1EAZA

Crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANDEM PH DOMAIN CONTAINING PROTEIN-1
publication title Crystal Structure of the Phosphatidylinositol 3,4-Bisphosphate-Binding Pleckstrin Homology (Ph) Domain of Tandem Ph-Domain-Containing Protein 1 (Tapp1): Molecular Basis of Lipid Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1eazA00
3AJ4A 2CRFA 1UNQA 3T06A 1U5GA 4HB2B 4IAPA 2Y8GA 3TW1A 1V5PA 1GC6A 3AU5A 3P6AA 1XR0B 4EMOA 1WJ1A 1WJMA 1NTYA 1IRSA 3PP2A 2VKIA 2QKMA 2UZRA 2DYNA 1EGXA 2OQBA 2LYDA 3D8DA 1FHXA 2YT0A 1FOEA 2DYQA 4KHBB 4YONA 1DDVA 2D9ZA 2P0HA 2RVBB 4GN1A 3OANA 4A5KA 1WVHA 3WA0A 2VSZA 2CAYA 5FI1A 2D4QA 4HAVB 2N23A 3ODOA 3PEGA 5CLLB 5D3XA 3ULBA 4F7UP 4HHVA 3PSCA 3A8QA 1AWEA 1ZC4B 3GYOA 5HE1A 3ZVRA 1Q67A 2D11A 1FAOA 2P8VA 4KHOA 3DXEA 2MWNB 1EF1A 3CXBB 1LB1A 2Y8FA 3SUZA 1MIXA 2W2XC 2DN6A 1U29A 1UPQA 2L1CA 2V76A 4ZRKA 5LOPB 1J19A 1DDMA 4PQ0A 5HE2A 1FHOA 2RGNB 5JLJB 1U5EA 3V5WA 1UPRA 2LOXA 4CYEA 1DYNA 2YF0A 4PNKA 2YSZA 1ZC3B 5D27A 2D2QA 1WI1A 2KUPA 5C6RA 5J3TA 3ODXA 3BINA 2EMTA 4NY0A 5DHFB 5L81A 1SHCA 3PG7A 1U5DA 4GMXB 2GJYA 3HQCA 3GYPA 1V88A 2CY4A 5D3VA 2ELBA 2DLWA 4H8SA 2I5FA 3FEHA 3KZ1A 3LJUX 3D8EA 5KQ1A 1EVHA 3KSYA 2CY5A 4TKNA 2VRWB 1DROA 2H7DA 2W2WA 2YT1A 5C16A 1FB8A 3AU4A 2DX5A 2NZ8B 1WGQA 2YS5A 4K81A 2R09A 1ZVRA 3F0WA 4HAUB 1WGUA 2AEHA 1J0WA 1SGHA 3F5RA 1PFJA 4YL8A 2G35A 1I2HA 5HE3A 3QBVB 4B6HA 4K2OA 2DKPA 1XODA 1PLSA 2D9VA 1GG3A 4NSWA 1MKEA 2Z0OA 4CHMA 1X11A 3ULCA 2OTXA 3SYXA 4A6FA 3DXDA 3G9WA 2DX1A 1OY2A 3PVUA 5KCVA 1V5UA 1XCGA 3FSSA 3X23A 5DHAB 1UEFA 1FHWA 1P5TA 3U8ZA 1XX0A 4ZRJA 2M14A 4HB3B 2RNRB 4WVFB 1TXDA 3UZTA 1X1FA 2ZPYA 3U7DA 2EC1A 4MK0A 5GOWB 1NU2A 2JP2A 1P3RA 1UNRA 1KI1B 2N0YA 3TO1A 3D8FA 5JHHA 4A6KA 3DXCA 1X86A 3A8PA 2M38A 2YS3A 1ISNA 2P0FA 2FJLA 2D9WA 3ML4A 2K00A 1QC6A 4Z2NA 1GC7A 4XWXA 5C79A 2DA0A 2LG1A 1EAZA 2J0KA 4Y94A 2MKRA 3KY9A 2UZSA 2X18A 1BWNA 2AL6A 3SV1A 2YVCA 2HE7A 4DBBA 1H4RA 2DFKA 1K5GB 4GMVA 3BJIA 1RJ2A 5FI0A 2IYBA 2RSGA 4GPTB 1NTVA 1MIZB 2K2UA 5EFXA 2XQNM 4MT7A 3NSUA 4IOYX 5J3QA 2D9XA 2LKOA 5DIFB 2J0MA 2KGXB 2Y7BA 2QKLA 2P0DA 4F7HA 2YRYA 1XKEA 3A98B 3VIAA 4MY6A 1LW3A 1TQZA 1M7EA 3FM8C 1ZSQA 4K2PA 2RUKB 4HDOA 1BTKA 4WSFA 4HAYB 4HAXB 3RCPA 1MK7B 1Z87A 4WJ7A 1P6SA 1DBHA 2YS1A 1PMSA 5KQ4A 4D0NB 1B55A 3M1IB 1M7RA 2COCA 1W1DA 3P7ZA 2ADZA 2DHJA 4HAZB 2GCJA 1BAKA 2R0DA 4CHJA 2Z0PA 2COAA 1BTNA 4DX90 5D3YA 5JP4A 1ZM0A 1K5DB 4L6EA 1U2BA 1AQCA 2E2XA 4HB4B 2J59M 2D10A 2DKQA 2D9YA 2K2JA 4KHAA 4TYZA 4IFSA 3KRWA 4GZUA 5C5BA 5J3YA 1QQGA 3O96A 1W1GA 5JHGA 3QWMA 4DX8A 4HDQA 4Z2MB 5DI9B 2GCLA 1N3HA 2DHIA 3ZDTA 4K17A 2LULA 1V5MA 3MDBC 4ZRIA 4C0AA 5HE0A 1KZ7A 2MDXA 4EKUA 2CODA 4HB0B 2UVMA 2I1KA 1V89A 3TFMA 3TCAA 1MAIA 2I5CA 5CLQB 1FGYA 1Y5OA 3PVLA 4GXBA 1UNPA 2ROVA 2NMBA 1FGZA 4F7GA 5DH9B 2LOZA 4HAWB 3SO6A 2BCJA 2COFA 1OQNA 2KCJA 3IVFA 3TVVA 2RLOA 1DDWA 2DTCA 2IFSA 1MK9B 1E5WA 3KRXA 3ODWA 4A6HA 3MPXA 1OMWA 2Q13A 3PZDA 2H7EA 1X05A 1H10A 1Y19B 2PZ1A 1W1HA 2L2IA 2EMSA 1WG7A 3QIJA 2EJ8A 5LONB 1NI2A 2I1JA 2HTHB 4A6FB 2ELAA 4P7IA 3WYFB 2J0JA 2W2XD 1KZGA 1RRPB 1MPHA 4KAXB 2MFQA 3CIKA 1U5FA 1U27A 1I7AA 3SNHA 4KVGB 2GS0A 5C5BB 3HK0A 4EJNA 5D3WA 4HATB 1XD4A 4DXAB 1TJ6A 3N7CA 2ROZB 2DHKA 1X1GA 2Z0QA 3VOQA 3HW2B 4BBKA 3PVWA 1V61A
chains in the Genus database with same CATH superfamily
3AJ4A 2CRFA 1UNQA 2Z14A 3T06A 1U5GA 4HB2B 4IAPA 2Y8GA 3TW1A 1V5PA 1GC6A 3AU5A 3P6AA 1XR0B 4EMOA 1WJ1A 1WJMA 1NTYA 1IRSA 3PP2A 2VKIA 2QKMA 2UZRA 2DYNA 1EGXA 2OQBA 2LYDA 3D8DA 1FHXA 2YT0A 1FOEA 2DYQA 4KHBB 4YONA 1DDVA 2D9ZA 2P0HA 2RVBB 4GOUA 4GN1A 2FJUB 3OANA 4A5KA 1WVHA 3WA0A 5I2SA 2RRFA 2VSZA 2CAYA 5FI1A 2GUMA 1MI1A 2D4QA 4HAVB 2N23A 3ODOA 3PEGA 5CLLB 5D3XA 3ULBA 4F7UP 4HHVA 3PSCA 3A8QA 1AWEA 4L1RA 1ZC4B 3GYOA 4DIXA 5HE1A 3ZVRA 2R2YA 4HSIA 1Q67A 2D11A 1FAOA 2P8VA 4KHOA 3DXEA 2MWNB 1EF1A 3CXBB 1LB1A 2Y8FA 3SUZA 1MIXA 2W2XC 2DN6A 1U29A 1UPQA 2L1CA 2V76A 4ZRKA 5LOPB 1J19A 1DDMA 4PQ0A 5HE2A 1FHOA 2RGNB 5JLJB 1U5EA 3V5WA 1UPRA 2KIGA 2LOXA 4CYEA 1DYNA 2YF0A 4PNKA 2YSZA 1ZC3B 3NWAA 3FVCA 5D27A 2D2QA 1WI1A 2KR0A 2KUPA 5C6RA 5J3TA 3ODXA 3BINA 2EMTA 4NY0A 5DHFB 5L81A 1SHCA 3PG7A 1U5DA 4GMXB 4QJ4B 2GJYA 3HQCA 3GYPA 1V88A 2CY4A 5D3VA 1BAKA 2ELBA 2DLWA 4H8SA 2I5FA 3FEHA 3KZ1A 3LJUX 3D8EA 5KQ1A 1EVHA 3KSYA 2CY5A 4TKNA 2VRWB 2Z4DA 1DROA 2H7DA 2W2WA 4CSQA 2YT1A 5C16A 1FB8A 3AU4A 2DX5A 2NZ8B 1WGQA 2YS5A 4K81A 2R09A 1ZVRA 3F0WA 4HAUB 1WGUA 2AEHA 1J0WA 4QJ5B 3A58A 1SGHA 3F5RA 1PFJA 4YL8A 2G35A 1I2HA 5HE3A 2Z13A 3QBVB 4B6HA 4K2OA 2DKPA 1XODA 1PLSA 2D9VA 1GG3A 4NSWA 1MKEA 2Z0OA 4CHMA 1X11A 2K49A 3ULCA 2OTXA 3SYXA 4A6FA 3DXDA 3G9WA 2DX1A 1OY2A 3PVUA 5KCVA 1V5UA 4D6WA 1XCGA 3FSSA 3X23A 5DHAB 1UEFA 1FHWA 1P5TA 3U8ZA 1XX0A 4ZRJA 2KIEA 2M14A 4HB3B 2RNRB 4WVFB 1TXDA 3UZTA 1X1FA 2ZPYA 3U7DA 2EC1A 4MK0A 5GOWB 1NU2A 2JP2A 1P3RA 1UNRA 1KI1B 2N0YA 3TO1A 3D8FA 3NWDA 4QXAB 3HIEA 5JHHA 4A6KA 3DXCA 1X86A 3A8PA 2M38A 2YS3A 1ISNA 2P0FA 2FJLA 2D9WA 3ML4A 2K00A 3NWFA 1QC6A 4Z2NA 1GC7A 4XWXA 5C79A 2DA0A 2LG1A 1EAZA 2J0KA 2ZKMX 4Y94A 2MKRA 3KY9A 2UZSA 2X18A 1BWNA 2AL6A 3SV1A 2YVCA 2HE7A 4DBBA 1H4RA 2K8EA 2DFKA 1K5GB 4GMVA 3BJIA 1RJ2A 5FI0A 2IYBA 2RSGA 4GPTB 1NTVA 1MIZB 2K2UA 5EFXA 2XQNM 4MT7A 3NSUA 4IOYX 5J3QA 2D9XA 2LKOA 5DIFB 2J0MA 2KGXB 2Y7BA 2QKLA 2P0DA 4F7HA 2YRYA 1XKEA 3A98B 3VIAA 4MY6A 1LW3A 3OHMB 1TQZA 1M7EA 3FM8C 1ZSQA 4K2PA 2RUKB 4HDOA 1BTKA 4WSFA 4HAYB 4HAXB 3RCPA 1MK7B 1Z87A 4WJ7A 1P6SA 1DBHA 3B77A 2YS1A 1PMSA 5KQ4A 4D0NB 1B55A 3M1IB 1M7RA 2COCA 1W1DA 3P7ZA 2ADZA 2DHJA 4HAZB 2GCJA 3U12A 2R0DA 4CHJA 2COAA 2Z0PA 1ZYIA 1BTNA 5D3YA 4DX90 5JP4A 1ZM0A 1K5DB 4L6EA 1U2BA 1AQCA 2E2XA 4HB4B 2J59M 2D10A 2DKQA 4OSNA 2D9YA 2K2JA 4KHAA 4TYZA 4IFSA 3KRWA 4GZUA 5C5BA 5J3YA 1QQGA 3O96A 5I2MA 1W1GA 5JHGA 3QWMA 4DX8A 4HDQA 4Z2MB 5DI9B 2GCLA 1N3HA 2DHIA 3ZDTA 4K17A 2LULA 1V5MA 3MDBC 4ZRIA 4C0AA 5HE0A 1KZ7A 2MDXA 4EKUA 2CODA 4HB0B 2UVMA 2I1KA 4OT1A 1V89A 3TFMA 3TCAA 5IRSA 1MAIA 2I5CA 5CLQB 1FGYA 1Y5OA 3PVLA 4GXBA 3HSAA 1UNPA 2ROVA 2KUQA 2NMBA 1FGZA 4F7GA 5DH9B 2LOZA 4HAWB 3SO6A 2BCJA 2COFA 1OQNA 5M4YB 2KCJA 3IVFA 2NBVA 2RLOA 1DDWA 2DTCA 2IFSA 1MK9B 3TVVA 1E5WA 3KRXA 3ODWA 2YT2A 4A6HA 3MPXA 1OMWA 3DCXA 4KHBA 2Q13A 3PZDA 2H7EA 4GNKB 1X05A 1H10A 1Y19B 2PZ1A 1W1HA 2L2IA 2EMSA 1WG7A 3QIJA 2EJ8A 5LONB 1NI2A 5LG4B 2I1JA 2HTHB 4A6FB 2ELAA 4P7IA 3WYFB 2J0JA 2W2XD 1KZGA 1RRPB 4QJ3B 1MPHA 4KAXB 1T77A 2MFQA 3CIKA 1U5FA 1U27A 1I7AA 3SNHA 4KVGB 2GS0A 5C5BB 2Z59A 3HK0A 3NW8A 4EJNA 5D3WA 4HATB 1XD4A 4DXAB 1TJ6A 3N7CA 2ROZB 2DHKA 1X1GA 2Z0QA 3VOQA 3HW2B 4BBKA 3PVWA 1V61A
chains in the Genus database with same CATH topology
3AJ4A 2CRFA 1UNQA 3T06A 1U5GA 4HB2B 4IAPA 2Y8GA 3TW1A 1V5PA 1GC6A 3AU5A 3P6AA 1XR0B 4EMOA 1WJ1A 1WJMA 1NTYA 1IRSA 3PP2A 2VKIA 2QKMA 2UZRA 2DYNA 1EGXA 2OQBA 2LYDA 3D8DA 1FHXA 2YT0A 1FOEA 2DYQA 4KHBB 4YONA 1DDVA 2D9ZA 2P0HA 2RVBB 4GN1A 3OANA 4A5KA 1WVHA 3WA0A 2VSZA 2CAYA 5FI1A 2D4QA 4HAVB 2N23A 3ODOA 3PEGA 5CLLB 5D3XA 3ULBA 4F7UP 4HHVA 3PSCA 3A8QA 1AWEA 1ZC4B 3GYOA 5HE1A 3ZVRA 1Q67A 2D11A 1FAOA 2P8VA 4KHOA 3DXEA 2MWNB 1EF1A 3CXBB 1LB1A 2Y8FA 3SUZA 1MIXA 2W2XC 2DN6A 1U29A 1UPQA 2L1CA 2V76A 4ZRKA 5LOPB 1J19A 1DDMA 4PQ0A 5HE2A 1FHOA 2RGNB 5JLJB 1U5EA 3V5WA 1UPRA 2LOXA 4CYEA 1DYNA 2YF0A 4PNKA 2YSZA 1ZC3B 5D27A 2D2QA 1WI1A 2KUPA 5C6RA 5J3TA 3ODXA 3BINA 2EMTA 4NY0A 5DHFB 5L81A 1SHCA 3PG7A 1U5DA 4GMXB 2GJYA 3HQCA 3GYPA 1V88A 2CY4A 5D3VA 2ELBA 2DLWA 4H8SA 2I5FA 3FEHA 3KZ1A 3LJUX 3D8EA 5KQ1A 1EVHA 3KSYA 2CY5A 4TKNA 2VRWB 1DROA 2H7DA 2W2WA 2YT1A 5C16A 1FB8A 3AU4A 2DX5A 2NZ8B 1WGQA 2YS5A 4K81A 2R09A 1ZVRA 3F0WA 4HAUB 1WGUA 2AEHA 1J0WA 1SGHA 3F5RA 1PFJA 4YL8A 2G35A 1I2HA 5HE3A 3QBVB 4B6HA 4K2OA 2DKPA 1XODA 1PLSA 2D9VA 1GG3A 4NSWA 1MKEA 2Z0OA 4CHMA 1X11A 3ULCA 2OTXA 3SYXA 4A6FA 3DXDA 3G9WA 2DX1A 1OY2A 3PVUA 5KCVA 1V5UA 1XCGA 3FSSA 3X23A 5DHAB 1UEFA 1FHWA 1P5TA 3U8ZA 1XX0A 4ZRJA 2M14A 4HB3B 2RNRB 4WVFB 1TXDA 3UZTA 1X1FA 2ZPYA 3U7DA 2EC1A 4MK0A 5GOWB 1NU2A 2JP2A 1P3RA 1UNRA 1KI1B 2N0YA 3TO1A 3D8FA 5JHHA 4A6KA 3DXCA 1X86A 3A8PA 2M38A 2YS3A 1ISNA 2P0FA 2FJLA 2D9WA 3ML4A 2K00A 1QC6A 4Z2NA 1GC7A 4XWXA 5C79A 2DA0A 2LG1A 1EAZA 2J0KA 4Y94A 2MKRA 3KY9A 2UZSA 2X18A 1BWNA 2AL6A 3SV1A 2YVCA 2HE7A 4DBBA 1H4RA 2DFKA 1K5GB 4GMVA 3BJIA 1RJ2A 5FI0A 2IYBA 2RSGA 4GPTB 1NTVA 1MIZB 2K2UA 5EFXA 2XQNM 4MT7A 3NSUA 4IOYX 5J3QA 2D9XA 2LKOA 5DIFB 2J0MA 2KGXB 2Y7BA 2QKLA 2P0DA 4F7HA 2YRYA 1XKEA 3A98B 3VIAA 4MY6A 1LW3A 1TQZA 1M7EA 3FM8C 1ZSQA 4K2PA 2RUKB 4HDOA 1BTKA 4WSFA 4HAYB 4HAXB 3RCPA 1MK7B 1Z87A 4WJ7A 1P6SA 1DBHA 2YS1A 1PMSA 5KQ4A 4D0NB 1B55A 3M1IB 1M7RA 2COCA 1W1DA 3P7ZA 2ADZA 2DHJA 4HAZB 2GCJA 1BAKA 2R0DA 4CHJA 2Z0PA 2COAA 1BTNA 4DX90 5D3YA 5JP4A 1ZM0A 1K5DB 4L6EA 1U2BA 1AQCA 2E2XA 4HB4B 2J59M 2D10A 2DKQA 2D9YA 2K2JA 4KHAA 4TYZA 4IFSA 3KRWA 4GZUA 5C5BA 5J3YA 1QQGA 3O96A 1W1GA 5JHGA 3QWMA 4DX8A 4HDQA 4Z2MB 5DI9B 2GCLA 1N3HA 2DHIA 3ZDTA 4K17A 2LULA 1V5MA 3MDBC 4ZRIA 4C0AA 5HE0A 1KZ7A 2MDXA 4EKUA 2CODA 4HB0B 2UVMA 2I1KA 1V89A 3TFMA 3TCAA 1MAIA 2I5CA 5CLQB 1FGYA 1Y5OA 3PVLA 4GXBA 1UNPA 2ROVA 2NMBA 1FGZA 4F7GA 5DH9B 2LOZA 4HAWB 3SO6A 2BCJA 2COFA 1OQNA 2KCJA 3IVFA 3TVVA 2RLOA 1DDWA 2DTCA 2IFSA 1MK9B 1E5WA 3KRXA 3ODWA 4A6HA 3MPXA 1OMWA 2Q13A 3PZDA 2H7EA 1X05A 1H10A 1Y19B 2PZ1A 1W1HA 2L2IA 2EMSA 1WG7A 3QIJA 2EJ8A 5LONB 1NI2A 2I1JA 2HTHB 4A6FB 2ELAA 4P7IA 3WYFB 2J0JA 2W2XD 1KZGA 1RRPB 1MPHA 4KAXB 2MFQA 3CIKA 1U5FA 1U27A 1I7AA 3SNHA 4KVGB 2GS0A 5C5BB 3HK0A 4EJNA 5D3WA 4HATB 1XD4A 4DXAB 1TJ6A 3N7CA 2ROZB 2DHKA 1X1GA 2Z0QA 3VOQA 3HW2B 4BBKA 3PVWA 1V61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJ4 A;  2CRF A;  1UNQ A;  3T06 A;  1U5G A;  4HB2 B;  4IAP A;  2Y8G A;  3TW1 A;  1V5P A;  1GC6 A;  3AU5 A;  3P6A A;  1XR0 B;  4EMO A;  1WJ1 A;  1WJM A;  1NTY A;  1IRS A;  3PP2 A;  2VKI A;  2QKM A;  2UZR A;  2DYN A;  1EGX A;  2OQB A;  2LYD A;  3D8D A;  1FHX A;  2YT0 A;  1FOE A;  2DYQ A;  4KHB B;  4YON A;  1DDV A;  2D9Z A;  2P0H A;  2RVB B;  4GN1 A;  3OAN A;  4A5K A;  1WVH A;  3WA0 A;  2VSZ A;  2CAY A;  5FI1 A;  2D4Q A;  4HAV B;  2N23 A;  3ODO A;  3PEG A;  5CLL B;  5D3X A;  3ULB A;  4F7U P;  4HHV A;  3PSC A;  3A8Q A;  1AWE A;  1ZC4 B;  3GYO A;  5HE1 A;  3ZVR A;  1Q67 A;  2D11 A;  1FAO A;  2P8V A;  4KHO A;  3DXE A;  2MWN B;  1EF1 A;  3CXB B;  1LB1 A;  2Y8F A;  3SUZ A;  1MIX A;  2W2X C;  2DN6 A;  1U29 A;  1UPQ A;  2L1C A;  2V76 A;  4ZRK A;  5LOP B;  1J19 A;  1DDM A;  4PQ0 A;  5HE2 A;  1FHO A;  2RGN B;  5JLJ B;  1U5E A;  3V5W A;  1UPR A;  2LOX A;  4CYE A;  1DYN A;  2YF0 A;  4PNK A;  2YSZ A;  1ZC3 B;  5D27 A;  2D2Q A;  1WI1 A;  2KUP A;  5C6R A;  5J3T A;  3ODX A;  3BIN A;  2EMT A;  4NY0 A;  5DHF B;  5L81 A;  1SHC A;  3PG7 A;  1U5D A;  4GMX B;  2GJY A;  3HQC A;  3GYP A;  1V88 A;  2CY4 A;  5D3V A;  2ELB A;  2DLW A;  4H8S A;  2I5F A;  3FEH A;  3KZ1 A;  3LJU X;  3D8E A;  5KQ1 A;  1EVH A;  3KSY A;  2CY5 A;  4TKN A;  2VRW B;  1DRO A;  2H7D A;  2W2W A;  2YT1 A;  5C16 A;  1FB8 A;  3AU4 A;  2DX5 A;  2NZ8 B;  1WGQ A;  2YS5 A;  4K81 A;  2R09 A;  1ZVR A;  3F0W A;  4HAU B;  1WGU A;  2AEH A;  1J0W A;  1SGH A;  3F5R A;  1PFJ A;  4YL8 A;  2G35 A;  1I2H A;  5HE3 A;  3QBV B;  4B6H A;  4K2O A;  2DKP A;  1XOD A;  1PLS A;  2D9V A;  1GG3 A;  4NSW A;  1MKE A;  2Z0O A;  4CHM A;  1X11 A;  3ULC A;  2OTX A;  3SYX A;  4A6F A;  3DXD A;  3G9W A;  2DX1 A;  1OY2 A;  3PVU A;  5KCV A;  1V5U A;  1XCG A;  3FSS A;  3X23 A;  5DHA B;  1UEF A;  1FHW A;  1P5T A;  3U8Z A;  1XX0 A;  4ZRJ A;  2M14 A;  4HB3 B;  2RNR B;  4WVF B;  1TXD A;  3UZT A;  1X1F A;  2ZPY A;  3U7D A;  2EC1 A;  4MK0 A;  5GOW B;  1NU2 A;  2JP2 A;  1P3R A;  1UNR A;  1KI1 B;  2N0Y A;  3TO1 A;  3D8F A;  5JHH A;  4A6K A;  3DXC A;  1X86 A;  3A8P A;  2M38 A;  2YS3 A;  1ISN A;  2P0F A;  2FJL A;  2D9W A;  3ML4 A;  2K00 A;  1QC6 A;  4Z2N A;  1GC7 A;  4XWX A;  5C79 A;  2DA0 A;  2LG1 A;  1EAZ A;  2J0K A;  4Y94 A;  2MKR A;  3KY9 A;  2UZS A;  2X18 A;  1BWN A;  2AL6 A;  3SV1 A;  2YVC A;  2HE7 A;  4DBB A;  1H4R A;  2DFK A;  1K5G B;  4GMV A;  3BJI A;  1RJ2 A;  5FI0 A;  2IYB A;  2RSG A;  4GPT B;  1NTV A;  1MIZ B;  2K2U A;  5EFX A;  2XQN M;  4MT7 A;  3NSU A;  4IOY X;  5J3Q A;  2D9X A;  2LKO A;  5DIF B;  2J0M A;  2KGX B;  2Y7B A;  2QKL A;  2P0D A;  4F7H A;  2YRY A;  1XKE A;  3A98 B;  3VIA A;  4MY6 A;  1LW3 A;  1TQZ A;  1M7E A;  3FM8 C;  1ZSQ A;  4K2P A;  2RUK B;  4HDO A;  1BTK A;  4WSF A;  4HAY B;  4HAX B;  3RCP A;  1MK7 B;  1Z87 A;  4WJ7 A;  1P6S A;  1DBH A;  2YS1 A;  1PMS A;  5KQ4 A;  4D0N B;  1B55 A;  3M1I B;  1M7R A;  2COC A;  1W1D A;  3P7Z A;  2ADZ A;  2DHJ A;  4HAZ B;  2GCJ A;  1BAK A;  2R0D A;  4CHJ A;  2Z0P A;  2COA A;  1BTN A;  4DX9 0;  5D3Y A;  5JP4 A;  1ZM0 A;  1K5D B;  4L6E A;  1U2B A;  1AQC A;  2E2X A;  4HB4 B;  2J59 M;  2D10 A;  2DKQ A;  2D9Y A;  2K2J A;  4KHA A;  4TYZ A;  4IFS A;  3KRW A;  4GZU A;  5C5B A;  5J3Y A;  1QQG A;  3O96 A;  1W1G A;  5JHG A;  3QWM A;  4DX8 A;  4HDQ A;  4Z2M B;  5DI9 B;  2GCL A;  1N3H A;  2DHI A;  3ZDT A;  4K17 A;  2LUL A;  1V5M A;  3MDB C;  4ZRI A;  4C0A A;  5HE0 A;  1KZ7 A;  2MDX A;  4EKU A;  2COD A;  4HB0 B;  2UVM A;  2I1K A;  1V89 A;  3TFM A;  3TCA A;  1MAI A;  2I5C A;  5CLQ B;  1FGY A;  1Y5O A;  3PVL A;  4GXB A;  1UNP A;  2ROV A;  2NMB A;  1FGZ A;  4F7G A;  5DH9 B;  2LOZ A;  4HAW B;  3SO6 A;  2BCJ A;  2COF A;  1OQN A;  2KCJ A;  3IVF A;  3TVV A;  2RLO A;  1DDW A;  2DTC A;  2IFS A;  1MK9 B;  1E5W A;  3KRX A;  3ODW A;  4A6H A;  3MPX A;  1OMW A;  2Q13 A;  3PZD A;  2H7E A;  1X05 A;  1H10 A;  1Y19 B;  2PZ1 A;  1W1H A;  2L2I A;  2EMS A;  1WG7 A;  3QIJ A;  2EJ8 A;  5LON B;  1NI2 A;  2I1J A;  2HTH B;  4A6F B;  2ELA A;  4P7I A;  3WYF B;  2J0J A;  2W2X D;  1KZG A;  1RRP B;  1MPH A;  4KAX B;  2MFQ A;  3CIK A;  1U5F A;  1U27 A;  1I7A A;  3SNH A;  4KVG B;  2GS0 A;  5C5B B;  3HK0 A;  4EJN A;  5D3W A;  4HAT B;  1XD4 A;  4DXA B;  1TJ6 A;  3N7C A;  2ROZ B;  2DHK A;  1X1G A;  2Z0Q A;  3VOQ A;  3HW2 B;  4BBK A;  3PVW A;  1V61 A; 
#chains in the Genus database with same CATH topology
 3AJ4 A;  2CRF A;  1UNQ A;  2Z14 A;  3T06 A;  1U5G A;  4HB2 B;  4IAP A;  2Y8G A;  3TW1 A;  1V5P A;  1GC6 A;  3AU5 A;  3P6A A;  1XR0 B;  4EMO A;  1WJ1 A;  1WJM A;  1NTY A;  1IRS A;  3PP2 A;  2VKI A;  2QKM A;  2UZR A;  2DYN A;  1EGX A;  2OQB A;  2LYD A;  3D8D A;  1FHX A;  2YT0 A;  1FOE A;  2DYQ A;  4KHB B;  4YON A;  1DDV A;  2D9Z A;  2P0H A;  2RVB B;  4GOU A;  4GN1 A;  2FJU B;  3OAN A;  4A5K A;  1WVH A;  3WA0 A;  5I2S A;  2RRF A;  2VSZ A;  2CAY A;  5FI1 A;  2GUM A;  1MI1 A;  2D4Q A;  4HAV B;  2N23 A;  3ODO A;  3PEG A;  5CLL B;  5D3X A;  3ULB A;  4F7U P;  4HHV A;  3PSC A;  3A8Q A;  1AWE A;  4L1R A;  1ZC4 B;  3GYO A;  4DIX A;  5HE1 A;  3ZVR A;  2R2Y A;  4HSI A;  1Q67 A;  2D11 A;  1FAO A;  2P8V A;  4KHO A;  3DXE A;  2MWN B;  1EF1 A;  3CXB B;  1LB1 A;  2Y8F A;  3SUZ A;  1MIX A;  2W2X C;  2DN6 A;  1U29 A;  1UPQ A;  2L1C A;  2V76 A;  4ZRK A;  5LOP B;  1J19 A;  1DDM A;  4PQ0 A;  5HE2 A;  1FHO A;  2RGN B;  5JLJ B;  1U5E A;  3V5W A;  1UPR A;  2KIG A;  2LOX A;  4CYE A;  1DYN A;  2YF0 A;  4PNK A;  2YSZ A;  1ZC3 B;  3NWA A;  3FVC A;  5D27 A;  2D2Q A;  1WI1 A;  2KR0 A;  2KUP A;  5C6R A;  5J3T A;  3ODX A;  3BIN A;  2EMT A;  4NY0 A;  5DHF B;  5L81 A;  1SHC A;  3PG7 A;  1U5D A;  4GMX B;  4QJ4 B;  2GJY A;  3HQC A;  3GYP A;  1V88 A;  2CY4 A;  5D3V A;  1BAK A;  2ELB A;  2DLW A;  4H8S A;  2I5F A;  3FEH A;  3KZ1 A;  3LJU X;  3D8E A;  5KQ1 A;  1EVH A;  3KSY A;  2CY5 A;  4TKN A;  2VRW B;  2Z4D A;  1DRO A;  2H7D A;  2W2W A;  4CSQ A;  2YT1 A;  5C16 A;  1FB8 A;  3AU4 A;  2DX5 A;  2NZ8 B;  1WGQ A;  2YS5 A;  4K81 A;  2R09 A;  1ZVR A;  3F0W A;  4HAU B;  1WGU A;  2AEH A;  1J0W A;  4QJ5 B;  3A58 A;  1SGH A;  3F5R A;  1PFJ A;  4YL8 A;  2G35 A;  1I2H A;  5HE3 A;  2Z13 A;  3QBV B;  4B6H A;  4K2O A;  2DKP A;  1XOD A;  1PLS A;  2D9V A;  1GG3 A;  4NSW A;  1MKE A;  2Z0O A;  4CHM A;  1X11 A;  2K49 A;  3ULC A;  2OTX A;  3SYX A;  4A6F A;  3DXD A;  3G9W A;  2DX1 A;  1OY2 A;  3PVU A;  5KCV A;  1V5U A;  4D6W A;  1XCG A;  3FSS A;  3X23 A;  5DHA B;  1UEF A;  1FHW A;  1P5T A;  3U8Z A;  1XX0 A;  4ZRJ A;  2KIE A;  2M14 A;  4HB3 B;  2RNR B;  4WVF B;  1TXD A;  3UZT A;  1X1F A;  2ZPY A;  3U7D A;  2EC1 A;  4MK0 A;  5GOW B;  1NU2 A;  2JP2 A;  1P3R A;  1UNR A;  1KI1 B;  2N0Y A;  3TO1 A;  3D8F A;  3NWD A;  4QXA B;  3HIE A;  5JHH A;  4A6K A;  3DXC A;  1X86 A;  3A8P A;  2M38 A;  2YS3 A;  1ISN A;  2P0F A;  2FJL A;  2D9W A;  3ML4 A;  2K00 A;  3NWF A;  1QC6 A;  4Z2N A;  1GC7 A;  4XWX A;  5C79 A;  2DA0 A;  2LG1 A;  1EAZ A;  2J0K A;  2ZKM X;  4Y94 A;  2MKR A;  3KY9 A;  2UZS A;  2X18 A;  1BWN A;  2AL6 A;  3SV1 A;  2YVC A;  2HE7 A;  4DBB A;  1H4R A;  2K8E A;  2DFK A;  1K5G B;  4GMV A;  3BJI A;  1RJ2 A;  5FI0 A;  2IYB A;  2RSG A;  4GPT B;  1NTV A;  1MIZ B;  2K2U A;  5EFX A;  2XQN M;  4MT7 A;  3NSU A;  4IOY X;  5J3Q A;  2D9X A;  2LKO A;  5DIF B;  2J0M A;  2KGX B;  2Y7B A;  2QKL A;  2P0D A;  4F7H A;  2YRY A;  1XKE A;  3A98 B;  3VIA A;  4MY6 A;  1LW3 A;  3OHM B;  1TQZ A;  1M7E A;  3FM8 C;  1ZSQ A;  4K2P A;  2RUK B;  4HDO A;  1BTK A;  4WSF A;  4HAY B;  4HAX B;  3RCP A;  1MK7 B;  1Z87 A;  4WJ7 A;  1P6S A;  1DBH A;  3B77 A;  2YS1 A;  1PMS A;  5KQ4 A;  4D0N B;  1B55 A;  3M1I B;  1M7R A;  2COC A;  1W1D A;  3P7Z A;  2ADZ A;  2DHJ A;  4HAZ B;  2GCJ A;  3U12 A;  2R0D A;  4CHJ A;  2COA A;  2Z0P A;  1ZYI A;  1BTN A;  5D3Y A;  4DX9 0;  5JP4 A;  1ZM0 A;  1K5D B;  4L6E A;  1U2B A;  1AQC A;  2E2X A;  4HB4 B;  2J59 M;  2D10 A;  2DKQ A;  4OSN A;  2D9Y A;  2K2J A;  4KHA A;  4TYZ A;  4IFS A;  3KRW A;  4GZU A;  5C5B A;  5J3Y A;  1QQG A;  3O96 A;  5I2M A;  1W1G A;  5JHG A;  3QWM A;  4DX8 A;  4HDQ A;  4Z2M B;  5DI9 B;  2GCL A;  1N3H A;  2DHI A;  3ZDT A;  4K17 A;  2LUL A;  1V5M A;  3MDB C;  4ZRI A;  4C0A A;  5HE0 A;  1KZ7 A;  2MDX A;  4EKU A;  2COD A;  4HB0 B;  2UVM A;  2I1K A;  4OT1 A;  1V89 A;  3TFM A;  3TCA A;  5IRS A;  1MAI A;  2I5C A;  5CLQ B;  1FGY A;  1Y5O A;  3PVL A;  4GXB A;  3HSA A;  1UNP A;  2ROV A;  2KUQ A;  2NMB A;  1FGZ A;  4F7G A;  5DH9 B;  2LOZ A;  4HAW B;  3SO6 A;  2BCJ A;  2COF A;  1OQN A;  5M4Y B;  2KCJ A;  3IVF A;  2NBV A;  2RLO A;  1DDW A;  2DTC A;  2IFS A;  1MK9 B;  3TVV A;  1E5W A;  3KRX A;  3ODW A;  2YT2 A;  4A6H A;  3MPX A;  1OMW A;  3DCX A;  4KHB A;  2Q13 A;  3PZD A;  2H7E A;  4GNK B;  1X05 A;  1H10 A;  1Y19 B;  2PZ1 A;  1W1H A;  2L2I A;  2EMS A;  1WG7 A;  3QIJ A;  2EJ8 A;  5LON B;  1NI2 A;  5LG4 B;  2I1J A;  2HTH B;  4A6F B;  2ELA A;  4P7I A;  3WYF B;  2J0J A;  2W2X D;  1KZG A;  1RRP B;  4QJ3 B;  1MPH A;  4KAX B;  1T77 A;  2MFQ A;  3CIK A;  1U5F A;  1U27 A;  1I7A A;  3SNH A;  4KVG B;  2GS0 A;  5C5B B;  2Z59 A;  3HK0 A;  3NW8 A;  4EJN A;  5D3W A;  4HAT B;  1XD4 A;  4DXA B;  1TJ6 A;  3N7C A;  2ROZ B;  2DHK A;  1X1G A;  2Z0Q A;  3VOQ A;  3HW2 B;  4BBK A;  3PVW A;  1V61 A; 
#chains in the Genus database with same CATH homology
 3AJ4 A;  2CRF A;  1UNQ A;  3T06 A;  1U5G A;  4HB2 B;  4IAP A;  2Y8G A;  3TW1 A;  1V5P A;  1GC6 A;  3AU5 A;  3P6A A;  1XR0 B;  4EMO A;  1WJ1 A;  1WJM A;  1NTY A;  1IRS A;  3PP2 A;  2VKI A;  2QKM A;  2UZR A;  2DYN A;  1EGX A;  2OQB A;  2LYD A;  3D8D A;  1FHX A;  2YT0 A;  1FOE A;  2DYQ A;  4KHB B;  4YON A;  1DDV A;  2D9Z A;  2P0H A;  2RVB B;  4GN1 A;  3OAN A;  4A5K A;  1WVH A;  3WA0 A;  2VSZ A;  2CAY A;  5FI1 A;  2D4Q A;  4HAV B;  2N23 A;  3ODO A;  3PEG A;  5CLL B;  5D3X A;  3ULB A;  4F7U P;  4HHV A;  3PSC A;  3A8Q A;  1AWE A;  1ZC4 B;  3GYO A;  5HE1 A;  3ZVR A;  1Q67 A;  2D11 A;  1FAO A;  2P8V A;  4KHO A;  3DXE A;  2MWN B;  1EF1 A;  3CXB B;  1LB1 A;  2Y8F A;  3SUZ A;  1MIX A;  2W2X C;  2DN6 A;  1U29 A;  1UPQ A;  2L1C A;  2V76 A;  4ZRK A;  5LOP B;  1J19 A;  1DDM A;  4PQ0 A;  5HE2 A;  1FHO A;  2RGN B;  5JLJ B;  1U5E A;  3V5W A;  1UPR A;  2LOX A;  4CYE A;  1DYN A;  2YF0 A;  4PNK A;  2YSZ A;  1ZC3 B;  5D27 A;  2D2Q A;  1WI1 A;  2KUP A;  5C6R A;  5J3T A;  3ODX A;  3BIN A;  2EMT A;  4NY0 A;  5DHF B;  5L81 A;  1SHC A;  3PG7 A;  1U5D A;  4GMX B;  2GJY A;  3HQC A;  3GYP A;  1V88 A;  2CY4 A;  5D3V A;  2ELB A;  2DLW A;  4H8S A;  2I5F A;  3FEH A;  3KZ1 A;  3LJU X;  3D8E A;  5KQ1 A;  1EVH A;  3KSY A;  2CY5 A;  4TKN A;  2VRW B;  1DRO A;  2H7D A;  2W2W A;  2YT1 A;  5C16 A;  1FB8 A;  3AU4 A;  2DX5 A;  2NZ8 B;  1WGQ A;  2YS5 A;  4K81 A;  2R09 A;  1ZVR A;  3F0W A;  4HAU B;  1WGU A;  2AEH A;  1J0W A;  1SGH A;  3F5R A;  1PFJ A;  4YL8 A;  2G35 A;  1I2H A;  5HE3 A;  3QBV B;  4B6H A;  4K2O A;  2DKP A;  1XOD A;  1PLS A;  2D9V A;  1GG3 A;  4NSW A;  1MKE A;  2Z0O A;  4CHM A;  1X11 A;  3ULC A;  2OTX A;  3SYX A;  4A6F A;  3DXD A;  3G9W A;  2DX1 A;  1OY2 A;  3PVU A;  5KCV A;  1V5U A;  1XCG A;  3FSS A;  3X23 A;  5DHA B;  1UEF A;  1FHW A;  1P5T A;  3U8Z A;  1XX0 A;  4ZRJ A;  2M14 A;  4HB3 B;  2RNR B;  4WVF B;  1TXD A;  3UZT A;  1X1F A;  2ZPY A;  3U7D A;  2EC1 A;  4MK0 A;  5GOW B;  1NU2 A;  2JP2 A;  1P3R A;  1UNR A;  1KI1 B;  2N0Y A;  3TO1 A;  3D8F A;  5JHH A;  4A6K A;  3DXC A;  1X86 A;  3A8P A;  2M38 A;  2YS3 A;  1ISN A;  2P0F A;  2FJL A;  2D9W A;  3ML4 A;  2K00 A;  1QC6 A;  4Z2N A;  1GC7 A;  4XWX A;  5C79 A;  2DA0 A;  2LG1 A;  1EAZ A;  2J0K A;  4Y94 A;  2MKR A;  3KY9 A;  2UZS A;  2X18 A;  1BWN A;  2AL6 A;  3SV1 A;  2YVC A;  2HE7 A;  4DBB A;  1H4R A;  2DFK A;  1K5G B;  4GMV A;  3BJI A;  1RJ2 A;  5FI0 A;  2IYB A;  2RSG A;  4GPT B;  1NTV A;  1MIZ B;  2K2U A;  5EFX A;  2XQN M;  4MT7 A;  3NSU A;  4IOY X;  5J3Q A;  2D9X A;  2LKO A;  5DIF B;  2J0M A;  2KGX B;  2Y7B A;  2QKL A;  2P0D A;  4F7H A;  2YRY A;  1XKE A;  3A98 B;  3VIA A;  4MY6 A;  1LW3 A;  1TQZ A;  1M7E A;  3FM8 C;  1ZSQ A;  4K2P A;  2RUK B;  4HDO A;  1BTK A;  4WSF A;  4HAY B;  4HAX B;  3RCP A;  1MK7 B;  1Z87 A;  4WJ7 A;  1P6S A;  1DBH A;  2YS1 A;  1PMS A;  5KQ4 A;  4D0N B;  1B55 A;  3M1I B;  1M7R A;  2COC A;  1W1D A;  3P7Z A;  2ADZ A;  2DHJ A;  4HAZ B;  2GCJ A;  1BAK A;  2R0D A;  4CHJ A;  2Z0P A;  2COA A;  1BTN A;  4DX9 0;  5D3Y A;  5JP4 A;  1ZM0 A;  1K5D B;  4L6E A;  1U2B A;  1AQC A;  2E2X A;  4HB4 B;  2J59 M;  2D10 A;  2DKQ A;  2D9Y A;  2K2J A;  4KHA A;  4TYZ A;  4IFS A;  3KRW A;  4GZU A;  5C5B A;  5J3Y A;  1QQG A;  3O96 A;  1W1G A;  5JHG A;  3QWM A;  4DX8 A;  4HDQ A;  4Z2M B;  5DI9 B;  2GCL A;  1N3H A;  2DHI A;  3ZDT A;  4K17 A;  2LUL A;  1V5M A;  3MDB C;  4ZRI A;  4C0A A;  5HE0 A;  1KZ7 A;  2MDX A;  4EKU A;  2COD A;  4HB0 B;  2UVM A;  2I1K A;  1V89 A;  3TFM A;  3TCA A;  1MAI A;  2I5C A;  5CLQ B;  1FGY A;  1Y5O A;  3PVL A;  4GXB A;  1UNP A;  2ROV A;  2NMB A;  1FGZ A;  4F7G A;  5DH9 B;  2LOZ A;  4HAW B;  3SO6 A;  2BCJ A;  2COF A;  1OQN A;  2KCJ A;  3IVF A;  3TVV A;  2RLO A;  1DDW A;  2DTC A;  2IFS A;  1MK9 B;  1E5W A;  3KRX A;  3ODW A;  4A6H A;  3MPX A;  1OMW A;  2Q13 A;  3PZD A;  2H7E A;  1X05 A;  1H10 A;  1Y19 B;  2PZ1 A;  1W1H A;  2L2I A;  2EMS A;  1WG7 A;  3QIJ A;  2EJ8 A;  5LON B;  1NI2 A;  2I1J A;  2HTH B;  4A6F B;  2ELA A;  4P7I A;  3WYF B;  2J0J A;  2W2X D;  1KZG A;  1RRP B;  1MPH A;  4KAX B;  2MFQ A;  3CIK A;  1U5F A;  1U27 A;  1I7A A;  3SNH A;  4KVG B;  2GS0 A;  5C5B B;  3HK0 A;  4EJN A;  5D3W A;  4HAT B;  1XD4 A;  4DXA B;  1TJ6 A;  3N7C A;  2ROZ B;  2DHK A;  1X1G A;  2Z0Q A;  3VOQ A;  3HW2 B;  4BBK A;  3PVW A;  1V61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...