4GMV A;  2DHK A;  5FI0 A;  3CIK A;  2GCJ A;  1Q67 A;  2OTX A;  4HB4 B;  3P6A A;  4MY6 A;  2X18 A;  3DXC A;  5D27 A;  2GCL A;  2R0D A;  2KUP A;  4TYZ A;  3VOQ A;  3D8E A;  2M38 A;  2YT1 A;  3A8P A;  3SUZ A;  2RLO A;  2EC1 A;  3MDB C;  4TKN A;  1U5E A;  1XCG A;  1W1D A;  1J0W A;  3KY9 A;  3TCA A;  5EFX A;  1U5D A;  3ODO A;  2LKO A;  4P7I A;  4PQ0 A;  4A6F A;  5KCV A;  4NSW A;  1MK9 B;  1WGU A;  3FSS A;  1XD4 A;  3U8Z A;  2J59 M;  1WGQ A;  4D0N B;  3F5R A;  2RGN B;  3PVU A;  1SHC A;  3KZ1 A;  2ROZ B;  2GS0 A;  5KQ1 A;  1BWN A;  2P0H A;  2QKL A;  1V61 A;  1V88 A;  4MT7 A;  5CLQ B;  1GC7 A;  1QQG A;  1UNR A;  3QIJ A;  3WA0 A;  1DDM A;  4A6K A;  3FEH A;  4HB0 B;  1M7R A;  1Z87 A;  2I5F A;  4ZRI A;  1FHW A;  2YF0 A;  1NI2 A;  2DX1 A;  1AQC A;  2G35 A;  2I1K A;  2ZPY A;  4XWX A;  1RRP B;  1KZ7 A;  4HB3 B;  3KRW A;  1AWE A;  2I5C A;  4KAX B;  2YRY A;  1Y19 B;  2YSZ A;  3PZD A;  3MPX A;  4B6H A;  2JP2 A;  1NU2 A;  2D2Q A;  5JP4 A;  2V76 A;  1FHO A;  4HAW B;  2DFK A;  3FM8 C;  4IAP A;  1DRO A;  2Y7B A;  5C16 A;  2KGX B;  2D9Y A;  2W2X D;  3DXD A;  3BIN A;  4K81 A;  4YON A;  1EAZ A;  1WJM A;  2H7D A;  2RNR B;  1OY2 A;  3DXE A;  1FB8 A;  2Y8F A;  5DHF B;  2GJY A;  5DHA B;  2HTH B;  2D4Q A;  1X11 A;  4DXA B;  4PNK A;  4Y94 A;  3RCP A;  4IFS A;  2LYD A;  1H4R A; 
#chains in the Genus database with same CATH topology
 3HSA A;  5JHG A;  2I1J A;  3NSU A;  4DIX A;  3NWF A;  1K5D B;  1UNQ A;  3AU4 A;  5D3Y A;  3CXB B;  2CRF A;  5GOW B;  2DKQ A;  2MFQ A;  5C79 A;  1UEF A;  2MWN B;  3M1I B;  5J3T A;  3IVF A;  2GUM A;  3AU5 A;  2L1C A;  3N7C A;  2KIE A;  2K2U A;  2ZKM X;  4KHO A;  4MK0 A;  2IFS A;  2QKM A;  3A8Q A;  1MIX A;  3X23 A;  2D9W A;  1X86 A;  4A5K A;  2DHI A;  1U5G A;  2M14 A;  1KI1 B;  1UPQ A;  5HE1 A;  2EJ8 A;  5FI1 A;  1GG3 A;  1RJ2 A;  2N23 A;  4GOU A;  4HAY B;  5DH9 B;  2VRW B;  2FJU B;  2KIG A;  5CLL B;  1WG7 A;  4GPT B;  2R09 A;  2UVM A;  4K17 A;  3QBV B;  2Q13 A;  1LW3 A;  3PEG A;  1XKE A;  3PVL A;  2OQB A;  1FGY A;  1PMS A;  3ULB A;  2YVC A;  3OAN A;  1V89 A;  5HE3 A;  2UZS A;  1P5T A;  1X05 A;  1K5G B;  4CYE A;  1MPH A;  1NTY A;  4OT1 A;  1XOD A;  2RRF A;  1FAO A;  4HAX B;  1H10 A;  1TXD A;  1NTV A;  3VIA A;  4L6E A;  2ROV A;  1ISN A;  4F7G A;  4A6H A;  3PG7 A;  1T77 A;  2COF A;  4IOY X;  4KVG B;  3TW1 A;  5JLJ B;  3G9W A;  1XX0 A;  4ZRJ A;  2E2X A;  1PLS A;  5L81 A;  4HAZ B;  4HAV B;  2P0D A;  1U27 A;  5J3Y A;  1EF1 A;  1WI1 A;  4F7H A;  3ZDT A;  4H8S A;  5HE2 A;  2Z13 A;  1TJ6 A;  3HK0 A;  4ZRK A;  4KHB B;  1E5W A;  2COC A;  5D3V A;  3PVW A;  2RUK B;  1B55 A;  2D10 A;  3SV1 A;  2H7E A;  3PSC A;  2J0M A;  3ML4 A;  5DIF B;  1V5U A;  1WJ1 A;  2ADZ A;  2EMS A;  4K2P A;  3T06 A;  1UPR A;  1U2B A;  3B77 A;  2MKR A;  2DA0 A;  2K49 A;  2W2W A;  1ZYI A;  4QXA B;  2K2J A;  3HW2 B;  4CHM A;  4CHJ A;  4HAU B;  3QWM A;  4HDO A;  1DDV A;  1MAI A;  2DTC A;  2ELA A;  1SGH A;  2HE7 A;  2AEH A;  4DX8 A;  1ZC3 B;  2PZ1 A;  1BTK A;  2R2Y A;  4K2O A;  2LUL A;  2D9X A;  3AJ4 A;  3SYX A;  4HB2 B;  1PFJ A;  1M7E A;  1P3R A;  2LOX A;  1N3H A;  2Z14 A;  3KRX A;  5LG4 B;  2DYQ A;  2AL6 A;  2NZ8 B;  3NWD A;  1DDW A;  5HE0 A;  2DYN A;  4DBB A;  2DN6 A;  3ZVR A;  2Z0O A;  5D3X A;  1OQN A;  3TVV A;  5C5B B;  5KQ4 A;  3D8F A;  2KCJ A;  2Z0P A;  1XR0 B;  1W1H A;  4BBK A;  4WJ7 A;  5LOP B;  2LOZ A;  4Z2M B;  4HDQ A;  2ELB A;  2YS3 A;  2N0Y A;  3GYO A;  2COD A;  4GMX B;  1Y5O A;  3U7D A;  2P8V A;  1ZC4 B;  3PP2 A;  1I2H A;  3KSY A;  4HSI A;  4KHB A;  3WYF B;  2CAY A;  3FVC A;  4QJ4 B;  1EGX A;  2NMB A;  3V5W A;  3HIE A;  2DLW A;  5DI9 B;  2NBV A;  2LG1 A;  1QC6 A;  3O96 A;  2EMT A;  2FJL A;  4HAT B;  4L1R A;  4Z2N A;  3NWA A;  4GNK B;  3SO6 A;  3TFM A;  1V5P A;  2CY4 A;  3U12 A;  2P0F A;  4YL8 A;  1MI1 A;  4GN1 A;  4F7U P;  4EKU A;  4HHV A;  4NY0 A;  3HQC A;  2CY5 A;  4EMO A;  4WSF A;  3BJI A;  1DYN A;  1X1G A;  3SNH A;  1DBH A;  1MK7 B;  1OMW A;  2DKP A;  1FOE A;  2RSG A;  1V5M A;  3ODW A;  4EJN A;  1MKE A;  1I7A A;  5LON B;  1U5F A;  2YT2 A;  1ZVR A;  2KR0 A;  1FGZ A;  2D9V A;  2Z4D A;  4A6F B;  3A58 A;  1TQZ A;  5C6R A;  3GYP A;  5C5B A;  3UZT A;  2DX5 A;  1J19 A;  3A98 B;  4GXB A;  2VKI A;  3ODX A;  4GZU A;  2IYB A;  2YS1 A;  5D3W A;  2BCJ A;  2J0K A;  1EVH A;  2D9Z A;  2D11 A;  2J0J A;  2YT0 A;  5IRS A;  2DHJ A;  1LB1 A;  4DX9 0;  3OHM B;  2Z0Q A;  1P6S A;  1GC6 A;  2UZR A;  3TO1 A;  3P7Z A;  4OSN A;  2XQN M;  5J3Q A;  2Z59 A;  1IRS A;  1U29 A;  4C0A A;  1MIZ B;  5JHH A;  3NW8 A;  2VSZ A;  1ZM0 A;  3F0W A;  3LJU X;  4WVF B;  2Y8G A;  2COA A;  3D8D A;  2YS5 A;  2RVB B;  5M4Y B;  2L2I A;  3ULC A;  2K00 A;  1WVH A;  1ZSQ A;  4KHA A;  1BAK A;  1W1G A;  1UNP A;  2MDX A;  1X1F A;  2W2X C;  1KZG A;  1FHX A;  1BTN A;  4GMV A;  2DHK A;  5FI0 A;  3CIK A;  2GCJ A;  1Q67 A;  2OTX A;  4HB4 B;  3P6A A;  4MY6 A;  2X18 A;  3DXC A;  5D27 A;  2GCL A;  2R0D A;  2KUP A;  4TYZ A;  3VOQ A;  4QJ5 B;  3D8E A;  2M38 A;  2YT1 A;  3A8P A;  3SUZ A;  2RLO A;  2EC1 A;  3MDB C;  4TKN A;  1U5E A;  1XCG A;  1W1D A;  1J0W A;  3KY9 A;  3TCA A;  5EFX A;  1U5D A;  3ODO A;  2LKO A;  4P7I A;  4PQ0 A;  4A6F A;  5KCV A;  2KUQ A;  4NSW A;  1MK9 B;  1WGU A;  3FSS A;  1XD4 A;  3U8Z A;  2J59 M;  1WGQ A;  4D0N B;  2K8E A;  3F5R A;  2RGN B;  3PVU A;  1SHC A;  3KZ1 A;  2ROZ B;  2GS0 A;  5KQ1 A;  1BWN A;  2P0H A;  2QKL A;  1V61 A;  1V88 A;  4MT7 A;  5CLQ B;  1GC7 A;  5I2M A;  1QQG A;  1UNR A;  3QIJ A;  3WA0 A;  1DDM A;  4A6K A;  3FEH A;  5I2S A;  4HB0 B;  1M7R A;  4D6W A;  1Z87 A;  2I5F A;  4ZRI A;  1FHW A;  2YF0 A;  1NI2 A;  2DX1 A;  1AQC A;  2G35 A;  2I1K A;  2ZPY A;  4XWX A;  1RRP B;  1KZ7 A;  4HB3 B;  3KRW A;  1AWE A;  2I5C A;  4KAX B;  2YRY A;  1Y19 B;  2YSZ A;  4QJ3 B;  3PZD A;  3MPX A;  4B6H A;  2JP2 A;  1NU2 A;  2D2Q A;  5JP4 A;  4CSQ A;  2V76 A;  1FHO A;  4HAW B;  2DFK A;  3FM8 C;  4IAP A;  1DRO A;  2Y7B A;  5C16 A;  2KGX B;  2D9Y A;  2W2X D;  3DXD A;  3BIN A;  4K81 A;  4YON A;  1EAZ A;  1WJM A;  2H7D A;  2RNR B;  1OY2 A;  3DXE A;  1FB8 A;  2Y8F A;  5DHF B;  2GJY A;  5DHA B;  2HTH B;  2D4Q A;  1X11 A;  4DXA B;  4PNK A;  4Y94 A;  3RCP A;  4IFS A;  2LYD A;  1H4R A;  3DCX A; 
#chains in the Genus database with same CATH homology
 5JHG A;  2I1J A;  3NSU A;  1K5D B;  1UNQ A;  3AU4 A;  5D3Y A;  3CXB B;  2CRF A;  5GOW B;  2DKQ A;  2MFQ A;  5C79 A;  1UEF A;  2MWN B;  3M1I B;  5J3T A;  3IVF A;  3AU5 A;  2L1C A;  3N7C A;  2K2U A;  4KHO A;  4MK0 A;  2IFS A;  2QKM A;  3A8Q A;  1MIX A;  3X23 A;  2D9W A;  1X86 A;  4A5K A;  2DHI A;  1U5G A;  2M14 A;  1KI1 B;  1UPQ A;  5HE1 A;  2EJ8 A;  5FI1 A;  1GG3 A;  1RJ2 A;  2N23 A;  4HAY B;  5DH9 B;  2VRW B;  5CLL B;  1WG7 A;  4GPT B;  2R09 A;  2UVM A;  4K17 A;  3QBV B;  2Q13 A;  1LW3 A;  3PEG A;  1XKE A;  3PVL A;  2OQB A;  1FGY A;  1PMS A;  3ULB A;  2YVC A;  3OAN A;  1V89 A;  5HE3 A;  2UZS A;  1P5T A;  1X05 A;  1K5G B;  4CYE A;  1MPH A;  1NTY A;  1XOD A;  1FAO A;  4HAX B;  1H10 A;  1TXD A;  1NTV A;  3VIA A;  4L6E A;  2ROV A;  1ISN A;  4F7G A;  4A6H A;  3PG7 A;  2COF A;  4IOY X;  4KVG B;  3TW1 A;  5JLJ B;  3G9W A;  1XX0 A;  4ZRJ A;  2E2X A;  1PLS A;  5L81 A;  4HAZ B;  4HAV B;  2P0D A;  1U27 A;  5J3Y A;  1EF1 A;  1WI1 A;  4F7H A;  3ZDT A;  4H8S A;  5HE2 A;  1TJ6 A;  3HK0 A;  4ZRK A;  4KHB B;  1E5W A;  2COC A;  5D3V A;  3PVW A;  2RUK B;  1B55 A;  2D10 A;  3SV1 A;  2H7E A;  3PSC A;  2J0M A;  3ML4 A;  5DIF B;  1V5U A;  1WJ1 A;  2ADZ A;  2EMS A;  4K2P A;  3T06 A;  1UPR A;  1U2B A;  2MKR A;  2DA0 A;  2W2W A;  2K2J A;  3HW2 B;  4CHM A;  4CHJ A;  4HAU B;  3QWM A;  4HDO A;  1DDV A;  1MAI A;  2DTC A;  2ELA A;  1SGH A;  2HE7 A;  2AEH A;  4DX8 A;  1ZC3 B;  2PZ1 A;  1BTK A;  4K2O A;  2LUL A;  2D9X A;  3AJ4 A;  3SYX A;  4HB2 B;  1PFJ A;  1M7E A;  1P3R A;  2LOX A;  1N3H A;  3KRX A;  2DYQ A;  2AL6 A;  2NZ8 B;  5HE0 A;  1DDW A;  2DYN A;  4DBB A;  2DN6 A;  3ZVR A;  2Z0O A;  5D3X A;  1OQN A;  3TVV A;  5C5B B;  5KQ4 A;  3D8F A;  2KCJ A;  2Z0P A;  1XR0 B;  1W1H A;  4BBK A;  4WJ7 A;  5LOP B;  2LOZ A;  4Z2M B;  4HDQ A;  2ELB A;  2YS3 A;  2N0Y A;  3GYO A;  2COD A;  4GMX B;  1Y5O A;  3U7D A;  2P8V A;  1ZC4 B;  3PP2 A;  1I2H A;  3KSY A;  3WYF B;  2CAY A;  1EGX A;  2NMB A;  3V5W A;  2DLW A;  5DI9 B;  2LG1 A;  1QC6 A;  3O96 A;  2EMT A;  2FJL A;  4HAT B;  4Z2N A;  3SO6 A;  3TFM A;  1V5P A;  2CY4 A;  2P0F A;  4YL8 A;  4GN1 A;  4F7U P;  4EKU A;  4HHV A;  4NY0 A;  3HQC A;  2CY5 A;  4EMO A;  4WSF A;  3BJI A;  1DYN A;  1X1G A;  3SNH A;  1DBH A;  1MK7 B;  1OMW A;  2DKP A;  1FOE A;  2RSG A;  1V5M A;  3ODW A;  4EJN A;  1MKE A;  1I7A A;  5LON B;  1U5F A;  1ZVR A;  1FGZ A;  2D9V A;  4A6F B;  1TQZ A;  5C6R A;  3GYP A;  5C5B A;  3UZT A;  2DX5 A;  1J19 A;  3A98 B;  4GXB A;  2VKI A;  3ODX A;  4GZU A;  2IYB A;  2YS1 A;  5D3W A;  2BCJ A;  2J0K A;  1EVH A;  2D9Z A;  2D11 A;  2J0J A;  2YT0 A;  2DHJ A;  1LB1 A;  4DX9 0;  2Z0Q A;  1P6S A;  1GC6 A;  2UZR A;  3TO1 A;  3P7Z A;  2XQN M;  5J3Q A;  1IRS A;  1U29 A;  4C0A A;  1MIZ B;  5JHH A;  2VSZ A;  1ZM0 A;  3F0W A;  3LJU X;  4WVF B;  2Y8G A;  2COA A;  3D8D A;  2YS5 A;  2RVB B;  2L2I A;  3ULC A;  2K00 A;  1WVH A;  1ZSQ A;  4KHA A;  1BAK A;  1W1G A;  1UNP A;  2MDX A;  1X1F A;  2W2X C;  1KZG A;  1FHX A;  1BTN A;  4GMV A;  2DHK A;  5FI0 A;  3CIK A;  2GCJ A;  1Q67 A;  2OTX A;  4HB4 B;  3P6A A;  4MY6 A;  2X18 A;  3DXC A;  5D27 A;  2GCL A;  2R0D A;  2KUP A;  4TYZ A;  3VOQ A;  3D8E A;  2M38 A;  2YT1 A;  3A8P A;  3SUZ A;  2RLO A;  2EC1 A;  3MDB C;  4TKN A;  1U5E A;  1XCG A;  1W1D A;  1J0W A;  3KY9 A;  3TCA A;  5EFX A;  1U5D A;  3ODO A;  2LKO A;  4P7I A;  4PQ0 A;  4A6F A;  5KCV A;  4NSW A;  1MK9 B;  1WGU A;  3FSS A;  1XD4 A;  3U8Z A;  2J59 M;  1WGQ A;  4D0N B;  3F5R A;  2RGN B;  3PVU A;  1SHC A;  3KZ1 A;  2ROZ B;  2GS0 A;  5KQ1 A;  1BWN A;  2P0H A;  2QKL A;  1V61 A;  1V88 A;  4MT7 A;  5CLQ B;  1GC7 A;  1QQG A;  1UNR A;  3QIJ A;  3WA0 A;  1DDM A;  4A6K A;  3FEH A;  4HB0 B;  1M7R A;  1Z87 A;  2I5F A;  4ZRI A;  1FHW A;  2YF0 A;  1NI2 A;  2DX1 A;  1AQC A;  2G35 A;  2I1K A;  2ZPY A;  4XWX A;  1RRP B;  1KZ7 A;  4HB3 B;  3KRW A;  1AWE A;  2I5C A;  4KAX B;  2YRY A;  1Y19 B;  2YSZ A;  3PZD A;  3MPX A;  4B6H A;  2JP2 A;  1NU2 A;  2D2Q A;  5JP4 A;  2V76 A;  1FHO A;  4HAW B;  2DFK A;  3FM8 C;  4IAP A;  1DRO A;  2Y7B A;  5C16 A;  2KGX B;  2D9Y A;  2W2X D;  3DXD A;  3BIN A;  4K81 A;  4YON A;  1EAZ A;  1WJM A;  2H7D A;  2RNR B;  1OY2 A;  3DXE A;  1FB8 A;  2Y8F A;  5DHF B;  2GJY A;  5DHA B;  2HTH B;  2D4Q A;  1X11 A;  4DXA B;  4PNK A;  4Y94 A;  3RCP A;  4IFS A;  2LYD A;  1H4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...