2MFQA

Nmr solution structures of frs2a ptb domain with neurotrophin receptor trkb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
SHMDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into FRS2 alpha PTB domain recognition by neurotrophin receptor TrkB.
pubmed doi rcsb
molecule keywords Fibroblast growth factor receptor substrate 2
molecule tags Transferase
source organism Homo sapiens
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mfqA00
2EC1A 4C0AA 4PNKA 2NMBA 4A6KA 1MK7B 1FHOA 3AJ4A 2K2JA 1XD4A 2YVCA 1SGHA 3TFMA 2P0HA 1GG3A 2COCA 2LOZA 1RRPB 2I1JA 3VIAA 3QIJA 4Z2MB 4KVGB 4HHVA 4IFSA 1V88A 2D9XA 5KQ1A 1E5WA 4ZRKA 3A8QA 1V61A 2CODA 4KHBB 1WJMA 5GOWB 1BTNA 3FSSA 3F5RA 1ZC4B 2K2UA 4WSFA 3QWMA 3ULCA 1PLSA 2RGNB 5HE1A 2H7EA 5JHGA 2LKOA 5DHAB 4IAPA 1J19A 1EVHA 1ISNA 3TO1A 1H10A 2DFKA 4NY0A 2FJLA 3DXDA 4DBBA 2DHJA 1QC6A 2AEHA 2DX1A 1BWNA 4KHOA 5D3XA 2Q13A 4ZRIA 3TW1A 3GYOA 1PMSA 3WA0A 3FEHA 3G9WA 5C6RA 4GPTB 1UNRA 2YT1A 1W1DA 5FI0A 4B6HA 1RJ2A 1XODA 1WVHA 4GMVA 5HE2A 3QBVB 5D3YA 5C79A 2RLOA 4HAVB 1U5DA 2MDXA 2ELAA 4EJNA 1ZVRA 1TQZA 1WJ1A 1FHWA 3P7ZA 3ODOA 2DTCA 2VKIA 1P6SA 2LULA 1OY2A 1ZC3B 4HAWB 1LW3A 1N3HA 1W1GA 1QQGA 2DLWA 5DH9B 2MKRA 3DXCA 1XR0B 3T06A 5DIFB 3KZ1A 3A98B 2BCJA 5JHHA 3CXBB 4HATB 2D4QA 2M14A 4XWXA 2D2QA 3P6AA 1M7RA 3RCPA 1V5PA 2ADZA 2D9ZA 2GCJA 1W1HA 1MIZB 3ODWA 1DDMA 3PP2A 1V5MA 1U5FA 1MKEA 3ULBA 2GJYA 2I1KA 1DDVA 2D9WA 1NTYA 2Y7BA 2RSGA 3SUZA 4DX90 4F7GA 4EKUA 2DYNA 2IYBA 2DHIA 3KRXA 2GS0A 2Y8FA 4Y94A 1AQCA 3KRWA 4YONA 5D3WA 3DXEA 3HQCA 4TKNA 2DHKA 5FI1A 2OQBA 2PZ1A 2HE7A 3PVLA 1SHCA 4HAXB 5LONB 4WJ7A 3AU4A 2P8VA 3ML4A 2D9YA 5D3VA 2Z0PA 1P3RA 2JP2A 1NTVA 5DI9B 3KY9A 4A5KA 2E2XA 1X11A 2J0JA 5KQ4A 4WVFB 2R09A 2OTXA 2MFQA 4HB0B 1V5UA 3PZDA 1LB1A 4DXAB 3WYFB 1FAOA 2W2XD 2RUKB 4K2OA 2EMSA 4CHMA 5C5BA 5EFXA 2LOXA 1I7AA 5J3TA 4GXBA 2COAA 2Z0OA 1ZSQA 3MPXA 4ZRJA 4GN1A 2VRWB 2YRYA 2R0DA 2X18A 1X05A 3NSUA 3PVUA 1U2BA 1UPQA 1PFJA 1XX0A 4A6HA 5LOPB 4HDOA 3CIKA 2CY5A 1FGZA 4MY6A 1MPHA 4KAXB 4F7UP 2ELBA 2I5CA 3SO6A 2RNRB 1DYNA 4IOYX 3SYXA 1DDWA 4GMXB 4F7HA 5DHFB 3U8ZA 4DX8A 3PEGA 5J3QA 3U7DA 2KCJA 4CHJA 2YS3A 2Z0QA 2QKMA 5C5BB 1MK9B 3VOQA 2K00A 4HDQA 3SNHA 3M1IB 3PVWA 1KI1B 2J0MA 2DKPA 2G35A 4HAUB 2AL6A 2LG1A 3TCAA 4K2PA 1WGUA 4YL8A 1OQNA 3D8FA 3BINA 1XCGA 1P5TA 1EF1A 1X86A 2KUPA 2M38A 1J0WA 1FHXA 1MAIA 2CRFA 2YT0A 2DYQA 3ODXA 2H7DA 3KSYA 5L81A 3AU5A 2P0DA 2UZSA 1I2HA 1Q67A 2N0YA 1FGYA 1Y19B 1EGXA 4EMOA 4A6FA 4GZUA 2W2XC 4L6EA 2J59M 5HE0A 4MK0A 1OMWA 2RVBB 2D11A 1Z87A 2ROVA 3F0WA 4MT7A 1NU2A 4NSWA 2L2IA 4CYEA 3HK0A 3V5WA 2CY4A 3LJUX 5D27A 1TJ6A 4HB2B 1XKEA 1ZM0A 4HAZB 1KZGA 1U5EA 1B55A 1Y5OA 3D8EA 3A8PA 3ZVRA 1U27A 2XQNM 3X23A 2W2WA 2YS5A 3FM8C 1BAKA 5HE3A 1UNQA 2YSZA 3OANA 5J3YA 1FB8A 3TVVA 4Z2NA 1WG7A 1K5GB 3SV1A 4K81A 4D0NB 1MIXA 2L1CA 2YS1A 4TYZA 1UPRA 2KGXB 3N7CA 2J0KA 1K5DB 2GCLA 5KCVA 1H4RA 2DN6A 4A6FB 2ROZB 2CAYA 3MDBC 2P0FA 3IVFA 5JLJB 1UEFA 1AWEA 3UZTA 1WGQA 2UVMA 2I5FA 5C16A 4KHAA 1GC6A 1BTKA 1EAZA 1GC7A 1V89A 4HB4B 5JP4A 2DKQA 2V76A 1TXDA 2MWNB 1M7EA 2D9VA 1DROA 1X1FA 2Y8GA 2ZPYA 2D10A 2COFA 4P7IA 3BJIA 1KZ7A 1X1GA 1DBHA 4PQ0A 1WI1A 3PSCA 2IFSA 1IRSA 3D8DA 1U5GA 2N23A 2DA0A 3ZDTA 1UNPA 5CLLB 2DX5A 3GYPA 2EJ8A 2YF0A 4HAYB 4K17A 2EMTA 4HB3B 4BBKA 2NZ8B 3PG7A 2QKLA 2UZRA 1FOEA 3O96A 2HTHB 5CLQB 1U29A 4H8SA 3HW2B 1NI2A 2VSZA 2LYDA
chains in the Genus database with same CATH superfamily
2EC1A 4C0AA 4PNKA 2NMBA 4A6KA 1MI1A 1MK7B 1FHOA 3AJ4A 2K2JA 1XD4A 2YVCA 1SGHA 3TFMA 2P0HA 1GG3A 2COCA 2LOZA 1RRPB 2I1JA 3VIAA 3QIJA 4Z2MB 4KVGB 4HHVA 4IFSA 4L1RA 1V88A 2D9XA 5KQ1A 1E5WA 4ZRKA 3A8QA 1V61A 2CODA 3NWDA 4KHBB 1WJMA 3B77A 5GOWB 1BTNA 3FSSA 3F5RA 3DCXA 1ZC4B 3NWAA 4QJ5B 2K2UA 4WSFA 3QWMA 3ULCA 1PLSA 2RGNB 2KIEA 2GUMA 5HE1A 2H7EA 5JHGA 2RRFA 2LKOA 5DHAB 3U12A 4IAPA 1J19A 1EVHA 1ISNA 3TO1A 1H10A 2DFKA 4NY0A 2FJLA 3DXDA 4DBBA 2DHJA 1QC6A 2AEHA 2DX1A 1BWNA 4KHOA 5D3XA 2Q13A 4OSNA 4ZRIA 3TW1A 3GYOA 1PMSA 3WA0A 3FEHA 3G9WA 2KIGA 5C6RA 4GPTB 2ZKMX 1UNRA 2YT1A 1W1DA 5FI0A 4B6HA 1RJ2A 1XODA 1WVHA 4GMVA 5HE2A 3QBVB 5D3YA 5C79A 2RLOA 4HAVB 1U5DA 3FVCA 2MDXA 2ELAA 4EJNA 1ZVRA 1TQZA 1WJ1A 1FHWA 3P7ZA 3ODOA 2DTCA 2VKIA 1P6SA 2LULA 1OY2A 1ZC3B 4HAWB 1LW3A 1N3HA 1W1GA 1QQGA 2DLWA 5DH9B 2MKRA 3DXCA 1XR0B 3T06A 4GNKB 5DIFB 3KZ1A 3A98B 2BCJA 5JHHA 3CXBB 4HATB 2D4QA 2M14A 4XWXA 2D2QA 3P6AA 1M7RA 5LG4B 3RCPA 1V5PA 2ADZA 2D9ZA 2GCJA 1W1HA 1MIZB 3ODWA 1DDMA 3PP2A 1V5MA 2K8EA 1U5FA 1MKEA 3ULBA 2GJYA 2I1KA 1DDVA 2D9WA 1NTYA 2Y7BA 2RSGA 3SUZA 4HSIA 4DX90 4F7GA 4EKUA 2DYNA 2IYBA 2DHIA 3KRXA 2GS0A 2Y8FA 4Y94A 1AQCA 3KRWA 4YONA 5D3WA 3DXEA 3HQCA 4TKNA 2DHKA 5FI1A 2OQBA 2PZ1A 2HE7A 3PVLA 1SHCA 4HAXB 5LONB 2NBVA 4WJ7A 3AU4A 2P8VA 3ML4A 2Z13A 2D9YA 5D3VA 2Z0PA 1P3RA 2JP2A 1NTVA 5DI9B 2K49A 3KY9A 4A5KA 2E2XA 1X11A 2J0JA 5KQ4A 4WVFB 2R09A 2OTXA 2MFQA 4HB0B 1V5UA 3PZDA 1LB1A 4DXAB 2KUQA 3WYFB 1FAOA 2W2XD 2RUKB 4K2OA 2EMSA 4CHMA 3HSAA 5C5BA 5EFXA 2LOXA 1I7AA 5J3TA 4GXBA 2COAA 2Z0OA 1ZSQA 3MPXA 4ZRJA 4GN1A 2VRWB 2YRYA 2R0DA 2X18A 1X05A 3NSUA 3PVUA 1U2BA 1UPQA 1PFJA 1XX0A 4A6HA 5LOPB 4HDOA 3CIKA 2CY5A 1FGZA 4QXAB 4MY6A 1MPHA 4KAXB 4DIXA 4F7UP 2ELBA 2I5CA 3SO6A 2RNRB 1DYNA 4IOYX 3A58A 3SYXA 1DDWA 4GMXB 4F7HA 5DHFB 3U8ZA 4DX8A 3PEGA 5J3QA 3U7DA 2KCJA 4CHJA 5I2MA 3OHMB 2YS3A 2Z0QA 2QKMA 5C5BB 1MK9B 3VOQA 2K00A 4HDQA 3SNHA 3M1IB 3PVWA 1KI1B 2J0MA 2DKPA 2G35A 4HAUB 2AL6A 2LG1A 3TCAA 4K2PA 1WGUA 4YL8A 1OQNA 4QJ3B 3D8FA 3NWFA 3BINA 1XCGA 1P5TA 1EF1A 1X86A 2KUPA 2M38A 1J0WA 1FHXA 1MAIA 2CRFA 2YT0A 2DYQA 3ODXA 2H7DA 3KSYA 5L81A 3AU5A 2P0DA 2UZSA 1I2HA 1Q67A 5IRSA 3HIEA 2N0YA 1FGYA 1Y19B 1EGXA 4EMOA 4A6FA 4GZUA 2W2XC 2YT2A 4L6EA 2J59M 5HE0A 4MK0A 1OMWA 2RVBB 2D11A 1Z87A 2ROVA 3F0WA 4MT7A 3NW8A 1NU2A 4NSWA 2L2IA 5I2SA 4CYEA 3HK0A 3V5WA 2CY4A 3LJUX 5D27A 1TJ6A 4HB2B 1XKEA 1ZM0A 4HAZB 1KZGA 1U5EA 1B55A 1Y5OA 3D8EA 3A8PA 3ZVRA 1ZYIA 1U27A 2XQNM 3X23A 2W2WA 2YS5A 3FM8C 1BAKA 5HE3A 1UNQA 2YSZA 3OANA 5J3YA 1FB8A 3TVVA 4GOUA 4Z2NA 1WG7A 1K5GB 5M4YB 3SV1A 4D6WA 4K81A 4D0NB 1MIXA 2L1CA 2YS1A 2KR0A 4TYZA 4OT1A 1UPRA 2KGXB 3N7CA 2J0KA 1K5DB 2GCLA 5KCVA 1H4RA 2DN6A 4A6FB 2ROZB 2CAYA 3MDBC 2P0FA 3IVFA 5JLJB 1UEFA 2R2YA 1AWEA 3UZTA 1WGQA 2UVMA 2I5FA 2Z14A 5C16A 4KHAA 1GC6A 1BTKA 1EAZA 1GC7A 1V89A 4HB4B 5JP4A 2DKQA 2V76A 2Z59A 2FJUB 1TXDA 2MWNB 1M7EA 2D9VA 1DROA 1X1FA 2Y8GA 2ZPYA 2D10A 2COFA 4P7IA 3BJIA 1KZ7A 1X1GA 1DBHA 4PQ0A 1WI1A 2Z4DA 3PSCA 2IFSA 1IRSA 3D8DA 1U5GA 2N23A 2DA0A 3ZDTA 1UNPA 5CLLB 2DX5A 3GYPA 2EJ8A 2YF0A 4KHBA 4HAYB 4K17A 2EMTA 4HB3B 4BBKA 2NZ8B 3PG7A 2QKLA 2UZRA 4CSQA 1FOEA 4QJ4B 3O96A 2HTHB 5CLQB 1U29A 4H8SA 3HW2B 1NI2A 1T77A 2VSZA 2LYDA
chains in the Genus database with same CATH topology
2EC1A 4C0AA 4PNKA 2NMBA 4A6KA 1MK7B 1FHOA 3AJ4A 2K2JA 1XD4A 2YVCA 1SGHA 3TFMA 2P0HA 1GG3A 2COCA 2LOZA 1RRPB 2I1JA 3VIAA 3QIJA 4Z2MB 4KVGB 4HHVA 4IFSA 1V88A 2D9XA 5KQ1A 1E5WA 4ZRKA 3A8QA 1V61A 2CODA 4KHBB 1WJMA 5GOWB 1BTNA 3FSSA 3F5RA 1ZC4B 2K2UA 4WSFA 3QWMA 3ULCA 1PLSA 2RGNB 5HE1A 2H7EA 5JHGA 2LKOA 5DHAB 4IAPA 1J19A 1EVHA 1ISNA 3TO1A 1H10A 2DFKA 4NY0A 2FJLA 3DXDA 4DBBA 2DHJA 1QC6A 2AEHA 2DX1A 1BWNA 4KHOA 5D3XA 2Q13A 4ZRIA 3TW1A 3GYOA 1PMSA 3WA0A 3FEHA 3G9WA 5C6RA 4GPTB 1UNRA 2YT1A 1W1DA 5FI0A 4B6HA 1RJ2A 1XODA 1WVHA 4GMVA 5HE2A 3QBVB 5D3YA 5C79A 2RLOA 4HAVB 1U5DA 2MDXA 2ELAA 4EJNA 1ZVRA 1TQZA 1WJ1A 1FHWA 3P7ZA 3ODOA 2DTCA 2VKIA 1P6SA 2LULA 1OY2A 1ZC3B 4HAWB 1LW3A 1N3HA 1W1GA 1QQGA 2DLWA 5DH9B 2MKRA 3DXCA 1XR0B 3T06A 5DIFB 3KZ1A 3A98B 2BCJA 5JHHA 3CXBB 4HATB 2D4QA 2M14A 4XWXA 2D2QA 3P6AA 1M7RA 3RCPA 1V5PA 2ADZA 2D9ZA 2GCJA 1W1HA 1MIZB 3ODWA 1DDMA 3PP2A 1V5MA 1U5FA 1MKEA 3ULBA 2GJYA 2I1KA 1DDVA 2D9WA 1NTYA 2Y7BA 2RSGA 3SUZA 4DX90 4F7GA 4EKUA 2DYNA 2IYBA 2DHIA 3KRXA 2GS0A 2Y8FA 4Y94A 1AQCA 3KRWA 4YONA 5D3WA 3DXEA 3HQCA 4TKNA 2DHKA 5FI1A 2OQBA 2PZ1A 2HE7A 3PVLA 1SHCA 4HAXB 5LONB 4WJ7A 3AU4A 2P8VA 3ML4A 2D9YA 5D3VA 2Z0PA 1P3RA 2JP2A 1NTVA 5DI9B 3KY9A 4A5KA 2E2XA 1X11A 2J0JA 5KQ4A 4WVFB 2R09A 2OTXA 2MFQA 4HB0B 1V5UA 3PZDA 1LB1A 4DXAB 3WYFB 1FAOA 2W2XD 2RUKB 4K2OA 2EMSA 4CHMA 5C5BA 5EFXA 2LOXA 1I7AA 5J3TA 4GXBA 2COAA 2Z0OA 1ZSQA 3MPXA 4ZRJA 4GN1A 2VRWB 2YRYA 2R0DA 2X18A 1X05A 3NSUA 3PVUA 1U2BA 1UPQA 1PFJA 1XX0A 4A6HA 5LOPB 4HDOA 3CIKA 2CY5A 1FGZA 4MY6A 1MPHA 4KAXB 4F7UP 2ELBA 2I5CA 3SO6A 2RNRB 1DYNA 4IOYX 3SYXA 1DDWA 4GMXB 4F7HA 5DHFB 3U8ZA 4DX8A 3PEGA 5J3QA 3U7DA 2KCJA 4CHJA 2YS3A 2Z0QA 2QKMA 5C5BB 1MK9B 3VOQA 2K00A 4HDQA 3SNHA 3M1IB 3PVWA 1KI1B 2J0MA 2DKPA 2G35A 4HAUB 2AL6A 2LG1A 3TCAA 4K2PA 1WGUA 4YL8A 1OQNA 3D8FA 3BINA 1XCGA 1P5TA 1EF1A 1X86A 2KUPA 2M38A 1J0WA 1FHXA 1MAIA 2CRFA 2YT0A 2DYQA 3ODXA 2H7DA 3KSYA 5L81A 3AU5A 2P0DA 2UZSA 1I2HA 1Q67A 2N0YA 1FGYA 1Y19B 1EGXA 4EMOA 4A6FA 4GZUA 2W2XC 4L6EA 2J59M 5HE0A 4MK0A 1OMWA 2RVBB 2D11A 1Z87A 2ROVA 3F0WA 4MT7A 1NU2A 4NSWA 2L2IA 4CYEA 3HK0A 3V5WA 2CY4A 3LJUX 5D27A 1TJ6A 4HB2B 1XKEA 1ZM0A 4HAZB 1KZGA 1U5EA 1B55A 1Y5OA 3D8EA 3A8PA 3ZVRA 1U27A 2XQNM 3X23A 2W2WA 2YS5A 3FM8C 1BAKA 5HE3A 1UNQA 2YSZA 3OANA 5J3YA 1FB8A 3TVVA 4Z2NA 1WG7A 1K5GB 3SV1A 4K81A 4D0NB 1MIXA 2L1CA 2YS1A 4TYZA 1UPRA 2KGXB 3N7CA 2J0KA 1K5DB 2GCLA 5KCVA 1H4RA 2DN6A 4A6FB 2ROZB 2CAYA 3MDBC 2P0FA 3IVFA 5JLJB 1UEFA 1AWEA 3UZTA 1WGQA 2UVMA 2I5FA 5C16A 4KHAA 1GC6A 1BTKA 1EAZA 1GC7A 1V89A 4HB4B 5JP4A 2DKQA 2V76A 1TXDA 2MWNB 1M7EA 2D9VA 1DROA 1X1FA 2Y8GA 2ZPYA 2D10A 2COFA 4P7IA 3BJIA 1KZ7A 1X1GA 1DBHA 4PQ0A 1WI1A 3PSCA 2IFSA 1IRSA 3D8DA 1U5GA 2N23A 2DA0A 3ZDTA 1UNPA 5CLLB 2DX5A 3GYPA 2EJ8A 2YF0A 4HAYB 4K17A 2EMTA 4HB3B 4BBKA 2NZ8B 3PG7A 2QKLA 2UZRA 1FOEA 3O96A 2HTHB 5CLQB 1U29A 4H8SA 3HW2B 1NI2A 2VSZA 2LYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC1 A;  4C0A A;  4PNK A;  2NMB A;  4A6K A;  1MK7 B;  1FHO A;  3AJ4 A;  2K2J A;  1XD4 A;  2YVC A;  1SGH A;  3TFM A;  2P0H A;  1GG3 A;  2COC A;  2LOZ A;  1RRP B;  2I1J A;  3VIA A;  3QIJ A;  4Z2M B;  4KVG B;  4HHV A;  4IFS A;  1V88 A;  2D9X A;  5KQ1 A;  1E5W A;  4ZRK A;  3A8Q A;  1V61 A;  2COD A;  4KHB B;  1WJM A;  5GOW B;  1BTN A;  3FSS A;  3F5R A;  1ZC4 B;  2K2U A;  4WSF A;  3QWM A;  3ULC A;  1PLS A;  2RGN B;  5HE1 A;  2H7E A;  5JHG A;  2LKO A;  5DHA B;  4IAP A;  1J19 A;  1EVH A;  1ISN A;  3TO1 A;  1H10 A;  2DFK A;  4NY0 A;  2FJL A;  3DXD A;  4DBB A;  2DHJ A;  1QC6 A;  2AEH A;  2DX1 A;  1BWN A;  4KHO A;  5D3X A;  2Q13 A;  4ZRI A;  3TW1 A;  3GYO A;  1PMS A;  3WA0 A;  3FEH A;  3G9W A;  5C6R A;  4GPT B;  1UNR A;  2YT1 A;  1W1D A;  5FI0 A;  4B6H A;  1RJ2 A;  1XOD A;  1WVH A;  4GMV A;  5HE2 A;  3QBV B;  5D3Y A;  5C79 A;  2RLO A;  4HAV B;  1U5D A;  2MDX A;  2ELA A;  4EJN A;  1ZVR A;  1TQZ A;  1WJ1 A;  1FHW A;  3P7Z A;  3ODO A;  2DTC A;  2VKI A;  1P6S A;  2LUL A;  1OY2 A;  1ZC3 B;  4HAW B;  1LW3 A;  1N3H A;  1W1G A;  1QQG A;  2DLW A;  5DH9 B;  2MKR A;  3DXC A;  1XR0 B;  3T06 A;  5DIF B;  3KZ1 A;  3A98 B;  2BCJ A;  5JHH A;  3CXB B;  4HAT B;  2D4Q A;  2M14 A;  4XWX A;  2D2Q A;  3P6A A;  1M7R A;  3RCP A;  1V5P A;  2ADZ A;  2D9Z A;  2GCJ A;  1W1H A;  1MIZ B;  3ODW A;  1DDM A;  3PP2 A;  1V5M A;  1U5F A;  1MKE A;  3ULB A;  2GJY A;  2I1K A;  1DDV A;  2D9W A;  1NTY A;  2Y7B A;  2RSG A;  3SUZ A;  4DX9 0;  4F7G A;  4EKU A;  2DYN A;  2IYB A;  2DHI A;  3KRX A;  2GS0 A;  2Y8F A;  4Y94 A;  1AQC A;  3KRW A;  4YON A;  5D3W A;  3DXE A;  3HQC A;  4TKN A;  2DHK A;  5FI1 A;  2OQB A;  2PZ1 A;  2HE7 A;  3PVL A;  1SHC A;  4HAX B;  5LON B;  4WJ7 A;  3AU4 A;  2P8V A;  3ML4 A;  2D9Y A;  5D3V A;  2Z0P A;  1P3R A;  2JP2 A;  1NTV A;  5DI9 B;  3KY9 A;  4A5K A;  2E2X A;  1X11 A;  2J0J A;  5KQ4 A;  4WVF B;  2R09 A;  2OTX A;  2MFQ A;  4HB0 B;  1V5U A;  3PZD A;  1LB1 A;  4DXA B;  3WYF B;  1FAO A;  2W2X D;  2RUK B;  4K2O A;  2EMS A;  4CHM A;  5C5B A;  5EFX A;  2LOX A;  1I7A A;  5J3T A;  4GXB A;  2COA A;  2Z0O A;  1ZSQ A;  3MPX A;  4ZRJ A;  4GN1 A;  2VRW B;  2YRY A;  2R0D A;  2X18 A;  1X05 A;  3NSU A;  3PVU A;  1U2B A;  1UPQ A;  1PFJ A;  1XX0 A;  4A6H A;  5LOP B;  4HDO A;  3CIK A;  2CY5 A;  1FGZ A;  4MY6 A;  1MPH A;  4KAX B;  4F7U P;  2ELB A;  2I5C A;  3SO6 A;  2RNR B;  1DYN A;  4IOY X;  3SYX A;  1DDW A;  4GMX B;  4F7H A;  5DHF B;  3U8Z A;  4DX8 A;  3PEG A;  5J3Q A;  3U7D A;  2KCJ A;  4CHJ A;  2YS3 A;  2Z0Q A;  2QKM A;  5C5B B;  1MK9 B;  3VOQ A;  2K00 A;  4HDQ A;  3SNH A;  3M1I B;  3PVW A;  1KI1 B;  2J0M A;  2DKP A;  2G35 A;  4HAU B;  2AL6 A;  2LG1 A;  3TCA A;  4K2P A;  1WGU A;  4YL8 A;  1OQN A;  3D8F A;  3BIN A;  1XCG A;  1P5T A;  1EF1 A;  1X86 A;  2KUP A;  2M38 A;  1J0W A;  1FHX A;  1MAI A;  2CRF A;  2YT0 A;  2DYQ A;  3ODX A;  2H7D A;  3KSY A;  5L81 A;  3AU5 A;  2P0D A;  2UZS A;  1I2H A;  1Q67 A;  2N0Y A;  1FGY A;  1Y19 B;  1EGX A;  4EMO A;  4A6F A;  4GZU A;  2W2X C;  4L6E A;  2J59 M;  5HE0 A;  4MK0 A;  1OMW A;  2RVB B;  2D11 A;  1Z87 A;  2ROV A;  3F0W A;  4MT7 A;  1NU2 A;  4NSW A;  2L2I A;  4CYE A;  3HK0 A;  3V5W A;  2CY4 A;  3LJU X;  5D27 A;  1TJ6 A;  4HB2 B;  1XKE A;  1ZM0 A;  4HAZ B;  1KZG A;  1U5E A;  1B55 A;  1Y5O A;  3D8E A;  3A8P A;  3ZVR A;  1U27 A;  2XQN M;  3X23 A;  2W2W A;  2YS5 A;  3FM8 C;  1BAK A;  5HE3 A;  1UNQ A;  2YSZ A;  3OAN A;  5J3Y A;  1FB8 A;  3TVV A;  4Z2N A;  1WG7 A;  1K5G B;  3SV1 A;  4K81 A;  4D0N B;  1MIX A;  2L1C A;  2YS1 A;  4TYZ A;  1UPR A;  2KGX B;  3N7C A;  2J0K A;  1K5D B;  2GCL A;  5KCV A;  1H4R A;  2DN6 A;  4A6F B;  2ROZ B;  2CAY A;  3MDB C;  2P0F A;  3IVF A;  5JLJ B;  1UEF A;  1AWE A;  3UZT A;  1WGQ A;  2UVM A;  2I5F A;  5C16 A;  4KHA A;  1GC6 A;  1BTK A;  1EAZ A;  1GC7 A;  1V89 A;  4HB4 B;  5JP4 A;  2DKQ A;  2V76 A;  1TXD A;  2MWN B;  1M7E A;  2D9V A;  1DRO A;  1X1F A;  2Y8G A;  2ZPY A;  2D10 A;  2COF A;  4P7I A;  3BJI A;  1KZ7 A;  1X1G A;  1DBH A;  4PQ0 A;  1WI1 A;  3PSC A;  2IFS A;  1IRS A;  3D8D A;  1U5G A;  2N23 A;  2DA0 A;  3ZDT A;  1UNP A;  5CLL B;  2DX5 A;  3GYP A;  2EJ8 A;  2YF0 A;  4HAY B;  4K17 A;  2EMT A;  4HB3 B;  4BBK A;  2NZ8 B;  3PG7 A;  2QKL A;  2UZR A;  1FOE A;  3O96 A;  2HTH B;  5CLQ B;  1U29 A;  4H8S A;  3HW2 B;  1NI2 A;  2VSZ A;  2LYD A; 
#chains in the Genus database with same CATH topology
 2EC1 A;  4C0A A;  4PNK A;  2NMB A;  4A6K A;  1MI1 A;  1MK7 B;  1FHO A;  3AJ4 A;  2K2J A;  1XD4 A;  2YVC A;  1SGH A;  3TFM A;  2P0H A;  1GG3 A;  2COC A;  2LOZ A;  1RRP B;  2I1J A;  3VIA A;  3QIJ A;  4Z2M B;  4KVG B;  4HHV A;  4IFS A;  4L1R A;  1V88 A;  2D9X A;  5KQ1 A;  1E5W A;  4ZRK A;  3A8Q A;  1V61 A;  2COD A;  3NWD A;  4KHB B;  1WJM A;  3B77 A;  5GOW B;  1BTN A;  3FSS A;  3F5R A;  3DCX A;  1ZC4 B;  3NWA A;  4QJ5 B;  2K2U A;  4WSF A;  3QWM A;  3ULC A;  1PLS A;  2RGN B;  2KIE A;  2GUM A;  5HE1 A;  2H7E A;  5JHG A;  2RRF A;  2LKO A;  5DHA B;  3U12 A;  4IAP A;  1J19 A;  1EVH A;  1ISN A;  3TO1 A;  1H10 A;  2DFK A;  4NY0 A;  2FJL A;  3DXD A;  4DBB A;  2DHJ A;  1QC6 A;  2AEH A;  2DX1 A;  1BWN A;  4KHO A;  5D3X A;  2Q13 A;  4OSN A;  4ZRI A;  3TW1 A;  3GYO A;  1PMS A;  3WA0 A;  3FEH A;  3G9W A;  2KIG A;  5C6R A;  4GPT B;  2ZKM X;  1UNR A;  2YT1 A;  1W1D A;  5FI0 A;  4B6H A;  1RJ2 A;  1XOD A;  1WVH A;  4GMV A;  5HE2 A;  3QBV B;  5D3Y A;  5C79 A;  2RLO A;  4HAV B;  1U5D A;  3FVC A;  2MDX A;  2ELA A;  4EJN A;  1ZVR A;  1TQZ A;  1WJ1 A;  1FHW A;  3P7Z A;  3ODO A;  2DTC A;  2VKI A;  1P6S A;  2LUL A;  1OY2 A;  1ZC3 B;  4HAW B;  1LW3 A;  1N3H A;  1W1G A;  1QQG A;  2DLW A;  5DH9 B;  2MKR A;  3DXC A;  1XR0 B;  3T06 A;  4GNK B;  5DIF B;  3KZ1 A;  3A98 B;  2BCJ A;  5JHH A;  3CXB B;  4HAT B;  2D4Q A;  2M14 A;  4XWX A;  2D2Q A;  3P6A A;  1M7R A;  5LG4 B;  3RCP A;  1V5P A;  2ADZ A;  2D9Z A;  2GCJ A;  1W1H A;  1MIZ B;  3ODW A;  1DDM A;  3PP2 A;  1V5M A;  2K8E A;  1U5F A;  1MKE A;  3ULB A;  2GJY A;  2I1K A;  1DDV A;  2D9W A;  1NTY A;  2Y7B A;  2RSG A;  3SUZ A;  4HSI A;  4DX9 0;  4F7G A;  4EKU A;  2DYN A;  2IYB A;  2DHI A;  3KRX A;  2GS0 A;  2Y8F A;  4Y94 A;  1AQC A;  3KRW A;  4YON A;  5D3W A;  3DXE A;  3HQC A;  4TKN A;  2DHK A;  5FI1 A;  2OQB A;  2PZ1 A;  2HE7 A;  3PVL A;  1SHC A;  4HAX B;  5LON B;  2NBV A;  4WJ7 A;  3AU4 A;  2P8V A;  3ML4 A;  2Z13 A;  2D9Y A;  5D3V A;  2Z0P A;  1P3R A;  2JP2 A;  1NTV A;  5DI9 B;  2K49 A;  3KY9 A;  4A5K A;  2E2X A;  1X11 A;  2J0J A;  5KQ4 A;  4WVF B;  2R09 A;  2OTX A;  2MFQ A;  4HB0 B;  1V5U A;  3PZD A;  1LB1 A;  4DXA B;  2KUQ A;  3WYF B;  1FAO A;  2W2X D;  2RUK B;  4K2O A;  2EMS A;  4CHM A;  3HSA A;  5C5B A;  5EFX A;  2LOX A;  1I7A A;  5J3T A;  4GXB A;  2COA A;  2Z0O A;  1ZSQ A;  3MPX A;  4ZRJ A;  4GN1 A;  2VRW B;  2YRY A;  2R0D A;  2X18 A;  1X05 A;  3NSU A;  3PVU A;  1U2B A;  1UPQ A;  1PFJ A;  1XX0 A;  4A6H A;  5LOP B;  4HDO A;  3CIK A;  2CY5 A;  1FGZ A;  4QXA B;  4MY6 A;  1MPH A;  4KAX B;  4DIX A;  4F7U P;  2ELB A;  2I5C A;  3SO6 A;  2RNR B;  1DYN A;  4IOY X;  3A58 A;  3SYX A;  1DDW A;  4GMX B;  4F7H A;  5DHF B;  3U8Z A;  4DX8 A;  3PEG A;  5J3Q A;  3U7D A;  2KCJ A;  4CHJ A;  5I2M A;  3OHM B;  2YS3 A;  2Z0Q A;  2QKM A;  5C5B B;  1MK9 B;  3VOQ A;  2K00 A;  4HDQ A;  3SNH A;  3M1I B;  3PVW A;  1KI1 B;  2J0M A;  2DKP A;  2G35 A;  4HAU B;  2AL6 A;  2LG1 A;  3TCA A;  4K2P A;  1WGU A;  4YL8 A;  1OQN A;  4QJ3 B;  3D8F A;  3NWF A;  3BIN A;  1XCG A;  1P5T A;  1EF1 A;  1X86 A;  2KUP A;  2M38 A;  1J0W A;  1FHX A;  1MAI A;  2CRF A;  2YT0 A;  2DYQ A;  3ODX A;  2H7D A;  3KSY A;  5L81 A;  3AU5 A;  2P0D A;  2UZS A;  1I2H A;  1Q67 A;  5IRS A;  3HIE A;  2N0Y A;  1FGY A;  1Y19 B;  1EGX A;  4EMO A;  4A6F A;  4GZU A;  2W2X C;  2YT2 A;  4L6E A;  2J59 M;  5HE0 A;  4MK0 A;  1OMW A;  2RVB B;  2D11 A;  1Z87 A;  2ROV A;  3F0W A;  4MT7 A;  3NW8 A;  1NU2 A;  4NSW A;  2L2I A;  5I2S A;  4CYE A;  3HK0 A;  3V5W A;  2CY4 A;  3LJU X;  5D27 A;  1TJ6 A;  4HB2 B;  1XKE A;  1ZM0 A;  4HAZ B;  1KZG A;  1U5E A;  1B55 A;  1Y5O A;  3D8E A;  3A8P A;  3ZVR A;  1ZYI A;  1U27 A;  2XQN M;  3X23 A;  2W2W A;  2YS5 A;  3FM8 C;  1BAK A;  5HE3 A;  1UNQ A;  2YSZ A;  3OAN A;  5J3Y A;  1FB8 A;  3TVV A;  4GOU A;  4Z2N A;  1WG7 A;  1K5G B;  5M4Y B;  3SV1 A;  4D6W A;  4K81 A;  4D0N B;  1MIX A;  2L1C A;  2YS1 A;  2KR0 A;  4TYZ A;  4OT1 A;  1UPR A;  2KGX B;  3N7C A;  2J0K A;  1K5D B;  2GCL A;  5KCV A;  1H4R A;  2DN6 A;  4A6F B;  2ROZ B;  2CAY A;  3MDB C;  2P0F A;  3IVF A;  5JLJ B;  1UEF A;  2R2Y A;  1AWE A;  3UZT A;  1WGQ A;  2UVM A;  2I5F A;  2Z14 A;  5C16 A;  4KHA A;  1GC6 A;  1BTK A;  1EAZ A;  1GC7 A;  1V89 A;  4HB4 B;  5JP4 A;  2DKQ A;  2V76 A;  2Z59 A;  2FJU B;  1TXD A;  2MWN B;  1M7E A;  2D9V A;  1DRO A;  1X1F A;  2Y8G A;  2ZPY A;  2D10 A;  2COF A;  4P7I A;  3BJI A;  1KZ7 A;  1X1G A;  1DBH A;  4PQ0 A;  1WI1 A;  2Z4D A;  3PSC A;  2IFS A;  1IRS A;  3D8D A;  1U5G A;  2N23 A;  2DA0 A;  3ZDT A;  1UNP A;  5CLL B;  2DX5 A;  3GYP A;  2EJ8 A;  2YF0 A;  4KHB A;  4HAY B;  4K17 A;  2EMT A;  4HB3 B;  4BBK A;  2NZ8 B;  3PG7 A;  2QKL A;  2UZR A;  4CSQ A;  1FOE A;  4QJ4 B;  3O96 A;  2HTH B;  5CLQ B;  1U29 A;  4H8S A;  3HW2 B;  1NI2 A;  1T77 A;  2VSZ A;  2LYD A; 
#chains in the Genus database with same CATH homology
 2EC1 A;  4C0A A;  4PNK A;  2NMB A;  4A6K A;  1MK7 B;  1FHO A;  3AJ4 A;  2K2J A;  1XD4 A;  2YVC A;  1SGH A;  3TFM A;  2P0H A;  1GG3 A;  2COC A;  2LOZ A;  1RRP B;  2I1J A;  3VIA A;  3QIJ A;  4Z2M B;  4KVG B;  4HHV A;  4IFS A;  1V88 A;  2D9X A;  5KQ1 A;  1E5W A;  4ZRK A;  3A8Q A;  1V61 A;  2COD A;  4KHB B;  1WJM A;  5GOW B;  1BTN A;  3FSS A;  3F5R A;  1ZC4 B;  2K2U A;  4WSF A;  3QWM A;  3ULC A;  1PLS A;  2RGN B;  5HE1 A;  2H7E A;  5JHG A;  2LKO A;  5DHA B;  4IAP A;  1J19 A;  1EVH A;  1ISN A;  3TO1 A;  1H10 A;  2DFK A;  4NY0 A;  2FJL A;  3DXD A;  4DBB A;  2DHJ A;  1QC6 A;  2AEH A;  2DX1 A;  1BWN A;  4KHO A;  5D3X A;  2Q13 A;  4ZRI A;  3TW1 A;  3GYO A;  1PMS A;  3WA0 A;  3FEH A;  3G9W A;  5C6R A;  4GPT B;  1UNR A;  2YT1 A;  1W1D A;  5FI0 A;  4B6H A;  1RJ2 A;  1XOD A;  1WVH A;  4GMV A;  5HE2 A;  3QBV B;  5D3Y A;  5C79 A;  2RLO A;  4HAV B;  1U5D A;  2MDX A;  2ELA A;  4EJN A;  1ZVR A;  1TQZ A;  1WJ1 A;  1FHW A;  3P7Z A;  3ODO A;  2DTC A;  2VKI A;  1P6S A;  2LUL A;  1OY2 A;  1ZC3 B;  4HAW B;  1LW3 A;  1N3H A;  1W1G A;  1QQG A;  2DLW A;  5DH9 B;  2MKR A;  3DXC A;  1XR0 B;  3T06 A;  5DIF B;  3KZ1 A;  3A98 B;  2BCJ A;  5JHH A;  3CXB B;  4HAT B;  2D4Q A;  2M14 A;  4XWX A;  2D2Q A;  3P6A A;  1M7R A;  3RCP A;  1V5P A;  2ADZ A;  2D9Z A;  2GCJ A;  1W1H A;  1MIZ B;  3ODW A;  1DDM A;  3PP2 A;  1V5M A;  1U5F A;  1MKE A;  3ULB A;  2GJY A;  2I1K A;  1DDV A;  2D9W A;  1NTY A;  2Y7B A;  2RSG A;  3SUZ A;  4DX9 0;  4F7G A;  4EKU A;  2DYN A;  2IYB A;  2DHI A;  3KRX A;  2GS0 A;  2Y8F A;  4Y94 A;  1AQC A;  3KRW A;  4YON A;  5D3W A;  3DXE A;  3HQC A;  4TKN A;  2DHK A;  5FI1 A;  2OQB A;  2PZ1 A;  2HE7 A;  3PVL A;  1SHC A;  4HAX B;  5LON B;  4WJ7 A;  3AU4 A;  2P8V A;  3ML4 A;  2D9Y A;  5D3V A;  2Z0P A;  1P3R A;  2JP2 A;  1NTV A;  5DI9 B;  3KY9 A;  4A5K A;  2E2X A;  1X11 A;  2J0J A;  5KQ4 A;  4WVF B;  2R09 A;  2OTX A;  2MFQ A;  4HB0 B;  1V5U A;  3PZD A;  1LB1 A;  4DXA B;  3WYF B;  1FAO A;  2W2X D;  2RUK B;  4K2O A;  2EMS A;  4CHM A;  5C5B A;  5EFX A;  2LOX A;  1I7A A;  5J3T A;  4GXB A;  2COA A;  2Z0O A;  1ZSQ A;  3MPX A;  4ZRJ A;  4GN1 A;  2VRW B;  2YRY A;  2R0D A;  2X18 A;  1X05 A;  3NSU A;  3PVU A;  1U2B A;  1UPQ A;  1PFJ A;  1XX0 A;  4A6H A;  5LOP B;  4HDO A;  3CIK A;  2CY5 A;  1FGZ A;  4MY6 A;  1MPH A;  4KAX B;  4F7U P;  2ELB A;  2I5C A;  3SO6 A;  2RNR B;  1DYN A;  4IOY X;  3SYX A;  1DDW A;  4GMX B;  4F7H A;  5DHF B;  3U8Z A;  4DX8 A;  3PEG A;  5J3Q A;  3U7D A;  2KCJ A;  4CHJ A;  2YS3 A;  2Z0Q A;  2QKM A;  5C5B B;  1MK9 B;  3VOQ A;  2K00 A;  4HDQ A;  3SNH A;  3M1I B;  3PVW A;  1KI1 B;  2J0M A;  2DKP A;  2G35 A;  4HAU B;  2AL6 A;  2LG1 A;  3TCA A;  4K2P A;  1WGU A;  4YL8 A;  1OQN A;  3D8F A;  3BIN A;  1XCG A;  1P5T A;  1EF1 A;  1X86 A;  2KUP A;  2M38 A;  1J0W A;  1FHX A;  1MAI A;  2CRF A;  2YT0 A;  2DYQ A;  3ODX A;  2H7D A;  3KSY A;  5L81 A;  3AU5 A;  2P0D A;  2UZS A;  1I2H A;  1Q67 A;  2N0Y A;  1FGY A;  1Y19 B;  1EGX A;  4EMO A;  4A6F A;  4GZU A;  2W2X C;  4L6E A;  2J59 M;  5HE0 A;  4MK0 A;  1OMW A;  2RVB B;  2D11 A;  1Z87 A;  2ROV A;  3F0W A;  4MT7 A;  1NU2 A;  4NSW A;  2L2I A;  4CYE A;  3HK0 A;  3V5W A;  2CY4 A;  3LJU X;  5D27 A;  1TJ6 A;  4HB2 B;  1XKE A;  1ZM0 A;  4HAZ B;  1KZG A;  1U5E A;  1B55 A;  1Y5O A;  3D8E A;  3A8P A;  3ZVR A;  1U27 A;  2XQN M;  3X23 A;  2W2W A;  2YS5 A;  3FM8 C;  1BAK A;  5HE3 A;  1UNQ A;  2YSZ A;  3OAN A;  5J3Y A;  1FB8 A;  3TVV A;  4Z2N A;  1WG7 A;  1K5G B;  3SV1 A;  4K81 A;  4D0N B;  1MIX A;  2L1C A;  2YS1 A;  4TYZ A;  1UPR A;  2KGX B;  3N7C A;  2J0K A;  1K5D B;  2GCL A;  5KCV A;  1H4R A;  2DN6 A;  4A6F B;  2ROZ B;  2CAY A;  3MDB C;  2P0F A;  3IVF A;  5JLJ B;  1UEF A;  1AWE A;  3UZT A;  1WGQ A;  2UVM A;  2I5F A;  5C16 A;  4KHA A;  1GC6 A;  1BTK A;  1EAZ A;  1GC7 A;  1V89 A;  4HB4 B;  5JP4 A;  2DKQ A;  2V76 A;  1TXD A;  2MWN B;  1M7E A;  2D9V A;  1DRO A;  1X1F A;  2Y8G A;  2ZPY A;  2D10 A;  2COF A;  4P7I A;  3BJI A;  1KZ7 A;  1X1G A;  1DBH A;  4PQ0 A;  1WI1 A;  3PSC A;  2IFS A;  1IRS A;  3D8D A;  1U5G A;  2N23 A;  2DA0 A;  3ZDT A;  1UNP A;  5CLL B;  2DX5 A;  3GYP A;  2EJ8 A;  2YF0 A;  4HAY B;  4K17 A;  2EMT A;  4HB3 B;  4BBK A;  2NZ8 B;  3PG7 A;  2QKL A;  2UZR A;  1FOE A;  3O96 A;  2HTH B;  5CLQ B;  1U29 A;  4H8S A;  3HW2 B;  1NI2 A;  2VSZ A;  2LYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...