1EAZA

Crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Phosphatidylinositol 3,4-Bisphosphate-Binding Pleckstrin Homology (Ph) Domain of Tandem Ph-Domain-Containing Protein 1 (Tapp1): Molecular Basis of Lipid Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords TANDEM PH DOMAIN CONTAINING PROTEIN-1
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1eazA00
2RVBB 4HAXB 3QBVB 4KVGB 5GOWB 2LKOA 1GC7A 1X1GA 1ZVRA 1OQNA 5DHAB 1DROA 1KZGA 4DX8A 4HDQA 1NI2A 1DDMA 5DHFB 2J0KA 4KAXB 4MK0A 2COFA 1WG7A 1AWEA 4A6HA 3CIKA 1K5GB 2KCJA 3TFMA 4HAVB 4KHOA 5JHGA 2MWNB 4GMXB 1GC6A 2Q13A 1RRPB 1V88A 5CLLB 4XWXA 4ZRJA 1U5EA 2BCJA 1MKEA 5DI9B 3PVLA 3U7DA 3IVFA 2I1JA 2RGNB 2YS1A 1UPQA 1ISNA 2P0HA 4C0AA 1V5PA 3P6AA 1FB8A 2K2JA 2IFSA 4Y94A 1U5GA 1M7EA 1X86A 3TVVA 4PNKA 2UZSA 1W1HA 1WVHA 1W1DA 4MY6A 2D11A 2QKLA 2I5FA 3PEGA 5D3WA 2NMBA 2J0JA 1TXDA 2H7DA 2M38A 1EVHA 4MT7A 3P7ZA 2YRYA 4HAUB 2I5CA 5C5BB 2LG1A 3WA0A 1FHXA 2D10A 4F7HA 1V89A 3SUZA 1NTYA 3FEHA 2RUKB 4HB4B 1ZSQA 2QKMA 3F0WA 1XODA 4TKNA 4DXAB 4GPTB 3HQCA 2Z0OA 4KHBB 1W1GA 1MAIA 4HAWB 3PVUA 1QC6A 1U29A 2KGXB 3V5WA 2DHKA 1XX0A 2GCJA 3MPXA 3VIAA 2R09A 5D3VA 2L1CA 3D8EA 4WSFA 2COAA 4GN1A 2DX5A 4WJ7A 3KRXA 3ZDTA 3RCPA 2DHJA 2Y8GA 1Q67A 1Y5OA 1FHOA 4K2PA 4KHAA 1UPRA 2ADZA 1UNPA 2COCA 1FHWA 2J0MA 2ROVA 3ODWA 4GMVA 3D8DA 5C5BA 2H7EA 3PSCA 1EF1A 3AJ4A 2CRFA 2DFKA 4H8SA 1X1FA 1XCGA 1LW3A 5KQ4A 1LB1A 2M14A 4HDOA 1BWNA 1PFJA 2YSZA 3BINA 3VOQA 1N3HA 4EKUA 5C79A 2CODA 3AU5A 2YT1A 2DTCA 1NTVA 1DYNA 1EGXA 2NZ8B 2K2UA 3KSYA 1MK7B 5EFXA 4K2OA 1SHCA 1DDVA 1GG3A 5HE3A 2W2WA 4HAYB 2X18A 1J0WA 3T06A 2V76A 1AQCA 3D8FA 2YS3A 2CAYA 2P0FA 5L81A 1ZC3B 3HW2B 1P5TA 4BBKA 3KRWA 4F7GA 2MKRA 1ZC4B 2IYBA 3KY9A 2EMSA 2DHIA 1P3RA 2UZRA 1OMWA 4NY0A 4P7IA 4PQ0A 3G9WA 5J3TA 3GYPA 3M1IB 3X23A 1PMSA 5D3XA 2DA0A 2W2XC 1NU2A 1U5FA 1H10A 2J59M 4IOYX 3WYFB 2LULA 2EMTA 2G35A 2N23A 2P8VA 2VRWB 2ZPYA 3DXCA 1WGUA 2D9ZA 2LOXA 5LOPB 2DLWA 3TW1A 4IAPA 3ULCA 2GJYA 4EMOA 1PLSA 3KZ1A 4GXBA 5FI0A 2Y7BA 5J3QA 3PP2A 2DKPA 3DXDA 3MDBC 5HE2A 2DYNA 1P6SA 1FGZA 2YVCA 3AU4A 1U5DA 5C16A 1V5MA 2OTXA 2W2XD 3QIJA 1DBHA 2I1KA 1KI1B 1U27A 4A6FB 3SV1A 1WGQA 1V5UA 2E2XA 1MPHA 2D4QA 2D9XA 1XKEA 2L2IA 5D3YA 1I7AA 4NSWA 2OQBA 2RSGA 1UNRA 3F5RA 1WI1A 4HHVA 5J3YA 4CHMA 2YF0A 1U2BA 1WJMA 2GS0A 4K17A 5JHHA 2LYDA 1X05A 2MDXA 3ZVRA 3QWMA 2KUPA 3GYOA 1K5DB 2D2QA 1MK9B 3FM8C 1XR0B 4YL8A 1UEFA 1Z87A 2ELAA 2D9YA 3BJIA 5D27A 1X11A 1FAOA 1MIZB 3A8PA 3TCAA 2Z0PA 3LJUX 5LONB 1BAKA 2XQNM 4ZRIA 3U8ZA 5KCVA 3ODXA 3FSSA 4ZRKA 4HB3B 2RLOA 3ULBA 1RJ2A 1H4RA 2YT0A 4Z2NA 1I2HA 2HTHB 1V61A 2D9VA 1FGYA 1TQZA 5CLQB 1FOEA 4HATB 1OY2A 2CY4A 4GZUA 4WVFB 1UNQA 5HE1A 3ODOA 2PZ1A 2EC1A 3DXEA 4HB0B 1BTKA 2AL6A 4CHJA 4TYZA 4IFSA 2MFQA 1WJ1A 2UVMA 2HE7A 4HAZB 5JLJB 2R0DA 5JP4A 2P0DA 5FI1A 3SO6A 3PVWA 1E5WA 3CXBB 2GCLA 2DKQA 4A5KA 2D9WA 4B6HA 2ROZB 4K81A 3TO1A 1DDWA 1EAZA 3N7CA 2CY5A 5DH9B 2DN6A 2JP2A 2VKIA 2EJ8A 4A6KA 4DBBA 1M7RA 5DIFB 2DX1A 2VSZA 4YONA 3HK0A 2K00A 4DX90 3SNHA 1KZ7A 3PZDA 2Y8FA 2LOZA 5KQ1A 2ELBA 1B55A 2DYQA 3A8QA 2AEHA 4A6FA 4D0NB 5C6RA 1TJ6A 1BTNA 3O96A 4HB2B 3OANA 1ZM0A 4EJNA 4CYEA 3UZTA 3PG7A 1IRSA 1QQGA 5HE0A 3ML4A 3NSUA 1XD4A 2N0YA 3SYXA 2YS5A 1J19A 2FJLA 4Z2MB 3A98B 4L6EA 2RNRB 4F7UP 2Z0QA 1MIXA 1SGHA 1Y19B
chains in the Genus database with same CATH superfamily
2RVBB 4HAXB 3QBVB 4KVGB 5GOWB 2LKOA 1GC7A 1X1GA 1ZVRA 1OQNA 5DHAB 3NW8A 4CSQA 1DROA 1KZGA 4DX8A 2KIGA 4HDQA 1NI2A 1DDMA 5DHFB 2J0KA 4KAXB 4MK0A 4D6WA 2COFA 1WG7A 1AWEA 4A6HA 3CIKA 1K5GB 2KCJA 3TFMA 4HAVB 4KHOA 5JHGA 2MWNB 4GMXB 3DCXA 1GC6A 2Q13A 1RRPB 1V88A 5CLLB 4XWXA 4ZRJA 1U5EA 2BCJA 1MKEA 5DI9B 3PVLA 3U7DA 3IVFA 2I1JA 3HSAA 2RGNB 2YS1A 1UPQA 1ISNA 2P0HA 4C0AA 1V5PA 3P6AA 1FB8A 2K2JA 2IFSA 4Y94A 1U5GA 1M7EA 1X86A 3TVVA 4PNKA 2UZSA 1W1HA 1WVHA 1W1DA 4MY6A 2D11A 2QKLA 2I5FA 3PEGA 5D3WA 2NMBA 2J0JA 1TXDA 2H7DA 2M38A 1EVHA 4MT7A 2KUQA 3P7ZA 2YRYA 2GUMA 4HAUB 2I5CA 5C5BB 2LG1A 3WA0A 1FHXA 1MI1A 2D10A 4F7HA 1V89A 3SUZA 1NTYA 4DIXA 3FEHA 2RUKB 4HB4B 4GNKB 2Z13A 1ZSQA 2NBVA 2QKMA 3F0WA 1XODA 4TKNA 4DXAB 4GPTB 3HQCA 2Z0OA 4KHBB 1W1GA 1MAIA 4HAWB 3PVUA 1QC6A 1U29A 2KGXB 3V5WA 3A58A 2DHKA 1XX0A 2GCJA 3MPXA 3VIAA 2R09A 5D3VA 2L1CA 3D8EA 4WSFA 2COAA 4GN1A 2DX5A 4WJ7A 3KRXA 3FVCA 3ZDTA 3RCPA 2DHJA 2Y8GA 1Q67A 1Y5OA 1FHOA 4K2PA 4KHAA 1UPRA 2ADZA 1UNPA 2COCA 1FHWA 2J0MA 2ROVA 3ODWA 4GMVA 3D8DA 5C5BA 2H7EA 4QXAB 3PSCA 1EF1A 3AJ4A 2CRFA 2DFKA 4H8SA 1X1FA 1XCGA 1LW3A 3NWFA 1LB1A 5KQ4A 2M14A 4HDOA 2K49A 1BWNA 1PFJA 2YSZA 3BINA 3VOQA 1N3HA 4EKUA 5C79A 2CODA 3AU5A 2YT1A 2DTCA 1NTVA 1DYNA 1T77A 1EGXA 2NZ8B 2K2UA 3KSYA 4GOUA 1MK7B 5EFXA 4K2OA 1SHCA 1DDVA 1GG3A 3NWAA 5HE3A 2W2WA 4HAYB 2X18A 1J0WA 3T06A 2V76A 1AQCA 3D8FA 2YS3A 3U12A 2CAYA 2P0FA 5L81A 1ZC3B 3HW2B 1P5TA 4BBKA 3KRWA 4F7GA 2MKRA 1ZC4B 2IYBA 3KY9A 4QJ4B 2EMSA 2DHIA 1P3RA 2UZRA 5IRSA 1OMWA 4NY0A 4P7IA 4PQ0A 3G9WA 5J3TA 3GYPA 3M1IB 3X23A 1PMSA 3NWDA 5D3XA 2DA0A 2W2XC 1NU2A 5LG4B 1U5FA 1H10A 2J59M 4IOYX 3WYFB 2LULA 2EMTA 2G35A 2N23A 2P8VA 2VRWB 2ZKMX 2ZPYA 3DXCA 4QJ5B 1WGUA 2D9ZA 2LOXA 5LOPB 2DLWA 3TW1A 4IAPA 3ULCA 2K8EA 2GJYA 4EMOA 1PLSA 3KZ1A 4GXBA 5FI0A 2Y7BA 5J3QA 3PP2A 2DKPA 3DXDA 3MDBC 5HE2A 2DYNA 1P6SA 1FGZA 2YVCA 2Z4DA 3AU4A 1U5DA 5C16A 1V5MA 2OTXA 3OHMB 2W2XD 3QIJA 1DBHA 2I1KA 1KI1B 1U27A 4A6FB 3SV1A 1WGQA 1V5UA 2E2XA 1MPHA 2D4QA 2D9XA 1XKEA 2L2IA 5D3YA 1I7AA 4NSWA 2OQBA 2RSGA 4OSNA 1UNRA 3F5RA 1WI1A 4HHVA 5J3YA 4CHMA 2YF0A 1U2BA 1WJMA 2GS0A 2R2YA 4K17A 5JHHA 2LYDA 1X05A 2MDXA 4OT1A 3QWMA 3ZVRA 2KUPA 3GYOA 1K5DB 2D2QA 1MK9B 3FM8C 1XR0B 4YL8A 1UEFA 1Z87A 2ELAA 2D9YA 3BJIA 5D27A 1X11A 1FAOA 1MIZB 3A8PA 3TCAA 2Z0PA 3LJUX 5LONB 1BAKA 2XQNM 4ZRIA 3U8ZA 5KCVA 3ODXA 3FSSA 4ZRKA 4HB3B 2RLOA 2Z59A 3ULBA 1RJ2A 1H4RA 2YT0A 4Z2NA 1I2HA 2HTHB 1V61A 2D9VA 1FGYA 2Z14A 1TQZA 5CLQB 2KR0A 1FOEA 4HATB 1OY2A 2CY4A 4GZUA 4WVFB 1UNQA 5HE1A 3ODOA 2PZ1A 2EC1A 5I2SA 3DXEA 4HB0B 1BTKA 2AL6A 4CHJA 4TYZA 3HIEA 4IFSA 2MFQA 1WJ1A 2RRFA 2UVMA 2HE7A 4QJ3B 4HAZB 5JLJB 2R0DA 5JP4A 2P0DA 5FI1A 3SO6A 3PVWA 1E5WA 3CXBB 2GCLA 2DKQA 2FJUB 4A5KA 2D9WA 4B6HA 2ROZB 4K81A 3TO1A 1DDWA 1EAZA 5M4YB 3N7CA 2CY5A 5DH9B 2DN6A 2JP2A 2VKIA 2EJ8A 4KHBA 4A6KA 2KIEA 4DBBA 1M7RA 5DIFB 2DX1A 2VSZA 4HSIA 4YONA 3HK0A 2K00A 4DX90 3SNHA 1KZ7A 4L1RA 3PZDA 2Y8FA 2LOZA 5KQ1A 2ELBA 1B55A 2DYQA 3A8QA 2AEHA 4A6FA 4D0NB 5C6RA 1TJ6A 1BTNA 3O96A 3B77A 4HB2B 3OANA 1ZM0A 5I2MA 4EJNA 4CYEA 3UZTA 3PG7A 1IRSA 1QQGA 1ZYIA 5HE0A 3ML4A 3NSUA 1XD4A 2N0YA 3SYXA 2YS5A 1J19A 2FJLA 4Z2MB 3A98B 4L6EA 2RNRB 4F7UP 2Z0QA 2YT2A 1MIXA 1SGHA 1Y19B
chains in the Genus database with same CATH topology
2RVBB 4HAXB 3QBVB 4KVGB 5GOWB 2LKOA 1GC7A 1X1GA 1ZVRA 1OQNA 5DHAB 1DROA 1KZGA 4DX8A 4HDQA 1NI2A 1DDMA 5DHFB 2J0KA 4KAXB 4MK0A 2COFA 1WG7A 1AWEA 4A6HA 3CIKA 1K5GB 2KCJA 3TFMA 4HAVB 4KHOA 5JHGA 2MWNB 4GMXB 1GC6A 2Q13A 1RRPB 1V88A 5CLLB 4XWXA 4ZRJA 1U5EA 2BCJA 1MKEA 5DI9B 3PVLA 3U7DA 3IVFA 2I1JA 2RGNB 2YS1A 1UPQA 1ISNA 2P0HA 4C0AA 1V5PA 3P6AA 1FB8A 2K2JA 2IFSA 4Y94A 1U5GA 1M7EA 1X86A 3TVVA 4PNKA 2UZSA 1W1HA 1WVHA 1W1DA 4MY6A 2D11A 2QKLA 2I5FA 3PEGA 5D3WA 2NMBA 2J0JA 1TXDA 2H7DA 2M38A 1EVHA 4MT7A 3P7ZA 2YRYA 4HAUB 2I5CA 5C5BB 2LG1A 3WA0A 1FHXA 2D10A 4F7HA 1V89A 3SUZA 1NTYA 3FEHA 2RUKB 4HB4B 1ZSQA 2QKMA 3F0WA 1XODA 4TKNA 4DXAB 4GPTB 3HQCA 2Z0OA 4KHBB 1W1GA 1MAIA 4HAWB 3PVUA 1QC6A 1U29A 2KGXB 3V5WA 2DHKA 1XX0A 2GCJA 3MPXA 3VIAA 2R09A 5D3VA 2L1CA 3D8EA 4WSFA 2COAA 4GN1A 2DX5A 4WJ7A 3KRXA 3ZDTA 3RCPA 2DHJA 2Y8GA 1Q67A 1Y5OA 1FHOA 4K2PA 4KHAA 1UPRA 2ADZA 1UNPA 2COCA 1FHWA 2J0MA 2ROVA 3ODWA 4GMVA 3D8DA 5C5BA 2H7EA 3PSCA 1EF1A 3AJ4A 2CRFA 2DFKA 4H8SA 1X1FA 1XCGA 1LW3A 5KQ4A 1LB1A 2M14A 4HDOA 1BWNA 1PFJA 2YSZA 3BINA 3VOQA 1N3HA 4EKUA 5C79A 2CODA 3AU5A 2YT1A 2DTCA 1NTVA 1DYNA 1EGXA 2NZ8B 2K2UA 3KSYA 1MK7B 5EFXA 4K2OA 1SHCA 1DDVA 1GG3A 5HE3A 2W2WA 4HAYB 2X18A 1J0WA 3T06A 2V76A 1AQCA 3D8FA 2YS3A 2CAYA 2P0FA 5L81A 1ZC3B 3HW2B 1P5TA 4BBKA 3KRWA 4F7GA 2MKRA 1ZC4B 2IYBA 3KY9A 2EMSA 2DHIA 1P3RA 2UZRA 1OMWA 4NY0A 4P7IA 4PQ0A 3G9WA 5J3TA 3GYPA 3M1IB 3X23A 1PMSA 5D3XA 2DA0A 2W2XC 1NU2A 1U5FA 1H10A 2J59M 4IOYX 3WYFB 2LULA 2EMTA 2G35A 2N23A 2P8VA 2VRWB 2ZPYA 3DXCA 1WGUA 2D9ZA 2LOXA 5LOPB 2DLWA 3TW1A 4IAPA 3ULCA 2GJYA 4EMOA 1PLSA 3KZ1A 4GXBA 5FI0A 2Y7BA 5J3QA 3PP2A 2DKPA 3DXDA 3MDBC 5HE2A 2DYNA 1P6SA 1FGZA 2YVCA 3AU4A 1U5DA 5C16A 1V5MA 2OTXA 2W2XD 3QIJA 1DBHA 2I1KA 1KI1B 1U27A 4A6FB 3SV1A 1WGQA 1V5UA 2E2XA 1MPHA 2D4QA 2D9XA 1XKEA 2L2IA 5D3YA 1I7AA 4NSWA 2OQBA 2RSGA 1UNRA 3F5RA 1WI1A 4HHVA 5J3YA 4CHMA 2YF0A 1U2BA 1WJMA 2GS0A 4K17A 5JHHA 2LYDA 1X05A 2MDXA 3ZVRA 3QWMA 2KUPA 3GYOA 1K5DB 2D2QA 1MK9B 3FM8C 1XR0B 4YL8A 1UEFA 1Z87A 2ELAA 2D9YA 3BJIA 5D27A 1X11A 1FAOA 1MIZB 3A8PA 3TCAA 2Z0PA 3LJUX 5LONB 1BAKA 2XQNM 4ZRIA 3U8ZA 5KCVA 3ODXA 3FSSA 4ZRKA 4HB3B 2RLOA 3ULBA 1RJ2A 1H4RA 2YT0A 4Z2NA 1I2HA 2HTHB 1V61A 2D9VA 1FGYA 1TQZA 5CLQB 1FOEA 4HATB 1OY2A 2CY4A 4GZUA 4WVFB 1UNQA 5HE1A 3ODOA 2PZ1A 2EC1A 3DXEA 4HB0B 1BTKA 2AL6A 4CHJA 4TYZA 4IFSA 2MFQA 1WJ1A 2UVMA 2HE7A 4HAZB 5JLJB 2R0DA 5JP4A 2P0DA 5FI1A 3SO6A 3PVWA 1E5WA 3CXBB 2GCLA 2DKQA 4A5KA 2D9WA 4B6HA 2ROZB 4K81A 3TO1A 1DDWA 1EAZA 3N7CA 2CY5A 5DH9B 2DN6A 2JP2A 2VKIA 2EJ8A 4A6KA 4DBBA 1M7RA 5DIFB 2DX1A 2VSZA 4YONA 3HK0A 2K00A 4DX90 3SNHA 1KZ7A 3PZDA 2Y8FA 2LOZA 5KQ1A 2ELBA 1B55A 2DYQA 3A8QA 2AEHA 4A6FA 4D0NB 5C6RA 1TJ6A 1BTNA 3O96A 4HB2B 3OANA 1ZM0A 4EJNA 4CYEA 3UZTA 3PG7A 1IRSA 1QQGA 5HE0A 3ML4A 3NSUA 1XD4A 2N0YA 3SYXA 2YS5A 1J19A 2FJLA 4Z2MB 3A98B 4L6EA 2RNRB 4F7UP 2Z0QA 1MIXA 1SGHA 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVB B;  4HAX B;  3QBV B;  4KVG B;  5GOW B;  2LKO A;  1GC7 A;  1X1G A;  1ZVR A;  1OQN A;  5DHA B;  1DRO A;  1KZG A;  4DX8 A;  4HDQ A;  1NI2 A;  1DDM A;  5DHF B;  2J0K A;  4KAX B;  4MK0 A;  2COF A;  1WG7 A;  1AWE A;  4A6H A;  3CIK A;  1K5G B;  2KCJ A;  3TFM A;  4HAV B;  4KHO A;  5JHG A;  2MWN B;  4GMX B;  1GC6 A;  2Q13 A;  1RRP B;  1V88 A;  5CLL B;  4XWX A;  4ZRJ A;  1U5E A;  2BCJ A;  1MKE A;  5DI9 B;  3PVL A;  3U7D A;  3IVF A;  2I1J A;  2RGN B;  2YS1 A;  1UPQ A;  1ISN A;  2P0H A;  4C0A A;  1V5P A;  3P6A A;  1FB8 A;  2K2J A;  2IFS A;  4Y94 A;  1U5G A;  1M7E A;  1X86 A;  3TVV A;  4PNK A;  2UZS A;  1W1H A;  1WVH A;  1W1D A;  4MY6 A;  2D11 A;  2QKL A;  2I5F A;  3PEG A;  5D3W A;  2NMB A;  2J0J A;  1TXD A;  2H7D A;  2M38 A;  1EVH A;  4MT7 A;  3P7Z A;  2YRY A;  4HAU B;  2I5C A;  5C5B B;  2LG1 A;  3WA0 A;  1FHX A;  2D10 A;  4F7H A;  1V89 A;  3SUZ A;  1NTY A;  3FEH A;  2RUK B;  4HB4 B;  1ZSQ A;  2QKM A;  3F0W A;  1XOD A;  4TKN A;  4DXA B;  4GPT B;  3HQC A;  2Z0O A;  4KHB B;  1W1G A;  1MAI A;  4HAW B;  3PVU A;  1QC6 A;  1U29 A;  2KGX B;  3V5W A;  2DHK A;  1XX0 A;  2GCJ A;  3MPX A;  3VIA A;  2R09 A;  5D3V A;  2L1C A;  3D8E A;  4WSF A;  2COA A;  4GN1 A;  2DX5 A;  4WJ7 A;  3KRX A;  3ZDT A;  3RCP A;  2DHJ A;  2Y8G A;  1Q67 A;  1Y5O A;  1FHO A;  4K2P A;  4KHA A;  1UPR A;  2ADZ A;  1UNP A;  2COC A;  1FHW A;  2J0M A;  2ROV A;  3ODW A;  4GMV A;  3D8D A;  5C5B A;  2H7E A;  3PSC A;  1EF1 A;  3AJ4 A;  2CRF A;  2DFK A;  4H8S A;  1X1F A;  1XCG A;  1LW3 A;  5KQ4 A;  1LB1 A;  2M14 A;  4HDO A;  1BWN A;  1PFJ A;  2YSZ A;  3BIN A;  3VOQ A;  1N3H A;  4EKU A;  5C79 A;  2COD A;  3AU5 A;  2YT1 A;  2DTC A;  1NTV A;  1DYN A;  1EGX A;  2NZ8 B;  2K2U A;  3KSY A;  1MK7 B;  5EFX A;  4K2O A;  1SHC A;  1DDV A;  1GG3 A;  5HE3 A;  2W2W A;  4HAY B;  2X18 A;  1J0W A;  3T06 A;  2V76 A;  1AQC A;  3D8F A;  2YS3 A;  2CAY A;  2P0F A;  5L81 A;  1ZC3 B;  3HW2 B;  1P5T A;  4BBK A;  3KRW A;  4F7G A;  2MKR A;  1ZC4 B;  2IYB A;  3KY9 A;  2EMS A;  2DHI A;  1P3R A;  2UZR A;  1OMW A;  4NY0 A;  4P7I A;  4PQ0 A;  3G9W A;  5J3T A;  3GYP A;  3M1I B;  3X23 A;  1PMS A;  5D3X A;  2DA0 A;  2W2X C;  1NU2 A;  1U5F A;  1H10 A;  2J59 M;  4IOY X;  3WYF B;  2LUL A;  2EMT A;  2G35 A;  2N23 A;  2P8V A;  2VRW B;  2ZPY A;  3DXC A;  1WGU A;  2D9Z A;  2LOX A;  5LOP B;  2DLW A;  3TW1 A;  4IAP A;  3ULC A;  2GJY A;  4EMO A;  1PLS A;  3KZ1 A;  4GXB A;  5FI0 A;  2Y7B A;  5J3Q A;  3PP2 A;  2DKP A;  3DXD A;  3MDB C;  5HE2 A;  2DYN A;  1P6S A;  1FGZ A;  2YVC A;  3AU4 A;  1U5D A;  5C16 A;  1V5M A;  2OTX A;  2W2X D;  3QIJ A;  1DBH A;  2I1K A;  1KI1 B;  1U27 A;  4A6F B;  3SV1 A;  1WGQ A;  1V5U A;  2E2X A;  1MPH A;  2D4Q A;  2D9X A;  1XKE A;  2L2I A;  5D3Y A;  1I7A A;  4NSW A;  2OQB A;  2RSG A;  1UNR A;  3F5R A;  1WI1 A;  4HHV A;  5J3Y A;  4CHM A;  2YF0 A;  1U2B A;  1WJM A;  2GS0 A;  4K17 A;  5JHH A;  2LYD A;  1X05 A;  2MDX A;  3ZVR A;  3QWM A;  2KUP A;  3GYO A;  1K5D B;  2D2Q A;  1MK9 B;  3FM8 C;  1XR0 B;  4YL8 A;  1UEF A;  1Z87 A;  2ELA A;  2D9Y A;  3BJI A;  5D27 A;  1X11 A;  1FAO A;  1MIZ B;  3A8P A;  3TCA A;  2Z0P A;  3LJU X;  5LON B;  1BAK A;  2XQN M;  4ZRI A;  3U8Z A;  5KCV A;  3ODX A;  3FSS A;  4ZRK A;  4HB3 B;  2RLO A;  3ULB A;  1RJ2 A;  1H4R A;  2YT0 A;  4Z2N A;  1I2H A;  2HTH B;  1V61 A;  2D9V A;  1FGY A;  1TQZ A;  5CLQ B;  1FOE A;  4HAT B;  1OY2 A;  2CY4 A;  4GZU A;  4WVF B;  1UNQ A;  5HE1 A;  3ODO A;  2PZ1 A;  2EC1 A;  3DXE A;  4HB0 B;  1BTK A;  2AL6 A;  4CHJ A;  4TYZ A;  4IFS A;  2MFQ A;  1WJ1 A;  2UVM A;  2HE7 A;  4HAZ B;  5JLJ B;  2R0D A;  5JP4 A;  2P0D A;  5FI1 A;  3SO6 A;  3PVW A;  1E5W A;  3CXB B;  2GCL A;  2DKQ A;  4A5K A;  2D9W A;  4B6H A;  2ROZ B;  4K81 A;  3TO1 A;  1DDW A;  1EAZ A;  3N7C A;  2CY5 A;  5DH9 B;  2DN6 A;  2JP2 A;  2VKI A;  2EJ8 A;  4A6K A;  4DBB A;  1M7R A;  5DIF B;  2DX1 A;  2VSZ A;  4YON A;  3HK0 A;  2K00 A;  4DX9 0;  3SNH A;  1KZ7 A;  3PZD A;  2Y8F A;  2LOZ A;  5KQ1 A;  2ELB A;  1B55 A;  2DYQ A;  3A8Q A;  2AEH A;  4A6F A;  4D0N B;  5C6R A;  1TJ6 A;  1BTN A;  3O96 A;  4HB2 B;  3OAN A;  1ZM0 A;  4EJN A;  4CYE A;  3UZT A;  3PG7 A;  1IRS A;  1QQG A;  5HE0 A;  3ML4 A;  3NSU A;  1XD4 A;  2N0Y A;  3SYX A;  2YS5 A;  1J19 A;  2FJL A;  4Z2M B;  3A98 B;  4L6E A;  2RNR B;  4F7U P;  2Z0Q A;  1MIX A;  1SGH A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 2RVB B;  4HAX B;  3QBV B;  4KVG B;  5GOW B;  2LKO A;  1GC7 A;  1X1G A;  1ZVR A;  1OQN A;  5DHA B;  3NW8 A;  4CSQ A;  1DRO A;  1KZG A;  4DX8 A;  2KIG A;  4HDQ A;  1NI2 A;  1DDM A;  5DHF B;  2J0K A;  4KAX B;  4MK0 A;  4D6W A;  2COF A;  1WG7 A;  1AWE A;  4A6H A;  3CIK A;  1K5G B;  2KCJ A;  3TFM A;  4HAV B;  4KHO A;  5JHG A;  2MWN B;  4GMX B;  3DCX A;  1GC6 A;  2Q13 A;  1RRP B;  1V88 A;  5CLL B;  4XWX A;  4ZRJ A;  1U5E A;  2BCJ A;  1MKE A;  5DI9 B;  3PVL A;  3U7D A;  3IVF A;  2I1J A;  3HSA A;  2RGN B;  2YS1 A;  1UPQ A;  1ISN A;  2P0H A;  4C0A A;  1V5P A;  3P6A A;  1FB8 A;  2K2J A;  2IFS A;  4Y94 A;  1U5G A;  1M7E A;  1X86 A;  3TVV A;  4PNK A;  2UZS A;  1W1H A;  1WVH A;  1W1D A;  4MY6 A;  2D11 A;  2QKL A;  2I5F A;  3PEG A;  5D3W A;  2NMB A;  2J0J A;  1TXD A;  2H7D A;  2M38 A;  1EVH A;  4MT7 A;  2KUQ A;  3P7Z A;  2YRY A;  2GUM A;  4HAU B;  2I5C A;  5C5B B;  2LG1 A;  3WA0 A;  1FHX A;  1MI1 A;  2D10 A;  4F7H A;  1V89 A;  3SUZ A;  1NTY A;  4DIX A;  3FEH A;  2RUK B;  4HB4 B;  4GNK B;  2Z13 A;  1ZSQ A;  2NBV A;  2QKM A;  3F0W A;  1XOD A;  4TKN A;  4DXA B;  4GPT B;  3HQC A;  2Z0O A;  4KHB B;  1W1G A;  1MAI A;  4HAW B;  3PVU A;  1QC6 A;  1U29 A;  2KGX B;  3V5W A;  3A58 A;  2DHK A;  1XX0 A;  2GCJ A;  3MPX A;  3VIA A;  2R09 A;  5D3V A;  2L1C A;  3D8E A;  4WSF A;  2COA A;  4GN1 A;  2DX5 A;  4WJ7 A;  3KRX A;  3FVC A;  3ZDT A;  3RCP A;  2DHJ A;  2Y8G A;  1Q67 A;  1Y5O A;  1FHO A;  4K2P A;  4KHA A;  1UPR A;  2ADZ A;  1UNP A;  2COC A;  1FHW A;  2J0M A;  2ROV A;  3ODW A;  4GMV A;  3D8D A;  5C5B A;  2H7E A;  4QXA B;  3PSC A;  1EF1 A;  3AJ4 A;  2CRF A;  2DFK A;  4H8S A;  1X1F A;  1XCG A;  1LW3 A;  3NWF A;  1LB1 A;  5KQ4 A;  2M14 A;  4HDO A;  2K49 A;  1BWN A;  1PFJ A;  2YSZ A;  3BIN A;  3VOQ A;  1N3H A;  4EKU A;  5C79 A;  2COD A;  3AU5 A;  2YT1 A;  2DTC A;  1NTV A;  1DYN A;  1T77 A;  1EGX A;  2NZ8 B;  2K2U A;  3KSY A;  4GOU A;  1MK7 B;  5EFX A;  4K2O A;  1SHC A;  1DDV A;  1GG3 A;  3NWA A;  5HE3 A;  2W2W A;  4HAY B;  2X18 A;  1J0W A;  3T06 A;  2V76 A;  1AQC A;  3D8F A;  2YS3 A;  3U12 A;  2CAY A;  2P0F A;  5L81 A;  1ZC3 B;  3HW2 B;  1P5T A;  4BBK A;  3KRW A;  4F7G A;  2MKR A;  1ZC4 B;  2IYB A;  3KY9 A;  4QJ4 B;  2EMS A;  2DHI A;  1P3R A;  2UZR A;  5IRS A;  1OMW A;  4NY0 A;  4P7I A;  4PQ0 A;  3G9W A;  5J3T A;  3GYP A;  3M1I B;  3X23 A;  1PMS A;  3NWD A;  5D3X A;  2DA0 A;  2W2X C;  1NU2 A;  5LG4 B;  1U5F A;  1H10 A;  2J59 M;  4IOY X;  3WYF B;  2LUL A;  2EMT A;  2G35 A;  2N23 A;  2P8V A;  2VRW B;  2ZKM X;  2ZPY A;  3DXC A;  4QJ5 B;  1WGU A;  2D9Z A;  2LOX A;  5LOP B;  2DLW A;  3TW1 A;  4IAP A;  3ULC A;  2K8E A;  2GJY A;  4EMO A;  1PLS A;  3KZ1 A;  4GXB A;  5FI0 A;  2Y7B A;  5J3Q A;  3PP2 A;  2DKP A;  3DXD A;  3MDB C;  5HE2 A;  2DYN A;  1P6S A;  1FGZ A;  2YVC A;  2Z4D A;  3AU4 A;  1U5D A;  5C16 A;  1V5M A;  2OTX A;  3OHM B;  2W2X D;  3QIJ A;  1DBH A;  2I1K A;  1KI1 B;  1U27 A;  4A6F B;  3SV1 A;  1WGQ A;  1V5U A;  2E2X A;  1MPH A;  2D4Q A;  2D9X A;  1XKE A;  2L2I A;  5D3Y A;  1I7A A;  4NSW A;  2OQB A;  2RSG A;  4OSN A;  1UNR A;  3F5R A;  1WI1 A;  4HHV A;  5J3Y A;  4CHM A;  2YF0 A;  1U2B A;  1WJM A;  2GS0 A;  2R2Y A;  4K17 A;  5JHH A;  2LYD A;  1X05 A;  2MDX A;  4OT1 A;  3QWM A;  3ZVR A;  2KUP A;  3GYO A;  1K5D B;  2D2Q A;  1MK9 B;  3FM8 C;  1XR0 B;  4YL8 A;  1UEF A;  1Z87 A;  2ELA A;  2D9Y A;  3BJI A;  5D27 A;  1X11 A;  1FAO A;  1MIZ B;  3A8P A;  3TCA A;  2Z0P A;  3LJU X;  5LON B;  1BAK A;  2XQN M;  4ZRI A;  3U8Z A;  5KCV A;  3ODX A;  3FSS A;  4ZRK A;  4HB3 B;  2RLO A;  2Z59 A;  3ULB A;  1RJ2 A;  1H4R A;  2YT0 A;  4Z2N A;  1I2H A;  2HTH B;  1V61 A;  2D9V A;  1FGY A;  2Z14 A;  1TQZ A;  5CLQ B;  2KR0 A;  1FOE A;  4HAT B;  1OY2 A;  2CY4 A;  4GZU A;  4WVF B;  1UNQ A;  5HE1 A;  3ODO A;  2PZ1 A;  2EC1 A;  5I2S A;  3DXE A;  4HB0 B;  1BTK A;  2AL6 A;  4CHJ A;  4TYZ A;  3HIE A;  4IFS A;  2MFQ A;  1WJ1 A;  2RRF A;  2UVM A;  2HE7 A;  4QJ3 B;  4HAZ B;  5JLJ B;  2R0D A;  5JP4 A;  2P0D A;  5FI1 A;  3SO6 A;  3PVW A;  1E5W A;  3CXB B;  2GCL A;  2DKQ A;  2FJU B;  4A5K A;  2D9W A;  4B6H A;  2ROZ B;  4K81 A;  3TO1 A;  1DDW A;  1EAZ A;  5M4Y B;  3N7C A;  2CY5 A;  5DH9 B;  2DN6 A;  2JP2 A;  2VKI A;  2EJ8 A;  4KHB A;  4A6K A;  2KIE A;  4DBB A;  1M7R A;  5DIF B;  2DX1 A;  2VSZ A;  4HSI A;  4YON A;  3HK0 A;  2K00 A;  4DX9 0;  3SNH A;  1KZ7 A;  4L1R A;  3PZD A;  2Y8F A;  2LOZ A;  5KQ1 A;  2ELB A;  1B55 A;  2DYQ A;  3A8Q A;  2AEH A;  4A6F A;  4D0N B;  5C6R A;  1TJ6 A;  1BTN A;  3O96 A;  3B77 A;  4HB2 B;  3OAN A;  1ZM0 A;  5I2M A;  4EJN A;  4CYE A;  3UZT A;  3PG7 A;  1IRS A;  1QQG A;  1ZYI A;  5HE0 A;  3ML4 A;  3NSU A;  1XD4 A;  2N0Y A;  3SYX A;  2YS5 A;  1J19 A;  2FJL A;  4Z2M B;  3A98 B;  4L6E A;  2RNR B;  4F7U P;  2Z0Q A;  2YT2 A;  1MIX A;  1SGH A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 2RVB B;  4HAX B;  3QBV B;  4KVG B;  5GOW B;  2LKO A;  1GC7 A;  1X1G A;  1ZVR A;  1OQN A;  5DHA B;  1DRO A;  1KZG A;  4DX8 A;  4HDQ A;  1NI2 A;  1DDM A;  5DHF B;  2J0K A;  4KAX B;  4MK0 A;  2COF A;  1WG7 A;  1AWE A;  4A6H A;  3CIK A;  1K5G B;  2KCJ A;  3TFM A;  4HAV B;  4KHO A;  5JHG A;  2MWN B;  4GMX B;  1GC6 A;  2Q13 A;  1RRP B;  1V88 A;  5CLL B;  4XWX A;  4ZRJ A;  1U5E A;  2BCJ A;  1MKE A;  5DI9 B;  3PVL A;  3U7D A;  3IVF A;  2I1J A;  2RGN B;  2YS1 A;  1UPQ A;  1ISN A;  2P0H A;  4C0A A;  1V5P A;  3P6A A;  1FB8 A;  2K2J A;  2IFS A;  4Y94 A;  1U5G A;  1M7E A;  1X86 A;  3TVV A;  4PNK A;  2UZS A;  1W1H A;  1WVH A;  1W1D A;  4MY6 A;  2D11 A;  2QKL A;  2I5F A;  3PEG A;  5D3W A;  2NMB A;  2J0J A;  1TXD A;  2H7D A;  2M38 A;  1EVH A;  4MT7 A;  3P7Z A;  2YRY A;  4HAU B;  2I5C A;  5C5B B;  2LG1 A;  3WA0 A;  1FHX A;  2D10 A;  4F7H A;  1V89 A;  3SUZ A;  1NTY A;  3FEH A;  2RUK B;  4HB4 B;  1ZSQ A;  2QKM A;  3F0W A;  1XOD A;  4TKN A;  4DXA B;  4GPT B;  3HQC A;  2Z0O A;  4KHB B;  1W1G A;  1MAI A;  4HAW B;  3PVU A;  1QC6 A;  1U29 A;  2KGX B;  3V5W A;  2DHK A;  1XX0 A;  2GCJ A;  3MPX A;  3VIA A;  2R09 A;  5D3V A;  2L1C A;  3D8E A;  4WSF A;  2COA A;  4GN1 A;  2DX5 A;  4WJ7 A;  3KRX A;  3ZDT A;  3RCP A;  2DHJ A;  2Y8G A;  1Q67 A;  1Y5O A;  1FHO A;  4K2P A;  4KHA A;  1UPR A;  2ADZ A;  1UNP A;  2COC A;  1FHW A;  2J0M A;  2ROV A;  3ODW A;  4GMV A;  3D8D A;  5C5B A;  2H7E A;  3PSC A;  1EF1 A;  3AJ4 A;  2CRF A;  2DFK A;  4H8S A;  1X1F A;  1XCG A;  1LW3 A;  5KQ4 A;  1LB1 A;  2M14 A;  4HDO A;  1BWN A;  1PFJ A;  2YSZ A;  3BIN A;  3VOQ A;  1N3H A;  4EKU A;  5C79 A;  2COD A;  3AU5 A;  2YT1 A;  2DTC A;  1NTV A;  1DYN A;  1EGX A;  2NZ8 B;  2K2U A;  3KSY A;  1MK7 B;  5EFX A;  4K2O A;  1SHC A;  1DDV A;  1GG3 A;  5HE3 A;  2W2W A;  4HAY B;  2X18 A;  1J0W A;  3T06 A;  2V76 A;  1AQC A;  3D8F A;  2YS3 A;  2CAY A;  2P0F A;  5L81 A;  1ZC3 B;  3HW2 B;  1P5T A;  4BBK A;  3KRW A;  4F7G A;  2MKR A;  1ZC4 B;  2IYB A;  3KY9 A;  2EMS A;  2DHI A;  1P3R A;  2UZR A;  1OMW A;  4NY0 A;  4P7I A;  4PQ0 A;  3G9W A;  5J3T A;  3GYP A;  3M1I B;  3X23 A;  1PMS A;  5D3X A;  2DA0 A;  2W2X C;  1NU2 A;  1U5F A;  1H10 A;  2J59 M;  4IOY X;  3WYF B;  2LUL A;  2EMT A;  2G35 A;  2N23 A;  2P8V A;  2VRW B;  2ZPY A;  3DXC A;  1WGU A;  2D9Z A;  2LOX A;  5LOP B;  2DLW A;  3TW1 A;  4IAP A;  3ULC A;  2GJY A;  4EMO A;  1PLS A;  3KZ1 A;  4GXB A;  5FI0 A;  2Y7B A;  5J3Q A;  3PP2 A;  2DKP A;  3DXD A;  3MDB C;  5HE2 A;  2DYN A;  1P6S A;  1FGZ A;  2YVC A;  3AU4 A;  1U5D A;  5C16 A;  1V5M A;  2OTX A;  2W2X D;  3QIJ A;  1DBH A;  2I1K A;  1KI1 B;  1U27 A;  4A6F B;  3SV1 A;  1WGQ A;  1V5U A;  2E2X A;  1MPH A;  2D4Q A;  2D9X A;  1XKE A;  2L2I A;  5D3Y A;  1I7A A;  4NSW A;  2OQB A;  2RSG A;  1UNR A;  3F5R A;  1WI1 A;  4HHV A;  5J3Y A;  4CHM A;  2YF0 A;  1U2B A;  1WJM A;  2GS0 A;  4K17 A;  5JHH A;  2LYD A;  1X05 A;  2MDX A;  3ZVR A;  3QWM A;  2KUP A;  3GYO A;  1K5D B;  2D2Q A;  1MK9 B;  3FM8 C;  1XR0 B;  4YL8 A;  1UEF A;  1Z87 A;  2ELA A;  2D9Y A;  3BJI A;  5D27 A;  1X11 A;  1FAO A;  1MIZ B;  3A8P A;  3TCA A;  2Z0P A;  3LJU X;  5LON B;  1BAK A;  2XQN M;  4ZRI A;  3U8Z A;  5KCV A;  3ODX A;  3FSS A;  4ZRK A;  4HB3 B;  2RLO A;  3ULB A;  1RJ2 A;  1H4R A;  2YT0 A;  4Z2N A;  1I2H A;  2HTH B;  1V61 A;  2D9V A;  1FGY A;  1TQZ A;  5CLQ B;  1FOE A;  4HAT B;  1OY2 A;  2CY4 A;  4GZU A;  4WVF B;  1UNQ A;  5HE1 A;  3ODO A;  2PZ1 A;  2EC1 A;  3DXE A;  4HB0 B;  1BTK A;  2AL6 A;  4CHJ A;  4TYZ A;  4IFS A;  2MFQ A;  1WJ1 A;  2UVM A;  2HE7 A;  4HAZ B;  5JLJ B;  2R0D A;  5JP4 A;  2P0D A;  5FI1 A;  3SO6 A;  3PVW A;  1E5W A;  3CXB B;  2GCL A;  2DKQ A;  4A5K A;  2D9W A;  4B6H A;  2ROZ B;  4K81 A;  3TO1 A;  1DDW A;  1EAZ A;  3N7C A;  2CY5 A;  5DH9 B;  2DN6 A;  2JP2 A;  2VKI A;  2EJ8 A;  4A6K A;  4DBB A;  1M7R A;  5DIF B;  2DX1 A;  2VSZ A;  4YON A;  3HK0 A;  2K00 A;  4DX9 0;  3SNH A;  1KZ7 A;  3PZD A;  2Y8F A;  2LOZ A;  5KQ1 A;  2ELB A;  1B55 A;  2DYQ A;  3A8Q A;  2AEH A;  4A6F A;  4D0N B;  5C6R A;  1TJ6 A;  1BTN A;  3O96 A;  4HB2 B;  3OAN A;  1ZM0 A;  4EJN A;  4CYE A;  3UZT A;  3PG7 A;  1IRS A;  1QQG A;  5HE0 A;  3ML4 A;  3NSU A;  1XD4 A;  2N0Y A;  3SYX A;  2YS5 A;  1J19 A;  2FJL A;  4Z2M B;  3A98 B;  4L6E A;  2RNR B;  4F7U P;  2Z0Q A;  1MIX A;  1SGH A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...