1EAZA

Crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANDEM PH DOMAIN CONTAINING PROTEIN-1
publication title Crystal Structure of the Phosphatidylinositol 3,4-Bisphosphate-Binding Pleckstrin Homology (Ph) Domain of Tandem Ph-Domain-Containing Protein 1 (Tapp1): Molecular Basis of Lipid Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1eazA00
2VKIA 2ELAA 1RRPB 1ZM0A 2DA0A 4F7UP 4B6HA 3BINA 2MFQA 1ZVRA 1V88A 1J19A 4CHMA 1BTNA 2L2IA 2LKOA 5JP4A 3TW1A 3MDBC 3KRWA 1H10A 2GCLA 4H8SA 4GZUA 3RCPA 1MAIA 3AU5A 3QBVB 1EAZA 1FGZA 2Z0OA 3SUZA 2P0FA 2FJLA 1PMSA 2YT0A 1BTKA 3AU4A 3ULCA 4K2PA 5JLJB 2E2XA 2DKPA 4DX90 3SV1A 4NY0A 5HE0A 1WJMA 4K2OA 2OTXA 1SHCA 2Y8FA 4ZRIA 3QIJA 3CIKA 4ZRKA 3DXEA 2LG1A 2D9ZA 4KVGB 1IRSA 2GJYA 1M7EA 3HK0A 1H4RA 3PVUA 2OQBA 3SYXA 3SNHA 2MWNB 1UNRA 1UPRA 3PSCA 4ZRJA 4Z2MB 2D4QA 2DHIA 2KGXB 2KUPA 1LB1A 1K5GB 1GG3A 5FI0A 2D9YA 4KHBB 1OQNA 3OANA 2YRYA 1N3HA 3PP2A 3P7ZA 1Q67A 5KCVA 4MY6A 1KZGA 3A8PA 2ELBA 5DHFB 2CODA 2DYNA 2DX5A 3NSUA 1RJ2A 4F7GA 1FOEA 2P0DA 2UZSA 1Y19B 5LOPB 2J0MA 2LOZA 4EKUA 1FHOA 5D3WA 1NI2A 1PFJA 1X1FA 1ISNA 3ML4A 4XWXA 5C16A 2IYBA 4TYZA 4Y94A 2LOXA 1MKEA 2AEHA 1V5PA 5C5BA 3ZDTA 4WSFA 1U5FA 2I5CA 2X18A 5D3XA 5CLLB 1TXDA 5L81A 1FHXA 1EF1A 2ADZA 1XCGA 1M7RA 2VSZA 1DBHA 4A6KA 2W2XC 1XX0A 4BBKA 1SGHA 2RSGA 3KSYA 1X86A 3HW2B 1X11A 3PVLA 4D0NB 2D9VA 2DKQA 4K81A 2D9XA 4WJ7A 5D3YA 4DX8A 1NTVA 3ODXA 2K2UA 3QWMA 1MIZB 3ODWA 4HHVA 2YS3A 2VRWB 3KY9A 3SO6A 2UVMA 1TJ6A 2YF0A 4L6EA 2P0HA 2M38A 4NSWA 2YS1A 5GOWB 4HDQA 1U29A 1MIXA 1WJ1A 1QC6A 3VOQA 5DH9B 5J3QA 2NZ8B 1I2HA 5DI9B 3KZ1A 1MK9B 3GYPA 5HE1A 3F0WA 1DROA 5CLQB 2CAYA 1EVHA 2Y7BA 4HB4B 2H7EA 4HAUB 3KRXA 1P5TA 1U2BA 1UPQA 1W1GA 5LONB 2COCA 1B55A 1E5WA 1V89A 2D10A 4IFSA 4HAWB 4IOYX 2AL6A 4CHJA 2N23A 2EC1A 2KCJA 1Z87A 3AJ4A 2DLWA 5C6RA 2I1JA 2YSZA 5D3VA 4PNKA 1FHWA 2LYDA 5FI1A 3FSSA 1P3RA 2XQNM 1KZ7A 2MKRA 5D27A 1MPHA 4CYEA 1I7AA 1Y5OA 1XR0B 4HB0B 4A6FB 2Y8GA 1J0WA 2RLOA 5J3YA 3TCAA 1ZC4B 2ROZB 1ZC3B 4KAXB 2COFA 2GS0A 1K5DB 1OMWA 4WVFB 3CXBB 1XD4A 4HAZB 3M1IB 1X1GA 4A5KA 2RGNB 3PG7A 2D2QA 4GMXB 4EJNA 2V76A 2M14A 2G35A 3F5RA 1NU2A 3HQCA 3WYFB 2J0JA 2CRFA 2QKMA 2DTCA 1QQGA 2L1CA 3MPXA 1XODA 1KI1B 2BCJA 3FEHA 3A8QA 3P6AA 4YL8A 5DIFB 5KQ4A 1BAKA 1X05A 4K17A 1WVHA 2I1KA 2YT1A 2K2JA 2J59M 4TKNA 2IFSA 2RVBB 1DDVA 5KQ1A 1FAOA 1AWEA 1WI1A 1WGQA 4HAVB 2DX1A 2PZ1A 3U8ZA 3LJUX 3U7DA 2R0DA 2COAA 3T06A 2ZPYA 4HB2B 1U5GA 3DXCA 2K00A 1DDWA 1UNPA 2P8VA 2W2WA 2N0YA 4P7IA 1V5UA 4GXBA 4A6HA 1DYNA 3N7CA 2DHJA 1ZSQA 3X23A 1U5EA 1W1HA 2NMBA 5J3TA 4HATB 4YONA 2D11A 3O96A 1UNQA 2DFKA 2CY4A 1FB8A 4DBBA 3DXDA 4HAYB 3WA0A 3V5WA 3UZTA 1NTYA 2JP2A 3G9WA 5JHGA 2Z0QA 2CY5A 1U27A 2LULA 1OY2A 3A98B 1MK7B 2MDXA 1EGXA 3BJIA 3TO1A 4GN1A 2D9WA 4GPTB 2YS5A 1W1DA 2J0KA 3PEGA 4HAXB 4PQ0A 2HTHB 4MK0A 1V61A 3FM8C 4EMOA 2ROVA 2EMTA 5C5BB 2RUKB 1XKEA 3GYOA 2DN6A 1WGUA 1GC6A 2R09A 1DDMA 4DXAB 1AQCA 1P6SA 1LW3A 2DYQA 2Z0PA 3ZVRA 3PZDA 1U5DA 1GC7A 2YVCA 3TFMA 3D8FA 4HB3B 4HDOA 1V5MA 2HE7A 1FGYA 3D8DA 1BWNA 2QKLA 4Z2NA 5JHHA 4A6FA 2I5FA 5HE3A 2EJ8A 2EMSA 2RNRB 5HE2A 1TQZA 4F7HA 4IAPA 1PLSA 1WG7A 2H7DA 5EFXA 2DHKA 3D8EA 4KHAA 4MT7A 3ULBA 2W2XD 3VIAA 4KHOA 3PVWA 2GCJA 5DHAB 3TVVA 4C0AA 2Q13A 2UZRA 4GMVA 5C79A 3IVFA 3ODOA 1UEFA
chains in the Genus database with same CATH superfamily
2VKIA 2ELAA 1RRPB 1ZM0A 2DA0A 4F7UP 4B6HA 3BINA 2MFQA 1ZVRA 1V88A 1J19A 4CHMA 1BTNA 2L2IA 4QJ3B 2LKOA 5JP4A 3TW1A 3MDBC 3KRWA 1H10A 2GCLA 3NWFA 4H8SA 4GZUA 3RCPA 1MAIA 3AU5A 3QBVB 1EAZA 1FGZA 2YT2A 2Z0OA 3SUZA 2P0FA 2FJLA 2KUQA 1PMSA 2YT0A 1BTKA 3AU4A 5LG4B 3ULCA 2RRFA 4K2PA 5JLJB 2E2XA 2DKPA 4DX90 3SV1A 4NY0A 5HE0A 4QJ4B 1WJMA 4K2OA 2OTXA 1SHCA 2Y8FA 4ZRIA 3QIJA 3CIKA 2FJUB 4OSNA 5IRSA 4ZRKA 3DXEA 2LG1A 2D9ZA 2R2YA 1IRSA 2GJYA 2Z14A 1M7EA 3HK0A 4KVGB 4QJ5B 1H4RA 3PVUA 2OQBA 3SYXA 3SNHA 2MWNB 1UNRA 1UPRA 3PSCA 4ZRJA 4Z2MB 2D4QA 2DHIA 2KGXB 2KUPA 1LB1A 1K5GB 2KIGA 1GG3A 5FI0A 2D9YA 4KHBB 1OQNA 3OANA 3B77A 2YRYA 1N3HA 3PP2A 3P7ZA 1Q67A 5KCVA 4MY6A 1KZGA 3A8PA 2ELBA 1ZYIA 5DHFB 2CODA 2DYNA 3NW8A 2DX5A 3NSUA 1RJ2A 4F7GA 1FOEA 2P0DA 2UZSA 1Y19B 5LOPB 2J0MA 2LOZA 4EKUA 1FHOA 5D3WA 1NI2A 2GUMA 1T77A 1PFJA 1X1FA 1ISNA 3ML4A 4XWXA 1MI1A 5C16A 2IYBA 4TYZA 4Y94A 2LOXA 1MKEA 2AEHA 1V5PA 4DIXA 5C5BA 3ZDTA 5I2MA 4WSFA 1U5FA 2I5CA 2X18A 5D3XA 5CLLB 3NWAA 1TXDA 5L81A 1FHXA 1EF1A 4GOUA 4KHBA 2ADZA 1XCGA 4L1RA 1M7RA 2VSZA 1DBHA 4GNKB 4A6KA 2W2XC 1XX0A 4BBKA 3U12A 1SGHA 2RSGA 3KSYA 1X86A 3HW2B 1X11A 3PVLA 4D0NB 2D9VA 2DKQA 4K81A 2D9XA 4WJ7A 5D3YA 4DX8A 1NTVA 3ODXA 2K2UA 3QWMA 1MIZB 3ODWA 2Z4DA 4HHVA 2YS3A 2VRWB 3KY9A 3SO6A 2UVMA 1TJ6A 2YF0A 4L6EA 2K49A 2P0HA 2M38A 5I2SA 4NSWA 2YS1A 5GOWB 4HDQA 1U29A 1MIXA 1WJ1A 1QC6A 3VOQA 5DH9B 5J3QA 2NZ8B 1I2HA 5DI9B 3KZ1A 1MK9B 4OT1A 4CSQA 3GYPA 5HE1A 3F0WA 1DROA 5CLQB 2CAYA 1EVHA 2Y7BA 4HB4B 2H7EA 4HAUB 3KRXA 1P5TA 1U2BA 1UPQA 1W1GA 5LONB 2COCA 1B55A 1E5WA 1V89A 2D10A 4IFSA 4HAWB 4IOYX 2AL6A 4CHJA 2N23A 2EC1A 2KCJA 1Z87A 3AJ4A 2DLWA 3FVCA 5C6RA 5M4YB 3HIEA 2I1JA 2YSZA 5D3VA 4PNKA 1FHWA 2LYDA 5FI1A 3FSSA 1P3RA 2XQNM 1KZ7A 2MKRA 5D27A 1MPHA 4CYEA 1I7AA 1Y5OA 1XR0B 4HB0B 4A6FB 2Y8GA 1J0WA 2RLOA 5J3YA 3TCAA 1ZC4B 2ROZB 1ZC3B 4KAXB 2COFA 2GS0A 1K5DB 1OMWA 4WVFB 3CXBB 1XD4A 4HAZB 3M1IB 1X1GA 4A5KA 2RGNB 3A58A 2D2QA 3PG7A 4GMXB 4EJNA 2V76A 2M14A 2G35A 3F5RA 1NU2A 3HQCA 3WYFB 2J0JA 2CRFA 2QKMA 2DTCA 1QQGA 2L1CA 3MPXA 1XODA 1KI1B 2BCJA 3FEHA 3A8QA 3P6AA 4YL8A 5DIFB 5KQ4A 1BAKA 1X05A 4K17A 1WVHA 2I1KA 2YT1A 2K2JA 2J59M 4TKNA 2IFSA 2RVBB 1DDVA 5KQ1A 1FAOA 4QXAB 1AWEA 1WI1A 1WGQA 4HAVB 2DX1A 2PZ1A 3U8ZA 3LJUX 3U7DA 2R0DA 2COAA 3T06A 2ZPYA 4HB2B 1U5GA 3DXCA 2K00A 1DDWA 1UNPA 2P8VA 2W2WA 2N0YA 4P7IA 3NWDA 1V5UA 4GXBA 4A6HA 1DYNA 3N7CA 2DHJA 1ZSQA 3X23A 4D6WA 2ZKMX 1U5EA 2Z59A 1W1HA 2NMBA 5J3TA 3OHMB 4HATB 4YONA 2D11A 3O96A 1UNQA 2DFKA 2CY4A 1FB8A 4DBBA 3DXDA 4HAYB 3WA0A 3V5WA 3UZTA 1NTYA 2JP2A 3G9WA 3HSAA 5JHGA 2Z0QA 2CY5A 1U27A 2LULA 1OY2A 3A98B 1MK7B 2MDXA 1EGXA 3BJIA 3TO1A 4GN1A 2D9WA 4GPTB 2YS5A 1W1DA 2J0KA 3PEGA 4HAXB 4PQ0A 2HTHB 4MK0A 1V61A 3FM8C 2NBVA 4EMOA 2ROVA 2EMTA 5C5BB 2RUKB 1XKEA 3GYOA 3DCXA 2DN6A 1WGUA 2KR0A 1GC6A 2R09A 1DDMA 4DXAB 1AQCA 1P6SA 1LW3A 2DYQA 2Z0PA 3ZVRA 3PZDA 1U5DA 1GC7A 2YVCA 3TFMA 3D8FA 4HB3B 4HDOA 2K8EA 1V5MA 2HE7A 2Z13A 1FGYA 3D8DA 1BWNA 2QKLA 4Z2NA 4HSIA 5JHHA 4A6FA 2I5FA 5HE3A 2EJ8A 2EMSA 2RNRB 5HE2A 1TQZA 4F7HA 4IAPA 1PLSA 1WG7A 2H7DA 5EFXA 2DHKA 3D8EA 4KHAA 4MT7A 2KIEA 3ULBA 2W2XD 3VIAA 4KHOA 3PVWA 2GCJA 5DHAB 3TVVA 4C0AA 2Q13A 2UZRA 4GMVA 5C79A 3IVFA 3ODOA 1UEFA
chains in the Genus database with same CATH topology
2VKIA 2ELAA 1RRPB 1ZM0A 2DA0A 4F7UP 4B6HA 3BINA 2MFQA 1ZVRA 1V88A 1J19A 4CHMA 1BTNA 2L2IA 2LKOA 5JP4A 3TW1A 3MDBC 3KRWA 1H10A 2GCLA 4H8SA 4GZUA 3RCPA 1MAIA 3AU5A 3QBVB 1EAZA 1FGZA 2Z0OA 3SUZA 2P0FA 2FJLA 1PMSA 2YT0A 1BTKA 3AU4A 3ULCA 4K2PA 5JLJB 2E2XA 2DKPA 4DX90 3SV1A 4NY0A 5HE0A 1WJMA 4K2OA 2OTXA 1SHCA 2Y8FA 4ZRIA 3QIJA 3CIKA 4ZRKA 3DXEA 2LG1A 2D9ZA 4KVGB 1IRSA 2GJYA 1M7EA 3HK0A 1H4RA 3PVUA 2OQBA 3SYXA 3SNHA 2MWNB 1UNRA 1UPRA 3PSCA 4ZRJA 4Z2MB 2D4QA 2DHIA 2KGXB 2KUPA 1LB1A 1K5GB 1GG3A 5FI0A 2D9YA 4KHBB 1OQNA 3OANA 2YRYA 1N3HA 3PP2A 3P7ZA 1Q67A 5KCVA 4MY6A 1KZGA 3A8PA 2ELBA 5DHFB 2CODA 2DYNA 2DX5A 3NSUA 1RJ2A 4F7GA 1FOEA 2P0DA 2UZSA 1Y19B 5LOPB 2J0MA 2LOZA 4EKUA 1FHOA 5D3WA 1NI2A 1PFJA 1X1FA 1ISNA 3ML4A 4XWXA 5C16A 2IYBA 4TYZA 4Y94A 2LOXA 1MKEA 2AEHA 1V5PA 5C5BA 3ZDTA 4WSFA 1U5FA 2I5CA 2X18A 5D3XA 5CLLB 1TXDA 5L81A 1FHXA 1EF1A 2ADZA 1XCGA 1M7RA 2VSZA 1DBHA 4A6KA 2W2XC 1XX0A 4BBKA 1SGHA 2RSGA 3KSYA 1X86A 3HW2B 1X11A 3PVLA 4D0NB 2D9VA 2DKQA 4K81A 2D9XA 4WJ7A 5D3YA 4DX8A 1NTVA 3ODXA 2K2UA 3QWMA 1MIZB 3ODWA 4HHVA 2YS3A 2VRWB 3KY9A 3SO6A 2UVMA 1TJ6A 2YF0A 4L6EA 2P0HA 2M38A 4NSWA 2YS1A 5GOWB 4HDQA 1U29A 1MIXA 1WJ1A 1QC6A 3VOQA 5DH9B 5J3QA 2NZ8B 1I2HA 5DI9B 3KZ1A 1MK9B 3GYPA 5HE1A 3F0WA 1DROA 5CLQB 2CAYA 1EVHA 2Y7BA 4HB4B 2H7EA 4HAUB 3KRXA 1P5TA 1U2BA 1UPQA 1W1GA 5LONB 2COCA 1B55A 1E5WA 1V89A 2D10A 4IFSA 4HAWB 4IOYX 2AL6A 4CHJA 2N23A 2EC1A 2KCJA 1Z87A 3AJ4A 2DLWA 5C6RA 2I1JA 2YSZA 5D3VA 4PNKA 1FHWA 2LYDA 5FI1A 3FSSA 1P3RA 2XQNM 1KZ7A 2MKRA 5D27A 1MPHA 4CYEA 1I7AA 1Y5OA 1XR0B 4HB0B 4A6FB 2Y8GA 1J0WA 2RLOA 5J3YA 3TCAA 1ZC4B 2ROZB 1ZC3B 4KAXB 2COFA 2GS0A 1K5DB 1OMWA 4WVFB 3CXBB 1XD4A 4HAZB 3M1IB 1X1GA 4A5KA 2RGNB 3PG7A 2D2QA 4GMXB 4EJNA 2V76A 2M14A 2G35A 3F5RA 1NU2A 3HQCA 3WYFB 2J0JA 2CRFA 2QKMA 2DTCA 1QQGA 2L1CA 3MPXA 1XODA 1KI1B 2BCJA 3FEHA 3A8QA 3P6AA 4YL8A 5DIFB 5KQ4A 1BAKA 1X05A 4K17A 1WVHA 2I1KA 2YT1A 2K2JA 2J59M 4TKNA 2IFSA 2RVBB 1DDVA 5KQ1A 1FAOA 1AWEA 1WI1A 1WGQA 4HAVB 2DX1A 2PZ1A 3U8ZA 3LJUX 3U7DA 2R0DA 2COAA 3T06A 2ZPYA 4HB2B 1U5GA 3DXCA 2K00A 1DDWA 1UNPA 2P8VA 2W2WA 2N0YA 4P7IA 1V5UA 4GXBA 4A6HA 1DYNA 3N7CA 2DHJA 1ZSQA 3X23A 1U5EA 1W1HA 2NMBA 5J3TA 4HATB 4YONA 2D11A 3O96A 1UNQA 2DFKA 2CY4A 1FB8A 4DBBA 3DXDA 4HAYB 3WA0A 3V5WA 3UZTA 1NTYA 2JP2A 3G9WA 5JHGA 2Z0QA 2CY5A 1U27A 2LULA 1OY2A 3A98B 1MK7B 2MDXA 1EGXA 3BJIA 3TO1A 4GN1A 2D9WA 4GPTB 2YS5A 1W1DA 2J0KA 3PEGA 4HAXB 4PQ0A 2HTHB 4MK0A 1V61A 3FM8C 4EMOA 2ROVA 2EMTA 5C5BB 2RUKB 1XKEA 3GYOA 2DN6A 1WGUA 1GC6A 2R09A 1DDMA 4DXAB 1AQCA 1P6SA 1LW3A 2DYQA 2Z0PA 3ZVRA 3PZDA 1U5DA 1GC7A 2YVCA 3TFMA 3D8FA 4HB3B 4HDOA 1V5MA 2HE7A 1FGYA 3D8DA 1BWNA 2QKLA 4Z2NA 5JHHA 4A6FA 2I5FA 5HE3A 2EJ8A 2EMSA 2RNRB 5HE2A 1TQZA 4F7HA 4IAPA 1PLSA 1WG7A 2H7DA 5EFXA 2DHKA 3D8EA 4KHAA 4MT7A 3ULBA 2W2XD 3VIAA 4KHOA 3PVWA 2GCJA 5DHAB 3TVVA 4C0AA 2Q13A 2UZRA 4GMVA 5C79A 3IVFA 3ODOA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKI A;  2ELA A;  1RRP B;  1ZM0 A;  2DA0 A;  4F7U P;  4B6H A;  3BIN A;  2MFQ A;  1ZVR A;  1V88 A;  1J19 A;  4CHM A;  1BTN A;  2L2I A;  2LKO A;  5JP4 A;  3TW1 A;  3MDB C;  3KRW A;  1H10 A;  2GCL A;  4H8S A;  4GZU A;  3RCP A;  1MAI A;  3AU5 A;  3QBV B;  1EAZ A;  1FGZ A;  2Z0O A;  3SUZ A;  2P0F A;  2FJL A;  1PMS A;  2YT0 A;  1BTK A;  3AU4 A;  3ULC A;  4K2P A;  5JLJ B;  2E2X A;  2DKP A;  4DX9 0;  3SV1 A;  4NY0 A;  5HE0 A;  1WJM A;  4K2O A;  2OTX A;  1SHC A;  2Y8F A;  4ZRI A;  3QIJ A;  3CIK A;  4ZRK A;  3DXE A;  2LG1 A;  2D9Z A;  4KVG B;  1IRS A;  2GJY A;  1M7E A;  3HK0 A;  1H4R A;  3PVU A;  2OQB A;  3SYX A;  3SNH A;  2MWN B;  1UNR A;  1UPR A;  3PSC A;  4ZRJ A;  4Z2M B;  2D4Q A;  2DHI A;  2KGX B;  2KUP A;  1LB1 A;  1K5G B;  1GG3 A;  5FI0 A;  2D9Y A;  4KHB B;  1OQN A;  3OAN A;  2YRY A;  1N3H A;  3PP2 A;  3P7Z A;  1Q67 A;  5KCV A;  4MY6 A;  1KZG A;  3A8P A;  2ELB A;  5DHF B;  2COD A;  2DYN A;  2DX5 A;  3NSU A;  1RJ2 A;  4F7G A;  1FOE A;  2P0D A;  2UZS A;  1Y19 B;  5LOP B;  2J0M A;  2LOZ A;  4EKU A;  1FHO A;  5D3W A;  1NI2 A;  1PFJ A;  1X1F A;  1ISN A;  3ML4 A;  4XWX A;  5C16 A;  2IYB A;  4TYZ A;  4Y94 A;  2LOX A;  1MKE A;  2AEH A;  1V5P A;  5C5B A;  3ZDT A;  4WSF A;  1U5F A;  2I5C A;  2X18 A;  5D3X A;  5CLL B;  1TXD A;  5L81 A;  1FHX A;  1EF1 A;  2ADZ A;  1XCG A;  1M7R A;  2VSZ A;  1DBH A;  4A6K A;  2W2X C;  1XX0 A;  4BBK A;  1SGH A;  2RSG A;  3KSY A;  1X86 A;  3HW2 B;  1X11 A;  3PVL A;  4D0N B;  2D9V A;  2DKQ A;  4K81 A;  2D9X A;  4WJ7 A;  5D3Y A;  4DX8 A;  1NTV A;  3ODX A;  2K2U A;  3QWM A;  1MIZ B;  3ODW A;  4HHV A;  2YS3 A;  2VRW B;  3KY9 A;  3SO6 A;  2UVM A;  1TJ6 A;  2YF0 A;  4L6E A;  2P0H A;  2M38 A;  4NSW A;  2YS1 A;  5GOW B;  4HDQ A;  1U29 A;  1MIX A;  1WJ1 A;  1QC6 A;  3VOQ A;  5DH9 B;  5J3Q A;  2NZ8 B;  1I2H A;  5DI9 B;  3KZ1 A;  1MK9 B;  3GYP A;  5HE1 A;  3F0W A;  1DRO A;  5CLQ B;  2CAY A;  1EVH A;  2Y7B A;  4HB4 B;  2H7E A;  4HAU B;  3KRX A;  1P5T A;  1U2B A;  1UPQ A;  1W1G A;  5LON B;  2COC A;  1B55 A;  1E5W A;  1V89 A;  2D10 A;  4IFS A;  4HAW B;  4IOY X;  2AL6 A;  4CHJ A;  2N23 A;  2EC1 A;  2KCJ A;  1Z87 A;  3AJ4 A;  2DLW A;  5C6R A;  2I1J A;  2YSZ A;  5D3V A;  4PNK A;  1FHW A;  2LYD A;  5FI1 A;  3FSS A;  1P3R A;  2XQN M;  1KZ7 A;  2MKR A;  5D27 A;  1MPH A;  4CYE A;  1I7A A;  1Y5O A;  1XR0 B;  4HB0 B;  4A6F B;  2Y8G A;  1J0W A;  2RLO A;  5J3Y A;  3TCA A;  1ZC4 B;  2ROZ B;  1ZC3 B;  4KAX B;  2COF A;  2GS0 A;  1K5D B;  1OMW A;  4WVF B;  3CXB B;  1XD4 A;  4HAZ B;  3M1I B;  1X1G A;  4A5K A;  2RGN B;  3PG7 A;  2D2Q A;  4GMX B;  4EJN A;  2V76 A;  2M14 A;  2G35 A;  3F5R A;  1NU2 A;  3HQC A;  3WYF B;  2J0J A;  2CRF A;  2QKM A;  2DTC A;  1QQG A;  2L1C A;  3MPX A;  1XOD A;  1KI1 B;  2BCJ A;  3FEH A;  3A8Q A;  3P6A A;  4YL8 A;  5DIF B;  5KQ4 A;  1BAK A;  1X05 A;  4K17 A;  1WVH A;  2I1K A;  2YT1 A;  2K2J A;  2J59 M;  4TKN A;  2IFS A;  2RVB B;  1DDV A;  5KQ1 A;  1FAO A;  1AWE A;  1WI1 A;  1WGQ A;  4HAV B;  2DX1 A;  2PZ1 A;  3U8Z A;  3LJU X;  3U7D A;  2R0D A;  2COA A;  3T06 A;  2ZPY A;  4HB2 B;  1U5G A;  3DXC A;  2K00 A;  1DDW A;  1UNP A;  2P8V A;  2W2W A;  2N0Y A;  4P7I A;  1V5U A;  4GXB A;  4A6H A;  1DYN A;  3N7C A;  2DHJ A;  1ZSQ A;  3X23 A;  1U5E A;  1W1H A;  2NMB A;  5J3T A;  4HAT B;  4YON A;  2D11 A;  3O96 A;  1UNQ A;  2DFK A;  2CY4 A;  1FB8 A;  4DBB A;  3DXD A;  4HAY B;  3WA0 A;  3V5W A;  3UZT A;  1NTY A;  2JP2 A;  3G9W A;  5JHG A;  2Z0Q A;  2CY5 A;  1U27 A;  2LUL A;  1OY2 A;  3A98 B;  1MK7 B;  2MDX A;  1EGX A;  3BJI A;  3TO1 A;  4GN1 A;  2D9W A;  4GPT B;  2YS5 A;  1W1D A;  2J0K A;  3PEG A;  4HAX B;  4PQ0 A;  2HTH B;  4MK0 A;  1V61 A;  3FM8 C;  4EMO A;  2ROV A;  2EMT A;  5C5B B;  2RUK B;  1XKE A;  3GYO A;  2DN6 A;  1WGU A;  1GC6 A;  2R09 A;  1DDM A;  4DXA B;  1AQC A;  1P6S A;  1LW3 A;  2DYQ A;  2Z0P A;  3ZVR A;  3PZD A;  1U5D A;  1GC7 A;  2YVC A;  3TFM A;  3D8F A;  4HB3 B;  4HDO A;  1V5M A;  2HE7 A;  1FGY A;  3D8D A;  1BWN A;  2QKL A;  4Z2N A;  5JHH A;  4A6F A;  2I5F A;  5HE3 A;  2EJ8 A;  2EMS A;  2RNR B;  5HE2 A;  1TQZ A;  4F7H A;  4IAP A;  1PLS A;  1WG7 A;  2H7D A;  5EFX A;  2DHK A;  3D8E A;  4KHA A;  4MT7 A;  3ULB A;  2W2X D;  3VIA A;  4KHO A;  3PVW A;  2GCJ A;  5DHA B;  3TVV A;  4C0A A;  2Q13 A;  2UZR A;  4GMV A;  5C79 A;  3IVF A;  3ODO A;  1UEF A; 
#chains in the Genus database with same CATH topology
 2VKI A;  2ELA A;  1RRP B;  1ZM0 A;  2DA0 A;  4F7U P;  4B6H A;  3BIN A;  2MFQ A;  1ZVR A;  1V88 A;  1J19 A;  4CHM A;  1BTN A;  2L2I A;  4QJ3 B;  2LKO A;  5JP4 A;  3TW1 A;  3MDB C;  3KRW A;  1H10 A;  2GCL A;  3NWF A;  4H8S A;  4GZU A;  3RCP A;  1MAI A;  3AU5 A;  3QBV B;  1EAZ A;  1FGZ A;  2YT2 A;  2Z0O A;  3SUZ A;  2P0F A;  2FJL A;  2KUQ A;  1PMS A;  2YT0 A;  1BTK A;  3AU4 A;  5LG4 B;  3ULC A;  2RRF A;  4K2P A;  5JLJ B;  2E2X A;  2DKP A;  4DX9 0;  3SV1 A;  4NY0 A;  5HE0 A;  4QJ4 B;  1WJM A;  4K2O A;  2OTX A;  1SHC A;  2Y8F A;  4ZRI A;  3QIJ A;  3CIK A;  2FJU B;  4OSN A;  5IRS A;  4ZRK A;  3DXE A;  2LG1 A;  2D9Z A;  2R2Y A;  1IRS A;  2GJY A;  2Z14 A;  1M7E A;  3HK0 A;  4KVG B;  4QJ5 B;  1H4R A;  3PVU A;  2OQB A;  3SYX A;  3SNH A;  2MWN B;  1UNR A;  1UPR A;  3PSC A;  4ZRJ A;  4Z2M B;  2D4Q A;  2DHI A;  2KGX B;  2KUP A;  1LB1 A;  1K5G B;  2KIG A;  1GG3 A;  5FI0 A;  2D9Y A;  4KHB B;  1OQN A;  3OAN A;  3B77 A;  2YRY A;  1N3H A;  3PP2 A;  3P7Z A;  1Q67 A;  5KCV A;  4MY6 A;  1KZG A;  3A8P A;  2ELB A;  1ZYI A;  5DHF B;  2COD A;  2DYN A;  3NW8 A;  2DX5 A;  3NSU A;  1RJ2 A;  4F7G A;  1FOE A;  2P0D A;  2UZS A;  1Y19 B;  5LOP B;  2J0M A;  2LOZ A;  4EKU A;  1FHO A;  5D3W A;  1NI2 A;  2GUM A;  1T77 A;  1PFJ A;  1X1F A;  1ISN A;  3ML4 A;  4XWX A;  1MI1 A;  5C16 A;  2IYB A;  4TYZ A;  4Y94 A;  2LOX A;  1MKE A;  2AEH A;  1V5P A;  4DIX A;  5C5B A;  3ZDT A;  5I2M A;  4WSF A;  1U5F A;  2I5C A;  2X18 A;  5D3X A;  5CLL B;  3NWA A;  1TXD A;  5L81 A;  1FHX A;  1EF1 A;  4GOU A;  4KHB A;  2ADZ A;  1XCG A;  4L1R A;  1M7R A;  2VSZ A;  1DBH A;  4GNK B;  4A6K A;  2W2X C;  1XX0 A;  4BBK A;  3U12 A;  1SGH A;  2RSG A;  3KSY A;  1X86 A;  3HW2 B;  1X11 A;  3PVL A;  4D0N B;  2D9V A;  2DKQ A;  4K81 A;  2D9X A;  4WJ7 A;  5D3Y A;  4DX8 A;  1NTV A;  3ODX A;  2K2U A;  3QWM A;  1MIZ B;  3ODW A;  2Z4D A;  4HHV A;  2YS3 A;  2VRW B;  3KY9 A;  3SO6 A;  2UVM A;  1TJ6 A;  2YF0 A;  4L6E A;  2K49 A;  2P0H A;  2M38 A;  5I2S A;  4NSW A;  2YS1 A;  5GOW B;  4HDQ A;  1U29 A;  1MIX A;  1WJ1 A;  1QC6 A;  3VOQ A;  5DH9 B;  5J3Q A;  2NZ8 B;  1I2H A;  5DI9 B;  3KZ1 A;  1MK9 B;  4OT1 A;  4CSQ A;  3GYP A;  5HE1 A;  3F0W A;  1DRO A;  5CLQ B;  2CAY A;  1EVH A;  2Y7B A;  4HB4 B;  2H7E A;  4HAU B;  3KRX A;  1P5T A;  1U2B A;  1UPQ A;  1W1G A;  5LON B;  2COC A;  1B55 A;  1E5W A;  1V89 A;  2D10 A;  4IFS A;  4HAW B;  4IOY X;  2AL6 A;  4CHJ A;  2N23 A;  2EC1 A;  2KCJ A;  1Z87 A;  3AJ4 A;  2DLW A;  3FVC A;  5C6R A;  5M4Y B;  3HIE A;  2I1J A;  2YSZ A;  5D3V A;  4PNK A;  1FHW A;  2LYD A;  5FI1 A;  3FSS A;  1P3R A;  2XQN M;  1KZ7 A;  2MKR A;  5D27 A;  1MPH A;  4CYE A;  1I7A A;  1Y5O A;  1XR0 B;  4HB0 B;  4A6F B;  2Y8G A;  1J0W A;  2RLO A;  5J3Y A;  3TCA A;  1ZC4 B;  2ROZ B;  1ZC3 B;  4KAX B;  2COF A;  2GS0 A;  1K5D B;  1OMW A;  4WVF B;  3CXB B;  1XD4 A;  4HAZ B;  3M1I B;  1X1G A;  4A5K A;  2RGN B;  3A58 A;  2D2Q A;  3PG7 A;  4GMX B;  4EJN A;  2V76 A;  2M14 A;  2G35 A;  3F5R A;  1NU2 A;  3HQC A;  3WYF B;  2J0J A;  2CRF A;  2QKM A;  2DTC A;  1QQG A;  2L1C A;  3MPX A;  1XOD A;  1KI1 B;  2BCJ A;  3FEH A;  3A8Q A;  3P6A A;  4YL8 A;  5DIF B;  5KQ4 A;  1BAK A;  1X05 A;  4K17 A;  1WVH A;  2I1K A;  2YT1 A;  2K2J A;  2J59 M;  4TKN A;  2IFS A;  2RVB B;  1DDV A;  5KQ1 A;  1FAO A;  4QXA B;  1AWE A;  1WI1 A;  1WGQ A;  4HAV B;  2DX1 A;  2PZ1 A;  3U8Z A;  3LJU X;  3U7D A;  2R0D A;  2COA A;  3T06 A;  2ZPY A;  4HB2 B;  1U5G A;  3DXC A;  2K00 A;  1DDW A;  1UNP A;  2P8V A;  2W2W A;  2N0Y A;  4P7I A;  3NWD A;  1V5U A;  4GXB A;  4A6H A;  1DYN A;  3N7C A;  2DHJ A;  1ZSQ A;  3X23 A;  4D6W A;  2ZKM X;  1U5E A;  2Z59 A;  1W1H A;  2NMB A;  5J3T A;  3OHM B;  4HAT B;  4YON A;  2D11 A;  3O96 A;  1UNQ A;  2DFK A;  2CY4 A;  1FB8 A;  4DBB A;  3DXD A;  4HAY B;  3WA0 A;  3V5W A;  3UZT A;  1NTY A;  2JP2 A;  3G9W A;  3HSA A;  5JHG A;  2Z0Q A;  2CY5 A;  1U27 A;  2LUL A;  1OY2 A;  3A98 B;  1MK7 B;  2MDX A;  1EGX A;  3BJI A;  3TO1 A;  4GN1 A;  2D9W A;  4GPT B;  2YS5 A;  1W1D A;  2J0K A;  3PEG A;  4HAX B;  4PQ0 A;  2HTH B;  4MK0 A;  1V61 A;  3FM8 C;  2NBV A;  4EMO A;  2ROV A;  2EMT A;  5C5B B;  2RUK B;  1XKE A;  3GYO A;  3DCX A;  2DN6 A;  1WGU A;  2KR0 A;  1GC6 A;  2R09 A;  1DDM A;  4DXA B;  1AQC A;  1P6S A;  1LW3 A;  2DYQ A;  2Z0P A;  3ZVR A;  3PZD A;  1U5D A;  1GC7 A;  2YVC A;  3TFM A;  3D8F A;  4HB3 B;  4HDO A;  2K8E A;  1V5M A;  2HE7 A;  2Z13 A;  1FGY A;  3D8D A;  1BWN A;  2QKL A;  4Z2N A;  4HSI A;  5JHH A;  4A6F A;  2I5F A;  5HE3 A;  2EJ8 A;  2EMS A;  2RNR B;  5HE2 A;  1TQZ A;  4F7H A;  4IAP A;  1PLS A;  1WG7 A;  2H7D A;  5EFX A;  2DHK A;  3D8E A;  4KHA A;  4MT7 A;  2KIE A;  3ULB A;  2W2X D;  3VIA A;  4KHO A;  3PVW A;  2GCJ A;  5DHA B;  3TVV A;  4C0A A;  2Q13 A;  2UZR A;  4GMV A;  5C79 A;  3IVF A;  3ODO A;  1UEF A; 
#chains in the Genus database with same CATH homology
 2VKI A;  2ELA A;  1RRP B;  1ZM0 A;  2DA0 A;  4F7U P;  4B6H A;  3BIN A;  2MFQ A;  1ZVR A;  1V88 A;  1J19 A;  4CHM A;  1BTN A;  2L2I A;  2LKO A;  5JP4 A;  3TW1 A;  3MDB C;  3KRW A;  1H10 A;  2GCL A;  4H8S A;  4GZU A;  3RCP A;  1MAI A;  3AU5 A;  3QBV B;  1EAZ A;  1FGZ A;  2Z0O A;  3SUZ A;  2P0F A;  2FJL A;  1PMS A;  2YT0 A;  1BTK A;  3AU4 A;  3ULC A;  4K2P A;  5JLJ B;  2E2X A;  2DKP A;  4DX9 0;  3SV1 A;  4NY0 A;  5HE0 A;  1WJM A;  4K2O A;  2OTX A;  1SHC A;  2Y8F A;  4ZRI A;  3QIJ A;  3CIK A;  4ZRK A;  3DXE A;  2LG1 A;  2D9Z A;  4KVG B;  1IRS A;  2GJY A;  1M7E A;  3HK0 A;  1H4R A;  3PVU A;  2OQB A;  3SYX A;  3SNH A;  2MWN B;  1UNR A;  1UPR A;  3PSC A;  4ZRJ A;  4Z2M B;  2D4Q A;  2DHI A;  2KGX B;  2KUP A;  1LB1 A;  1K5G B;  1GG3 A;  5FI0 A;  2D9Y A;  4KHB B;  1OQN A;  3OAN A;  2YRY A;  1N3H A;  3PP2 A;  3P7Z A;  1Q67 A;  5KCV A;  4MY6 A;  1KZG A;  3A8P A;  2ELB A;  5DHF B;  2COD A;  2DYN A;  2DX5 A;  3NSU A;  1RJ2 A;  4F7G A;  1FOE A;  2P0D A;  2UZS A;  1Y19 B;  5LOP B;  2J0M A;  2LOZ A;  4EKU A;  1FHO A;  5D3W A;  1NI2 A;  1PFJ A;  1X1F A;  1ISN A;  3ML4 A;  4XWX A;  5C16 A;  2IYB A;  4TYZ A;  4Y94 A;  2LOX A;  1MKE A;  2AEH A;  1V5P A;  5C5B A;  3ZDT A;  4WSF A;  1U5F A;  2I5C A;  2X18 A;  5D3X A;  5CLL B;  1TXD A;  5L81 A;  1FHX A;  1EF1 A;  2ADZ A;  1XCG A;  1M7R A;  2VSZ A;  1DBH A;  4A6K A;  2W2X C;  1XX0 A;  4BBK A;  1SGH A;  2RSG A;  3KSY A;  1X86 A;  3HW2 B;  1X11 A;  3PVL A;  4D0N B;  2D9V A;  2DKQ A;  4K81 A;  2D9X A;  4WJ7 A;  5D3Y A;  4DX8 A;  1NTV A;  3ODX A;  2K2U A;  3QWM A;  1MIZ B;  3ODW A;  4HHV A;  2YS3 A;  2VRW B;  3KY9 A;  3SO6 A;  2UVM A;  1TJ6 A;  2YF0 A;  4L6E A;  2P0H A;  2M38 A;  4NSW A;  2YS1 A;  5GOW B;  4HDQ A;  1U29 A;  1MIX A;  1WJ1 A;  1QC6 A;  3VOQ A;  5DH9 B;  5J3Q A;  2NZ8 B;  1I2H A;  5DI9 B;  3KZ1 A;  1MK9 B;  3GYP A;  5HE1 A;  3F0W A;  1DRO A;  5CLQ B;  2CAY A;  1EVH A;  2Y7B A;  4HB4 B;  2H7E A;  4HAU B;  3KRX A;  1P5T A;  1U2B A;  1UPQ A;  1W1G A;  5LON B;  2COC A;  1B55 A;  1E5W A;  1V89 A;  2D10 A;  4IFS A;  4HAW B;  4IOY X;  2AL6 A;  4CHJ A;  2N23 A;  2EC1 A;  2KCJ A;  1Z87 A;  3AJ4 A;  2DLW A;  5C6R A;  2I1J A;  2YSZ A;  5D3V A;  4PNK A;  1FHW A;  2LYD A;  5FI1 A;  3FSS A;  1P3R A;  2XQN M;  1KZ7 A;  2MKR A;  5D27 A;  1MPH A;  4CYE A;  1I7A A;  1Y5O A;  1XR0 B;  4HB0 B;  4A6F B;  2Y8G A;  1J0W A;  2RLO A;  5J3Y A;  3TCA A;  1ZC4 B;  2ROZ B;  1ZC3 B;  4KAX B;  2COF A;  2GS0 A;  1K5D B;  1OMW A;  4WVF B;  3CXB B;  1XD4 A;  4HAZ B;  3M1I B;  1X1G A;  4A5K A;  2RGN B;  3PG7 A;  2D2Q A;  4GMX B;  4EJN A;  2V76 A;  2M14 A;  2G35 A;  3F5R A;  1NU2 A;  3HQC A;  3WYF B;  2J0J A;  2CRF A;  2QKM A;  2DTC A;  1QQG A;  2L1C A;  3MPX A;  1XOD A;  1KI1 B;  2BCJ A;  3FEH A;  3A8Q A;  3P6A A;  4YL8 A;  5DIF B;  5KQ4 A;  1BAK A;  1X05 A;  4K17 A;  1WVH A;  2I1K A;  2YT1 A;  2K2J A;  2J59 M;  4TKN A;  2IFS A;  2RVB B;  1DDV A;  5KQ1 A;  1FAO A;  1AWE A;  1WI1 A;  1WGQ A;  4HAV B;  2DX1 A;  2PZ1 A;  3U8Z A;  3LJU X;  3U7D A;  2R0D A;  2COA A;  3T06 A;  2ZPY A;  4HB2 B;  1U5G A;  3DXC A;  2K00 A;  1DDW A;  1UNP A;  2P8V A;  2W2W A;  2N0Y A;  4P7I A;  1V5U A;  4GXB A;  4A6H A;  1DYN A;  3N7C A;  2DHJ A;  1ZSQ A;  3X23 A;  1U5E A;  1W1H A;  2NMB A;  5J3T A;  4HAT B;  4YON A;  2D11 A;  3O96 A;  1UNQ A;  2DFK A;  2CY4 A;  1FB8 A;  4DBB A;  3DXD A;  4HAY B;  3WA0 A;  3V5W A;  3UZT A;  1NTY A;  2JP2 A;  3G9W A;  5JHG A;  2Z0Q A;  2CY5 A;  1U27 A;  2LUL A;  1OY2 A;  3A98 B;  1MK7 B;  2MDX A;  1EGX A;  3BJI A;  3TO1 A;  4GN1 A;  2D9W A;  4GPT B;  2YS5 A;  1W1D A;  2J0K A;  3PEG A;  4HAX B;  4PQ0 A;  2HTH B;  4MK0 A;  1V61 A;  3FM8 C;  4EMO A;  2ROV A;  2EMT A;  5C5B B;  2RUK B;  1XKE A;  3GYO A;  2DN6 A;  1WGU A;  1GC6 A;  2R09 A;  1DDM A;  4DXA B;  1AQC A;  1P6S A;  1LW3 A;  2DYQ A;  2Z0P A;  3ZVR A;  3PZD A;  1U5D A;  1GC7 A;  2YVC A;  3TFM A;  3D8F A;  4HB3 B;  4HDO A;  1V5M A;  2HE7 A;  1FGY A;  3D8D A;  1BWN A;  2QKL A;  4Z2N A;  5JHH A;  4A6F A;  2I5F A;  5HE3 A;  2EJ8 A;  2EMS A;  2RNR B;  5HE2 A;  1TQZ A;  4F7H A;  4IAP A;  1PLS A;  1WG7 A;  2H7D A;  5EFX A;  2DHK A;  3D8E A;  4KHA A;  4MT7 A;  3ULB A;  2W2X D;  3VIA A;  4KHO A;  3PVW A;  2GCJ A;  5DHA B;  3TVV A;  4C0A A;  2Q13 A;  2UZR A;  4GMV A;  5C79 A;  3IVF A;  3ODO A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...