2MFQA

Nmr solution structures of frs2a ptb domain with neurotrophin receptor trkb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
b'SHMDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 2
publication title Structural insights into FRS2 alpha PTB domain recognition by neurotrophin receptor TrkB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mfqA00
3DXDA 3PVWA 2X18A 5C16A 1FAOA 4TKNA 4GPTB 5DHAB 2RVBB 2D10A 4EJNA 2DYNA 4HDQA 5LOPB 2UZRA 5LONB 1XKEA 2DHKA 4D0NB 1RJ2A 1W1GA 2Y7BA 2K00A 1LW3A 2YS3A 1I7AA 3KRXA 1MIZB 2PZ1A 1M7EA 3LJUX 1PFJA 2G35A 2J0MA 3D8FA 1Y5OA 2OQBA 5D3VA 1NI2A 4H8SA 4KAXB 3HK0A 4YONA 1MKEA 2DTCA 2IYBA 1EAZA 3U7DA 5J3YA 4MY6A 3N7CA 3AJ4A 4KHBB 3P6AA 2RLOA 1UNPA 4DBBA 2J59M 2COCA 4HAVB 5FI0A 5D3XA 2D9XA 2VRWB 1BAKA 2VKIA 3HQCA 1J19A 2AEHA 2UZSA 3ZVRA 1TXDA 2GJYA 3PG7A 1GG3A 3AU5A 2DX5A 5L81A 1FHXA 4K2PA 1UPRA 3M1IB 3GYPA 5FI1A 2YT0A 2Y8GA 2P0DA 1N3HA 2NMBA 1TQZA 1BTNA 3MDBC 2R09A 2GS0A 3RCPA 3A8PA 2GCJA 3QBVB 4HAYB 2DHIA 2J0JA 2YF0A 3BINA 2HTHB 2Z0OA 3QWMA 2YS1A 2ROVA 4NY0A 1NTVA 1ISNA 3SO6A 1WJ1A 1FGYA 2I5FA 3VOQA 2MFQA 4PNKA 4CHMA 1SGHA 3TCAA 1XODA 2EMSA 4HB4B 4TYZA 4HAWB 2RNRB 2LG1A 2M38A 2H7DA 4DX90 3KY9A 1DDVA 4EKUA 2LKOA 3MPXA 1X05A 1MPHA 1U5EA 1GC6A 1V89A 5CLLB 4F7GA 2CY5A 2DA0A 4GMVA 5D3WA 5DHFB 2D9ZA 1MAIA 2GCLA 2I1KA 4WJ7A 2J0KA 1OMWA 4A5KA 3ZDTA 3VIAA 1MIXA 2DKQA 5HE1A 1DDWA 1U5FA 1KI1B 4WVFB 4B6HA 1ZC4B 5HE0A 3TFMA 2L1CA 1KZ7A 5CLQB 4ZRKA 4HB0B 2YT1A 1WG7A 2LULA 3GYOA 2Z0PA 2EC1A 1MK9B 4KHAA 2RUKB 4ZRIA 5KCVA 3X23A 1J0WA 1QC6A 5DIFB 2W2XD 3OANA 1H10A 4HB2B 3WYFB 1UPQA 1V5UA 3ODXA 3ML4A 2L2IA 5JHHA 2ZPYA 4A6FB 1EVHA 3DXEA 2W2WA 5DI9B 4YL8A 4C0AA 5KQ4A 3ULBA 3BJIA 5JHGA 1DDMA 4A6KA 4P7IA 3ODWA 2Q13A 1TJ6A 3D8EA 3TVVA 1Y19B 2EJ8A 3PVUA 1I2HA 1P6SA 3PZDA 5GOWB 2AL6A 4Z2MB 2ADZA 2OTXA 4WSFA 4F7HA 2D9VA 4GZUA 4K81A 2CY4A 3SV1A 2LOZA 3A8QA 3KRWA 1E5WA 2XQNM 2I1JA 2Y8FA 3UZTA 3TW1A 1FGZA 4HHVA 4F7UP 4PQ0A 2K2UA 1K5DB 2IFSA 4DX8A 1KZGA 4DXAB 1P5TA 4A6HA 2YRYA 3SYXA 1K5GB 3ULCA 1BWNA 3HW2B 1QQGA 1V88A 2MKRA 1U5GA 2NZ8B 5C5BB 2ELBA 4GMXB 3CIKA 2N0YA 2LYDA 1X1GA 2Z0QA 1SHCA 3SNHA 4MK0A 3TO1A 1DYNA 3A98B 2DLWA 5HE2A 2D9WA 1AWEA 5D3YA 2QKMA 1LB1A 1DROA 4HDOA 2M14A 4CYEA 1U29A 4Z2NA 1MK7B 1XR0B 1GC7A 4HATB 4MT7A 2DN6A 5DH9B 1UNRA 2D9YA 1U2BA 5JLJB 1UNQA 1H4RA 2YVCA 3D8DA 1RRPB 4HAXB 1FB8A 2W2XC 1DBHA 2CODA 3KZ1A 3NSUA 1EF1A 2D11A 2UVMA 4ZRJA 2P0HA 2I5CA 1V5MA 1Z87A 3PEGA 2ROZB 5EFXA 1AQCA 3O96A 1ZSQA 1ZVRA 4A6FA 1EGXA 4KVGB 2COAA 2YSZA 1FOEA 1B55A 2RGNB 1ZM0A 2FJLA 5KQ1A 1XCGA 1U27A 5HE3A 2P8VA 3PP2A 3AU4A 3F5RA 2K2JA 1V5PA 4IOYX 2D4QA 4K2OA 4EMOA 5C79A 1FHOA 2DX1A 2P0FA 2EMTA 1NTYA 3ODOA 1OY2A 1WJMA 2KUPA 4CHJA 3FEHA 4IAPA 1Q67A 1BTKA 1ZC3B 1X11A 1WGUA 2VSZA 3CXBB 4HAZB 2D2QA 2YS5A 4K17A 3G9WA 4L6EA 4GN1A 3U8ZA 2DHJA 4HB3B 2QKLA 2BCJA 3V5WA 1UEFA 1P3RA 2KCJA 2V76A 1X86A 2JP2A 3DXCA 3P7ZA 1NU2A 1OQNA 1W1HA 3QIJA 5J3TA 3F0WA 2N23A 4NSWA 3IVFA 4IFSA 5J3QA 2RSGA 4GXBA 5JP4A 3SUZA 4Y94A 2LOXA 5C5BA 1IRSA 3FM8C 2DYQA 2E2XA 2CAYA 3T06A 1FHWA 2DFKA 2CRFA 2ELAA 2HE7A 5D27A 5C6RA 1W1DA 3WA0A 1XD4A 1M7RA 1XX0A 2DKPA 2MDXA 3PSCA 2MWNB 1WVHA 1V61A 1U5DA 2H7EA 3FSSA 4BBKA 2COFA 1X1FA 3PVLA 1PLSA 1WI1A 2R0DA 1PMSA 4XWXA 4KHOA 2KGXB 3KSYA 1WGQA 4HAUB
chains in the Genus database with same CATH superfamily
3DXDA 3PVWA 2X18A 5C16A 1FAOA 4TKNA 4GPTB 5DHAB 2RVBB 2D10A 2K49A 4EJNA 2DYNA 4HDQA 5LOPB 2UZRA 5LONB 1XKEA 5LG4B 2DHKA 4D0NB 1RJ2A 1W1GA 2Y7BA 2K00A 1LW3A 2YS3A 1I7AA 3KRXA 1MIZB 2PZ1A 1M7EA 3LJUX 1PFJA 2G35A 2J0MA 3D8FA 1Y5OA 2OQBA 5D3VA 1NI2A 4H8SA 4KAXB 4HSIA 3HK0A 4YONA 1MKEA 2DTCA 2IYBA 1EAZA 3NWFA 3U7DA 5J3YA 4MY6A 3N7CA 3AJ4A 4KHBB 3P6AA 2RLOA 1UNPA 4DBBA 2J59M 2COCA 4HAVB 5FI0A 5D3XA 2D9XA 2VRWB 1BAKA 2VKIA 3HQCA 1J19A 3FVCA 2AEHA 2ZKMX 2UZSA 3ZVRA 1TXDA 2GJYA 3PG7A 1GG3A 3AU5A 2DX5A 5L81A 1FHXA 4K2PA 1UPRA 3M1IB 3GYPA 5FI1A 2YT0A 2R2YA 2Y8GA 2P0DA 2KUQA 2Z4DA 1N3HA 2NMBA 1TQZA 1BTNA 3MDBC 2R09A 2GS0A 3HSAA 3OHMB 3RCPA 3A8PA 2GCJA 3QBVB 4HAYB 2DHIA 2J0JA 2YF0A 3BINA 2HTHB 2Z0OA 3QWMA 2YS1A 2ROVA 4NY0A 1NTVA 1ISNA 3SO6A 1WJ1A 2Z59A 1FGYA 2I5FA 3VOQA 2MFQA 4PNKA 4CHMA 1SGHA 3TCAA 1XODA 2EMSA 4HB4B 1ZYIA 4TYZA 4HAWB 2RNRB 2LG1A 2M38A 2H7DA 4DX90 3KY9A 1DDVA 4EKUA 2LKOA 3MPXA 1X05A 1MPHA 1U5EA 1GC6A 1V89A 2FJUB 5CLLB 4F7GA 2CY5A 2DA0A 4GMVA 5D3WA 5DHFB 2D9ZA 1MAIA 2GCLA 2I1KA 4WJ7A 2J0KA 1OMWA 4A5KA 3ZDTA 3VIAA 1MIXA 2DKQA 5HE1A 1DDWA 1U5FA 1KI1B 4WVFB 4B6HA 1ZC4B 5HE0A 3NWAA 3TFMA 2L1CA 1KZ7A 4GNKB 5CLQB 4ZRKA 4HB0B 2YT1A 1WG7A 2LULA 3GYOA 2Z0PA 2EC1A 1MK9B 5I2SA 4KHBA 4KHAA 2RUKB 4L1RA 4ZRIA 5KCVA 3X23A 1J0WA 1MI1A 1QC6A 5DIFB 2RRFA 2W2XD 3OANA 1H10A 4HB2B 3WYFB 1UPQA 1V5UA 3ODXA 3ML4A 2L2IA 5JHHA 2ZPYA 4A6FB 1EVHA 3DXEA 2W2WA 5DI9B 4YL8A 4C0AA 4OSNA 5KQ4A 3ULBA 3BJIA 5JHGA 1DDMA 4A6KA 4OT1A 4P7IA 2Q13A 3ODWA 4QJ3B 1TJ6A 3D8EA 3TVVA 1Y19B 2EJ8A 3PVUA 1I2HA 1P6SA 3PZDA 5GOWB 2AL6A 4Z2MB 2ADZA 4CSQA 2OTXA 4WSFA 4F7HA 2D9VA 4GZUA 4K81A 2CY4A 3SV1A 2LOZA 3A8QA 3KRWA 1E5WA 2XQNM 5I2MA 2I1JA 2Y8FA 3UZTA 3TW1A 1FGZA 1T77A 4HHVA 4F7UP 4PQ0A 2K2UA 5IRSA 1K5DB 2IFSA 4DX8A 1KZGA 4DXAB 1P5TA 4A6HA 2YRYA 3SYXA 1K5GB 3ULCA 1BWNA 3HW2B 1QQGA 1V88A 2MKRA 1U5GA 2NZ8B 5C5BB 2ELBA 2GUMA 4D6WA 4GMXB 3CIKA 2N0YA 2LYDA 1X1GA 2Z0QA 1SHCA 3SNHA 4MK0A 3NW8A 3TO1A 3DCXA 1DYNA 3A98B 2DLWA 5HE2A 2D9WA 3HIEA 1AWEA 5D3YA 2QKMA 1LB1A 1DROA 4HDOA 2M14A 4CYEA 1U29A 4Z2NA 2KR0A 1MK7B 1XR0B 1GC7A 4HATB 4MT7A 2DN6A 5DH9B 1UNRA 2KIGA 2D9YA 1U2BA 5JLJB 1UNQA 1H4RA 2YVCA 3D8DA 1RRPB 4HAXB 1FB8A 2W2XC 1DBHA 3NWDA 2CODA 3KZ1A 3NSUA 1EF1A 2D11A 2UVMA 4ZRJA 2P0HA 2I5CA 1V5MA 1Z87A 3PEGA 2ROZB 5EFXA 1AQCA 3O96A 2Z14A 1ZSQA 1ZVRA 4A6FA 1EGXA 2Z13A 4KVGB 2COAA 2YSZA 1FOEA 1B55A 2RGNB 1ZM0A 2FJLA 5KQ1A 1XCGA 1U27A 5HE3A 2P8VA 3PP2A 3AU4A 3F5RA 2K2JA 1V5PA 4IOYX 2D4QA 4K2OA 4EMOA 5C79A 4QJ5B 1FHOA 2DX1A 2P0FA 2EMTA 1NTYA 3ODOA 1OY2A 1WJMA 2KUPA 4CHJA 3FEHA 4IAPA 3A58A 1Q67A 1BTKA 1ZC3B 1X11A 2K8EA 1WGUA 2VSZA 3CXBB 4HAZB 2D2QA 2YS5A 4K17A 3G9WA 4L6EA 4GN1A 3U8ZA 4GOUA 2DHJA 4HB3B 4QJ4B 2QKLA 3B77A 2BCJA 3V5WA 1UEFA 2KIEA 1P3RA 2KCJA 2V76A 1X86A 2JP2A 5M4YB 3DXCA 3P7ZA 1NU2A 1OQNA 1W1HA 3QIJA 5J3TA 3F0WA 2N23A 4NSWA 3IVFA 4IFSA 3U12A 5J3QA 2RSGA 4GXBA 5JP4A 3SUZA 4Y94A 2LOXA 5C5BA 4QXAB 1IRSA 3FM8C 2DYQA 2E2XA 2CAYA 3T06A 1FHWA 2DFKA 2CRFA 2ELAA 2HE7A 5D27A 5C6RA 1W1DA 3WA0A 1XD4A 1M7RA 2YT2A 4DIXA 1XX0A 2DKPA 2MDXA 3PSCA 2MWNB 1WVHA 1V61A 1U5DA 2NBVA 2H7EA 3FSSA 4BBKA 2COFA 1X1FA 1PLSA 3PVLA 1WI1A 2R0DA 1PMSA 4XWXA 4KHOA 2KGXB 3KSYA 1WGQA 4HAUB
chains in the Genus database with same CATH topology
3DXDA 3PVWA 2X18A 5C16A 1FAOA 4TKNA 4GPTB 5DHAB 2RVBB 2D10A 4EJNA 2DYNA 4HDQA 5LOPB 2UZRA 5LONB 1XKEA 2DHKA 4D0NB 1RJ2A 1W1GA 2Y7BA 2K00A 1LW3A 2YS3A 1I7AA 3KRXA 1MIZB 2PZ1A 1M7EA 3LJUX 1PFJA 2G35A 2J0MA 3D8FA 1Y5OA 2OQBA 5D3VA 1NI2A 4H8SA 4KAXB 3HK0A 4YONA 1MKEA 2DTCA 2IYBA 1EAZA 3U7DA 5J3YA 4MY6A 3N7CA 3AJ4A 4KHBB 3P6AA 2RLOA 1UNPA 4DBBA 2J59M 2COCA 4HAVB 5FI0A 5D3XA 2D9XA 2VRWB 1BAKA 2VKIA 3HQCA 1J19A 2AEHA 2UZSA 3ZVRA 1TXDA 2GJYA 3PG7A 1GG3A 3AU5A 2DX5A 5L81A 1FHXA 4K2PA 1UPRA 3M1IB 3GYPA 5FI1A 2YT0A 2Y8GA 2P0DA 1N3HA 2NMBA 1TQZA 1BTNA 3MDBC 2R09A 2GS0A 3RCPA 3A8PA 2GCJA 3QBVB 4HAYB 2DHIA 2J0JA 2YF0A 3BINA 2HTHB 2Z0OA 3QWMA 2YS1A 2ROVA 4NY0A 1NTVA 1ISNA 3SO6A 1WJ1A 1FGYA 2I5FA 3VOQA 2MFQA 4PNKA 4CHMA 1SGHA 3TCAA 1XODA 2EMSA 4HB4B 4TYZA 4HAWB 2RNRB 2LG1A 2M38A 2H7DA 4DX90 3KY9A 1DDVA 4EKUA 2LKOA 3MPXA 1X05A 1MPHA 1U5EA 1GC6A 1V89A 5CLLB 4F7GA 2CY5A 2DA0A 4GMVA 5D3WA 5DHFB 2D9ZA 1MAIA 2GCLA 2I1KA 4WJ7A 2J0KA 1OMWA 4A5KA 3ZDTA 3VIAA 1MIXA 2DKQA 5HE1A 1DDWA 1U5FA 1KI1B 4WVFB 4B6HA 1ZC4B 5HE0A 3TFMA 2L1CA 1KZ7A 5CLQB 4ZRKA 4HB0B 2YT1A 1WG7A 2LULA 3GYOA 2Z0PA 2EC1A 1MK9B 4KHAA 2RUKB 4ZRIA 5KCVA 3X23A 1J0WA 1QC6A 5DIFB 2W2XD 3OANA 1H10A 4HB2B 3WYFB 1UPQA 1V5UA 3ODXA 3ML4A 2L2IA 5JHHA 2ZPYA 4A6FB 1EVHA 3DXEA 2W2WA 5DI9B 4YL8A 4C0AA 5KQ4A 3ULBA 3BJIA 5JHGA 1DDMA 4A6KA 4P7IA 3ODWA 2Q13A 1TJ6A 3D8EA 3TVVA 1Y19B 2EJ8A 3PVUA 1I2HA 1P6SA 3PZDA 5GOWB 2AL6A 4Z2MB 2ADZA 2OTXA 4WSFA 4F7HA 2D9VA 4GZUA 4K81A 2CY4A 3SV1A 2LOZA 3A8QA 3KRWA 1E5WA 2XQNM 2I1JA 2Y8FA 3UZTA 3TW1A 1FGZA 4HHVA 4F7UP 4PQ0A 2K2UA 1K5DB 2IFSA 4DX8A 1KZGA 4DXAB 1P5TA 4A6HA 2YRYA 3SYXA 1K5GB 3ULCA 1BWNA 3HW2B 1QQGA 1V88A 2MKRA 1U5GA 2NZ8B 5C5BB 2ELBA 4GMXB 3CIKA 2N0YA 2LYDA 1X1GA 2Z0QA 1SHCA 3SNHA 4MK0A 3TO1A 1DYNA 3A98B 2DLWA 5HE2A 2D9WA 1AWEA 5D3YA 2QKMA 1LB1A 1DROA 4HDOA 2M14A 4CYEA 1U29A 4Z2NA 1MK7B 1XR0B 1GC7A 4HATB 4MT7A 2DN6A 5DH9B 1UNRA 2D9YA 1U2BA 5JLJB 1UNQA 1H4RA 2YVCA 3D8DA 1RRPB 4HAXB 1FB8A 2W2XC 1DBHA 2CODA 3KZ1A 3NSUA 1EF1A 2D11A 2UVMA 4ZRJA 2P0HA 2I5CA 1V5MA 1Z87A 3PEGA 2ROZB 5EFXA 1AQCA 3O96A 1ZSQA 1ZVRA 4A6FA 1EGXA 4KVGB 2COAA 2YSZA 1FOEA 1B55A 2RGNB 1ZM0A 2FJLA 5KQ1A 1XCGA 1U27A 5HE3A 2P8VA 3PP2A 3AU4A 3F5RA 2K2JA 1V5PA 4IOYX 2D4QA 4K2OA 4EMOA 5C79A 1FHOA 2DX1A 2P0FA 2EMTA 1NTYA 3ODOA 1OY2A 1WJMA 2KUPA 4CHJA 3FEHA 4IAPA 1Q67A 1BTKA 1ZC3B 1X11A 1WGUA 2VSZA 3CXBB 4HAZB 2D2QA 2YS5A 4K17A 3G9WA 4L6EA 4GN1A 3U8ZA 2DHJA 4HB3B 2QKLA 2BCJA 3V5WA 1UEFA 1P3RA 2KCJA 2V76A 1X86A 2JP2A 3DXCA 3P7ZA 1NU2A 1OQNA 1W1HA 3QIJA 5J3TA 3F0WA 2N23A 4NSWA 3IVFA 4IFSA 5J3QA 2RSGA 4GXBA 5JP4A 3SUZA 4Y94A 2LOXA 5C5BA 1IRSA 3FM8C 2DYQA 2E2XA 2CAYA 3T06A 1FHWA 2DFKA 2CRFA 2ELAA 2HE7A 5D27A 5C6RA 1W1DA 3WA0A 1XD4A 1M7RA 1XX0A 2DKPA 2MDXA 3PSCA 2MWNB 1WVHA 1V61A 1U5DA 2H7EA 3FSSA 4BBKA 2COFA 1X1FA 3PVLA 1PLSA 1WI1A 2R0DA 1PMSA 4XWXA 4KHOA 2KGXB 3KSYA 1WGQA 4HAUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXD A;  3PVW A;  2X18 A;  5C16 A;  1FAO A;  4TKN A;  4GPT B;  5DHA B;  2RVB B;  2D10 A;  4EJN A;  2DYN A;  4HDQ A;  5LOP B;  2UZR A;  5LON B;  1XKE A;  2DHK A;  4D0N B;  1RJ2 A;  1W1G A;  2Y7B A;  2K00 A;  1LW3 A;  2YS3 A;  1I7A A;  3KRX A;  1MIZ B;  2PZ1 A;  1M7E A;  3LJU X;  1PFJ A;  2G35 A;  2J0M A;  3D8F A;  1Y5O A;  2OQB A;  5D3V A;  1NI2 A;  4H8S A;  4KAX B;  3HK0 A;  4YON A;  1MKE A;  2DTC A;  2IYB A;  1EAZ A;  3U7D A;  5J3Y A;  4MY6 A;  3N7C A;  3AJ4 A;  4KHB B;  3P6A A;  2RLO A;  1UNP A;  4DBB A;  2J59 M;  2COC A;  4HAV B;  5FI0 A;  5D3X A;  2D9X A;  2VRW B;  1BAK A;  2VKI A;  3HQC A;  1J19 A;  2AEH A;  2UZS A;  3ZVR A;  1TXD A;  2GJY A;  3PG7 A;  1GG3 A;  3AU5 A;  2DX5 A;  5L81 A;  1FHX A;  4K2P A;  1UPR A;  3M1I B;  3GYP A;  5FI1 A;  2YT0 A;  2Y8G A;  2P0D A;  1N3H A;  2NMB A;  1TQZ A;  1BTN A;  3MDB C;  2R09 A;  2GS0 A;  3RCP A;  3A8P A;  2GCJ A;  3QBV B;  4HAY B;  2DHI A;  2J0J A;  2YF0 A;  3BIN A;  2HTH B;  2Z0O A;  3QWM A;  2YS1 A;  2ROV A;  4NY0 A;  1NTV A;  1ISN A;  3SO6 A;  1WJ1 A;  1FGY A;  2I5F A;  3VOQ A;  2MFQ A;  4PNK A;  4CHM A;  1SGH A;  3TCA A;  1XOD A;  2EMS A;  4HB4 B;  4TYZ A;  4HAW B;  2RNR B;  2LG1 A;  2M38 A;  2H7D A;  4DX9 0;  3KY9 A;  1DDV A;  4EKU A;  2LKO A;  3MPX A;  1X05 A;  1MPH A;  1U5E A;  1GC6 A;  1V89 A;  5CLL B;  4F7G A;  2CY5 A;  2DA0 A;  4GMV A;  5D3W A;  5DHF B;  2D9Z A;  1MAI A;  2GCL A;  2I1K A;  4WJ7 A;  2J0K A;  1OMW A;  4A5K A;  3ZDT A;  3VIA A;  1MIX A;  2DKQ A;  5HE1 A;  1DDW A;  1U5F A;  1KI1 B;  4WVF B;  4B6H A;  1ZC4 B;  5HE0 A;  3TFM A;  2L1C A;  1KZ7 A;  5CLQ B;  4ZRK A;  4HB0 B;  2YT1 A;  1WG7 A;  2LUL A;  3GYO A;  2Z0P A;  2EC1 A;  1MK9 B;  4KHA A;  2RUK B;  4ZRI A;  5KCV A;  3X23 A;  1J0W A;  1QC6 A;  5DIF B;  2W2X D;  3OAN A;  1H10 A;  4HB2 B;  3WYF B;  1UPQ A;  1V5U A;  3ODX A;  3ML4 A;  2L2I A;  5JHH A;  2ZPY A;  4A6F B;  1EVH A;  3DXE A;  2W2W A;  5DI9 B;  4YL8 A;  4C0A A;  5KQ4 A;  3ULB A;  3BJI A;  5JHG A;  1DDM A;  4A6K A;  4P7I A;  3ODW A;  2Q13 A;  1TJ6 A;  3D8E A;  3TVV A;  1Y19 B;  2EJ8 A;  3PVU A;  1I2H A;  1P6S A;  3PZD A;  5GOW B;  2AL6 A;  4Z2M B;  2ADZ A;  2OTX A;  4WSF A;  4F7H A;  2D9V A;  4GZU A;  4K81 A;  2CY4 A;  3SV1 A;  2LOZ A;  3A8Q A;  3KRW A;  1E5W A;  2XQN M;  2I1J A;  2Y8F A;  3UZT A;  3TW1 A;  1FGZ A;  4HHV A;  4F7U P;  4PQ0 A;  2K2U A;  1K5D B;  2IFS A;  4DX8 A;  1KZG A;  4DXA B;  1P5T A;  4A6H A;  2YRY A;  3SYX A;  1K5G B;  3ULC A;  1BWN A;  3HW2 B;  1QQG A;  1V88 A;  2MKR A;  1U5G A;  2NZ8 B;  5C5B B;  2ELB A;  4GMX B;  3CIK A;  2N0Y A;  2LYD A;  1X1G A;  2Z0Q A;  1SHC A;  3SNH A;  4MK0 A;  3TO1 A;  1DYN A;  3A98 B;  2DLW A;  5HE2 A;  2D9W A;  1AWE A;  5D3Y A;  2QKM A;  1LB1 A;  1DRO A;  4HDO A;  2M14 A;  4CYE A;  1U29 A;  4Z2N A;  1MK7 B;  1XR0 B;  1GC7 A;  4HAT B;  4MT7 A;  2DN6 A;  5DH9 B;  1UNR A;  2D9Y A;  1U2B A;  5JLJ B;  1UNQ A;  1H4R A;  2YVC A;  3D8D A;  1RRP B;  4HAX B;  1FB8 A;  2W2X C;  1DBH A;  2COD A;  3KZ1 A;  3NSU A;  1EF1 A;  2D11 A;  2UVM A;  4ZRJ A;  2P0H A;  2I5C A;  1V5M A;  1Z87 A;  3PEG A;  2ROZ B;  5EFX A;  1AQC A;  3O96 A;  1ZSQ A;  1ZVR A;  4A6F A;  1EGX A;  4KVG B;  2COA A;  2YSZ A;  1FOE A;  1B55 A;  2RGN B;  1ZM0 A;  2FJL A;  5KQ1 A;  1XCG A;  1U27 A;  5HE3 A;  2P8V A;  3PP2 A;  3AU4 A;  3F5R A;  2K2J A;  1V5P A;  4IOY X;  2D4Q A;  4K2O A;  4EMO A;  5C79 A;  1FHO A;  2DX1 A;  2P0F A;  2EMT A;  1NTY A;  3ODO A;  1OY2 A;  1WJM A;  2KUP A;  4CHJ A;  3FEH A;  4IAP A;  1Q67 A;  1BTK A;  1ZC3 B;  1X11 A;  1WGU A;  2VSZ A;  3CXB B;  4HAZ B;  2D2Q A;  2YS5 A;  4K17 A;  3G9W A;  4L6E A;  4GN1 A;  3U8Z A;  2DHJ A;  4HB3 B;  2QKL A;  2BCJ A;  3V5W A;  1UEF A;  1P3R A;  2KCJ A;  2V76 A;  1X86 A;  2JP2 A;  3DXC A;  3P7Z A;  1NU2 A;  1OQN A;  1W1H A;  3QIJ A;  5J3T A;  3F0W A;  2N23 A;  4NSW A;  3IVF A;  4IFS A;  5J3Q A;  2RSG A;  4GXB A;  5JP4 A;  3SUZ A;  4Y94 A;  2LOX A;  5C5B A;  1IRS A;  3FM8 C;  2DYQ A;  2E2X A;  2CAY A;  3T06 A;  1FHW A;  2DFK A;  2CRF A;  2ELA A;  2HE7 A;  5D27 A;  5C6R A;  1W1D A;  3WA0 A;  1XD4 A;  1M7R A;  1XX0 A;  2DKP A;  2MDX A;  3PSC A;  2MWN B;  1WVH A;  1V61 A;  1U5D A;  2H7E A;  3FSS A;  4BBK A;  2COF A;  1X1F A;  3PVL A;  1PLS A;  1WI1 A;  2R0D A;  1PMS A;  4XWX A;  4KHO A;  2KGX B;  3KSY A;  1WGQ A;  4HAU B; 
#chains in the Genus database with same CATH topology
 3DXD A;  3PVW A;  2X18 A;  5C16 A;  1FAO A;  4TKN A;  4GPT B;  5DHA B;  2RVB B;  2D10 A;  2K49 A;  4EJN A;  2DYN A;  4HDQ A;  5LOP B;  2UZR A;  5LON B;  1XKE A;  5LG4 B;  2DHK A;  4D0N B;  1RJ2 A;  1W1G A;  2Y7B A;  2K00 A;  1LW3 A;  2YS3 A;  1I7A A;  3KRX A;  1MIZ B;  2PZ1 A;  1M7E A;  3LJU X;  1PFJ A;  2G35 A;  2J0M A;  3D8F A;  1Y5O A;  2OQB A;  5D3V A;  1NI2 A;  4H8S A;  4KAX B;  4HSI A;  3HK0 A;  4YON A;  1MKE A;  2DTC A;  2IYB A;  1EAZ A;  3NWF A;  3U7D A;  5J3Y A;  4MY6 A;  3N7C A;  3AJ4 A;  4KHB B;  3P6A A;  2RLO A;  1UNP A;  4DBB A;  2J59 M;  2COC A;  4HAV B;  5FI0 A;  5D3X A;  2D9X A;  2VRW B;  1BAK A;  2VKI A;  3HQC A;  1J19 A;  3FVC A;  2AEH A;  2ZKM X;  2UZS A;  3ZVR A;  1TXD A;  2GJY A;  3PG7 A;  1GG3 A;  3AU5 A;  2DX5 A;  5L81 A;  1FHX A;  4K2P A;  1UPR A;  3M1I B;  3GYP A;  5FI1 A;  2YT0 A;  2R2Y A;  2Y8G A;  2P0D A;  2KUQ A;  2Z4D A;  1N3H A;  2NMB A;  1TQZ A;  1BTN A;  3MDB C;  2R09 A;  2GS0 A;  3HSA A;  3OHM B;  3RCP A;  3A8P A;  2GCJ A;  3QBV B;  4HAY B;  2DHI A;  2J0J A;  2YF0 A;  3BIN A;  2HTH B;  2Z0O A;  3QWM A;  2YS1 A;  2ROV A;  4NY0 A;  1NTV A;  1ISN A;  3SO6 A;  1WJ1 A;  2Z59 A;  1FGY A;  2I5F A;  3VOQ A;  2MFQ A;  4PNK A;  4CHM A;  1SGH A;  3TCA A;  1XOD A;  2EMS A;  4HB4 B;  1ZYI A;  4TYZ A;  4HAW B;  2RNR B;  2LG1 A;  2M38 A;  2H7D A;  4DX9 0;  3KY9 A;  1DDV A;  4EKU A;  2LKO A;  3MPX A;  1X05 A;  1MPH A;  1U5E A;  1GC6 A;  1V89 A;  2FJU B;  5CLL B;  4F7G A;  2CY5 A;  2DA0 A;  4GMV A;  5D3W A;  5DHF B;  2D9Z A;  1MAI A;  2GCL A;  2I1K A;  4WJ7 A;  2J0K A;  1OMW A;  4A5K A;  3ZDT A;  3VIA A;  1MIX A;  2DKQ A;  5HE1 A;  1DDW A;  1U5F A;  1KI1 B;  4WVF B;  4B6H A;  1ZC4 B;  5HE0 A;  3NWA A;  3TFM A;  2L1C A;  1KZ7 A;  4GNK B;  5CLQ B;  4ZRK A;  4HB0 B;  2YT1 A;  1WG7 A;  2LUL A;  3GYO A;  2Z0P A;  2EC1 A;  1MK9 B;  5I2S A;  4KHB A;  4KHA A;  2RUK B;  4L1R A;  4ZRI A;  5KCV A;  3X23 A;  1J0W A;  1MI1 A;  1QC6 A;  5DIF B;  2RRF A;  2W2X D;  3OAN A;  1H10 A;  4HB2 B;  3WYF B;  1UPQ A;  1V5U A;  3ODX A;  3ML4 A;  2L2I A;  5JHH A;  2ZPY A;  4A6F B;  1EVH A;  3DXE A;  2W2W A;  5DI9 B;  4YL8 A;  4C0A A;  4OSN A;  5KQ4 A;  3ULB A;  3BJI A;  5JHG A;  1DDM A;  4A6K A;  4OT1 A;  4P7I A;  2Q13 A;  3ODW A;  4QJ3 B;  1TJ6 A;  3D8E A;  3TVV A;  1Y19 B;  2EJ8 A;  3PVU A;  1I2H A;  1P6S A;  3PZD A;  5GOW B;  2AL6 A;  4Z2M B;  2ADZ A;  4CSQ A;  2OTX A;  4WSF A;  4F7H A;  2D9V A;  4GZU A;  4K81 A;  2CY4 A;  3SV1 A;  2LOZ A;  3A8Q A;  3KRW A;  1E5W A;  2XQN M;  5I2M A;  2I1J A;  2Y8F A;  3UZT A;  3TW1 A;  1FGZ A;  1T77 A;  4HHV A;  4F7U P;  4PQ0 A;  2K2U A;  5IRS A;  1K5D B;  2IFS A;  4DX8 A;  1KZG A;  4DXA B;  1P5T A;  4A6H A;  2YRY A;  3SYX A;  1K5G B;  3ULC A;  1BWN A;  3HW2 B;  1QQG A;  1V88 A;  2MKR A;  1U5G A;  2NZ8 B;  5C5B B;  2ELB A;  2GUM A;  4D6W A;  4GMX B;  3CIK A;  2N0Y A;  2LYD A;  1X1G A;  2Z0Q A;  1SHC A;  3SNH A;  4MK0 A;  3NW8 A;  3TO1 A;  3DCX A;  1DYN A;  3A98 B;  2DLW A;  5HE2 A;  2D9W A;  3HIE A;  1AWE A;  5D3Y A;  2QKM A;  1LB1 A;  1DRO A;  4HDO A;  2M14 A;  4CYE A;  1U29 A;  4Z2N A;  2KR0 A;  1MK7 B;  1XR0 B;  1GC7 A;  4HAT B;  4MT7 A;  2DN6 A;  5DH9 B;  1UNR A;  2KIG A;  2D9Y A;  1U2B A;  5JLJ B;  1UNQ A;  1H4R A;  2YVC A;  3D8D A;  1RRP B;  4HAX B;  1FB8 A;  2W2X C;  1DBH A;  3NWD A;  2COD A;  3KZ1 A;  3NSU A;  1EF1 A;  2D11 A;  2UVM A;  4ZRJ A;  2P0H A;  2I5C A;  1V5M A;  1Z87 A;  3PEG A;  2ROZ B;  5EFX A;  1AQC A;  3O96 A;  2Z14 A;  1ZSQ A;  1ZVR A;  4A6F A;  1EGX A;  2Z13 A;  4KVG B;  2COA A;  2YSZ A;  1FOE A;  1B55 A;  2RGN B;  1ZM0 A;  2FJL A;  5KQ1 A;  1XCG A;  1U27 A;  5HE3 A;  2P8V A;  3PP2 A;  3AU4 A;  3F5R A;  2K2J A;  1V5P A;  4IOY X;  2D4Q A;  4K2O A;  4EMO A;  5C79 A;  4QJ5 B;  1FHO A;  2DX1 A;  2P0F A;  2EMT A;  1NTY A;  3ODO A;  1OY2 A;  1WJM A;  2KUP A;  4CHJ A;  3FEH A;  4IAP A;  3A58 A;  1Q67 A;  1BTK A;  1ZC3 B;  1X11 A;  2K8E A;  1WGU A;  2VSZ A;  3CXB B;  4HAZ B;  2D2Q A;  2YS5 A;  4K17 A;  3G9W A;  4L6E A;  4GN1 A;  3U8Z A;  4GOU A;  2DHJ A;  4HB3 B;  4QJ4 B;  2QKL A;  3B77 A;  2BCJ A;  3V5W A;  1UEF A;  2KIE A;  1P3R A;  2KCJ A;  2V76 A;  1X86 A;  2JP2 A;  5M4Y B;  3DXC A;  3P7Z A;  1NU2 A;  1OQN A;  1W1H A;  3QIJ A;  5J3T A;  3F0W A;  2N23 A;  4NSW A;  3IVF A;  4IFS A;  3U12 A;  5J3Q A;  2RSG A;  4GXB A;  5JP4 A;  3SUZ A;  4Y94 A;  2LOX A;  5C5B A;  4QXA B;  1IRS A;  3FM8 C;  2DYQ A;  2E2X A;  2CAY A;  3T06 A;  1FHW A;  2DFK A;  2CRF A;  2ELA A;  2HE7 A;  5D27 A;  5C6R A;  1W1D A;  3WA0 A;  1XD4 A;  1M7R A;  2YT2 A;  4DIX A;  1XX0 A;  2DKP A;  2MDX A;  3PSC A;  2MWN B;  1WVH A;  1V61 A;  1U5D A;  2NBV A;  2H7E A;  3FSS A;  4BBK A;  2COF A;  1X1F A;  1PLS A;  3PVL A;  1WI1 A;  2R0D A;  1PMS A;  4XWX A;  4KHO A;  2KGX B;  3KSY A;  1WGQ A;  4HAU B; 
#chains in the Genus database with same CATH homology
 3DXD A;  3PVW A;  2X18 A;  5C16 A;  1FAO A;  4TKN A;  4GPT B;  5DHA B;  2RVB B;  2D10 A;  4EJN A;  2DYN A;  4HDQ A;  5LOP B;  2UZR A;  5LON B;  1XKE A;  2DHK A;  4D0N B;  1RJ2 A;  1W1G A;  2Y7B A;  2K00 A;  1LW3 A;  2YS3 A;  1I7A A;  3KRX A;  1MIZ B;  2PZ1 A;  1M7E A;  3LJU X;  1PFJ A;  2G35 A;  2J0M A;  3D8F A;  1Y5O A;  2OQB A;  5D3V A;  1NI2 A;  4H8S A;  4KAX B;  3HK0 A;  4YON A;  1MKE A;  2DTC A;  2IYB A;  1EAZ A;  3U7D A;  5J3Y A;  4MY6 A;  3N7C A;  3AJ4 A;  4KHB B;  3P6A A;  2RLO A;  1UNP A;  4DBB A;  2J59 M;  2COC A;  4HAV B;  5FI0 A;  5D3X A;  2D9X A;  2VRW B;  1BAK A;  2VKI A;  3HQC A;  1J19 A;  2AEH A;  2UZS A;  3ZVR A;  1TXD A;  2GJY A;  3PG7 A;  1GG3 A;  3AU5 A;  2DX5 A;  5L81 A;  1FHX A;  4K2P A;  1UPR A;  3M1I B;  3GYP A;  5FI1 A;  2YT0 A;  2Y8G A;  2P0D A;  1N3H A;  2NMB A;  1TQZ A;  1BTN A;  3MDB C;  2R09 A;  2GS0 A;  3RCP A;  3A8P A;  2GCJ A;  3QBV B;  4HAY B;  2DHI A;  2J0J A;  2YF0 A;  3BIN A;  2HTH B;  2Z0O A;  3QWM A;  2YS1 A;  2ROV A;  4NY0 A;  1NTV A;  1ISN A;  3SO6 A;  1WJ1 A;  1FGY A;  2I5F A;  3VOQ A;  2MFQ A;  4PNK A;  4CHM A;  1SGH A;  3TCA A;  1XOD A;  2EMS A;  4HB4 B;  4TYZ A;  4HAW B;  2RNR B;  2LG1 A;  2M38 A;  2H7D A;  4DX9 0;  3KY9 A;  1DDV A;  4EKU A;  2LKO A;  3MPX A;  1X05 A;  1MPH A;  1U5E A;  1GC6 A;  1V89 A;  5CLL B;  4F7G A;  2CY5 A;  2DA0 A;  4GMV A;  5D3W A;  5DHF B;  2D9Z A;  1MAI A;  2GCL A;  2I1K A;  4WJ7 A;  2J0K A;  1OMW A;  4A5K A;  3ZDT A;  3VIA A;  1MIX A;  2DKQ A;  5HE1 A;  1DDW A;  1U5F A;  1KI1 B;  4WVF B;  4B6H A;  1ZC4 B;  5HE0 A;  3TFM A;  2L1C A;  1KZ7 A;  5CLQ B;  4ZRK A;  4HB0 B;  2YT1 A;  1WG7 A;  2LUL A;  3GYO A;  2Z0P A;  2EC1 A;  1MK9 B;  4KHA A;  2RUK B;  4ZRI A;  5KCV A;  3X23 A;  1J0W A;  1QC6 A;  5DIF B;  2W2X D;  3OAN A;  1H10 A;  4HB2 B;  3WYF B;  1UPQ A;  1V5U A;  3ODX A;  3ML4 A;  2L2I A;  5JHH A;  2ZPY A;  4A6F B;  1EVH A;  3DXE A;  2W2W A;  5DI9 B;  4YL8 A;  4C0A A;  5KQ4 A;  3ULB A;  3BJI A;  5JHG A;  1DDM A;  4A6K A;  4P7I A;  3ODW A;  2Q13 A;  1TJ6 A;  3D8E A;  3TVV A;  1Y19 B;  2EJ8 A;  3PVU A;  1I2H A;  1P6S A;  3PZD A;  5GOW B;  2AL6 A;  4Z2M B;  2ADZ A;  2OTX A;  4WSF A;  4F7H A;  2D9V A;  4GZU A;  4K81 A;  2CY4 A;  3SV1 A;  2LOZ A;  3A8Q A;  3KRW A;  1E5W A;  2XQN M;  2I1J A;  2Y8F A;  3UZT A;  3TW1 A;  1FGZ A;  4HHV A;  4F7U P;  4PQ0 A;  2K2U A;  1K5D B;  2IFS A;  4DX8 A;  1KZG A;  4DXA B;  1P5T A;  4A6H A;  2YRY A;  3SYX A;  1K5G B;  3ULC A;  1BWN A;  3HW2 B;  1QQG A;  1V88 A;  2MKR A;  1U5G A;  2NZ8 B;  5C5B B;  2ELB A;  4GMX B;  3CIK A;  2N0Y A;  2LYD A;  1X1G A;  2Z0Q A;  1SHC A;  3SNH A;  4MK0 A;  3TO1 A;  1DYN A;  3A98 B;  2DLW A;  5HE2 A;  2D9W A;  1AWE A;  5D3Y A;  2QKM A;  1LB1 A;  1DRO A;  4HDO A;  2M14 A;  4CYE A;  1U29 A;  4Z2N A;  1MK7 B;  1XR0 B;  1GC7 A;  4HAT B;  4MT7 A;  2DN6 A;  5DH9 B;  1UNR A;  2D9Y A;  1U2B A;  5JLJ B;  1UNQ A;  1H4R A;  2YVC A;  3D8D A;  1RRP B;  4HAX B;  1FB8 A;  2W2X C;  1DBH A;  2COD A;  3KZ1 A;  3NSU A;  1EF1 A;  2D11 A;  2UVM A;  4ZRJ A;  2P0H A;  2I5C A;  1V5M A;  1Z87 A;  3PEG A;  2ROZ B;  5EFX A;  1AQC A;  3O96 A;  1ZSQ A;  1ZVR A;  4A6F A;  1EGX A;  4KVG B;  2COA A;  2YSZ A;  1FOE A;  1B55 A;  2RGN B;  1ZM0 A;  2FJL A;  5KQ1 A;  1XCG A;  1U27 A;  5HE3 A;  2P8V A;  3PP2 A;  3AU4 A;  3F5R A;  2K2J A;  1V5P A;  4IOY X;  2D4Q A;  4K2O A;  4EMO A;  5C79 A;  1FHO A;  2DX1 A;  2P0F A;  2EMT A;  1NTY A;  3ODO A;  1OY2 A;  1WJM A;  2KUP A;  4CHJ A;  3FEH A;  4IAP A;  1Q67 A;  1BTK A;  1ZC3 B;  1X11 A;  1WGU A;  2VSZ A;  3CXB B;  4HAZ B;  2D2Q A;  2YS5 A;  4K17 A;  3G9W A;  4L6E A;  4GN1 A;  3U8Z A;  2DHJ A;  4HB3 B;  2QKL A;  2BCJ A;  3V5W A;  1UEF A;  1P3R A;  2KCJ A;  2V76 A;  1X86 A;  2JP2 A;  3DXC A;  3P7Z A;  1NU2 A;  1OQN A;  1W1H A;  3QIJ A;  5J3T A;  3F0W A;  2N23 A;  4NSW A;  3IVF A;  4IFS A;  5J3Q A;  2RSG A;  4GXB A;  5JP4 A;  3SUZ A;  4Y94 A;  2LOX A;  5C5B A;  1IRS A;  3FM8 C;  2DYQ A;  2E2X A;  2CAY A;  3T06 A;  1FHW A;  2DFK A;  2CRF A;  2ELA A;  2HE7 A;  5D27 A;  5C6R A;  1W1D A;  3WA0 A;  1XD4 A;  1M7R A;  1XX0 A;  2DKP A;  2MDX A;  3PSC A;  2MWN B;  1WVH A;  1V61 A;  1U5D A;  2H7E A;  3FSS A;  4BBK A;  2COF A;  1X1F A;  3PVL A;  1PLS A;  1WI1 A;  2R0D A;  1PMS A;  4XWX A;  4KHO A;  2KGX B;  3KSY A;  1WGQ A;  4HAU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...