2DTCA

Crystal structure of ms0666
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
PTMEGPLRRKTLLKEGRKPALSSWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAL GUANINE NUCLEOTIDE EXCHANGE FACTOR RALGPS1A
publication title Crystal structure of MS0666
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dtcA00
4IOYX 1EF1A 2P0FA 1U5EA 3WYFB 2XQNM 1XD4A 4K81A 2I5CA 5DH9B 1W1DA 1GC6A 2YF0A 3A98B 3HW2B 2J0JA 1UEFA 1P5TA 2DYNA 2L2IA 2EMSA 3IVFA 2Q13A 1GG3A 1J19A 2NZ8B 1TQZA 1ZVRA 3ML4A 1LB1A 1WJMA 1WGQA 1LW3A 1QC6A 2I5FA 4HDQA 3N7CA 4WVFB 5C79A 1Q67A 1I2HA 1X11A 1H4RA 1M7EA 4HAWB 2GCJA 4DX8A 1AWEA 2KCJA 4MK0A 2X18A 5J3QA 4MT7A 1E5WA 1PFJA 1BAKA 3WA0A 2VRWB 4HHVA 4PNKA 5LONB 3GYPA 4EMOA 3BJIA 3F5RA 2CRFA 4B6HA 1Y5OA 2R0DA 2D2QA 2LOZA 2UVMA 4BBKA 2N23A 4F7HA 1UPQA 4IAPA 2E2XA 2LG1A 2AL6A 2DFKA 2I1JA 3QWMA 5KQ1A 2YT0A 2DLWA 1WJ1A 2DYQA 1U5GA 1ZC3B 2G35A 2D9WA 3V5WA 5FI0A 1ZM0A 1RJ2A 3P7ZA 4KHBB 3CIKA 2YS3A 3SNHA 1X86A 2RSGA 1WGUA 1SHCA 1MAIA 2YT1A 1UNRA 2M38A 4KAXB 4K17A 4D0NB 5D3YA 2RNRB 1GC7A 3LJUX 2D9YA 1OMWA 2NMBA 1P3RA 2COCA 2DN6A 4MY6A 1PMSA 3NSUA 1BWNA 3HK0A 4H8SA 1H10A 1W1GA 1NI2A 4GPTB 1V5PA 3FM8C 2VKIA 3QIJA 3F0WA 2K2JA 2EJ8A 3U8ZA 1FB8A 1V89A 1PLSA 2DHKA 4F7GA 1WVHA 1NU2A 1V5UA 5KCVA 4HDOA 2LYDA 4P7IA 5JHHA 2K00A 4A5KA 1P6SA 2YS1A 2Z0QA 2L1CA 2DKQA 4KVGB 2DKPA 1DDVA 2HE7A 3U7DA 3T06A 1EGXA 1Z87A 3P6AA 4F7UP 1X1GA 5C16A 1DROA 4IFSA 3SV1A 3RCPA 3DXDA 3D8DA 1X05A 5EFXA 4GN1A 2W2XC 5D3VA 2QKLA 2HTHB 2RUKB 2YRYA 3AJ4A 4TKNA 3KZ1A 4GMXB 2D9VA 2DHJA 4HAXB 2ADZA 1TJ6A 2CAYA 1MK9B 3DXCA 3OANA 3KRWA 2I1KA 2Y7BA 2YSZA 2DX5A 4DXAB 2P0HA 3ODWA 3FEHA 1WG7A 4KHOA 5CLQB 2D9XA 2DX1A 1U5DA 2OTXA 1X1FA 2LKOA 1MKEA 2QKMA 3KRXA 2EMTA 5DHFB 1BTKA 4GMVA 2RVBB 1M7RA 3KSYA 1K5GB 3ULCA 3TCAA 3DXEA 1XKEA 1DYNA 2K2UA 1UNQA 4K2OA 3QBVB 3GYOA 4HAVB 2YS5A 2BCJA 4HAZB 4EKUA 4CYEA 3UZTA 1XR0B 4WSFA 3M1IB 4YL8A 2J0MA 2P8VA 1FGZA 4ZRKA 1SGHA 2Z0OA 4ZRIA 5D3XA 1RRPB 2H7EA 1AQCA 5HE0A 3ZVRA 2W2XD 1DDMA 3ODXA 4TYZA 2DTCA 3PVUA 1U27A 3SYXA 1TXDA 2D4QA 3A8QA 1OY2A 3PG7A 4C0AA 2LULA 1KI1B 3PVWA 4PQ0A 2ELAA 3FSSA 5D27A 2V76A 1IRSA 2Y8GA 2MWNB 5FI1A 2ZPYA 4HB3B 2D11A 2GCLA 3PP2A 1ZSQA 2DHIA 4A6FB 3ULBA 4CHJA 3G9WA 3ODOA 2CY4A 2J59M 4EJNA 2N0YA 2CODA 5J3YA 4KHAA 4DX90 2W2WA 4NSWA 4Z2MB 3SO6A 2UZRA 3TFMA 2COAA 3PSCA 5C5BB 4GXBA 4ZRJA 4L6EA 4HAUB 2JP2A 3AU4A 2UZSA 1B55A 3MPXA 5CLLB 1U5FA 1N3HA 1J0WA 5JHGA 4GZUA 4XWXA 1MPHA 2ROVA 1FHXA 2AEHA 1KZ7A 3ZDTA 1I7AA 5GOWB 3TVVA 1Y19B 1XCGA 4HB0B 1V61A 2D10A 1OQNA 1W1HA 2IFSA 1UPRA 3X23A 2H7DA 2VSZA 2GS0A 2EC1A 4DBBA 5HE3A 4Z2NA 4HATB 1V88A 3MDBC 5HE2A 1KZGA 2KGXB 3PEGA 2IYBA 2CY5A 1BTNA 4HB2B 2R09A 1MIZB 5JLJB 2FJLA 5DHAB 5DIFB 3D8FA 1WI1A 1V5MA 1EAZA 2OQBA 2YVCA 2ELBA 4A6FA 1MIXA 5J3TA 1FHOA 1QQGA 2MFQA 3CXBB 4K2PA 1NTVA 3TO1A 3KY9A 4NY0A 1FGYA 4HAYB 4YONA 3VOQA 5D3WA 1ZC4B 1FHWA 4HB4B 2J0KA 5DI9B 1DDWA 2LOXA 3VIAA 5HE1A 3A8PA 2GJYA 5C5BA 1MK7B 2COFA 2DA0A 1UNPA 2MDXA 2MKRA 2RGNB 3D8EA 5KQ4A 1DBHA 1U29A 3HQCA 5JP4A 1U2BA 1FOEA 5L81A 1ISNA 3AU5A 5C6RA 4A6HA 2KUPA 1XODA 3SUZA 1K5DB 3PZDA 4WJ7A 1NTYA 2ROZB 5LOPB 2RLOA 2PZ1A 2P0DA 3PVLA 4A6KA 2M14A 2Y8FA 2D9ZA 2Z0PA 1EVHA 3O96A 4CHMA 4Y94A 1FAOA 1XX0A 3TW1A 3BINA
chains in the Genus database with same CATH superfamily
4IOYX 2KR0A 4QXAB 1EF1A 2KIGA 2P0FA 1U5EA 3WYFB 2XQNM 1XD4A 4K81A 2I5CA 5M4YB 5DH9B 1W1DA 1GC6A 3NWAA 4HSIA 2YF0A 3A98B 3HW2B 2J0JA 1UEFA 1P5TA 2DYNA 5IRSA 2L2IA 2EMSA 3IVFA 2Q13A 1GG3A 1J19A 2NZ8B 1TQZA 1ZVRA 3ML4A 1LB1A 4QJ5B 1WJMA 1WGQA 1LW3A 1QC6A 2I5FA 4HDQA 3N7CA 4WVFB 5C79A 1Q67A 1I2HA 1X11A 1H4RA 1M7EA 4HAWB 2GCJA 4DX8A 1AWEA 2KCJA 4MK0A 2X18A 5J3QA 4MT7A 1E5WA 1PFJA 1BAKA 3WA0A 2VRWB 4HHVA 4PNKA 5LONB 3GYPA 4D6WA 3NWDA 3BJIA 4EMOA 3F5RA 2CRFA 4B6HA 1Y5OA 2R0DA 2D2QA 2LOZA 2UVMA 4BBKA 2N23A 4F7HA 1UPQA 4IAPA 2E2XA 2LG1A 2AL6A 2DFKA 2I1JA 3QWMA 5KQ1A 2YT0A 2DLWA 1WJ1A 2DYQA 1U5GA 1ZC3B 4L1RA 2G35A 2D9WA 3V5WA 5FI0A 1ZM0A 1RJ2A 3P7ZA 4KHBB 3CIKA 2YS3A 3SNHA 1X86A 2RSGA 1WGUA 1SHCA 1MAIA 2YT1A 1UNRA 2M38A 4KAXB 2ZKMX 4K17A 4D0NB 5D3YA 2RNRB 1GC7A 3LJUX 2R2YA 2D9YA 1OMWA 2NMBA 1P3RA 2COCA 2DN6A 4MY6A 1PMSA 3NSUA 1BWNA 3HK0A 4H8SA 3DCXA 1H10A 1W1GA 1NI2A 4GPTB 1V5PA 3FM8C 2VKIA 3QIJA 3F0WA 3NW8A 2K2JA 2EJ8A 2Z13A 3U8ZA 1FB8A 1V89A 1PLSA 2DHKA 4GNKB 4F7GA 1WVHA 1NU2A 1V5UA 5KCVA 4HDOA 2LYDA 4P7IA 5JHHA 2Z59A 5LG4B 2K00A 4A5KA 1P6SA 2YS1A 2Z0QA 2L1CA 2DKQA 4KVGB 2DKPA 1DDVA 2HE7A 3OHMB 3U7DA 3T06A 1EGXA 1Z87A 3P6AA 4F7UP 1X1GA 5C16A 1DROA 4IFSA 3SV1A 3RCPA 3DXDA 3D8DA 1X05A 5EFXA 4GN1A 2W2XC 5D3VA 2QKLA 2HTHB 2RUKB 4OSNA 2YRYA 3AJ4A 4TKNA 3KZ1A 4GMXB 2D9VA 2DHJA 4HAXB 2ADZA 4KHBA 1TJ6A 2CAYA 1MK9B 3DXCA 3OANA 2FJUB 3KRWA 2I1KA 2Y7BA 2YSZA 2DX5A 4DXAB 2P0HA 3ODWA 2YT2A 3FEHA 1WG7A 4KHOA 5CLQB 2D9XA 2DX1A 1U5DA 2OTXA 2KIEA 1X1FA 4CSQA 2LKOA 1MKEA 2QKMA 3KRXA 2EMTA 5DHFB 1BTKA 4GMVA 2RVBB 3HSAA 1M7RA 3KSYA 1K5GB 3ULCA 3TCAA 3DXEA 1XKEA 1DYNA 2K2UA 1UNQA 4K2OA 5I2MA 3QBVB 3GYOA 4HAVB 2YS5A 2BCJA 4HAZB 4EKUA 4CYEA 3UZTA 1XR0B 4WSFA 3M1IB 4YL8A 2J0MA 4QJ3B 2P8VA 1FGZA 4ZRKA 1SGHA 2Z0OA 4ZRIA 5D3XA 1RRPB 2H7EA 1AQCA 5HE0A 3ZVRA 2W2XD 1DDMA 3ODXA 4TYZA 2DTCA 3PVUA 1U27A 3SYXA 1TXDA 2D4QA 3A8QA 1OY2A 3PG7A 4C0AA 2LULA 1KI1B 3PVWA 4PQ0A 2ELAA 3FSSA 5D27A 2V76A 1IRSA 2Y8GA 2MWNB 5FI1A 2ZPYA 4HB3B 2D11A 2GCLA 3PP2A 1ZSQA 2DHIA 4A6FB 3ULBA 4CHJA 4QJ4B 3G9WA 3ODOA 2CY4A 2J59M 3B77A 4EJNA 4DIXA 2N0YA 2CODA 2KUQA 2K8EA 5J3YA 4KHAA 4DX90 2W2WA 4NSWA 4Z2MB 3SO6A 2UZRA 3TFMA 2GUMA 2COAA 3PSCA 5C5BB 4GXBA 4ZRJA 4L6EA 4HAUB 2JP2A 3AU4A 2UZSA 1B55A 2Z14A 3MPXA 5CLLB 1U5FA 1N3HA 1J0WA 5JHGA 4GZUA 4XWXA 1MPHA 2ROVA 1FHXA 2AEHA 1KZ7A 3ZDTA 1I7AA 5GOWB 3TVVA 3FVCA 1Y19B 1XCGA 4HB0B 1V61A 2D10A 1OQNA 1T77A 1W1HA 2IFSA 1UPRA 3X23A 2H7DA 2VSZA 2GS0A 5I2SA 2EC1A 4DBBA 4GOUA 5HE3A 4Z2NA 4HATB 1V88A 3MDBC 5HE2A 1KZGA 2KGXB 3PEGA 2IYBA 2CY5A 3HIEA 2NBVA 1BTNA 3U12A 4HB2B 2R09A 1MIZB 5JLJB 3NWFA 2FJLA 5DHAB 5DIFB 3D8FA 1WI1A 1V5MA 1EAZA 2OQBA 2YVCA 2ELBA 4A6FA 1MIXA 5J3TA 1FHOA 1ZYIA 1QQGA 2MFQA 3CXBB 4K2PA 1NTVA 3TO1A 3KY9A 4NY0A 1FGYA 4HAYB 4YONA 3VOQA 5D3WA 1ZC4B 1FHWA 4HB4B 2J0KA 5DI9B 1DDWA 2LOXA 3VIAA 5HE1A 3A8PA 2GJYA 5C5BA 1MK7B 2COFA 2DA0A 1UNPA 2K49A 2MDXA 2Z4DA 2MKRA 2RGNB 3D8EA 5KQ4A 1DBHA 1U29A 3HQCA 5JP4A 1U2BA 1FOEA 5L81A 1ISNA 3AU5A 5C6RA 4A6HA 2KUPA 1XODA 3SUZA 1K5DB 3PZDA 4WJ7A 1NTYA 2ROZB 5LOPB 2RLOA 2PZ1A 2P0DA 3PVLA 4A6KA 2M14A 2Y8FA 4OT1A 2D9ZA 2Z0PA 1EVHA 3O96A 4CHMA 3A58A 4Y94A 1FAOA 1XX0A 3TW1A 2RRFA 3BINA 1MI1A
chains in the Genus database with same CATH topology
4IOYX 1EF1A 2P0FA 1U5EA 3WYFB 2XQNM 1XD4A 4K81A 2I5CA 5DH9B 1W1DA 1GC6A 2YF0A 3A98B 3HW2B 2J0JA 1UEFA 1P5TA 2DYNA 2L2IA 2EMSA 3IVFA 2Q13A 1GG3A 1J19A 2NZ8B 1TQZA 1ZVRA 3ML4A 1LB1A 1WJMA 1WGQA 1LW3A 1QC6A 2I5FA 4HDQA 3N7CA 4WVFB 5C79A 1Q67A 1I2HA 1X11A 1H4RA 1M7EA 4HAWB 2GCJA 4DX8A 1AWEA 2KCJA 4MK0A 2X18A 5J3QA 4MT7A 1E5WA 1PFJA 1BAKA 3WA0A 2VRWB 4HHVA 4PNKA 5LONB 3GYPA 4EMOA 3BJIA 3F5RA 2CRFA 4B6HA 1Y5OA 2R0DA 2D2QA 2LOZA 2UVMA 4BBKA 2N23A 4F7HA 1UPQA 4IAPA 2E2XA 2LG1A 2AL6A 2DFKA 2I1JA 3QWMA 5KQ1A 2YT0A 2DLWA 1WJ1A 2DYQA 1U5GA 1ZC3B 2G35A 2D9WA 3V5WA 5FI0A 1ZM0A 1RJ2A 3P7ZA 4KHBB 3CIKA 2YS3A 3SNHA 1X86A 2RSGA 1WGUA 1SHCA 1MAIA 2YT1A 1UNRA 2M38A 4KAXB 4K17A 4D0NB 5D3YA 2RNRB 1GC7A 3LJUX 2D9YA 1OMWA 2NMBA 1P3RA 2COCA 2DN6A 4MY6A 1PMSA 3NSUA 1BWNA 3HK0A 4H8SA 1H10A 1W1GA 1NI2A 4GPTB 1V5PA 3FM8C 2VKIA 3QIJA 3F0WA 2K2JA 2EJ8A 3U8ZA 1FB8A 1V89A 1PLSA 2DHKA 4F7GA 1WVHA 1NU2A 1V5UA 5KCVA 4HDOA 2LYDA 4P7IA 5JHHA 2K00A 4A5KA 1P6SA 2YS1A 2Z0QA 2L1CA 2DKQA 4KVGB 2DKPA 1DDVA 2HE7A 3U7DA 3T06A 1EGXA 1Z87A 3P6AA 4F7UP 1X1GA 5C16A 1DROA 4IFSA 3SV1A 3RCPA 3DXDA 3D8DA 1X05A 5EFXA 4GN1A 2W2XC 5D3VA 2QKLA 2HTHB 2RUKB 2YRYA 3AJ4A 4TKNA 3KZ1A 4GMXB 2D9VA 2DHJA 4HAXB 2ADZA 1TJ6A 2CAYA 1MK9B 3DXCA 3OANA 3KRWA 2I1KA 2Y7BA 2YSZA 2DX5A 4DXAB 2P0HA 3ODWA 3FEHA 1WG7A 4KHOA 5CLQB 2D9XA 2DX1A 1U5DA 2OTXA 1X1FA 2LKOA 1MKEA 2QKMA 3KRXA 2EMTA 5DHFB 1BTKA 4GMVA 2RVBB 1M7RA 3KSYA 1K5GB 3ULCA 3TCAA 3DXEA 1XKEA 1DYNA 2K2UA 1UNQA 4K2OA 3QBVB 3GYOA 4HAVB 2YS5A 2BCJA 4HAZB 4EKUA 4CYEA 3UZTA 1XR0B 4WSFA 3M1IB 4YL8A 2J0MA 2P8VA 1FGZA 4ZRKA 1SGHA 2Z0OA 4ZRIA 5D3XA 1RRPB 2H7EA 1AQCA 5HE0A 3ZVRA 2W2XD 1DDMA 3ODXA 4TYZA 2DTCA 3PVUA 1U27A 3SYXA 1TXDA 2D4QA 3A8QA 1OY2A 3PG7A 4C0AA 2LULA 1KI1B 3PVWA 4PQ0A 2ELAA 3FSSA 5D27A 2V76A 1IRSA 2Y8GA 2MWNB 5FI1A 2ZPYA 4HB3B 2D11A 2GCLA 3PP2A 1ZSQA 2DHIA 4A6FB 3ULBA 4CHJA 3G9WA 3ODOA 2CY4A 2J59M 4EJNA 2N0YA 2CODA 5J3YA 4KHAA 4DX90 2W2WA 4NSWA 4Z2MB 3SO6A 2UZRA 3TFMA 2COAA 3PSCA 5C5BB 4GXBA 4ZRJA 4L6EA 4HAUB 2JP2A 3AU4A 2UZSA 1B55A 3MPXA 5CLLB 1U5FA 1N3HA 1J0WA 5JHGA 4GZUA 4XWXA 1MPHA 2ROVA 1FHXA 2AEHA 1KZ7A 3ZDTA 1I7AA 5GOWB 3TVVA 1Y19B 1XCGA 4HB0B 1V61A 2D10A 1OQNA 1W1HA 2IFSA 1UPRA 3X23A 2H7DA 2VSZA 2GS0A 2EC1A 4DBBA 5HE3A 4Z2NA 4HATB 1V88A 3MDBC 5HE2A 1KZGA 2KGXB 3PEGA 2IYBA 2CY5A 1BTNA 4HB2B 2R09A 1MIZB 5JLJB 2FJLA 5DHAB 5DIFB 3D8FA 1WI1A 1V5MA 1EAZA 2OQBA 2YVCA 2ELBA 4A6FA 1MIXA 5J3TA 1FHOA 1QQGA 2MFQA 3CXBB 4K2PA 1NTVA 3TO1A 3KY9A 4NY0A 1FGYA 4HAYB 4YONA 3VOQA 5D3WA 1ZC4B 1FHWA 4HB4B 2J0KA 5DI9B 1DDWA 2LOXA 3VIAA 5HE1A 3A8PA 2GJYA 5C5BA 1MK7B 2COFA 2DA0A 1UNPA 2MDXA 2MKRA 2RGNB 3D8EA 5KQ4A 1DBHA 1U29A 3HQCA 5JP4A 1U2BA 1FOEA 5L81A 1ISNA 3AU5A 5C6RA 4A6HA 2KUPA 1XODA 3SUZA 1K5DB 3PZDA 4WJ7A 1NTYA 2ROZB 5LOPB 2RLOA 2PZ1A 2P0DA 3PVLA 4A6KA 2M14A 2Y8FA 2D9ZA 2Z0PA 1EVHA 3O96A 4CHMA 4Y94A 1FAOA 1XX0A 3TW1A 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOY X;  1EF1 A;  2P0F A;  1U5E A;  3WYF B;  2XQN M;  1XD4 A;  4K81 A;  2I5C A;  5DH9 B;  1W1D A;  1GC6 A;  2YF0 A;  3A98 B;  3HW2 B;  2J0J A;  1UEF A;  1P5T A;  2DYN A;  2L2I A;  2EMS A;  3IVF A;  2Q13 A;  1GG3 A;  1J19 A;  2NZ8 B;  1TQZ A;  1ZVR A;  3ML4 A;  1LB1 A;  1WJM A;  1WGQ A;  1LW3 A;  1QC6 A;  2I5F A;  4HDQ A;  3N7C A;  4WVF B;  5C79 A;  1Q67 A;  1I2H A;  1X11 A;  1H4R A;  1M7E A;  4HAW B;  2GCJ A;  4DX8 A;  1AWE A;  2KCJ A;  4MK0 A;  2X18 A;  5J3Q A;  4MT7 A;  1E5W A;  1PFJ A;  1BAK A;  3WA0 A;  2VRW B;  4HHV A;  4PNK A;  5LON B;  3GYP A;  4EMO A;  3BJI A;  3F5R A;  2CRF A;  4B6H A;  1Y5O A;  2R0D A;  2D2Q A;  2LOZ A;  2UVM A;  4BBK A;  2N23 A;  4F7H A;  1UPQ A;  4IAP A;  2E2X A;  2LG1 A;  2AL6 A;  2DFK A;  2I1J A;  3QWM A;  5KQ1 A;  2YT0 A;  2DLW A;  1WJ1 A;  2DYQ A;  1U5G A;  1ZC3 B;  2G35 A;  2D9W A;  3V5W A;  5FI0 A;  1ZM0 A;  1RJ2 A;  3P7Z A;  4KHB B;  3CIK A;  2YS3 A;  3SNH A;  1X86 A;  2RSG A;  1WGU A;  1SHC A;  1MAI A;  2YT1 A;  1UNR A;  2M38 A;  4KAX B;  4K17 A;  4D0N B;  5D3Y A;  2RNR B;  1GC7 A;  3LJU X;  2D9Y A;  1OMW A;  2NMB A;  1P3R A;  2COC A;  2DN6 A;  4MY6 A;  1PMS A;  3NSU A;  1BWN A;  3HK0 A;  4H8S A;  1H10 A;  1W1G A;  1NI2 A;  4GPT B;  1V5P A;  3FM8 C;  2VKI A;  3QIJ A;  3F0W A;  2K2J A;  2EJ8 A;  3U8Z A;  1FB8 A;  1V89 A;  1PLS A;  2DHK A;  4F7G A;  1WVH A;  1NU2 A;  1V5U A;  5KCV A;  4HDO A;  2LYD A;  4P7I A;  5JHH A;  2K00 A;  4A5K A;  1P6S A;  2YS1 A;  2Z0Q A;  2L1C A;  2DKQ A;  4KVG B;  2DKP A;  1DDV A;  2HE7 A;  3U7D A;  3T06 A;  1EGX A;  1Z87 A;  3P6A A;  4F7U P;  1X1G A;  5C16 A;  1DRO A;  4IFS A;  3SV1 A;  3RCP A;  3DXD A;  3D8D A;  1X05 A;  5EFX A;  4GN1 A;  2W2X C;  5D3V A;  2QKL A;  2HTH B;  2RUK B;  2YRY A;  3AJ4 A;  4TKN A;  3KZ1 A;  4GMX B;  2D9V A;  2DHJ A;  4HAX B;  2ADZ A;  1TJ6 A;  2CAY A;  1MK9 B;  3DXC A;  3OAN A;  3KRW A;  2I1K A;  2Y7B A;  2YSZ A;  2DX5 A;  4DXA B;  2P0H A;  3ODW A;  3FEH A;  1WG7 A;  4KHO A;  5CLQ B;  2D9X A;  2DX1 A;  1U5D A;  2OTX A;  1X1F A;  2LKO A;  1MKE A;  2QKM A;  3KRX A;  2EMT A;  5DHF B;  1BTK A;  4GMV A;  2RVB B;  1M7R A;  3KSY A;  1K5G B;  3ULC A;  3TCA A;  3DXE A;  1XKE A;  1DYN A;  2K2U A;  1UNQ A;  4K2O A;  3QBV B;  3GYO A;  4HAV B;  2YS5 A;  2BCJ A;  4HAZ B;  4EKU A;  4CYE A;  3UZT A;  1XR0 B;  4WSF A;  3M1I B;  4YL8 A;  2J0M A;  2P8V A;  1FGZ A;  4ZRK A;  1SGH A;  2Z0O A;  4ZRI A;  5D3X A;  1RRP B;  2H7E A;  1AQC A;  5HE0 A;  3ZVR A;  2W2X D;  1DDM A;  3ODX A;  4TYZ A;  2DTC A;  3PVU A;  1U27 A;  3SYX A;  1TXD A;  2D4Q A;  3A8Q A;  1OY2 A;  3PG7 A;  4C0A A;  2LUL A;  1KI1 B;  3PVW A;  4PQ0 A;  2ELA A;  3FSS A;  5D27 A;  2V76 A;  1IRS A;  2Y8G A;  2MWN B;  5FI1 A;  2ZPY A;  4HB3 B;  2D11 A;  2GCL A;  3PP2 A;  1ZSQ A;  2DHI A;  4A6F B;  3ULB A;  4CHJ A;  3G9W A;  3ODO A;  2CY4 A;  2J59 M;  4EJN A;  2N0Y A;  2COD A;  5J3Y A;  4KHA A;  4DX9 0;  2W2W A;  4NSW A;  4Z2M B;  3SO6 A;  2UZR A;  3TFM A;  2COA A;  3PSC A;  5C5B B;  4GXB A;  4ZRJ A;  4L6E A;  4HAU B;  2JP2 A;  3AU4 A;  2UZS A;  1B55 A;  3MPX A;  5CLL B;  1U5F A;  1N3H A;  1J0W A;  5JHG A;  4GZU A;  4XWX A;  1MPH A;  2ROV A;  1FHX A;  2AEH A;  1KZ7 A;  3ZDT A;  1I7A A;  5GOW B;  3TVV A;  1Y19 B;  1XCG A;  4HB0 B;  1V61 A;  2D10 A;  1OQN A;  1W1H A;  2IFS A;  1UPR A;  3X23 A;  2H7D A;  2VSZ A;  2GS0 A;  2EC1 A;  4DBB A;  5HE3 A;  4Z2N A;  4HAT B;  1V88 A;  3MDB C;  5HE2 A;  1KZG A;  2KGX B;  3PEG A;  2IYB A;  2CY5 A;  1BTN A;  4HB2 B;  2R09 A;  1MIZ B;  5JLJ B;  2FJL A;  5DHA B;  5DIF B;  3D8F A;  1WI1 A;  1V5M A;  1EAZ A;  2OQB A;  2YVC A;  2ELB A;  4A6F A;  1MIX A;  5J3T A;  1FHO A;  1QQG A;  2MFQ A;  3CXB B;  4K2P A;  1NTV A;  3TO1 A;  3KY9 A;  4NY0 A;  1FGY A;  4HAY B;  4YON A;  3VOQ A;  5D3W A;  1ZC4 B;  1FHW A;  4HB4 B;  2J0K A;  5DI9 B;  1DDW A;  2LOX A;  3VIA A;  5HE1 A;  3A8P A;  2GJY A;  5C5B A;  1MK7 B;  2COF A;  2DA0 A;  1UNP A;  2MDX A;  2MKR A;  2RGN B;  3D8E A;  5KQ4 A;  1DBH A;  1U29 A;  3HQC A;  5JP4 A;  1U2B A;  1FOE A;  5L81 A;  1ISN A;  3AU5 A;  5C6R A;  4A6H A;  2KUP A;  1XOD A;  3SUZ A;  1K5D B;  3PZD A;  4WJ7 A;  1NTY A;  2ROZ B;  5LOP B;  2RLO A;  2PZ1 A;  2P0D A;  3PVL A;  4A6K A;  2M14 A;  2Y8F A;  2D9Z A;  2Z0P A;  1EVH A;  3O96 A;  4CHM A;  4Y94 A;  1FAO A;  1XX0 A;  3TW1 A;  3BIN A; 
#chains in the Genus database with same CATH topology
 4IOY X;  2KR0 A;  4QXA B;  1EF1 A;  2KIG A;  2P0F A;  1U5E A;  3WYF B;  2XQN M;  1XD4 A;  4K81 A;  2I5C A;  5M4Y B;  5DH9 B;  1W1D A;  1GC6 A;  3NWA A;  4HSI A;  2YF0 A;  3A98 B;  3HW2 B;  2J0J A;  1UEF A;  1P5T A;  2DYN A;  5IRS A;  2L2I A;  2EMS A;  3IVF A;  2Q13 A;  1GG3 A;  1J19 A;  2NZ8 B;  1TQZ A;  1ZVR A;  3ML4 A;  1LB1 A;  4QJ5 B;  1WJM A;  1WGQ A;  1LW3 A;  1QC6 A;  2I5F A;  4HDQ A;  3N7C A;  4WVF B;  5C79 A;  1Q67 A;  1I2H A;  1X11 A;  1H4R A;  1M7E A;  4HAW B;  2GCJ A;  4DX8 A;  1AWE A;  2KCJ A;  4MK0 A;  2X18 A;  5J3Q A;  4MT7 A;  1E5W A;  1PFJ A;  1BAK A;  3WA0 A;  2VRW B;  4HHV A;  4PNK A;  5LON B;  3GYP A;  4D6W A;  3NWD A;  3BJI A;  4EMO A;  3F5R A;  2CRF A;  4B6H A;  1Y5O A;  2R0D A;  2D2Q A;  2LOZ A;  2UVM A;  4BBK A;  2N23 A;  4F7H A;  1UPQ A;  4IAP A;  2E2X A;  2LG1 A;  2AL6 A;  2DFK A;  2I1J A;  3QWM A;  5KQ1 A;  2YT0 A;  2DLW A;  1WJ1 A;  2DYQ A;  1U5G A;  1ZC3 B;  4L1R A;  2G35 A;  2D9W A;  3V5W A;  5FI0 A;  1ZM0 A;  1RJ2 A;  3P7Z A;  4KHB B;  3CIK A;  2YS3 A;  3SNH A;  1X86 A;  2RSG A;  1WGU A;  1SHC A;  1MAI A;  2YT1 A;  1UNR A;  2M38 A;  4KAX B;  2ZKM X;  4K17 A;  4D0N B;  5D3Y A;  2RNR B;  1GC7 A;  3LJU X;  2R2Y A;  2D9Y A;  1OMW A;  2NMB A;  1P3R A;  2COC A;  2DN6 A;  4MY6 A;  1PMS A;  3NSU A;  1BWN A;  3HK0 A;  4H8S A;  3DCX A;  1H10 A;  1W1G A;  1NI2 A;  4GPT B;  1V5P A;  3FM8 C;  2VKI A;  3QIJ A;  3F0W A;  3NW8 A;  2K2J A;  2EJ8 A;  2Z13 A;  3U8Z A;  1FB8 A;  1V89 A;  1PLS A;  2DHK A;  4GNK B;  4F7G A;  1WVH A;  1NU2 A;  1V5U A;  5KCV A;  4HDO A;  2LYD A;  4P7I A;  5JHH A;  2Z59 A;  5LG4 B;  2K00 A;  4A5K A;  1P6S A;  2YS1 A;  2Z0Q A;  2L1C A;  2DKQ A;  4KVG B;  2DKP A;  1DDV A;  2HE7 A;  3OHM B;  3U7D A;  3T06 A;  1EGX A;  1Z87 A;  3P6A A;  4F7U P;  1X1G A;  5C16 A;  1DRO A;  4IFS A;  3SV1 A;  3RCP A;  3DXD A;  3D8D A;  1X05 A;  5EFX A;  4GN1 A;  2W2X C;  5D3V A;  2QKL A;  2HTH B;  2RUK B;  4OSN A;  2YRY A;  3AJ4 A;  4TKN A;  3KZ1 A;  4GMX B;  2D9V A;  2DHJ A;  4HAX B;  2ADZ A;  4KHB A;  1TJ6 A;  2CAY A;  1MK9 B;  3DXC A;  3OAN A;  2FJU B;  3KRW A;  2I1K A;  2Y7B A;  2YSZ A;  2DX5 A;  4DXA B;  2P0H A;  3ODW A;  2YT2 A;  3FEH A;  1WG7 A;  4KHO A;  5CLQ B;  2D9X A;  2DX1 A;  1U5D A;  2OTX A;  2KIE A;  1X1F A;  4CSQ A;  2LKO A;  1MKE A;  2QKM A;  3KRX A;  2EMT A;  5DHF B;  1BTK A;  4GMV A;  2RVB B;  3HSA A;  1M7R A;  3KSY A;  1K5G B;  3ULC A;  3TCA A;  3DXE A;  1XKE A;  1DYN A;  2K2U A;  1UNQ A;  4K2O A;  5I2M A;  3QBV B;  3GYO A;  4HAV B;  2YS5 A;  2BCJ A;  4HAZ B;  4EKU A;  4CYE A;  3UZT A;  1XR0 B;  4WSF A;  3M1I B;  4YL8 A;  2J0M A;  4QJ3 B;  2P8V A;  1FGZ A;  4ZRK A;  1SGH A;  2Z0O A;  4ZRI A;  5D3X A;  1RRP B;  2H7E A;  1AQC A;  5HE0 A;  3ZVR A;  2W2X D;  1DDM A;  3ODX A;  4TYZ A;  2DTC A;  3PVU A;  1U27 A;  3SYX A;  1TXD A;  2D4Q A;  3A8Q A;  1OY2 A;  3PG7 A;  4C0A A;  2LUL A;  1KI1 B;  3PVW A;  4PQ0 A;  2ELA A;  3FSS A;  5D27 A;  2V76 A;  1IRS A;  2Y8G A;  2MWN B;  5FI1 A;  2ZPY A;  4HB3 B;  2D11 A;  2GCL A;  3PP2 A;  1ZSQ A;  2DHI A;  4A6F B;  3ULB A;  4CHJ A;  4QJ4 B;  3G9W A;  3ODO A;  2CY4 A;  2J59 M;  3B77 A;  4EJN A;  4DIX A;  2N0Y A;  2COD A;  2KUQ A;  2K8E A;  5J3Y A;  4KHA A;  4DX9 0;  2W2W A;  4NSW A;  4Z2M B;  3SO6 A;  2UZR A;  3TFM A;  2GUM A;  2COA A;  3PSC A;  5C5B B;  4GXB A;  4ZRJ A;  4L6E A;  4HAU B;  2JP2 A;  3AU4 A;  2UZS A;  1B55 A;  2Z14 A;  3MPX A;  5CLL B;  1U5F A;  1N3H A;  1J0W A;  5JHG A;  4GZU A;  4XWX A;  1MPH A;  2ROV A;  1FHX A;  2AEH A;  1KZ7 A;  3ZDT A;  1I7A A;  5GOW B;  3TVV A;  3FVC A;  1Y19 B;  1XCG A;  4HB0 B;  1V61 A;  2D10 A;  1OQN A;  1T77 A;  1W1H A;  2IFS A;  1UPR A;  3X23 A;  2H7D A;  2VSZ A;  2GS0 A;  5I2S A;  2EC1 A;  4DBB A;  4GOU A;  5HE3 A;  4Z2N A;  4HAT B;  1V88 A;  3MDB C;  5HE2 A;  1KZG A;  2KGX B;  3PEG A;  2IYB A;  2CY5 A;  3HIE A;  2NBV A;  1BTN A;  3U12 A;  4HB2 B;  2R09 A;  1MIZ B;  5JLJ B;  3NWF A;  2FJL A;  5DHA B;  5DIF B;  3D8F A;  1WI1 A;  1V5M A;  1EAZ A;  2OQB A;  2YVC A;  2ELB A;  4A6F A;  1MIX A;  5J3T A;  1FHO A;  1ZYI A;  1QQG A;  2MFQ A;  3CXB B;  4K2P A;  1NTV A;  3TO1 A;  3KY9 A;  4NY0 A;  1FGY A;  4HAY B;  4YON A;  3VOQ A;  5D3W A;  1ZC4 B;  1FHW A;  4HB4 B;  2J0K A;  5DI9 B;  1DDW A;  2LOX A;  3VIA A;  5HE1 A;  3A8P A;  2GJY A;  5C5B A;  1MK7 B;  2COF A;  2DA0 A;  1UNP A;  2K49 A;  2MDX A;  2Z4D A;  2MKR A;  2RGN B;  3D8E A;  5KQ4 A;  1DBH A;  1U29 A;  3HQC A;  5JP4 A;  1U2B A;  1FOE A;  5L81 A;  1ISN A;  3AU5 A;  5C6R A;  4A6H A;  2KUP A;  1XOD A;  3SUZ A;  1K5D B;  3PZD A;  4WJ7 A;  1NTY A;  2ROZ B;  5LOP B;  2RLO A;  2PZ1 A;  2P0D A;  3PVL A;  4A6K A;  2M14 A;  2Y8F A;  4OT1 A;  2D9Z A;  2Z0P A;  1EVH A;  3O96 A;  4CHM A;  3A58 A;  4Y94 A;  1FAO A;  1XX0 A;  3TW1 A;  2RRF A;  3BIN A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 4IOY X;  1EF1 A;  2P0F A;  1U5E A;  3WYF B;  2XQN M;  1XD4 A;  4K81 A;  2I5C A;  5DH9 B;  1W1D A;  1GC6 A;  2YF0 A;  3A98 B;  3HW2 B;  2J0J A;  1UEF A;  1P5T A;  2DYN A;  2L2I A;  2EMS A;  3IVF A;  2Q13 A;  1GG3 A;  1J19 A;  2NZ8 B;  1TQZ A;  1ZVR A;  3ML4 A;  1LB1 A;  1WJM A;  1WGQ A;  1LW3 A;  1QC6 A;  2I5F A;  4HDQ A;  3N7C A;  4WVF B;  5C79 A;  1Q67 A;  1I2H A;  1X11 A;  1H4R A;  1M7E A;  4HAW B;  2GCJ A;  4DX8 A;  1AWE A;  2KCJ A;  4MK0 A;  2X18 A;  5J3Q A;  4MT7 A;  1E5W A;  1PFJ A;  1BAK A;  3WA0 A;  2VRW B;  4HHV A;  4PNK A;  5LON B;  3GYP A;  4EMO A;  3BJI A;  3F5R A;  2CRF A;  4B6H A;  1Y5O A;  2R0D A;  2D2Q A;  2LOZ A;  2UVM A;  4BBK A;  2N23 A;  4F7H A;  1UPQ A;  4IAP A;  2E2X A;  2LG1 A;  2AL6 A;  2DFK A;  2I1J A;  3QWM A;  5KQ1 A;  2YT0 A;  2DLW A;  1WJ1 A;  2DYQ A;  1U5G A;  1ZC3 B;  2G35 A;  2D9W A;  3V5W A;  5FI0 A;  1ZM0 A;  1RJ2 A;  3P7Z A;  4KHB B;  3CIK A;  2YS3 A;  3SNH A;  1X86 A;  2RSG A;  1WGU A;  1SHC A;  1MAI A;  2YT1 A;  1UNR A;  2M38 A;  4KAX B;  4K17 A;  4D0N B;  5D3Y A;  2RNR B;  1GC7 A;  3LJU X;  2D9Y A;  1OMW A;  2NMB A;  1P3R A;  2COC A;  2DN6 A;  4MY6 A;  1PMS A;  3NSU A;  1BWN A;  3HK0 A;  4H8S A;  1H10 A;  1W1G A;  1NI2 A;  4GPT B;  1V5P A;  3FM8 C;  2VKI A;  3QIJ A;  3F0W A;  2K2J A;  2EJ8 A;  3U8Z A;  1FB8 A;  1V89 A;  1PLS A;  2DHK A;  4F7G A;  1WVH A;  1NU2 A;  1V5U A;  5KCV A;  4HDO A;  2LYD A;  4P7I A;  5JHH A;  2K00 A;  4A5K A;  1P6S A;  2YS1 A;  2Z0Q A;  2L1C A;  2DKQ A;  4KVG B;  2DKP A;  1DDV A;  2HE7 A;  3U7D A;  3T06 A;  1EGX A;  1Z87 A;  3P6A A;  4F7U P;  1X1G A;  5C16 A;  1DRO A;  4IFS A;  3SV1 A;  3RCP A;  3DXD A;  3D8D A;  1X05 A;  5EFX A;  4GN1 A;  2W2X C;  5D3V A;  2QKL A;  2HTH B;  2RUK B;  2YRY A;  3AJ4 A;  4TKN A;  3KZ1 A;  4GMX B;  2D9V A;  2DHJ A;  4HAX B;  2ADZ A;  1TJ6 A;  2CAY A;  1MK9 B;  3DXC A;  3OAN A;  3KRW A;  2I1K A;  2Y7B A;  2YSZ A;  2DX5 A;  4DXA B;  2P0H A;  3ODW A;  3FEH A;  1WG7 A;  4KHO A;  5CLQ B;  2D9X A;  2DX1 A;  1U5D A;  2OTX A;  1X1F A;  2LKO A;  1MKE A;  2QKM A;  3KRX A;  2EMT A;  5DHF B;  1BTK A;  4GMV A;  2RVB B;  1M7R A;  3KSY A;  1K5G B;  3ULC A;  3TCA A;  3DXE A;  1XKE A;  1DYN A;  2K2U A;  1UNQ A;  4K2O A;  3QBV B;  3GYO A;  4HAV B;  2YS5 A;  2BCJ A;  4HAZ B;  4EKU A;  4CYE A;  3UZT A;  1XR0 B;  4WSF A;  3M1I B;  4YL8 A;  2J0M A;  2P8V A;  1FGZ A;  4ZRK A;  1SGH A;  2Z0O A;  4ZRI A;  5D3X A;  1RRP B;  2H7E A;  1AQC A;  5HE0 A;  3ZVR A;  2W2X D;  1DDM A;  3ODX A;  4TYZ A;  2DTC A;  3PVU A;  1U27 A;  3SYX A;  1TXD A;  2D4Q A;  3A8Q A;  1OY2 A;  3PG7 A;  4C0A A;  2LUL A;  1KI1 B;  3PVW A;  4PQ0 A;  2ELA A;  3FSS A;  5D27 A;  2V76 A;  1IRS A;  2Y8G A;  2MWN B;  5FI1 A;  2ZPY A;  4HB3 B;  2D11 A;  2GCL A;  3PP2 A;  1ZSQ A;  2DHI A;  4A6F B;  3ULB A;  4CHJ A;  3G9W A;  3ODO A;  2CY4 A;  2J59 M;  4EJN A;  2N0Y A;  2COD A;  5J3Y A;  4KHA A;  4DX9 0;  2W2W A;  4NSW A;  4Z2M B;  3SO6 A;  2UZR A;  3TFM A;  2COA A;  3PSC A;  5C5B B;  4GXB A;  4ZRJ A;  4L6E A;  4HAU B;  2JP2 A;  3AU4 A;  2UZS A;  1B55 A;  3MPX A;  5CLL B;  1U5F A;  1N3H A;  1J0W A;  5JHG A;  4GZU A;  4XWX A;  1MPH A;  2ROV A;  1FHX A;  2AEH A;  1KZ7 A;  3ZDT A;  1I7A A;  5GOW B;  3TVV A;  1Y19 B;  1XCG A;  4HB0 B;  1V61 A;  2D10 A;  1OQN A;  1W1H A;  2IFS A;  1UPR A;  3X23 A;  2H7D A;  2VSZ A;  2GS0 A;  2EC1 A;  4DBB A;  5HE3 A;  4Z2N A;  4HAT B;  1V88 A;  3MDB C;  5HE2 A;  1KZG A;  2KGX B;  3PEG A;  2IYB A;  2CY5 A;  1BTN A;  4HB2 B;  2R09 A;  1MIZ B;  5JLJ B;  2FJL A;  5DHA B;  5DIF B;  3D8F A;  1WI1 A;  1V5M A;  1EAZ A;  2OQB A;  2YVC A;  2ELB A;  4A6F A;  1MIX A;  5J3T A;  1FHO A;  1QQG A;  2MFQ A;  3CXB B;  4K2P A;  1NTV A;  3TO1 A;  3KY9 A;  4NY0 A;  1FGY A;  4HAY B;  4YON A;  3VOQ A;  5D3W A;  1ZC4 B;  1FHW A;  4HB4 B;  2J0K A;  5DI9 B;  1DDW A;  2LOX A;  3VIA A;  5HE1 A;  3A8P A;  2GJY A;  5C5B A;  1MK7 B;  2COF A;  2DA0 A;  1UNP A;  2MDX A;  2MKR A;  2RGN B;  3D8E A;  5KQ4 A;  1DBH A;  1U29 A;  3HQC A;  5JP4 A;  1U2B A;  1FOE A;  5L81 A;  1ISN A;  3AU5 A;  5C6R A;  4A6H A;  2KUP A;  1XOD A;  3SUZ A;  1K5D B;  3PZD A;  4WJ7 A;  1NTY A;  2ROZ B;  5LOP B;  2RLO A;  2PZ1 A;  2P0D A;  3PVL A;  4A6K A;  2M14 A;  2Y8F A;  2D9Z A;  2Z0P A;  1EVH A;  3O96 A;  4CHM A;  4Y94 A;  1FAO A;  1XX0 A;  3TW1 A;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...