1EAZA

Crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
b'SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANDEM PH DOMAIN CONTAINING PROTEIN-1
publication title Crystal Structure of the Phosphatidylinositol 3,4-Bisphosphate-Binding Pleckstrin Homology (Ph) Domain of Tandem Ph-Domain-Containing Protein 1 (Tapp1): Molecular Basis of Lipid Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1eazA00
4WSFA 4A6KA 2EMTA 3ODOA 1U5GA 3SYXA 2P0DA 2EC1A 2D11A 3HK0A 2AL6A 5JHHA 3V5WA 2DLWA 4L6EA 1EVHA 2AEHA 3D8EA 4IAPA 2I5FA 3X23A 2VKIA 5DH9B 3G9WA 5C5BB 4HHVA 3ULBA 3KSYA 1MIXA 3GYPA 4K2OA 5D3XA 4HB2B 1H4RA 2QKMA 1WVHA 1W1GA 2ROZB 3VIAA 1KZ7A 3IVFA 1QC6A 2NZ8B 3A98B 2MWNB 2J0JA 1Y5OA 3PVUA 1OMWA 2LKOA 2R0DA 4HB0B 5D3YA 1WJ1A 3WA0A 2GJYA 2I1KA 3NSUA 5D27A 5FI0A 2BCJA 2CY5A 3U8ZA 2YT1A 2VSZA 3FEHA 4CHMA 2KCJA 1W1HA 1AQCA 2H7DA 3OANA 4PQ0A 1XD4A 4EKUA 1K5GB 1IRSA 1Q67A 2DKQA 2YS1A 3PZDA 1FOEA 4CYEA 4ZRKA 2CY4A 3N7CA 5GOWB 2D9WA 2D4QA 1WI1A 2HTHB 1UNRA 2J0MA 2DHIA 4NSWA 3PSCA 3KRXA 4MY6A 4EMOA 2P0HA 1UNPA 2HE7A 2M14A 2W2XD 3F5RA 2J0KA 2YF0A 1TJ6A 4IOYX 4GPTB 4DX90 1OQNA 1E5WA 2YS3A 2LYDA 1P6SA 1ISNA 2XQNM 3KZ1A 4DXAB 2K2JA 2FJLA 2DYQA 1ZVRA 2D9XA 2UZSA 2DKPA 5LOPB 2RVBB 5HE2A 2DHKA 1X11A 1ZSQA 1WG7A 2GS0A 1TXDA 2Z0QA 1FHXA 3FM8C 5HE3A 1M7RA 2I5CA 3QWMA 2YVCA 5CLQB 1J0WA 2D10A 2V76A 1BTKA 3SUZA 5C6RA 2LOZA 1RJ2A 1I7AA 1U2BA 1I2HA 1KI1B 4MK0A 4KVGB 2MFQA 4YONA 2Y8FA 3T06A 1V5UA 4GMXB 2D9ZA 1NTVA 4MT7A 5J3TA 4C0AA 2IFSA 2CODA 1X1GA 4HDOA 2OTXA 2W2XC 2P8VA 2G35A 4A5KA 4HAXB 4Z2NA 1AWEA 1V88A 2LULA 2ZPYA 3HW2B 2DFKA 5CLLB 5DHFB 1SGHA 3DXCA 4P7IA 3LJUX 1PFJA 1V61A 1EF1A 4ZRIA 1XODA 2EMSA 4HAUB 1MIZB 1GG3A 3TCAA 1U5FA 1DROA 4CHJA 1M7EA 1P5TA 1P3RA 1FGYA 2L2IA 2N23A 3ODWA 1X1FA 3VOQA 4KHOA 1MAIA 2Y7BA 2DA0A 1NTYA 2K00A 2LG1A 3UZTA 4K81A 2H7EA 5FI1A 1B55A 3MPXA 2I1JA 2DTCA 5KCVA 1QQGA 1H10A 1GC7A 1KZGA 1PMSA 2DX1A 4A6FB 3P7ZA 4KHAA 3DXDA 3CXBB 3PVWA 1TQZA 2UZRA 1MK7B 2QKLA 3TVVA 2DX5A 5C5BA 4F7HA 4WJ7A 2E2XA 3BJIA 3A8PA 2NMBA 4HDQA 5L81A 3FSSA 3P6AA 1BTNA 3QIJA 2DN6A 2YRYA 4HAWB 1UNQA 3O96A 4B6HA 2ADZA 1DDVA 2ROVA 2P0FA 2RSGA 3SNHA 5DIFB 3PG7A 2OQBA 3PP2A 2W2WA 1U29A 2YT0A 1DYNA 1XX0A 1DBHA 4GMVA 1UEFA 4ZRJA 5D3WA 5DI9B 3CIKA 1UPQA 3SO6A 4PNKA 1N3HA 2COFA 4EJNA 1W1DA 2MKRA 2RLOA 2R09A 5LONB 3PVLA 5JHGA 4KHBB 3HQCA 5JP4A 1FGZA 1RRPB 1V5PA 4DX8A 5DHAB 2K2UA 1NI2A 4IFSA 4TYZA 2YS5A 3RCPA 2D9YA 3AJ4A 1MK9B 1LW3A 2MDXA 2DYNA 1K5DB 3ZVRA 1OY2A 2Y8GA 1BAKA 2Z0PA 2CRFA 1GC6A 2Q13A 5J3YA 1FB8A 1XKEA 1X05A 2D9VA 2N0YA 1X86A 4F7UP 2GCJA 1U27A 5EFXA 2DHJA 3ZDTA 4BBKA 4GZUA 2KUPA 4TKNA 2L1CA 3KRWA 1UPRA 1FHOA 4K17A 5HE0A 2LOXA 1V89A 2M38A 1MPHA 2Z0OA 1SHCA 2ELBA 2J59M 1EAZA 4HAVB 4HATB 3TO1A 3M1IB 1XCGA 4HB4B 5C16A 2YSZA 2X18A 4NY0A 1WGUA 3A8QA 4H8SA 3DXEA 2CAYA 2VRWB 3MDBC 1FHWA 3QBVB 3U7DA 1WJMA 3GYOA 4HB3B 3WYFB 5KQ1A 2JP2A 1Y19B 2RGNB 2KGXB 1FAOA 2UVMA 3KY9A 1BWNA 3F0WA 5C79A 3ML4A 4Z2MB 1LB1A 4K2PA 1ZC3B 4KAXB 4GXBA 4WVFB 1V5MA 1DDWA 1J19A 1XR0B 1U5EA 1NU2A 4HAZB 1PLSA 1ZC4B 2COCA 3BINA 2COAA 2ELAA 4YL8A 3TW1A 3D8DA 4A6HA 3AU4A 2RUKB 3TFMA 4HAYB 4D0NB 1WGQA 1Z87A 5D3VA 3D8FA 3ULCA 4GN1A 2EJ8A 3SV1A 1U5DA 2RNRB 3ODXA 4XWXA 5JLJB 4A6FA 1MKEA 5KQ4A 2PZ1A 4Y94A 2GCLA 3PEGA 1EGXA 2D2QA 1ZM0A 5J3QA 4F7GA 1DDMA 4DBBA 5HE1A 2IYBA 3AU5A
chains in the Genus database with same CATH superfamily
3FVCA 4WSFA 4A6KA 2EMTA 3ODOA 1U5GA 3SYXA 2P0DA 2EC1A 2D11A 3HK0A 2AL6A 5JHHA 3V5WA 2DLWA 4L6EA 1EVHA 2AEHA 3D8EA 4IAPA 2I5FA 3X23A 2R2YA 2VKIA 5DH9B 3G9WA 5C5BB 4HHVA 3ULBA 3KSYA 1MIXA 3GYPA 4K2OA 5D3XA 4HB2B 1H4RA 2QKMA 1WVHA 1W1GA 2ROZB 3VIAA 3NWFA 1KZ7A 4GOUA 3IVFA 1QC6A 2NZ8B 3U12A 3A98B 2MWNB 2J0JA 1Y5OA 3PVUA 1OMWA 2LKOA 2R0DA 4HB0B 2ZKMX 1WJ1A 5D3YA 4KHBA 3WA0A 2GJYA 2I1KA 3NSUA 5D27A 5FI0A 2BCJA 2CY5A 3U8ZA 2YT1A 2VSZA 3FEHA 4CHMA 2KCJA 1W1HA 1T77A 1AQCA 2H7DA 3OANA 4PQ0A 1XD4A 4EKUA 1K5GB 1IRSA 1Q67A 2DKQA 2YS1A 3PZDA 1FOEA 4CYEA 3NWAA 5I2MA 4ZRKA 2CY4A 3N7CA 5GOWB 2D9WA 2D4QA 1WI1A 2HTHB 1UNRA 2J0MA 2DHIA 4NSWA 3PSCA 1MI1A 3KRXA 4MY6A 4EMOA 3OHMB 2P0HA 1UNPA 2HE7A 2M14A 2W2XD 3F5RA 2J0KA 2YF0A 1TJ6A 4QJ5B 4IOYX 4GPTB 4DX90 1OQNA 1E5WA 2YS3A 3HSAA 2LYDA 1P6SA 1ISNA 2XQNM 3KZ1A 4DXAB 2K2JA 2FJLA 2DYQA 1ZVRA 2D9XA 2UZSA 2DKPA 5LOPB 2RVBB 5HE2A 2DHKA 1X11A 1ZSQA 1WG7A 2GS0A 1TXDA 2Z0QA 1FHXA 3FM8C 5HE3A 1M7RA 2I5CA 3QWMA 2YVCA 5CLQB 1J0WA 2D10A 3NW8A 2V76A 1BTKA 3SUZA 5C6RA 2LOZA 1RJ2A 4CSQA 1I7AA 1U2BA 1I2HA 1KI1B 4MK0A 4KVGB 2MFQA 4YONA 1ZYIA 2Y8FA 3T06A 1V5UA 4GMXB 2D9ZA 4D6WA 1NTVA 4MT7A 4DIXA 5J3TA 4C0AA 2IFSA 2CODA 1X1GA 4HDOA 2OTXA 2W2XC 4GNKB 2P8VA 2G35A 4A5KA 4HAXB 2KIGA 4Z2NA 4QJ4B 1AWEA 2K8EA 1V88A 2LULA 2ZPYA 3HW2B 2DFKA 5CLLB 5DHFB 1SGHA 3DXCA 4P7IA 3LJUX 1PFJA 4OSNA 1V61A 1EF1A 4ZRIA 1XODA 2EMSA 4HAUB 1MIZB 1GG3A 3TCAA 1U5FA 1DROA 4CHJA 1M7EA 1P5TA 1P3RA 1FGYA 2L2IA 2N23A 3ODWA 1X1FA 3VOQA 4KHOA 1MAIA 2Y7BA 2DA0A 1NTYA 2K00A 4L1RA 2LG1A 3UZTA 4K81A 2H7EA 5FI1A 1B55A 3MPXA 2I1JA 2DTCA 5I2SA 5KCVA 1QQGA 1H10A 1GC7A 1KZGA 1PMSA 2DX1A 4A6FB 2YT2A 3P7ZA 4KHAA 3DXDA 3CXBB 3PVWA 1TQZA 2UZRA 1MK7B 2QKLA 3TVVA 2DX5A 5C5BA 4F7HA 4WJ7A 2E2XA 3BJIA 3A8PA 2NMBA 4HDQA 5L81A 3FSSA 3P6AA 1BTNA 2Z14A 3QIJA 2DN6A 2YRYA 4HAWB 1UNQA 3O96A 4B6HA 2ADZA 1DDVA 2ROVA 2P0FA 2RSGA 3SNHA 5M4YB 5DIFB 3PG7A 2OQBA 3PP2A 2W2WA 1U29A 2YT0A 1DYNA 1XX0A 1DBHA 4GMVA 1UEFA 4ZRJA 5D3WA 5DI9B 3CIKA 1UPQA 3SO6A 4PNKA 1N3HA 2COFA 4EJNA 1W1DA 2MKRA 2RLOA 2R09A 5LONB 3PVLA 5JHGA 4KHBB 3HQCA 5JP4A 1FGZA 1RRPB 1V5PA 3NWDA 4DX8A 5DHAB 2K2UA 2RRFA 3HIEA 1NI2A 4IFSA 4TYZA 2YS5A 3RCPA 2D9YA 3AJ4A 1MK9B 1LW3A 2MDXA 2DYNA 1K5DB 3ZVRA 1OY2A 2Y8GA 1BAKA 2Z0PA 2CRFA 1GC6A 2Q13A 5J3YA 1FB8A 1XKEA 1X05A 2D9VA 2N0YA 1X86A 4F7UP 2GCJA 1U27A 5EFXA 2DHJA 3ZDTA 4BBKA 4GZUA 2KUPA 4TKNA 2L1CA 3KRWA 1UPRA 1FHOA 4K17A 5HE0A 2LOXA 1V89A 2M38A 3DCXA 1MPHA 2Z0OA 1SHCA 2ELBA 2J59M 2Z59A 1EAZA 4HSIA 4HAVB 4HATB 3TO1A 3M1IB 1XCGA 4HB4B 5C16A 2YSZA 2X18A 4NY0A 1WGUA 3A8QA 4H8SA 3DXEA 2CAYA 2VRWB 3MDBC 1FHWA 3A58A 3QBVB 3B77A 3U7DA 2Z13A 1WJMA 3GYOA 2GUMA 4HB3B 3WYFB 2JP2A 5KQ1A 1Y19B 2RGNB 2KGXB 1FAOA 2UVMA 3KY9A 1BWNA 3F0WA 5C79A 3ML4A 4Z2MB 1LB1A 4QJ3B 2KUQA 2KIEA 4K2PA 1ZC3B 4KAXB 4GXBA 4WVFB 1V5MA 2KR0A 1DDWA 1J19A 1XR0B 1U5EA 1NU2A 4HAZB 1PLSA 1ZC4B 2COCA 3BINA 2COAA 2ELAA 5IRSA 4YL8A 3TW1A 3D8DA 4A6HA 3AU4A 2RUKB 3TFMA 4HAYB 4D0NB 1WGQA 1Z87A 5D3VA 3D8FA 3ULCA 4GN1A 2EJ8A 3SV1A 2Z4DA 1U5DA 2RNRB 3ODXA 4OT1A 4XWXA 2FJUB 5JLJB 4A6FA 1MKEA 5KQ4A 2PZ1A 4Y94A 2GCLA 3PEGA 2K49A 1EGXA 5LG4B 2NBVA 2D2QA 1ZM0A 5J3QA 4F7GA 1DDMA 4DBBA 5HE1A 2IYBA 4QXAB 3AU5A
chains in the Genus database with same CATH topology
4WSFA 4A6KA 2EMTA 3ODOA 1U5GA 3SYXA 2P0DA 2EC1A 2D11A 3HK0A 2AL6A 5JHHA 3V5WA 2DLWA 4L6EA 1EVHA 2AEHA 3D8EA 4IAPA 2I5FA 3X23A 2VKIA 5DH9B 3G9WA 5C5BB 4HHVA 3ULBA 3KSYA 1MIXA 3GYPA 4K2OA 5D3XA 4HB2B 1H4RA 2QKMA 1WVHA 1W1GA 2ROZB 3VIAA 1KZ7A 3IVFA 1QC6A 2NZ8B 3A98B 2MWNB 2J0JA 1Y5OA 3PVUA 1OMWA 2LKOA 2R0DA 4HB0B 5D3YA 1WJ1A 3WA0A 2GJYA 2I1KA 3NSUA 5D27A 5FI0A 2BCJA 2CY5A 3U8ZA 2YT1A 2VSZA 3FEHA 4CHMA 2KCJA 1W1HA 1AQCA 2H7DA 3OANA 4PQ0A 1XD4A 4EKUA 1K5GB 1IRSA 1Q67A 2DKQA 2YS1A 3PZDA 1FOEA 4CYEA 4ZRKA 2CY4A 3N7CA 5GOWB 2D9WA 2D4QA 1WI1A 2HTHB 1UNRA 2J0MA 2DHIA 4NSWA 3PSCA 3KRXA 4MY6A 4EMOA 2P0HA 1UNPA 2HE7A 2M14A 2W2XD 3F5RA 2J0KA 2YF0A 1TJ6A 4IOYX 4GPTB 4DX90 1OQNA 1E5WA 2YS3A 2LYDA 1P6SA 1ISNA 2XQNM 3KZ1A 4DXAB 2K2JA 2FJLA 2DYQA 1ZVRA 2D9XA 2UZSA 2DKPA 5LOPB 2RVBB 5HE2A 2DHKA 1X11A 1ZSQA 1WG7A 2GS0A 1TXDA 2Z0QA 1FHXA 3FM8C 5HE3A 1M7RA 2I5CA 3QWMA 2YVCA 5CLQB 1J0WA 2D10A 2V76A 1BTKA 3SUZA 5C6RA 2LOZA 1RJ2A 1I7AA 1U2BA 1I2HA 1KI1B 4MK0A 4KVGB 2MFQA 4YONA 2Y8FA 3T06A 1V5UA 4GMXB 2D9ZA 1NTVA 4MT7A 5J3TA 4C0AA 2IFSA 2CODA 1X1GA 4HDOA 2OTXA 2W2XC 2P8VA 2G35A 4A5KA 4HAXB 4Z2NA 1AWEA 1V88A 2LULA 2ZPYA 3HW2B 2DFKA 5CLLB 5DHFB 1SGHA 3DXCA 4P7IA 3LJUX 1PFJA 1V61A 1EF1A 4ZRIA 1XODA 2EMSA 4HAUB 1MIZB 1GG3A 3TCAA 1U5FA 1DROA 4CHJA 1M7EA 1P5TA 1P3RA 1FGYA 2L2IA 2N23A 3ODWA 1X1FA 3VOQA 4KHOA 1MAIA 2Y7BA 2DA0A 1NTYA 2K00A 2LG1A 3UZTA 4K81A 2H7EA 5FI1A 1B55A 3MPXA 2I1JA 2DTCA 5KCVA 1QQGA 1H10A 1GC7A 1KZGA 1PMSA 2DX1A 4A6FB 3P7ZA 4KHAA 3DXDA 3CXBB 3PVWA 1TQZA 2UZRA 1MK7B 2QKLA 3TVVA 2DX5A 5C5BA 4F7HA 4WJ7A 2E2XA 3BJIA 3A8PA 2NMBA 4HDQA 5L81A 3FSSA 3P6AA 1BTNA 3QIJA 2DN6A 2YRYA 4HAWB 1UNQA 3O96A 4B6HA 2ADZA 1DDVA 2ROVA 2P0FA 2RSGA 3SNHA 5DIFB 3PG7A 2OQBA 3PP2A 2W2WA 1U29A 2YT0A 1DYNA 1XX0A 1DBHA 4GMVA 1UEFA 4ZRJA 5D3WA 5DI9B 3CIKA 1UPQA 3SO6A 4PNKA 1N3HA 2COFA 4EJNA 1W1DA 2MKRA 2RLOA 2R09A 5LONB 3PVLA 5JHGA 4KHBB 3HQCA 5JP4A 1FGZA 1RRPB 1V5PA 4DX8A 5DHAB 2K2UA 1NI2A 4IFSA 4TYZA 2YS5A 3RCPA 2D9YA 3AJ4A 1MK9B 1LW3A 2MDXA 2DYNA 1K5DB 3ZVRA 1OY2A 2Y8GA 1BAKA 2Z0PA 2CRFA 1GC6A 2Q13A 5J3YA 1FB8A 1XKEA 1X05A 2D9VA 2N0YA 1X86A 4F7UP 2GCJA 1U27A 5EFXA 2DHJA 3ZDTA 4BBKA 4GZUA 2KUPA 4TKNA 2L1CA 3KRWA 1UPRA 1FHOA 4K17A 5HE0A 2LOXA 1V89A 2M38A 1MPHA 2Z0OA 1SHCA 2ELBA 2J59M 1EAZA 4HAVB 4HATB 3TO1A 3M1IB 1XCGA 4HB4B 5C16A 2YSZA 2X18A 4NY0A 1WGUA 3A8QA 4H8SA 3DXEA 2CAYA 2VRWB 3MDBC 1FHWA 3QBVB 3U7DA 1WJMA 3GYOA 4HB3B 3WYFB 5KQ1A 2JP2A 1Y19B 2RGNB 2KGXB 1FAOA 2UVMA 3KY9A 1BWNA 3F0WA 5C79A 3ML4A 4Z2MB 1LB1A 4K2PA 1ZC3B 4KAXB 4GXBA 4WVFB 1V5MA 1DDWA 1J19A 1XR0B 1U5EA 1NU2A 4HAZB 1PLSA 1ZC4B 2COCA 3BINA 2COAA 2ELAA 4YL8A 3TW1A 3D8DA 4A6HA 3AU4A 2RUKB 3TFMA 4HAYB 4D0NB 1WGQA 1Z87A 5D3VA 3D8FA 3ULCA 4GN1A 2EJ8A 3SV1A 1U5DA 2RNRB 3ODXA 4XWXA 5JLJB 4A6FA 1MKEA 5KQ4A 2PZ1A 4Y94A 2GCLA 3PEGA 1EGXA 2D2QA 1ZM0A 5J3QA 4F7GA 1DDMA 4DBBA 5HE1A 2IYBA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSF A;  4A6K A;  2EMT A;  3ODO A;  1U5G A;  3SYX A;  2P0D A;  2EC1 A;  2D11 A;  3HK0 A;  2AL6 A;  5JHH A;  3V5W A;  2DLW A;  4L6E A;  1EVH A;  2AEH A;  3D8E A;  4IAP A;  2I5F A;  3X23 A;  2VKI A;  5DH9 B;  3G9W A;  5C5B B;  4HHV A;  3ULB A;  3KSY A;  1MIX A;  3GYP A;  4K2O A;  5D3X A;  4HB2 B;  1H4R A;  2QKM A;  1WVH A;  1W1G A;  2ROZ B;  3VIA A;  1KZ7 A;  3IVF A;  1QC6 A;  2NZ8 B;  3A98 B;  2MWN B;  2J0J A;  1Y5O A;  3PVU A;  1OMW A;  2LKO A;  2R0D A;  4HB0 B;  5D3Y A;  1WJ1 A;  3WA0 A;  2GJY A;  2I1K A;  3NSU A;  5D27 A;  5FI0 A;  2BCJ A;  2CY5 A;  3U8Z A;  2YT1 A;  2VSZ A;  3FEH A;  4CHM A;  2KCJ A;  1W1H A;  1AQC A;  2H7D A;  3OAN A;  4PQ0 A;  1XD4 A;  4EKU A;  1K5G B;  1IRS A;  1Q67 A;  2DKQ A;  2YS1 A;  3PZD A;  1FOE A;  4CYE A;  4ZRK A;  2CY4 A;  3N7C A;  5GOW B;  2D9W A;  2D4Q A;  1WI1 A;  2HTH B;  1UNR A;  2J0M A;  2DHI A;  4NSW A;  3PSC A;  3KRX A;  4MY6 A;  4EMO A;  2P0H A;  1UNP A;  2HE7 A;  2M14 A;  2W2X D;  3F5R A;  2J0K A;  2YF0 A;  1TJ6 A;  4IOY X;  4GPT B;  4DX9 0;  1OQN A;  1E5W A;  2YS3 A;  2LYD A;  1P6S A;  1ISN A;  2XQN M;  3KZ1 A;  4DXA B;  2K2J A;  2FJL A;  2DYQ A;  1ZVR A;  2D9X A;  2UZS A;  2DKP A;  5LOP B;  2RVB B;  5HE2 A;  2DHK A;  1X11 A;  1ZSQ A;  1WG7 A;  2GS0 A;  1TXD A;  2Z0Q A;  1FHX A;  3FM8 C;  5HE3 A;  1M7R A;  2I5C A;  3QWM A;  2YVC A;  5CLQ B;  1J0W A;  2D10 A;  2V76 A;  1BTK A;  3SUZ A;  5C6R A;  2LOZ A;  1RJ2 A;  1I7A A;  1U2B A;  1I2H A;  1KI1 B;  4MK0 A;  4KVG B;  2MFQ A;  4YON A;  2Y8F A;  3T06 A;  1V5U A;  4GMX B;  2D9Z A;  1NTV A;  4MT7 A;  5J3T A;  4C0A A;  2IFS A;  2COD A;  1X1G A;  4HDO A;  2OTX A;  2W2X C;  2P8V A;  2G35 A;  4A5K A;  4HAX B;  4Z2N A;  1AWE A;  1V88 A;  2LUL A;  2ZPY A;  3HW2 B;  2DFK A;  5CLL B;  5DHF B;  1SGH A;  3DXC A;  4P7I A;  3LJU X;  1PFJ A;  1V61 A;  1EF1 A;  4ZRI A;  1XOD A;  2EMS A;  4HAU B;  1MIZ B;  1GG3 A;  3TCA A;  1U5F A;  1DRO A;  4CHJ A;  1M7E A;  1P5T A;  1P3R A;  1FGY A;  2L2I A;  2N23 A;  3ODW A;  1X1F A;  3VOQ A;  4KHO A;  1MAI A;  2Y7B A;  2DA0 A;  1NTY A;  2K00 A;  2LG1 A;  3UZT A;  4K81 A;  2H7E A;  5FI1 A;  1B55 A;  3MPX A;  2I1J A;  2DTC A;  5KCV A;  1QQG A;  1H10 A;  1GC7 A;  1KZG A;  1PMS A;  2DX1 A;  4A6F B;  3P7Z A;  4KHA A;  3DXD A;  3CXB B;  3PVW A;  1TQZ A;  2UZR A;  1MK7 B;  2QKL A;  3TVV A;  2DX5 A;  5C5B A;  4F7H A;  4WJ7 A;  2E2X A;  3BJI A;  3A8P A;  2NMB A;  4HDQ A;  5L81 A;  3FSS A;  3P6A A;  1BTN A;  3QIJ A;  2DN6 A;  2YRY A;  4HAW B;  1UNQ A;  3O96 A;  4B6H A;  2ADZ A;  1DDV A;  2ROV A;  2P0F A;  2RSG A;  3SNH A;  5DIF B;  3PG7 A;  2OQB A;  3PP2 A;  2W2W A;  1U29 A;  2YT0 A;  1DYN A;  1XX0 A;  1DBH A;  4GMV A;  1UEF A;  4ZRJ A;  5D3W A;  5DI9 B;  3CIK A;  1UPQ A;  3SO6 A;  4PNK A;  1N3H A;  2COF A;  4EJN A;  1W1D A;  2MKR A;  2RLO A;  2R09 A;  5LON B;  3PVL A;  5JHG A;  4KHB B;  3HQC A;  5JP4 A;  1FGZ A;  1RRP B;  1V5P A;  4DX8 A;  5DHA B;  2K2U A;  1NI2 A;  4IFS A;  4TYZ A;  2YS5 A;  3RCP A;  2D9Y A;  3AJ4 A;  1MK9 B;  1LW3 A;  2MDX A;  2DYN A;  1K5D B;  3ZVR A;  1OY2 A;  2Y8G A;  1BAK A;  2Z0P A;  2CRF A;  1GC6 A;  2Q13 A;  5J3Y A;  1FB8 A;  1XKE A;  1X05 A;  2D9V A;  2N0Y A;  1X86 A;  4F7U P;  2GCJ A;  1U27 A;  5EFX A;  2DHJ A;  3ZDT A;  4BBK A;  4GZU A;  2KUP A;  4TKN A;  2L1C A;  3KRW A;  1UPR A;  1FHO A;  4K17 A;  5HE0 A;  2LOX A;  1V89 A;  2M38 A;  1MPH A;  2Z0O A;  1SHC A;  2ELB A;  2J59 M;  1EAZ A;  4HAV B;  4HAT B;  3TO1 A;  3M1I B;  1XCG A;  4HB4 B;  5C16 A;  2YSZ A;  2X18 A;  4NY0 A;  1WGU A;  3A8Q A;  4H8S A;  3DXE A;  2CAY A;  2VRW B;  3MDB C;  1FHW A;  3QBV B;  3U7D A;  1WJM A;  3GYO A;  4HB3 B;  3WYF B;  5KQ1 A;  2JP2 A;  1Y19 B;  2RGN B;  2KGX B;  1FAO A;  2UVM A;  3KY9 A;  1BWN A;  3F0W A;  5C79 A;  3ML4 A;  4Z2M B;  1LB1 A;  4K2P A;  1ZC3 B;  4KAX B;  4GXB A;  4WVF B;  1V5M A;  1DDW A;  1J19 A;  1XR0 B;  1U5E A;  1NU2 A;  4HAZ B;  1PLS A;  1ZC4 B;  2COC A;  3BIN A;  2COA A;  2ELA A;  4YL8 A;  3TW1 A;  3D8D A;  4A6H A;  3AU4 A;  2RUK B;  3TFM A;  4HAY B;  4D0N B;  1WGQ A;  1Z87 A;  5D3V A;  3D8F A;  3ULC A;  4GN1 A;  2EJ8 A;  3SV1 A;  1U5D A;  2RNR B;  3ODX A;  4XWX A;  5JLJ B;  4A6F A;  1MKE A;  5KQ4 A;  2PZ1 A;  4Y94 A;  2GCL A;  3PEG A;  1EGX A;  2D2Q A;  1ZM0 A;  5J3Q A;  4F7G A;  1DDM A;  4DBB A;  5HE1 A;  2IYB A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 3FVC A;  4WSF A;  4A6K A;  2EMT A;  3ODO A;  1U5G A;  3SYX A;  2P0D A;  2EC1 A;  2D11 A;  3HK0 A;  2AL6 A;  5JHH A;  3V5W A;  2DLW A;  4L6E A;  1EVH A;  2AEH A;  3D8E A;  4IAP A;  2I5F A;  3X23 A;  2R2Y A;  2VKI A;  5DH9 B;  3G9W A;  5C5B B;  4HHV A;  3ULB A;  3KSY A;  1MIX A;  3GYP A;  4K2O A;  5D3X A;  4HB2 B;  1H4R A;  2QKM A;  1WVH A;  1W1G A;  2ROZ B;  3VIA A;  3NWF A;  1KZ7 A;  4GOU A;  3IVF A;  1QC6 A;  2NZ8 B;  3U12 A;  3A98 B;  2MWN B;  2J0J A;  1Y5O A;  3PVU A;  1OMW A;  2LKO A;  2R0D A;  4HB0 B;  2ZKM X;  1WJ1 A;  5D3Y A;  4KHB A;  3WA0 A;  2GJY A;  2I1K A;  3NSU A;  5D27 A;  5FI0 A;  2BCJ A;  2CY5 A;  3U8Z A;  2YT1 A;  2VSZ A;  3FEH A;  4CHM A;  2KCJ A;  1W1H A;  1T77 A;  1AQC A;  2H7D A;  3OAN A;  4PQ0 A;  1XD4 A;  4EKU A;  1K5G B;  1IRS A;  1Q67 A;  2DKQ A;  2YS1 A;  3PZD A;  1FOE A;  4CYE A;  3NWA A;  5I2M A;  4ZRK A;  2CY4 A;  3N7C A;  5GOW B;  2D9W A;  2D4Q A;  1WI1 A;  2HTH B;  1UNR A;  2J0M A;  2DHI A;  4NSW A;  3PSC A;  1MI1 A;  3KRX A;  4MY6 A;  4EMO A;  3OHM B;  2P0H A;  1UNP A;  2HE7 A;  2M14 A;  2W2X D;  3F5R A;  2J0K A;  2YF0 A;  1TJ6 A;  4QJ5 B;  4IOY X;  4GPT B;  4DX9 0;  1OQN A;  1E5W A;  2YS3 A;  3HSA A;  2LYD A;  1P6S A;  1ISN A;  2XQN M;  3KZ1 A;  4DXA B;  2K2J A;  2FJL A;  2DYQ A;  1ZVR A;  2D9X A;  2UZS A;  2DKP A;  5LOP B;  2RVB B;  5HE2 A;  2DHK A;  1X11 A;  1ZSQ A;  1WG7 A;  2GS0 A;  1TXD A;  2Z0Q A;  1FHX A;  3FM8 C;  5HE3 A;  1M7R A;  2I5C A;  3QWM A;  2YVC A;  5CLQ B;  1J0W A;  2D10 A;  3NW8 A;  2V76 A;  1BTK A;  3SUZ A;  5C6R A;  2LOZ A;  1RJ2 A;  4CSQ A;  1I7A A;  1U2B A;  1I2H A;  1KI1 B;  4MK0 A;  4KVG B;  2MFQ A;  4YON A;  1ZYI A;  2Y8F A;  3T06 A;  1V5U A;  4GMX B;  2D9Z A;  4D6W A;  1NTV A;  4MT7 A;  4DIX A;  5J3T A;  4C0A A;  2IFS A;  2COD A;  1X1G A;  4HDO A;  2OTX A;  2W2X C;  4GNK B;  2P8V A;  2G35 A;  4A5K A;  4HAX B;  2KIG A;  4Z2N A;  4QJ4 B;  1AWE A;  2K8E A;  1V88 A;  2LUL A;  2ZPY A;  3HW2 B;  2DFK A;  5CLL B;  5DHF B;  1SGH A;  3DXC A;  4P7I A;  3LJU X;  1PFJ A;  4OSN A;  1V61 A;  1EF1 A;  4ZRI A;  1XOD A;  2EMS A;  4HAU B;  1MIZ B;  1GG3 A;  3TCA A;  1U5F A;  1DRO A;  4CHJ A;  1M7E A;  1P5T A;  1P3R A;  1FGY A;  2L2I A;  2N23 A;  3ODW A;  1X1F A;  3VOQ A;  4KHO A;  1MAI A;  2Y7B A;  2DA0 A;  1NTY A;  2K00 A;  4L1R A;  2LG1 A;  3UZT A;  4K81 A;  2H7E A;  5FI1 A;  1B55 A;  3MPX A;  2I1J A;  2DTC A;  5I2S A;  5KCV A;  1QQG A;  1H10 A;  1GC7 A;  1KZG A;  1PMS A;  2DX1 A;  4A6F B;  2YT2 A;  3P7Z A;  4KHA A;  3DXD A;  3CXB B;  3PVW A;  1TQZ A;  2UZR A;  1MK7 B;  2QKL A;  3TVV A;  2DX5 A;  5C5B A;  4F7H A;  4WJ7 A;  2E2X A;  3BJI A;  3A8P A;  2NMB A;  4HDQ A;  5L81 A;  3FSS A;  3P6A A;  1BTN A;  2Z14 A;  3QIJ A;  2DN6 A;  2YRY A;  4HAW B;  1UNQ A;  3O96 A;  4B6H A;  2ADZ A;  1DDV A;  2ROV A;  2P0F A;  2RSG A;  3SNH A;  5M4Y B;  5DIF B;  3PG7 A;  2OQB A;  3PP2 A;  2W2W A;  1U29 A;  2YT0 A;  1DYN A;  1XX0 A;  1DBH A;  4GMV A;  1UEF A;  4ZRJ A;  5D3W A;  5DI9 B;  3CIK A;  1UPQ A;  3SO6 A;  4PNK A;  1N3H A;  2COF A;  4EJN A;  1W1D A;  2MKR A;  2RLO A;  2R09 A;  5LON B;  3PVL A;  5JHG A;  4KHB B;  3HQC A;  5JP4 A;  1FGZ A;  1RRP B;  1V5P A;  3NWD A;  4DX8 A;  5DHA B;  2K2U A;  2RRF A;  3HIE A;  1NI2 A;  4IFS A;  4TYZ A;  2YS5 A;  3RCP A;  2D9Y A;  3AJ4 A;  1MK9 B;  1LW3 A;  2MDX A;  2DYN A;  1K5D B;  3ZVR A;  1OY2 A;  2Y8G A;  1BAK A;  2Z0P A;  2CRF A;  1GC6 A;  2Q13 A;  5J3Y A;  1FB8 A;  1XKE A;  1X05 A;  2D9V A;  2N0Y A;  1X86 A;  4F7U P;  2GCJ A;  1U27 A;  5EFX A;  2DHJ A;  3ZDT A;  4BBK A;  4GZU A;  2KUP A;  4TKN A;  2L1C A;  3KRW A;  1UPR A;  1FHO A;  4K17 A;  5HE0 A;  2LOX A;  1V89 A;  2M38 A;  3DCX A;  1MPH A;  2Z0O A;  1SHC A;  2ELB A;  2J59 M;  2Z59 A;  1EAZ A;  4HSI A;  4HAV B;  4HAT B;  3TO1 A;  3M1I B;  1XCG A;  4HB4 B;  5C16 A;  2YSZ A;  2X18 A;  4NY0 A;  1WGU A;  3A8Q A;  4H8S A;  3DXE A;  2CAY A;  2VRW B;  3MDB C;  1FHW A;  3A58 A;  3QBV B;  3B77 A;  3U7D A;  2Z13 A;  1WJM A;  3GYO A;  2GUM A;  4HB3 B;  3WYF B;  2JP2 A;  5KQ1 A;  1Y19 B;  2RGN B;  2KGX B;  1FAO A;  2UVM A;  3KY9 A;  1BWN A;  3F0W A;  5C79 A;  3ML4 A;  4Z2M B;  1LB1 A;  4QJ3 B;  2KUQ A;  2KIE A;  4K2P A;  1ZC3 B;  4KAX B;  4GXB A;  4WVF B;  1V5M A;  2KR0 A;  1DDW A;  1J19 A;  1XR0 B;  1U5E A;  1NU2 A;  4HAZ B;  1PLS A;  1ZC4 B;  2COC A;  3BIN A;  2COA A;  2ELA A;  5IRS A;  4YL8 A;  3TW1 A;  3D8D A;  4A6H A;  3AU4 A;  2RUK B;  3TFM A;  4HAY B;  4D0N B;  1WGQ A;  1Z87 A;  5D3V A;  3D8F A;  3ULC A;  4GN1 A;  2EJ8 A;  3SV1 A;  2Z4D A;  1U5D A;  2RNR B;  3ODX A;  4OT1 A;  4XWX A;  2FJU B;  5JLJ B;  4A6F A;  1MKE A;  5KQ4 A;  2PZ1 A;  4Y94 A;  2GCL A;  3PEG A;  2K49 A;  1EGX A;  5LG4 B;  2NBV A;  2D2Q A;  1ZM0 A;  5J3Q A;  4F7G A;  1DDM A;  4DBB A;  5HE1 A;  2IYB A;  4QXA B;  3AU5 A; 
#chains in the Genus database with same CATH homology
 4WSF A;  4A6K A;  2EMT A;  3ODO A;  1U5G A;  3SYX A;  2P0D A;  2EC1 A;  2D11 A;  3HK0 A;  2AL6 A;  5JHH A;  3V5W A;  2DLW A;  4L6E A;  1EVH A;  2AEH A;  3D8E A;  4IAP A;  2I5F A;  3X23 A;  2VKI A;  5DH9 B;  3G9W A;  5C5B B;  4HHV A;  3ULB A;  3KSY A;  1MIX A;  3GYP A;  4K2O A;  5D3X A;  4HB2 B;  1H4R A;  2QKM A;  1WVH A;  1W1G A;  2ROZ B;  3VIA A;  1KZ7 A;  3IVF A;  1QC6 A;  2NZ8 B;  3A98 B;  2MWN B;  2J0J A;  1Y5O A;  3PVU A;  1OMW A;  2LKO A;  2R0D A;  4HB0 B;  5D3Y A;  1WJ1 A;  3WA0 A;  2GJY A;  2I1K A;  3NSU A;  5D27 A;  5FI0 A;  2BCJ A;  2CY5 A;  3U8Z A;  2YT1 A;  2VSZ A;  3FEH A;  4CHM A;  2KCJ A;  1W1H A;  1AQC A;  2H7D A;  3OAN A;  4PQ0 A;  1XD4 A;  4EKU A;  1K5G B;  1IRS A;  1Q67 A;  2DKQ A;  2YS1 A;  3PZD A;  1FOE A;  4CYE A;  4ZRK A;  2CY4 A;  3N7C A;  5GOW B;  2D9W A;  2D4Q A;  1WI1 A;  2HTH B;  1UNR A;  2J0M A;  2DHI A;  4NSW A;  3PSC A;  3KRX A;  4MY6 A;  4EMO A;  2P0H A;  1UNP A;  2HE7 A;  2M14 A;  2W2X D;  3F5R A;  2J0K A;  2YF0 A;  1TJ6 A;  4IOY X;  4GPT B;  4DX9 0;  1OQN A;  1E5W A;  2YS3 A;  2LYD A;  1P6S A;  1ISN A;  2XQN M;  3KZ1 A;  4DXA B;  2K2J A;  2FJL A;  2DYQ A;  1ZVR A;  2D9X A;  2UZS A;  2DKP A;  5LOP B;  2RVB B;  5HE2 A;  2DHK A;  1X11 A;  1ZSQ A;  1WG7 A;  2GS0 A;  1TXD A;  2Z0Q A;  1FHX A;  3FM8 C;  5HE3 A;  1M7R A;  2I5C A;  3QWM A;  2YVC A;  5CLQ B;  1J0W A;  2D10 A;  2V76 A;  1BTK A;  3SUZ A;  5C6R A;  2LOZ A;  1RJ2 A;  1I7A A;  1U2B A;  1I2H A;  1KI1 B;  4MK0 A;  4KVG B;  2MFQ A;  4YON A;  2Y8F A;  3T06 A;  1V5U A;  4GMX B;  2D9Z A;  1NTV A;  4MT7 A;  5J3T A;  4C0A A;  2IFS A;  2COD A;  1X1G A;  4HDO A;  2OTX A;  2W2X C;  2P8V A;  2G35 A;  4A5K A;  4HAX B;  4Z2N A;  1AWE A;  1V88 A;  2LUL A;  2ZPY A;  3HW2 B;  2DFK A;  5CLL B;  5DHF B;  1SGH A;  3DXC A;  4P7I A;  3LJU X;  1PFJ A;  1V61 A;  1EF1 A;  4ZRI A;  1XOD A;  2EMS A;  4HAU B;  1MIZ B;  1GG3 A;  3TCA A;  1U5F A;  1DRO A;  4CHJ A;  1M7E A;  1P5T A;  1P3R A;  1FGY A;  2L2I A;  2N23 A;  3ODW A;  1X1F A;  3VOQ A;  4KHO A;  1MAI A;  2Y7B A;  2DA0 A;  1NTY A;  2K00 A;  2LG1 A;  3UZT A;  4K81 A;  2H7E A;  5FI1 A;  1B55 A;  3MPX A;  2I1J A;  2DTC A;  5KCV A;  1QQG A;  1H10 A;  1GC7 A;  1KZG A;  1PMS A;  2DX1 A;  4A6F B;  3P7Z A;  4KHA A;  3DXD A;  3CXB B;  3PVW A;  1TQZ A;  2UZR A;  1MK7 B;  2QKL A;  3TVV A;  2DX5 A;  5C5B A;  4F7H A;  4WJ7 A;  2E2X A;  3BJI A;  3A8P A;  2NMB A;  4HDQ A;  5L81 A;  3FSS A;  3P6A A;  1BTN A;  3QIJ A;  2DN6 A;  2YRY A;  4HAW B;  1UNQ A;  3O96 A;  4B6H A;  2ADZ A;  1DDV A;  2ROV A;  2P0F A;  2RSG A;  3SNH A;  5DIF B;  3PG7 A;  2OQB A;  3PP2 A;  2W2W A;  1U29 A;  2YT0 A;  1DYN A;  1XX0 A;  1DBH A;  4GMV A;  1UEF A;  4ZRJ A;  5D3W A;  5DI9 B;  3CIK A;  1UPQ A;  3SO6 A;  4PNK A;  1N3H A;  2COF A;  4EJN A;  1W1D A;  2MKR A;  2RLO A;  2R09 A;  5LON B;  3PVL A;  5JHG A;  4KHB B;  3HQC A;  5JP4 A;  1FGZ A;  1RRP B;  1V5P A;  4DX8 A;  5DHA B;  2K2U A;  1NI2 A;  4IFS A;  4TYZ A;  2YS5 A;  3RCP A;  2D9Y A;  3AJ4 A;  1MK9 B;  1LW3 A;  2MDX A;  2DYN A;  1K5D B;  3ZVR A;  1OY2 A;  2Y8G A;  1BAK A;  2Z0P A;  2CRF A;  1GC6 A;  2Q13 A;  5J3Y A;  1FB8 A;  1XKE A;  1X05 A;  2D9V A;  2N0Y A;  1X86 A;  4F7U P;  2GCJ A;  1U27 A;  5EFX A;  2DHJ A;  3ZDT A;  4BBK A;  4GZU A;  2KUP A;  4TKN A;  2L1C A;  3KRW A;  1UPR A;  1FHO A;  4K17 A;  5HE0 A;  2LOX A;  1V89 A;  2M38 A;  1MPH A;  2Z0O A;  1SHC A;  2ELB A;  2J59 M;  1EAZ A;  4HAV B;  4HAT B;  3TO1 A;  3M1I B;  1XCG A;  4HB4 B;  5C16 A;  2YSZ A;  2X18 A;  4NY0 A;  1WGU A;  3A8Q A;  4H8S A;  3DXE A;  2CAY A;  2VRW B;  3MDB C;  1FHW A;  3QBV B;  3U7D A;  1WJM A;  3GYO A;  4HB3 B;  3WYF B;  5KQ1 A;  2JP2 A;  1Y19 B;  2RGN B;  2KGX B;  1FAO A;  2UVM A;  3KY9 A;  1BWN A;  3F0W A;  5C79 A;  3ML4 A;  4Z2M B;  1LB1 A;  4K2P A;  1ZC3 B;  4KAX B;  4GXB A;  4WVF B;  1V5M A;  1DDW A;  1J19 A;  1XR0 B;  1U5E A;  1NU2 A;  4HAZ B;  1PLS A;  1ZC4 B;  2COC A;  3BIN A;  2COA A;  2ELA A;  4YL8 A;  3TW1 A;  3D8D A;  4A6H A;  3AU4 A;  2RUK B;  3TFM A;  4HAY B;  4D0N B;  1WGQ A;  1Z87 A;  5D3V A;  3D8F A;  3ULC A;  4GN1 A;  2EJ8 A;  3SV1 A;  1U5D A;  2RNR B;  3ODX A;  4XWX A;  5JLJ B;  4A6F A;  1MKE A;  5KQ4 A;  2PZ1 A;  4Y94 A;  2GCL A;  3PEG A;  1EGX A;  2D2Q A;  1ZM0 A;  5J3Q A;  4F7G A;  1DDM A;  4DBB A;  5HE1 A;  2IYB A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...