4QXAB

Crystal structure of the rab9a-rutbc2 rbd complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
147
Chain Sequence
ATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVATDYVFRIIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-9A
publication title Crystal Structure of the Rab9A-RUTBC2 RBD Complex Reveals the Molecular Basis for the Binding Specificity of Rab9A with RUTBC2
doi rcsb
source organism Mus musculus
molecule tags Protein transport/protein binding
total genus 30
structure length 147
sequence length 171
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12068 PH_RBD Rab-binding domain (RBD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.230 Mainly Beta Roll PH-domain like PH-domain like 4qxaB00
4QXAB
chains in the Genus database with same CATH superfamily
3WYFB 3KSYA 1V89A 2VKIA 4HAXB 2D9WA 4DBBA 3KRXA 1WGUA 1BTKA 1I2HA 2DFKA 2Z4DA 4Z2MB 2LG1A 1W1HA 4TKNA 5DHAB 2GUMA 4HB0B 1DDWA 3NWDA 3ULBA 3PVWA 5KCVA 2D9ZA 2DHKA 4CHMA 1U5EA 1PFJA 1X1FA 2ELAA 2P0DA 4MK0A 1MK7B 1FAOA 1DROA 1U29A 2D10A 1UNPA 1GG3A 1XR0B 5DHFB 5D3VA 2YF0A 4KHAA 3VIAA 3ML4A 4L1RA 3SO6A 1BTNA 1SGHA 4WVFB 2DYNA 4MT7A 3U12A 3TO1A 5D3WA 5C6RA 1FGZA 3P7ZA 4DX90 2RUKB 3QWMA 4GOUA 3ODWA 2YRYA 4HB4B 3HIEA 4HSIA 2KUQA 2LYDA 5D3YA 3SNHA 1OQNA 2LULA 4HDQA 4NY0A 5C16A 3FEHA 2N23A 3ODOA 3TFMA 5KQ4A 2D9XA 3V5WA 2MKRA 5J3QA 1MIZB 2YS1A 2QKMA 1UNRA 1ZM0A 4TYZA 4F7GA 1U5FA 3QIJA 3F5RA 5I2MA 2X18A 5CLLB 5EFXA 2KGXB 3D8FA 1QQGA 1V88A 2KUPA 2LOZA 1LB1A 4HATB 4ZRJA 3FM8C 1AQCA 1FHXA 2J0JA 2J59M 1TQZA 3D8EA 4CHJA 1DYNA 2I1JA 2DA0A 1DDMA 5D27A 2CODA 2LOXA 3MPXA 1J19A 2E2XA 3PVLA 3NWAA 4K17A 4Y94A 5HE0A 5IRSA 2M38A 1J0WA 3DXEA 2UZSA 4GN1A 1PMSA 1MAIA 1K5GB 2HE7A 4H8SA 4HAVB 3PEGA 2CY5A 1Y19B 1OY2A 4HAUB 4D6WA 3A58A 1X86A 5HE1A 1P6SA 3MDBC 2D9YA 4WSFA 2J0KA 2UZRA 4D0NB 2RVBB 1W1DA 2G35A 1ZC3B 4PNKA 3RCPA 3U7DA 2CY4A 2OQBA 4Z2NA 3ZDTA 4A6FA 4A5KA 2AEHA 1ZVRA 5JP4A 1MI1A 5J3YA 1MKEA 3T06A 4GXBA 5FI0A 2K8EA 2DHJA 2K2UA 3O96A 2Y8GA 2EMTA 3VOQA 1NTVA 4A6FB 4B6HA 2P0FA 3F0WA 5JHHA 3HW2B 2J0MA 4HB3B 3HK0A 1FGYA 1QC6A 5C79A 5C5BA 3X23A 1BWNA 4GMVA 3ULCA 2NBVA 2YT2A 2DX5A 4XWXA 2EJ8A 4F7HA 5M4YB 4EJNA 4HHVA 5I2SA 2MWNB 1U2BA 1M7EA 2W2WA 1WJMA 1TJ6A 5C5BB 3DXDA 5FI1A 4NSWA 4GPTB 3WA0A 2DX1A 1NU2A 4CYEA 1P5TA 2QKLA 2YS5A 3D8DA 1B55A 4KAXB 1Z87A 1XX0A 1UPRA 3A98B 1DDVA 4HAWB 2DN6A 1IRSA 2KCJA 2H7EA 5LG4B 4GZUA 1AWEA 1FHOA 4QJ5B 2I5FA 2YT1A 1WJ1A 2V76A 4C0AA 3NSUA 2IFSA 3IVFA 4KHBA 3NW8A 1T77A 3TW1A 1TXDA 4K2OA 5HE3A 2Z14A 3QBVB 5J3TA 2DLWA 4ZRKA 3KY9A 2W2XC 5L81A 4WJ7A 2FJLA 5LONB 2YSZA 1H10A 1V61A 4KHBB 2GS0A 2MFQA 3DXCA 3KZ1A 1Q67A 2L2IA 2YVCA 4IOYX 1Y5OA 2JP2A 2GCJA 4HAZB 1I7AA 3PSCA 2M14A 1EF1A 4ZRIA 2ZKMX 4F7UP 3G9WA 4YONA 4IFSA 1LW3A 3BJIA 3UZTA 1KZGA 1SHCA 1V5PA 2OTXA 2UVMA 2Z13A 2I5CA 3M1IB 1XKEA 2ZPYA 3N7CA 1MPHA 2Z0QA 2RGNB 3OHMB 2COCA 1XCGA 3AJ4A 3CXBB 1NTYA 1ZC4B 1GC6A 1V5UA 2I1KA 2P8VA 4PQ0A 2HTHB 2XQNM 2DHIA 1EAZA 4DX8A 3NWFA 1M7RA 2KR0A 2VRWB 1RRPB 1MIXA 2AL6A 3SYXA 2ELBA 1FOEA 4A6KA 2D9VA 3FSSA 1U5DA 1MK9B 2MDXA 3LJUX 3A8PA 2EMSA 2R09A 2K2JA 2DTCA 2RLOA 2CRFA 1X1GA 2Z0OA 5KQ1A 2RNRB 1ZYIA 2DYQA 2COAA 3PZDA 3A8QA 1U5GA 4K2PA 1FB8A 2LKOA 4L6EA 1RJ2A 1GC7A 2L1CA 4IAPA 2DKQA 3HQCA 1KI1B 2GJYA 1UPQA 2YT0A 1ISNA 2DKPA 4MY6A 4QXAB 1DBHA 5LOPB 1H4RA 3GYOA 1K5DB 4OT1A 3TCAA 3KRWA 3P6AA 2H7DA 5GOWB 4BBKA 2FJUB 2R0DA 1ZSQA 1WI1A 4DXAB 2RSGA 4P7IA 3B77A 1KZ7A 1FHWA 2N0YA 1EGXA 3BINA 1X11A 5JHGA 5DH9B 3ODXA 2COFA 1U27A 1X05A 2Y7BA 2D4QA 2ROZB 4CSQA 4K81A 2Z0PA 1UNQA 3PVUA 1NI2A 1BAKA 3DCXA 2D2QA 2YS3A 1WGQA 2CAYA 4EKUA 4KVGB 1XD4A 1PLSA 5DIFB 3FVCA 3CIKA 2GCLA 4DIXA 2PZ1A 2IYBA 2VSZA 1WG7A 4A6HA 2ADZA 2Y8FA 4QJ4B 2KIEA 5CLQB 3U8ZA 3HSAA 5D3XA 4EMOA 1P3RA 2P0HA 1OMWA 2NMBA 2EC1A 4YL8A 3SV1A 3PG7A 2K49A 4QJ3B 4GMXB 3PP2A 1XODA 4HDOA 5HE2A 2Z59A 3AU5A 1V5MA 2ROVA 4GNKB 3TVVA 3AU4A 3SUZA 2Q13A 2W2XD 3OANA 5DI9B 1EVHA 5JLJB 2BCJA 3ZVRA 2RRFA 1N3HA 1E5WA 2KIGA 1UEFA 4HAYB 2K00A 2NZ8B 3GYPA 2R2YA 4KHOA 2D11A 4HB2B 4OSNA 1W1GA 1WVHA
chains in the Genus database with same CATH topology
4PQ0A 4IFSA 2Z59A 3TW1A 2K8EA 2Z14A 4GOUA 3FVCA 5M4YB 2GCLA 5I2SA 3NWAA 4GNKB 3NWFA 2KR0A 4DIXA 3HIEA 4HSIA 3TO1A 2KUQA 3TVVA 2Z4DA 5LG4B 5IRSA 4Z2MB 4KHBB 4QXAB 2Z13A 4QJ4B 4QJ5B 4CSQA 2GUMA 3GYOA 2KIEA 3NWDA 4IOYX 4KHAA 4Z2NA 4OT1A 3FSSA 4L1RA 2RRFA 4KHBA 2GCJA 3OHMB 2K49A 2KIGA 3NW8A 2FJUB 4QJ3B 2NBVA 3GYPA 2YT2A 2ZKMX 2R2YA 4KHOA 4D6WA 3U12A 1ZYIA 5I2MA 4OSNA 3A58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXA B; 
#chains in the Genus database with same CATH topology
 3WYF B;  3KSY A;  1V89 A;  2VKI A;  4HAX B;  2D9W A;  4DBB A;  3KRX A;  1WGU A;  1BTK A;  1I2H A;  2DFK A;  2Z4D A;  4Z2M B;  2LG1 A;  1W1H A;  4TKN A;  5DHA B;  2GUM A;  4HB0 B;  1DDW A;  3NWD A;  3ULB A;  3PVW A;  5KCV A;  2D9Z A;  2DHK A;  4CHM A;  1U5E A;  1PFJ A;  1X1F A;  2ELA A;  2P0D A;  4MK0 A;  1MK7 B;  1FAO A;  1DRO A;  1U29 A;  2D10 A;  1UNP A;  1GG3 A;  1XR0 B;  5DHF B;  5D3V A;  2YF0 A;  4KHA A;  3VIA A;  3ML4 A;  4L1R A;  3SO6 A;  1BTN A;  1SGH A;  4WVF B;  2DYN A;  4MT7 A;  3U12 A;  3TO1 A;  5D3W A;  5C6R A;  1FGZ A;  3P7Z A;  4DX9 0;  2RUK B;  3QWM A;  4GOU A;  3ODW A;  2YRY A;  4HB4 B;  3HIE A;  4HSI A;  2KUQ A;  2LYD A;  5D3Y A;  3SNH A;  1OQN A;  2LUL A;  4HDQ A;  4NY0 A;  5C16 A;  3FEH A;  2N23 A;  3ODO A;  3TFM A;  5KQ4 A;  2D9X A;  3V5W A;  2MKR A;  5J3Q A;  1MIZ B;  2YS1 A;  2QKM A;  1UNR A;  1ZM0 A;  4TYZ A;  4F7G A;  1U5F A;  3QIJ A;  3F5R A;  5I2M A;  2X18 A;  5CLL B;  5EFX A;  2KGX B;  3D8F A;  1QQG A;  1V88 A;  2KUP A;  2LOZ A;  1LB1 A;  4HAT B;  4ZRJ A;  3FM8 C;  1AQC A;  1FHX A;  2J0J A;  2J59 M;  1TQZ A;  3D8E A;  4CHJ A;  1DYN A;  2I1J A;  2DA0 A;  1DDM A;  5D27 A;  2COD A;  2LOX A;  3MPX A;  1J19 A;  2E2X A;  3PVL A;  3NWA A;  4K17 A;  4Y94 A;  5HE0 A;  5IRS A;  2M38 A;  1J0W A;  3DXE A;  2UZS A;  4GN1 A;  1PMS A;  1MAI A;  1K5G B;  2HE7 A;  4H8S A;  4HAV B;  3PEG A;  2CY5 A;  1Y19 B;  1OY2 A;  4HAU B;  4D6W A;  3A58 A;  1X86 A;  5HE1 A;  1P6S A;  3MDB C;  2D9Y A;  4WSF A;  2J0K A;  2UZR A;  4D0N B;  2RVB B;  1W1D A;  2G35 A;  1ZC3 B;  4PNK A;  3RCP A;  3U7D A;  2CY4 A;  2OQB A;  4Z2N A;  3ZDT A;  4A6F A;  4A5K A;  2AEH A;  1ZVR A;  5JP4 A;  1MI1 A;  5J3Y A;  1MKE A;  3T06 A;  4GXB A;  5FI0 A;  2K8E A;  2DHJ A;  2K2U A;  3O96 A;  2Y8G A;  2EMT A;  3VOQ A;  1NTV A;  4A6F B;  4B6H A;  2P0F A;  3F0W A;  5JHH A;  3HW2 B;  2J0M A;  4HB3 B;  3HK0 A;  1FGY A;  1QC6 A;  5C79 A;  5C5B A;  3X23 A;  1BWN A;  4GMV A;  3ULC A;  2NBV A;  2YT2 A;  2DX5 A;  4XWX A;  2EJ8 A;  4F7H A;  5M4Y B;  4EJN A;  4HHV A;  5I2S A;  2MWN B;  1U2B A;  1M7E A;  2W2W A;  1WJM A;  1TJ6 A;  5C5B B;  3DXD A;  5FI1 A;  4NSW A;  4GPT B;  3WA0 A;  2DX1 A;  1NU2 A;  4CYE A;  1P5T A;  2QKL A;  2YS5 A;  3D8D A;  1B55 A;  4KAX B;  1Z87 A;  1XX0 A;  1UPR A;  3A98 B;  1DDV A;  4HAW B;  2DN6 A;  1IRS A;  2KCJ A;  2H7E A;  5LG4 B;  4GZU A;  1AWE A;  1FHO A;  4QJ5 B;  2I5F A;  2YT1 A;  1WJ1 A;  2V76 A;  4C0A A;  3NSU A;  2IFS A;  3IVF A;  4KHB A;  3NW8 A;  1T77 A;  3TW1 A;  1TXD A;  4K2O A;  5HE3 A;  2Z14 A;  3QBV B;  5J3T A;  2DLW A;  4ZRK A;  3KY9 A;  2W2X C;  5L81 A;  4WJ7 A;  2FJL A;  5LON B;  2YSZ A;  1H10 A;  1V61 A;  4KHB B;  2GS0 A;  2MFQ A;  3DXC A;  3KZ1 A;  1Q67 A;  2L2I A;  2YVC A;  4IOY X;  1Y5O A;  2JP2 A;  2GCJ A;  4HAZ B;  1I7A A;  3PSC A;  2M14 A;  1EF1 A;  4ZRI A;  2ZKM X;  4F7U P;  3G9W A;  4YON A;  4IFS A;  1LW3 A;  3BJI A;  3UZT A;  1KZG A;  1SHC A;  1V5P A;  2OTX A;  2UVM A;  2Z13 A;  2I5C A;  3M1I B;  1XKE A;  2ZPY A;  3N7C A;  1MPH A;  2Z0Q A;  2RGN B;  3OHM B;  2COC A;  1XCG A;  3AJ4 A;  3CXB B;  1NTY A;  1ZC4 B;  1GC6 A;  1V5U A;  2I1K A;  2P8V A;  4PQ0 A;  2HTH B;  2XQN M;  2DHI A;  1EAZ A;  4DX8 A;  3NWF A;  1M7R A;  2KR0 A;  2VRW B;  1RRP B;  1MIX A;  2AL6 A;  3SYX A;  2ELB A;  1FOE A;  4A6K A;  2D9V A;  3FSS A;  1U5D A;  1MK9 B;  2MDX A;  3LJU X;  3A8P A;  2EMS A;  2R09 A;  2K2J A;  2DTC A;  2RLO A;  2CRF A;  1X1G A;  2Z0O A;  5KQ1 A;  2RNR B;  1ZYI A;  2DYQ A;  2COA A;  3PZD A;  3A8Q A;  1U5G A;  4K2P A;  1FB8 A;  2LKO A;  4L6E A;  1RJ2 A;  1GC7 A;  2L1C A;  4IAP A;  2DKQ A;  3HQC A;  1KI1 B;  2GJY A;  1UPQ A;  2YT0 A;  1ISN A;  2DKP A;  4MY6 A;  4QXA B;  1DBH A;  5LOP B;  1H4R A;  3GYO A;  1K5D B;  4OT1 A;  3TCA A;  3KRW A;  3P6A A;  2H7D A;  5GOW B;  4BBK A;  2FJU B;  2R0D A;  1ZSQ A;  1WI1 A;  4DXA B;  2RSG A;  4P7I A;  3B77 A;  1KZ7 A;  1FHW A;  2N0Y A;  1EGX A;  3BIN A;  1X11 A;  5JHG A;  5DH9 B;  3ODX A;  2COF A;  1U27 A;  1X05 A;  2Y7B A;  2D4Q A;  2ROZ B;  4CSQ A;  4K81 A;  2Z0P A;  1UNQ A;  3PVU A;  1NI2 A;  1BAK A;  3DCX A;  2D2Q A;  2YS3 A;  1WGQ A;  2CAY A;  4EKU A;  4KVG B;  1XD4 A;  1PLS A;  5DIF B;  3FVC A;  3CIK A;  2GCL A;  4DIX A;  2PZ1 A;  2IYB A;  2VSZ A;  1WG7 A;  4A6H A;  2ADZ A;  2Y8F A;  4QJ4 B;  2KIE A;  5CLQ B;  3U8Z A;  3HSA A;  5D3X A;  4EMO A;  1P3R A;  2P0H A;  1OMW A;  2NMB A;  2EC1 A;  4YL8 A;  3SV1 A;  3PG7 A;  2K49 A;  4QJ3 B;  4GMX B;  3PP2 A;  1XOD A;  4HDO A;  5HE2 A;  2Z59 A;  3AU5 A;  1V5M A;  2ROV A;  4GNK B;  3TVV A;  3AU4 A;  3SUZ A;  2Q13 A;  2W2X D;  3OAN A;  5DI9 B;  1EVH A;  5JLJ B;  2BCJ A;  3ZVR A;  2RRF A;  1N3H A;  1E5W A;  2KIG A;  1UEF A;  4HAY B;  2K00 A;  2NZ8 B;  3GYP A;  2R2Y A;  4KHO A;  2D11 A;  4HB2 B;  4OSN A;  1W1G A;  1WVH A; 
#chains in the Genus database with same CATH homology
 4PQ0 A;  4IFS A;  2Z59 A;  3TW1 A;  2K8E A;  2Z14 A;  4GOU A;  3FVC A;  5M4Y B;  2GCL A;  5I2S A;  3NWA A;  4GNK B;  3NWF A;  2KR0 A;  4DIX A;  3HIE A;  4HSI A;  3TO1 A;  2KUQ A;  3TVV A;  2Z4D A;  5LG4 B;  5IRS A;  4Z2M B;  4KHB B;  4QXA B;  2Z13 A;  4QJ4 B;  4QJ5 B;  4CSQ A;  2GUM A;  3GYO A;  2KIE A;  3NWD A;  4IOY X;  4KHA A;  4Z2N A;  4OT1 A;  3FSS A;  4L1R A;  2RRF A;  4KHB A;  2GCJ A;  3OHM B;  2K49 A;  2KIG A;  3NW8 A;  2FJU B;  4QJ3 B;  2NBV A;  3GYP A;  2YT2 A;  2ZKM X;  2R2Y A;  4KHO A;  4D6W A;  3U12 A;  1ZYI A;  5I2M A;  4OSN A;  3A58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...