1EAZA

Crystal structure of the phosphoinositol (3,4)-bisphosphate binding ph domain of tapp1 from human.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords TANDEM PH DOMAIN CONTAINING PROTEIN-1
publication title Crystal Structure of the Phosphatidylinositol 3,4-Bisphosphate-Binding Pleckstrin Homology (Ph) Domain of Tandem Ph-Domain-Containing Protein 1 (Tapp1): Molecular Basis of Lipid Specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1eazA00
1P3RA 4HB3B 1E5WA 2H7EA 3MDBC 1V5UA 2M38A 3TO1A 3N7CA 5LOPB 3BJIA 1FHXA 2DKQA 1FOEA 2MFQA 1UEFA 2J59M 1M7RA 5FI1A 2DHIA 2E2XA 2YT1A 5DHAB 2L2IA 1P5TA 1EVHA 2YSZA 5C6RA 2D9XA 3AJ4A 5KCVA 2VKIA 2G35A 1TJ6A 4A6FA 4IFSA 5J3TA 3O96A 3SO6A 2UVMA 3P7ZA 2DYQA 1SGHA 4K2PA 4BBKA 3QIJA 2CY4A 2YS1A 3M1IB 2D9VA 2MKRA 2UZSA 4CHJA 2KCJA 4HB4B 4A5KA 4WVFB 1XX0A 1UPQA 3ML4A 2GCJA 5HE1A 3PP2A 3U7DA 3CXBB 3NSUA 4HB0B 4F7HA 2N0YA 3X23A 2BCJA 2DX5A 1UNQA 3D8DA 1ISNA 3F5RA 1MAIA 4MK0A 1XKEA 3OANA 1WI1A 3ODOA 2HTHB 4XWXA 4YL8A 1FHOA 2QKLA 1AQCA 4HAZB 2M14A 1WJMA 2ELAA 4TYZA 1XCGA 2Z0OA 2D11A 1UNPA 5C16A 3SUZA 2P0HA 4GMVA 2DA0A 4EMOA 1BTNA 5CLQB 3FM8C 1KZGA 5DH9B 1MIZB 2AL6A 2I1JA 3A98B 2W2XC 1W1HA 1PMSA 2D9YA 2D9ZA 2ELBA 4HAXB 5D3XA 2EJ8A 2DFKA 1EAZA 1ZVRA 1BTKA 1V61A 1J19A 2MDXA 1U5GA 2GCLA 2P0DA 4IOYX 3P6AA 1NU2A 1FHWA 2LOZA 2AEHA 3SV1A 1X05A 3KSYA 1NTYA 2H7DA 4HHVA 5HE3A 4L6EA 4CHMA 2FJLA 2UZRA 2EC1A 2VSZA 4C0AA 1WVHA 5C5BB 2RNRB 1UNRA 1QQGA 5JHHA 1NTVA 1OQNA 1MIXA 3KRXA 3PEGA 3GYOA 2RUKB 1MPHA 1X86A 2DLWA 1BWNA 2YRYA 5DI9B 3WYFB 4KVGB 3TW1A 5JP4A 1DROA 3BINA 3PSCA 5D3VA 2P8VA 5EFXA 2K2UA 2NMBA 1LB1A 2ROZB 2D9WA 2DHKA 1RRPB 2W2XD 2IFSA 1LW3A 1PFJA 2RGNB 4CYEA 4HB2B 1V5PA 2R0DA 4Z2MB 2ADZA 4Y94A 5GOWB 5J3YA 3PZDA 1ZSQA 1N3HA 4B6HA 1W1GA 1FB8A 2VRWB 2EMTA 1X1GA 3U8ZA 5KQ1A 3KRWA 1GG3A 3IVFA 5LONB 1BAKA 2ZPYA 4KHAA 1Z87A 1H10A 4HAVB 1I2HA 3ULBA 3D8FA 2LULA 3VIAA 1OY2A 3KY9A 5DIFB 2OTXA 1U5FA 4ZRKA 1FAOA 1RJ2A 1DYNA 1GC6A 3SNHA 2P0FA 4H8SA 3AU5A 2YS3A 3CIKA 1X1FA 1KZ7A 1NI2A 2Z0PA 3PVUA 2Y8FA 4KAXB 4MT7A 2KUPA 3PG7A 4KHOA 1J0WA 4K17A 5D27A 4F7UP 1FGZA 5L81A 2KGXB 2V76A 1OMWA 2NZ8B 4GXBA 2J0JA 1U5EA 3ODWA 2LOXA 1P6SA 2X18A 3FEHA 4F7GA 5JLJB 3TFMA 5DHFB 4YONA 3TVVA 4DX90 3V5WA 1U29A 4KHBB 4P7IA 3G9WA 3AU4A 4Z2NA 4ZRJA 2RSGA 2LKOA 4IAPA 3QBVB 2GS0A 4HDQA 1WGUA 1DBHA 1IRSA 1UPRA 2D2QA 3F0WA 3TCAA 1EF1A 4WJ7A 2DKPA 3QWMA 5HE2A 1PLSA 2MWNB 2ROVA 2L1CA 4HAYB 4A6HA 1V89A 4D0NB 1ZC3B 4HAWB 2I1KA 5C5BA 2IYBA 3DXDA 1GC7A 1Y5OA 2EMSA 1M7EA 2K00A 2I5FA 3PVWA 2J0KA 1FGYA 2Y7BA 3WA0A 1WJ1A 2D10A 3HW2B 3LJUX 2CY5A 1EGXA 4GMXB 2RVBB 3DXCA 1Q67A 4GPTB 1MK7B 1U2BA 2W2WA 1V5MA 2Y8GA 3RCPA 1K5GB 1XR0B 4PQ0A 1SHCA 3GYPA 5KQ4A 5D3YA 4A6FB 3VOQA 3ODXA 2N23A 2DN6A 1WG7A 1ZM0A 1QC6A 1ZC4B 5HE0A 3ULCA 2DX1A 2DHJA 2YT0A 4A6KA 1TXDA 5JHGA 2LG1A 5D3WA 2CODA 2DYNA 1H4RA 2DTCA 2QKMA 3MPXA 2CAYA 2CRFA 2YS5A 2LYDA 1W1DA 2J0MA 2JP2A 2D4QA 4NSWA 4MY6A 3FSSA 4GN1A 4WSFA 2PZ1A 2GJYA 4HDOA 1DDWA 4DX8A 1X11A 3ZVRA 3HK0A 4K2OA 1MKEA 4DBBA 4HAUB 3UZTA 1XODA 1U5DA 4HATB 2Q13A 3PVLA 4DXAB 1U27A 2R09A 3D8EA 1MK9B 5CLLB 2COAA 2COCA 3SYXA 2K2JA 3A8QA 1B55A 1DDMA 2YF0A 1V88A 2RLOA 4EKUA 1KI1B 2XQNM 1WGQA 2OQBA 2Z0QA 5J3QA 5C79A 1TQZA 3ZDTA 4ZRIA 1AWEA 4EJNA 1DDVA 2YVCA 1I7AA 3A8PA 3T06A 4NY0A 1K5DB 4TKNA 2COFA 2I5CA 5FI0A 4K81A 4GZUA 1XD4A 3DXEA 3HQCA 2HE7A 4PNKA 3KZ1A 1Y19B
chains in the Genus database with same CATH superfamily
1P3RA 4HB3B 1E5WA 3HIEA 2H7EA 3MDBC 1V5UA 2M38A 3TO1A 3N7CA 5LOPB 3BJIA 1FHXA 2DKQA 1FOEA 2MFQA 1UEFA 2J59M 1M7RA 5FI1A 5I2SA 2DHIA 2E2XA 2YT1A 5DHAB 2L2IA 1P5TA 1EVHA 2YSZA 2K8EA 5C6RA 2D9XA 3AJ4A 4L1RA 5KCVA 2KR0A 2VKIA 2G35A 1TJ6A 4A6FA 4IFSA 5J3TA 3O96A 3SO6A 2UVMA 3P7ZA 2DYQA 4QJ5B 1SGHA 4K2PA 4BBKA 3QIJA 2CY4A 2YS1A 3M1IB 2D9VA 2MKRA 2UZSA 4CHJA 2KCJA 4HB4B 4A5KA 4WVFB 1XX0A 3ML4A 2GCJA 5HE1A 3PP2A 3U7DA 5M4YB 3CXBB 4DIXA 3NSUA 4HB0B 2KIGA 4F7HA 3OHMB 2N0YA 4OSNA 3X23A 2BCJA 2Z14A 2DX5A 1UNQA 3D8DA 1ISNA 3F5RA 1MAIA 4MK0A 1XKEA 3OANA 1WI1A 3ODOA 2HTHB 4XWXA 4YL8A 1FHOA 2QKLA 1AQCA 4HAZB 2M14A 1WJMA 2ELAA 4TYZA 1XCGA 2Z13A 2Z0OA 2D11A 4GNKB 1UNPA 5C16A 3SUZA 2P0HA 4HSIA 4GMVA 2DA0A 4EMOA 2GUMA 1BTNA 5CLQB 3FM8C 1KZGA 5DH9B 1MIZB 5I2MA 2AL6A 2I1JA 1MI1A 3A98B 2W2XC 1W1HA 1PMSA 2D9YA 2D9ZA 2ELBA 3NWDA 4HAXB 3NWFA 5D3XA 2EJ8A 2DFKA 1EAZA 1ZVRA 1BTKA 1V61A 1J19A 2MDXA 1U5GA 2GCLA 2P0DA 4IOYX 3P6AA 3B77A 1NU2A 1FHWA 2LOZA 2AEHA 3SV1A 1X05A 3KSYA 1NTYA 2H7DA 4HHVA 5HE3A 4GOUA 4L6EA 4CHMA 2FJLA 4QXAB 2UZRA 2EC1A 2VSZA 4C0AA 1WVHA 5C5BB 2RNRB 1UNRA 1QQGA 5JHHA 1NTVA 1OQNA 1MIXA 3KRXA 3PEGA 3GYOA 2RUKB 1MPHA 1X86A 2Z4DA 2DLWA 1BWNA 2YRYA 5DI9B 4OT1A 4KVGB 3WYFB 3TW1A 5JP4A 1DROA 3BINA 3PSCA 5D3VA 2P8VA 5EFXA 2K2UA 2NMBA 1LB1A 2ROZB 2FJUB 2D9WA 2DHKA 1RRPB 2W2XD 2IFSA 1LW3A 1PFJA 2RGNB 4CYEA 4HB2B 1V5PA 2R0DA 4Z2MB 2ADZA 4Y94A 5GOWB 5J3YA 3PZDA 1ZSQA 1N3HA 4B6HA 1W1GA 1FB8A 2VRWB 2EMTA 1X1GA 3U8ZA 5KQ1A 3KRWA 1GG3A 3IVFA 5LONB 1BAKA 2ZPYA 4KHAA 1Z87A 1H10A 4HAVB 1I2HA 3ULBA 3D8FA 2LULA 3VIAA 1OY2A 3KY9A 5DIFB 2OTXA 1U5FA 4ZRKA 1FAOA 1RJ2A 1DYNA 1GC6A 3SNHA 3HSAA 2P0FA 4H8SA 3AU5A 2YS3A 3CIKA 1X1FA 1KZ7A 1NI2A 2Z0PA 3A58A 2Y8FA 3PVUA 4KAXB 4MT7A 2KUPA 3PG7A 4KHOA 2RRFA 1J0WA 4K17A 5D27A 5IRSA 4F7UP 1FGZA 5L81A 2KGXB 2V76A 1OMWA 2NZ8B 4GXBA 2J0JA 1U5EA 3ODWA 2LOXA 1P6SA 2KIEA 2X18A 3FEHA 4F7GA 5JLJB 3TFMA 5DHFB 4YONA 3TVVA 4DX90 2YT2A 3V5WA 1U29A 4KHBB 4P7IA 4D6WA 3G9WA 3AU4A 4Z2NA 4ZRJA 2RSGA 2LKOA 3NWAA 4IAPA 3QBVB 2GS0A 4HDQA 1WGUA 1DBHA 1IRSA 1UPRA 2D2QA 3F0WA 3U12A 2Z59A 3TCAA 5LG4B 1EF1A 4WJ7A 2DKPA 3QWMA 5HE2A 1PLSA 2MWNB 2ROVA 2L1CA 4HAYB 4A6HA 1V89A 4D0NB 1ZC3B 4HAWB 2I1KA 5C5BA 2IYBA 3DXDA 1GC7A 1Y5OA 2EMSA 1M7EA 2K00A 2I5FA 3PVWA 2J0KA 1FGYA 2Y7BA 3WA0A 1WJ1A 2D10A 3HW2B 3LJUX 2CY5A 1EGXA 2NBVA 4GMXB 2RVBB 3DXCA 1Q67A 4GPTB 1MK7B 1ZYIA 1U2BA 2W2WA 1V5MA 2Y8GA 3RCPA 1K5GB 1XR0B 4PQ0A 1SHCA 3GYPA 2KUQA 5KQ4A 2R2YA 5D3YA 4A6FB 3VOQA 3ODXA 2N23A 2DN6A 1WG7A 1ZM0A 1QC6A 1ZC4B 5HE0A 3ULCA 2DX1A 2DHJA 2YT0A 4A6KA 1TXDA 5JHGA 2LG1A 3KZ1A 5D3WA 2CODA 2DYNA 1H4RA 2DTCA 2QKMA 3MPXA 2CAYA 2CRFA 2YS5A 2LYDA 1W1DA 2J0MA 2JP2A 2D4QA 4NSWA 4MY6A 3FSSA 4GN1A 4WSFA 2PZ1A 2GJYA 4HDOA 1DDWA 4DX8A 3DCXA 1X11A 3ZVRA 3HK0A 4K2OA 1MKEA 4DBBA 4HAUB 3UZTA 1XODA 1U5DA 4HATB 2Q13A 3PVLA 4DXAB 1U27A 2R09A 3D8EA 1MK9B 5CLLB 4CSQA 2COAA 2COCA 3SYXA 2K2JA 3A8QA 1B55A 1DDMA 2YF0A 4QJ3B 3FVCA 1V88A 2RLOA 4QJ4B 4EKUA 1KI1B 1T77A 2XQNM 2ZKMX 1WGQA 2OQBA 2Z0QA 5J3QA 5C79A 1TQZA 3ZDTA 4ZRIA 1AWEA 4EJNA 1DDVA 4KHBA 3NW8A 2K49A 2YVCA 1I7AA 3A8PA 3T06A 4NY0A 1K5DB 4TKNA 2COFA 2I5CA 5FI0A 4K81A 4GZUA 1XD4A 3DXEA 3HQCA 2HE7A 4PNKA 1UPQA 1Y19B
chains in the Genus database with same CATH topology
1P3RA 4HB3B 1E5WA 2H7EA 3MDBC 1V5UA 2M38A 3TO1A 3N7CA 5LOPB 3BJIA 1FHXA 2DKQA 1FOEA 2MFQA 1UEFA 2J59M 1M7RA 5FI1A 2DHIA 2E2XA 2YT1A 5DHAB 2L2IA 1P5TA 1EVHA 2YSZA 5C6RA 2D9XA 3AJ4A 5KCVA 2VKIA 2G35A 1TJ6A 4A6FA 4IFSA 5J3TA 3O96A 3SO6A 2UVMA 3P7ZA 2DYQA 1SGHA 4K2PA 4BBKA 3QIJA 2CY4A 2YS1A 3M1IB 2D9VA 2MKRA 2UZSA 4CHJA 2KCJA 4HB4B 4A5KA 4WVFB 1XX0A 1UPQA 3ML4A 2GCJA 5HE1A 3PP2A 3U7DA 3CXBB 3NSUA 4HB0B 4F7HA 2N0YA 3X23A 2BCJA 2DX5A 1UNQA 3D8DA 1ISNA 3F5RA 1MAIA 4MK0A 1XKEA 3OANA 1WI1A 3ODOA 2HTHB 4XWXA 4YL8A 1FHOA 2QKLA 1AQCA 4HAZB 2M14A 1WJMA 2ELAA 4TYZA 1XCGA 2Z0OA 2D11A 1UNPA 5C16A 3SUZA 2P0HA 4GMVA 2DA0A 4EMOA 1BTNA 5CLQB 3FM8C 1KZGA 5DH9B 1MIZB 2AL6A 2I1JA 3A98B 2W2XC 1W1HA 1PMSA 2D9YA 2D9ZA 2ELBA 4HAXB 5D3XA 2EJ8A 2DFKA 1EAZA 1ZVRA 1BTKA 1V61A 1J19A 2MDXA 1U5GA 2GCLA 2P0DA 4IOYX 3P6AA 1NU2A 1FHWA 2LOZA 2AEHA 3SV1A 1X05A 3KSYA 1NTYA 2H7DA 4HHVA 5HE3A 4L6EA 4CHMA 2FJLA 2UZRA 2EC1A 2VSZA 4C0AA 1WVHA 5C5BB 2RNRB 1UNRA 1QQGA 5JHHA 1NTVA 1OQNA 1MIXA 3KRXA 3PEGA 3GYOA 2RUKB 1MPHA 1X86A 2DLWA 1BWNA 2YRYA 5DI9B 3WYFB 4KVGB 3TW1A 5JP4A 1DROA 3BINA 3PSCA 5D3VA 2P8VA 5EFXA 2K2UA 2NMBA 1LB1A 2ROZB 2D9WA 2DHKA 1RRPB 2W2XD 2IFSA 1LW3A 1PFJA 2RGNB 4CYEA 4HB2B 1V5PA 2R0DA 4Z2MB 2ADZA 4Y94A 5GOWB 5J3YA 3PZDA 1ZSQA 1N3HA 4B6HA 1W1GA 1FB8A 2VRWB 2EMTA 1X1GA 3U8ZA 5KQ1A 3KRWA 1GG3A 3IVFA 5LONB 1BAKA 2ZPYA 4KHAA 1Z87A 1H10A 4HAVB 1I2HA 3ULBA 3D8FA 2LULA 3VIAA 1OY2A 3KY9A 5DIFB 2OTXA 1U5FA 4ZRKA 1FAOA 1RJ2A 1DYNA 1GC6A 3SNHA 2P0FA 4H8SA 3AU5A 2YS3A 3CIKA 1X1FA 1KZ7A 1NI2A 2Z0PA 3PVUA 2Y8FA 4KAXB 4MT7A 2KUPA 3PG7A 4KHOA 1J0WA 4K17A 5D27A 4F7UP 1FGZA 5L81A 2KGXB 2V76A 1OMWA 2NZ8B 4GXBA 2J0JA 1U5EA 3ODWA 2LOXA 1P6SA 2X18A 3FEHA 4F7GA 5JLJB 3TFMA 5DHFB 4YONA 3TVVA 4DX90 3V5WA 1U29A 4KHBB 4P7IA 3G9WA 3AU4A 4Z2NA 4ZRJA 2RSGA 2LKOA 4IAPA 3QBVB 2GS0A 4HDQA 1WGUA 1DBHA 1IRSA 1UPRA 2D2QA 3F0WA 3TCAA 1EF1A 4WJ7A 2DKPA 3QWMA 5HE2A 1PLSA 2MWNB 2ROVA 2L1CA 4HAYB 4A6HA 1V89A 4D0NB 1ZC3B 4HAWB 2I1KA 5C5BA 2IYBA 3DXDA 1GC7A 1Y5OA 2EMSA 1M7EA 2K00A 2I5FA 3PVWA 2J0KA 1FGYA 2Y7BA 3WA0A 1WJ1A 2D10A 3HW2B 3LJUX 2CY5A 1EGXA 4GMXB 2RVBB 3DXCA 1Q67A 4GPTB 1MK7B 1U2BA 2W2WA 1V5MA 2Y8GA 3RCPA 1K5GB 1XR0B 4PQ0A 1SHCA 3GYPA 5KQ4A 5D3YA 4A6FB 3VOQA 3ODXA 2N23A 2DN6A 1WG7A 1ZM0A 1QC6A 1ZC4B 5HE0A 3ULCA 2DX1A 2DHJA 2YT0A 4A6KA 1TXDA 5JHGA 2LG1A 5D3WA 2CODA 2DYNA 1H4RA 2DTCA 2QKMA 3MPXA 2CAYA 2CRFA 2YS5A 2LYDA 1W1DA 2J0MA 2JP2A 2D4QA 4NSWA 4MY6A 3FSSA 4GN1A 4WSFA 2PZ1A 2GJYA 4HDOA 1DDWA 4DX8A 1X11A 3ZVRA 3HK0A 4K2OA 1MKEA 4DBBA 4HAUB 3UZTA 1XODA 1U5DA 4HATB 2Q13A 3PVLA 4DXAB 1U27A 2R09A 3D8EA 1MK9B 5CLLB 2COAA 2COCA 3SYXA 2K2JA 3A8QA 1B55A 1DDMA 2YF0A 1V88A 2RLOA 4EKUA 1KI1B 2XQNM 1WGQA 2OQBA 2Z0QA 5J3QA 5C79A 1TQZA 3ZDTA 4ZRIA 1AWEA 4EJNA 1DDVA 2YVCA 1I7AA 3A8PA 3T06A 4NY0A 1K5DB 4TKNA 2COFA 2I5CA 5FI0A 4K81A 4GZUA 1XD4A 3DXEA 3HQCA 2HE7A 4PNKA 3KZ1A 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3R A;  4HB3 B;  1E5W A;  2H7E A;  3MDB C;  1V5U A;  2M38 A;  3TO1 A;  3N7C A;  5LOP B;  3BJI A;  1FHX A;  2DKQ A;  1FOE A;  2MFQ A;  1UEF A;  2J59 M;  1M7R A;  5FI1 A;  2DHI A;  2E2X A;  2YT1 A;  5DHA B;  2L2I A;  1P5T A;  1EVH A;  2YSZ A;  5C6R A;  2D9X A;  3AJ4 A;  5KCV A;  2VKI A;  2G35 A;  1TJ6 A;  4A6F A;  4IFS A;  5J3T A;  3O96 A;  3SO6 A;  2UVM A;  3P7Z A;  2DYQ A;  1SGH A;  4K2P A;  4BBK A;  3QIJ A;  2CY4 A;  2YS1 A;  3M1I B;  2D9V A;  2MKR A;  2UZS A;  4CHJ A;  2KCJ A;  4HB4 B;  4A5K A;  4WVF B;  1XX0 A;  1UPQ A;  3ML4 A;  2GCJ A;  5HE1 A;  3PP2 A;  3U7D A;  3CXB B;  3NSU A;  4HB0 B;  4F7H A;  2N0Y A;  3X23 A;  2BCJ A;  2DX5 A;  1UNQ A;  3D8D A;  1ISN A;  3F5R A;  1MAI A;  4MK0 A;  1XKE A;  3OAN A;  1WI1 A;  3ODO A;  2HTH B;  4XWX A;  4YL8 A;  1FHO A;  2QKL A;  1AQC A;  4HAZ B;  2M14 A;  1WJM A;  2ELA A;  4TYZ A;  1XCG A;  2Z0O A;  2D11 A;  1UNP A;  5C16 A;  3SUZ A;  2P0H A;  4GMV A;  2DA0 A;  4EMO A;  1BTN A;  5CLQ B;  3FM8 C;  1KZG A;  5DH9 B;  1MIZ B;  2AL6 A;  2I1J A;  3A98 B;  2W2X C;  1W1H A;  1PMS A;  2D9Y A;  2D9Z A;  2ELB A;  4HAX B;  5D3X A;  2EJ8 A;  2DFK A;  1EAZ A;  1ZVR A;  1BTK A;  1V61 A;  1J19 A;  2MDX A;  1U5G A;  2GCL A;  2P0D A;  4IOY X;  3P6A A;  1NU2 A;  1FHW A;  2LOZ A;  2AEH A;  3SV1 A;  1X05 A;  3KSY A;  1NTY A;  2H7D A;  4HHV A;  5HE3 A;  4L6E A;  4CHM A;  2FJL A;  2UZR A;  2EC1 A;  2VSZ A;  4C0A A;  1WVH A;  5C5B B;  2RNR B;  1UNR A;  1QQG A;  5JHH A;  1NTV A;  1OQN A;  1MIX A;  3KRX A;  3PEG A;  3GYO A;  2RUK B;  1MPH A;  1X86 A;  2DLW A;  1BWN A;  2YRY A;  5DI9 B;  3WYF B;  4KVG B;  3TW1 A;  5JP4 A;  1DRO A;  3BIN A;  3PSC A;  5D3V A;  2P8V A;  5EFX A;  2K2U A;  2NMB A;  1LB1 A;  2ROZ B;  2D9W A;  2DHK A;  1RRP B;  2W2X D;  2IFS A;  1LW3 A;  1PFJ A;  2RGN B;  4CYE A;  4HB2 B;  1V5P A;  2R0D A;  4Z2M B;  2ADZ A;  4Y94 A;  5GOW B;  5J3Y A;  3PZD A;  1ZSQ A;  1N3H A;  4B6H A;  1W1G A;  1FB8 A;  2VRW B;  2EMT A;  1X1G A;  3U8Z A;  5KQ1 A;  3KRW A;  1GG3 A;  3IVF A;  5LON B;  1BAK A;  2ZPY A;  4KHA A;  1Z87 A;  1H10 A;  4HAV B;  1I2H A;  3ULB A;  3D8F A;  2LUL A;  3VIA A;  1OY2 A;  3KY9 A;  5DIF B;  2OTX A;  1U5F A;  4ZRK A;  1FAO A;  1RJ2 A;  1DYN A;  1GC6 A;  3SNH A;  2P0F A;  4H8S A;  3AU5 A;  2YS3 A;  3CIK A;  1X1F A;  1KZ7 A;  1NI2 A;  2Z0P A;  3PVU A;  2Y8F A;  4KAX B;  4MT7 A;  2KUP A;  3PG7 A;  4KHO A;  1J0W A;  4K17 A;  5D27 A;  4F7U P;  1FGZ A;  5L81 A;  2KGX B;  2V76 A;  1OMW A;  2NZ8 B;  4GXB A;  2J0J A;  1U5E A;  3ODW A;  2LOX A;  1P6S A;  2X18 A;  3FEH A;  4F7G A;  5JLJ B;  3TFM A;  5DHF B;  4YON A;  3TVV A;  4DX9 0;  3V5W A;  1U29 A;  4KHB B;  4P7I A;  3G9W A;  3AU4 A;  4Z2N A;  4ZRJ A;  2RSG A;  2LKO A;  4IAP A;  3QBV B;  2GS0 A;  4HDQ A;  1WGU A;  1DBH A;  1IRS A;  1UPR A;  2D2Q A;  3F0W A;  3TCA A;  1EF1 A;  4WJ7 A;  2DKP A;  3QWM A;  5HE2 A;  1PLS A;  2MWN B;  2ROV A;  2L1C A;  4HAY B;  4A6H A;  1V89 A;  4D0N B;  1ZC3 B;  4HAW B;  2I1K A;  5C5B A;  2IYB A;  3DXD A;  1GC7 A;  1Y5O A;  2EMS A;  1M7E A;  2K00 A;  2I5F A;  3PVW A;  2J0K A;  1FGY A;  2Y7B A;  3WA0 A;  1WJ1 A;  2D10 A;  3HW2 B;  3LJU X;  2CY5 A;  1EGX A;  4GMX B;  2RVB B;  3DXC A;  1Q67 A;  4GPT B;  1MK7 B;  1U2B A;  2W2W A;  1V5M A;  2Y8G A;  3RCP A;  1K5G B;  1XR0 B;  4PQ0 A;  1SHC A;  3GYP A;  5KQ4 A;  5D3Y A;  4A6F B;  3VOQ A;  3ODX A;  2N23 A;  2DN6 A;  1WG7 A;  1ZM0 A;  1QC6 A;  1ZC4 B;  5HE0 A;  3ULC A;  2DX1 A;  2DHJ A;  2YT0 A;  4A6K A;  1TXD A;  5JHG A;  2LG1 A;  5D3W A;  2COD A;  2DYN A;  1H4R A;  2DTC A;  2QKM A;  3MPX A;  2CAY A;  2CRF A;  2YS5 A;  2LYD A;  1W1D A;  2J0M A;  2JP2 A;  2D4Q A;  4NSW A;  4MY6 A;  3FSS A;  4GN1 A;  4WSF A;  2PZ1 A;  2GJY A;  4HDO A;  1DDW A;  4DX8 A;  1X11 A;  3ZVR A;  3HK0 A;  4K2O A;  1MKE A;  4DBB A;  4HAU B;  3UZT A;  1XOD A;  1U5D A;  4HAT B;  2Q13 A;  3PVL A;  4DXA B;  1U27 A;  2R09 A;  3D8E A;  1MK9 B;  5CLL B;  2COA A;  2COC A;  3SYX A;  2K2J A;  3A8Q A;  1B55 A;  1DDM A;  2YF0 A;  1V88 A;  2RLO A;  4EKU A;  1KI1 B;  2XQN M;  1WGQ A;  2OQB A;  2Z0Q A;  5J3Q A;  5C79 A;  1TQZ A;  3ZDT A;  4ZRI A;  1AWE A;  4EJN A;  1DDV A;  2YVC A;  1I7A A;  3A8P A;  3T06 A;  4NY0 A;  1K5D B;  4TKN A;  2COF A;  2I5C A;  5FI0 A;  4K81 A;  4GZU A;  1XD4 A;  3DXE A;  3HQC A;  2HE7 A;  4PNK A;  3KZ1 A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 1P3R A;  4HB3 B;  1E5W A;  3HIE A;  2H7E A;  3MDB C;  1V5U A;  2M38 A;  3TO1 A;  3N7C A;  5LOP B;  3BJI A;  1FHX A;  2DKQ A;  1FOE A;  2MFQ A;  1UEF A;  2J59 M;  1M7R A;  5FI1 A;  5I2S A;  2DHI A;  2E2X A;  2YT1 A;  5DHA B;  2L2I A;  1P5T A;  1EVH A;  2YSZ A;  2K8E A;  5C6R A;  2D9X A;  3AJ4 A;  4L1R A;  5KCV A;  2KR0 A;  2VKI A;  2G35 A;  1TJ6 A;  4A6F A;  4IFS A;  5J3T A;  3O96 A;  3SO6 A;  2UVM A;  3P7Z A;  2DYQ A;  4QJ5 B;  1SGH A;  4K2P A;  4BBK A;  3QIJ A;  2CY4 A;  2YS1 A;  3M1I B;  2D9V A;  2MKR A;  2UZS A;  4CHJ A;  2KCJ A;  4HB4 B;  4A5K A;  4WVF B;  1XX0 A;  3ML4 A;  2GCJ A;  5HE1 A;  3PP2 A;  3U7D A;  5M4Y B;  3CXB B;  4DIX A;  3NSU A;  4HB0 B;  2KIG A;  4F7H A;  3OHM B;  2N0Y A;  4OSN A;  3X23 A;  2BCJ A;  2Z14 A;  2DX5 A;  1UNQ A;  3D8D A;  1ISN A;  3F5R A;  1MAI A;  4MK0 A;  1XKE A;  3OAN A;  1WI1 A;  3ODO A;  2HTH B;  4XWX A;  4YL8 A;  1FHO A;  2QKL A;  1AQC A;  4HAZ B;  2M14 A;  1WJM A;  2ELA A;  4TYZ A;  1XCG A;  2Z13 A;  2Z0O A;  2D11 A;  4GNK B;  1UNP A;  5C16 A;  3SUZ A;  2P0H A;  4HSI A;  4GMV A;  2DA0 A;  4EMO A;  2GUM A;  1BTN A;  5CLQ B;  3FM8 C;  1KZG A;  5DH9 B;  1MIZ B;  5I2M A;  2AL6 A;  2I1J A;  1MI1 A;  3A98 B;  2W2X C;  1W1H A;  1PMS A;  2D9Y A;  2D9Z A;  2ELB A;  3NWD A;  4HAX B;  3NWF A;  5D3X A;  2EJ8 A;  2DFK A;  1EAZ A;  1ZVR A;  1BTK A;  1V61 A;  1J19 A;  2MDX A;  1U5G A;  2GCL A;  2P0D A;  4IOY X;  3P6A A;  3B77 A;  1NU2 A;  1FHW A;  2LOZ A;  2AEH A;  3SV1 A;  1X05 A;  3KSY A;  1NTY A;  2H7D A;  4HHV A;  5HE3 A;  4GOU A;  4L6E A;  4CHM A;  2FJL A;  4QXA B;  2UZR A;  2EC1 A;  2VSZ A;  4C0A A;  1WVH A;  5C5B B;  2RNR B;  1UNR A;  1QQG A;  5JHH A;  1NTV A;  1OQN A;  1MIX A;  3KRX A;  3PEG A;  3GYO A;  2RUK B;  1MPH A;  1X86 A;  2Z4D A;  2DLW A;  1BWN A;  2YRY A;  5DI9 B;  4OT1 A;  4KVG B;  3WYF B;  3TW1 A;  5JP4 A;  1DRO A;  3BIN A;  3PSC A;  5D3V A;  2P8V A;  5EFX A;  2K2U A;  2NMB A;  1LB1 A;  2ROZ B;  2FJU B;  2D9W A;  2DHK A;  1RRP B;  2W2X D;  2IFS A;  1LW3 A;  1PFJ A;  2RGN B;  4CYE A;  4HB2 B;  1V5P A;  2R0D A;  4Z2M B;  2ADZ A;  4Y94 A;  5GOW B;  5J3Y A;  3PZD A;  1ZSQ A;  1N3H A;  4B6H A;  1W1G A;  1FB8 A;  2VRW B;  2EMT A;  1X1G A;  3U8Z A;  5KQ1 A;  3KRW A;  1GG3 A;  3IVF A;  5LON B;  1BAK A;  2ZPY A;  4KHA A;  1Z87 A;  1H10 A;  4HAV B;  1I2H A;  3ULB A;  3D8F A;  2LUL A;  3VIA A;  1OY2 A;  3KY9 A;  5DIF B;  2OTX A;  1U5F A;  4ZRK A;  1FAO A;  1RJ2 A;  1DYN A;  1GC6 A;  3SNH A;  3HSA A;  2P0F A;  4H8S A;  3AU5 A;  2YS3 A;  3CIK A;  1X1F A;  1KZ7 A;  1NI2 A;  2Z0P A;  3A58 A;  2Y8F A;  3PVU A;  4KAX B;  4MT7 A;  2KUP A;  3PG7 A;  4KHO A;  2RRF A;  1J0W A;  4K17 A;  5D27 A;  5IRS A;  4F7U P;  1FGZ A;  5L81 A;  2KGX B;  2V76 A;  1OMW A;  2NZ8 B;  4GXB A;  2J0J A;  1U5E A;  3ODW A;  2LOX A;  1P6S A;  2KIE A;  2X18 A;  3FEH A;  4F7G A;  5JLJ B;  3TFM A;  5DHF B;  4YON A;  3TVV A;  4DX9 0;  2YT2 A;  3V5W A;  1U29 A;  4KHB B;  4P7I A;  4D6W A;  3G9W A;  3AU4 A;  4Z2N A;  4ZRJ A;  2RSG A;  2LKO A;  3NWA A;  4IAP A;  3QBV B;  2GS0 A;  4HDQ A;  1WGU A;  1DBH A;  1IRS A;  1UPR A;  2D2Q A;  3F0W A;  3U12 A;  2Z59 A;  3TCA A;  5LG4 B;  1EF1 A;  4WJ7 A;  2DKP A;  3QWM A;  5HE2 A;  1PLS A;  2MWN B;  2ROV A;  2L1C A;  4HAY B;  4A6H A;  1V89 A;  4D0N B;  1ZC3 B;  4HAW B;  2I1K A;  5C5B A;  2IYB A;  3DXD A;  1GC7 A;  1Y5O A;  2EMS A;  1M7E A;  2K00 A;  2I5F A;  3PVW A;  2J0K A;  1FGY A;  2Y7B A;  3WA0 A;  1WJ1 A;  2D10 A;  3HW2 B;  3LJU X;  2CY5 A;  1EGX A;  2NBV A;  4GMX B;  2RVB B;  3DXC A;  1Q67 A;  4GPT B;  1MK7 B;  1ZYI A;  1U2B A;  2W2W A;  1V5M A;  2Y8G A;  3RCP A;  1K5G B;  1XR0 B;  4PQ0 A;  1SHC A;  3GYP A;  2KUQ A;  5KQ4 A;  2R2Y A;  5D3Y A;  4A6F B;  3VOQ A;  3ODX A;  2N23 A;  2DN6 A;  1WG7 A;  1ZM0 A;  1QC6 A;  1ZC4 B;  5HE0 A;  3ULC A;  2DX1 A;  2DHJ A;  2YT0 A;  4A6K A;  1TXD A;  5JHG A;  2LG1 A;  3KZ1 A;  5D3W A;  2COD A;  2DYN A;  1H4R A;  2DTC A;  2QKM A;  3MPX A;  2CAY A;  2CRF A;  2YS5 A;  2LYD A;  1W1D A;  2J0M A;  2JP2 A;  2D4Q A;  4NSW A;  4MY6 A;  3FSS A;  4GN1 A;  4WSF A;  2PZ1 A;  2GJY A;  4HDO A;  1DDW A;  4DX8 A;  3DCX A;  1X11 A;  3ZVR A;  3HK0 A;  4K2O A;  1MKE A;  4DBB A;  4HAU B;  3UZT A;  1XOD A;  1U5D A;  4HAT B;  2Q13 A;  3PVL A;  4DXA B;  1U27 A;  2R09 A;  3D8E A;  1MK9 B;  5CLL B;  4CSQ A;  2COA A;  2COC A;  3SYX A;  2K2J A;  3A8Q A;  1B55 A;  1DDM A;  2YF0 A;  4QJ3 B;  3FVC A;  1V88 A;  2RLO A;  4QJ4 B;  4EKU A;  1KI1 B;  1T77 A;  2XQN M;  2ZKM X;  1WGQ A;  2OQB A;  2Z0Q A;  5J3Q A;  5C79 A;  1TQZ A;  3ZDT A;  4ZRI A;  1AWE A;  4EJN A;  1DDV A;  4KHB A;  3NW8 A;  2K49 A;  2YVC A;  1I7A A;  3A8P A;  3T06 A;  4NY0 A;  1K5D B;  4TKN A;  2COF A;  2I5C A;  5FI0 A;  4K81 A;  4GZU A;  1XD4 A;  3DXE A;  3HQC A;  2HE7 A;  4PNK A;  1UPQ A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 1P3R A;  4HB3 B;  1E5W A;  2H7E A;  3MDB C;  1V5U A;  2M38 A;  3TO1 A;  3N7C A;  5LOP B;  3BJI A;  1FHX A;  2DKQ A;  1FOE A;  2MFQ A;  1UEF A;  2J59 M;  1M7R A;  5FI1 A;  2DHI A;  2E2X A;  2YT1 A;  5DHA B;  2L2I A;  1P5T A;  1EVH A;  2YSZ A;  5C6R A;  2D9X A;  3AJ4 A;  5KCV A;  2VKI A;  2G35 A;  1TJ6 A;  4A6F A;  4IFS A;  5J3T A;  3O96 A;  3SO6 A;  2UVM A;  3P7Z A;  2DYQ A;  1SGH A;  4K2P A;  4BBK A;  3QIJ A;  2CY4 A;  2YS1 A;  3M1I B;  2D9V A;  2MKR A;  2UZS A;  4CHJ A;  2KCJ A;  4HB4 B;  4A5K A;  4WVF B;  1XX0 A;  1UPQ A;  3ML4 A;  2GCJ A;  5HE1 A;  3PP2 A;  3U7D A;  3CXB B;  3NSU A;  4HB0 B;  4F7H A;  2N0Y A;  3X23 A;  2BCJ A;  2DX5 A;  1UNQ A;  3D8D A;  1ISN A;  3F5R A;  1MAI A;  4MK0 A;  1XKE A;  3OAN A;  1WI1 A;  3ODO A;  2HTH B;  4XWX A;  4YL8 A;  1FHO A;  2QKL A;  1AQC A;  4HAZ B;  2M14 A;  1WJM A;  2ELA A;  4TYZ A;  1XCG A;  2Z0O A;  2D11 A;  1UNP A;  5C16 A;  3SUZ A;  2P0H A;  4GMV A;  2DA0 A;  4EMO A;  1BTN A;  5CLQ B;  3FM8 C;  1KZG A;  5DH9 B;  1MIZ B;  2AL6 A;  2I1J A;  3A98 B;  2W2X C;  1W1H A;  1PMS A;  2D9Y A;  2D9Z A;  2ELB A;  4HAX B;  5D3X A;  2EJ8 A;  2DFK A;  1EAZ A;  1ZVR A;  1BTK A;  1V61 A;  1J19 A;  2MDX A;  1U5G A;  2GCL A;  2P0D A;  4IOY X;  3P6A A;  1NU2 A;  1FHW A;  2LOZ A;  2AEH A;  3SV1 A;  1X05 A;  3KSY A;  1NTY A;  2H7D A;  4HHV A;  5HE3 A;  4L6E A;  4CHM A;  2FJL A;  2UZR A;  2EC1 A;  2VSZ A;  4C0A A;  1WVH A;  5C5B B;  2RNR B;  1UNR A;  1QQG A;  5JHH A;  1NTV A;  1OQN A;  1MIX A;  3KRX A;  3PEG A;  3GYO A;  2RUK B;  1MPH A;  1X86 A;  2DLW A;  1BWN A;  2YRY A;  5DI9 B;  3WYF B;  4KVG B;  3TW1 A;  5JP4 A;  1DRO A;  3BIN A;  3PSC A;  5D3V A;  2P8V A;  5EFX A;  2K2U A;  2NMB A;  1LB1 A;  2ROZ B;  2D9W A;  2DHK A;  1RRP B;  2W2X D;  2IFS A;  1LW3 A;  1PFJ A;  2RGN B;  4CYE A;  4HB2 B;  1V5P A;  2R0D A;  4Z2M B;  2ADZ A;  4Y94 A;  5GOW B;  5J3Y A;  3PZD A;  1ZSQ A;  1N3H A;  4B6H A;  1W1G A;  1FB8 A;  2VRW B;  2EMT A;  1X1G A;  3U8Z A;  5KQ1 A;  3KRW A;  1GG3 A;  3IVF A;  5LON B;  1BAK A;  2ZPY A;  4KHA A;  1Z87 A;  1H10 A;  4HAV B;  1I2H A;  3ULB A;  3D8F A;  2LUL A;  3VIA A;  1OY2 A;  3KY9 A;  5DIF B;  2OTX A;  1U5F A;  4ZRK A;  1FAO A;  1RJ2 A;  1DYN A;  1GC6 A;  3SNH A;  2P0F A;  4H8S A;  3AU5 A;  2YS3 A;  3CIK A;  1X1F A;  1KZ7 A;  1NI2 A;  2Z0P A;  3PVU A;  2Y8F A;  4KAX B;  4MT7 A;  2KUP A;  3PG7 A;  4KHO A;  1J0W A;  4K17 A;  5D27 A;  4F7U P;  1FGZ A;  5L81 A;  2KGX B;  2V76 A;  1OMW A;  2NZ8 B;  4GXB A;  2J0J A;  1U5E A;  3ODW A;  2LOX A;  1P6S A;  2X18 A;  3FEH A;  4F7G A;  5JLJ B;  3TFM A;  5DHF B;  4YON A;  3TVV A;  4DX9 0;  3V5W A;  1U29 A;  4KHB B;  4P7I A;  3G9W A;  3AU4 A;  4Z2N A;  4ZRJ A;  2RSG A;  2LKO A;  4IAP A;  3QBV B;  2GS0 A;  4HDQ A;  1WGU A;  1DBH A;  1IRS A;  1UPR A;  2D2Q A;  3F0W A;  3TCA A;  1EF1 A;  4WJ7 A;  2DKP A;  3QWM A;  5HE2 A;  1PLS A;  2MWN B;  2ROV A;  2L1C A;  4HAY B;  4A6H A;  1V89 A;  4D0N B;  1ZC3 B;  4HAW B;  2I1K A;  5C5B A;  2IYB A;  3DXD A;  1GC7 A;  1Y5O A;  2EMS A;  1M7E A;  2K00 A;  2I5F A;  3PVW A;  2J0K A;  1FGY A;  2Y7B A;  3WA0 A;  1WJ1 A;  2D10 A;  3HW2 B;  3LJU X;  2CY5 A;  1EGX A;  4GMX B;  2RVB B;  3DXC A;  1Q67 A;  4GPT B;  1MK7 B;  1U2B A;  2W2W A;  1V5M A;  2Y8G A;  3RCP A;  1K5G B;  1XR0 B;  4PQ0 A;  1SHC A;  3GYP A;  5KQ4 A;  5D3Y A;  4A6F B;  3VOQ A;  3ODX A;  2N23 A;  2DN6 A;  1WG7 A;  1ZM0 A;  1QC6 A;  1ZC4 B;  5HE0 A;  3ULC A;  2DX1 A;  2DHJ A;  2YT0 A;  4A6K A;  1TXD A;  5JHG A;  2LG1 A;  5D3W A;  2COD A;  2DYN A;  1H4R A;  2DTC A;  2QKM A;  3MPX A;  2CAY A;  2CRF A;  2YS5 A;  2LYD A;  1W1D A;  2J0M A;  2JP2 A;  2D4Q A;  4NSW A;  4MY6 A;  3FSS A;  4GN1 A;  4WSF A;  2PZ1 A;  2GJY A;  4HDO A;  1DDW A;  4DX8 A;  1X11 A;  3ZVR A;  3HK0 A;  4K2O A;  1MKE A;  4DBB A;  4HAU B;  3UZT A;  1XOD A;  1U5D A;  4HAT B;  2Q13 A;  3PVL A;  4DXA B;  1U27 A;  2R09 A;  3D8E A;  1MK9 B;  5CLL B;  2COA A;  2COC A;  3SYX A;  2K2J A;  3A8Q A;  1B55 A;  1DDM A;  2YF0 A;  1V88 A;  2RLO A;  4EKU A;  1KI1 B;  2XQN M;  1WGQ A;  2OQB A;  2Z0Q A;  5J3Q A;  5C79 A;  1TQZ A;  3ZDT A;  4ZRI A;  1AWE A;  4EJN A;  1DDV A;  2YVC A;  1I7A A;  3A8P A;  3T06 A;  4NY0 A;  1K5D B;  4TKN A;  2COF A;  2I5C A;  5FI0 A;  4K81 A;  4GZU A;  1XD4 A;  3DXE A;  3HQC A;  2HE7 A;  4PNK A;  3KZ1 A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...