4QXAB

Crystal structure of the rab9a-rutbc2 rbd complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
147
Chain Sequence
ATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVATDYVFRIIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Rab9A-RUTBC2 RBD Complex Reveals the Molecular Basis for the Binding Specificity of Rab9A with RUTBC2
doi rcsb
source organism Mus musculus
molecule tags Protein transport/protein binding
molecule keywords Ras-related protein Rab-9A
total genus 30
structure length 147
sequence length 171
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12068 PH_RBD Rab-binding domain (RBD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.230 Mainly Beta Roll PH-domain like PH-domain like 4qxaB00
4QXAB
chains in the Genus database with same CATH superfamily
3AJ4A 2RLOA 3TO1A 3DXDA 2J0KA 3D8EA 2MWNB 5D3XA 4L1RA 2DYNA 1FHXA 2DHKA 3PG7A 2W2XD 4GMVA 4HSIA 2KIEA 2BCJA 5DI9B 5DH9B 4F7UP 1GC7A 3IVFA 1UNPA 4Z2NA 2Z0OA 3GYOA 1EVHA 3KSYA 2QKLA 3HK0A 2DFKA 2I5CA 5J3TA 3FM8C 1WG7A 2EJ8A 1WI1A 4A6FA 4EKUA 1XODA 1FHWA 2K00A 2VSZA 2H7DA 5HE2A 2GCLA 2KUPA 5C16A 1AWEA 3LJUX 1E5WA 2UVMA 1T77A 1V5MA 3TW1A 4F7GA 4CYEA 1X1GA 4OT1A 1GC6A 2Z13A 3A58A 3SO6A 3HSAA 4HAUB 1Q67A 4PQ0A 3ODWA 4QJ3B 1AQCA 4CHMA 1LB1A 2R09A 1WJMA 2LULA 3HQCA 4ZRJA 2QKMA 2LOZA 3SYXA 1UPRA 2YS3A 3X23A 5LONB 1FOEA 1WJ1A 1Z87A 3DXEA 2HTHB 2JP2A 2VRWB 3OANA 4MT7A 3FVCA 2Y8FA 1V5UA 2M14A 1U27A 3PSCA 1FGZA 2EMSA 1BAKA 1KI1B 4QJ4B 5C5BB 3P7ZA 4KHBA 2LG1A 4P7IA 4BBKA 1QC6A 1MK7B 2IYBA 2OTXA 4XWXA 4F7HA 2HE7A 5C79A 4CSQA 5LG4B 2DX5A 3MPXA 4NSWA 1ZSQA 3ML4A 1V61A 5LOPB 5KCVA 3QWMA 3V5WA 2Z59A 5JLJB 4Z2MB 2I1JA 4B6HA 2R0DA 2W2WA 2Z0QA 4WJ7A 3NSUA 1XX0A 1NTYA 5FI0A 3ZDTA 2DTCA 2AEHA 3NWDA 5D27A 2EMTA 2W2XC 3N7CA 5HE1A 2DKPA 1UNRA 5JP4A 1U5GA 1J0WA 4CHJA 5DHFB 1NU2A 1H4RA 2COCA 5J3YA 1SHCA 2ZPYA 3TCAA 1PFJA 2CY5A 3O96A 4GN1A 2RUKB 5KQ4A 4A5KA 2OQBA 5FI1A 1BTKA 3PVLA 3ZVRA 2KCJA 1RJ2A 1Y19B 2RGNB 5KQ1A 1UNQA 2LYDA 1U5EA 4HHVA 1V89A 4DXAB 4HB0B 1DDMA 1V5PA 1DBHA 2D9XA 5JHHA 4D6WA 2M38A 3PZDA 4OSNA 2LKOA 3F0WA 5D3VA 5J3QA 2Y7BA 1KZ7A 5I2SA 1B55A 1X05A 2P0FA 4QJ5B 1W1GA 3CXBB 2MKRA 3WYFB 3D8DA 1EAZA 2KR0A 3BINA 2COFA 4L6EA 1TXDA 5DIFB 1SGHA 2PZ1A 2YRYA 3QBVB 3U8ZA 4MK0A 4Y94A 5M4YB 3VOQA 4GMXB 4QXAB 1K5GB 2ELBA 1W1DA 4GOUA 1MIXA 1LW3A 2D9VA 3GYPA 3A8PA 5HE0A 4HDQA 1J19A 2FJLA 1KZGA 3A8QA 1DROA 5DHAB 2Z14A 2YS1A 2H7EA 4GZUA 3M1IB 2Q13A 2KIGA 4NY0A 2I1KA 1EGXA 2AL6A 1OQNA 1V88A 5CLQB 4C0AA 3G9WA 1I2HA 1EF1A 1U2BA 3KRWA 2COAA 2YT0A 2ZKMX 4ZRIA 3F5RA 2NZ8B 4HB2B 4K17A 2R2YA 2MDXA 4EJNA 5C6RA 5L81A 1PLSA 2LOXA 2YSZA 3U12A 2UZSA 3SUZA 3PVWA 3PEGA 2XQNM 2Y8GA 1UPQA 2ADZA 2DHJA 1IRSA 1MIZB 2GCJA 3T06A 4H8SA 2ROZB 3B77A 1FAOA 3UZTA 1MI1A 2DX1A 3ODOA 4IAPA 4K2OA 4GNKB 3P6AA 2G35A 4A6HA 4YL8A 2D9WA 4KVGB 2RVBB 3KZ1A 2YF0A 5C5BA 2K2UA 1XKEA 2L2IA 2E2XA 4DX8A 1ZYIA 5IRSA 2D9ZA 4WVFB 4IFSA 1ZC4B 3SNHA 3AU5A 3PVUA 1MAIA 3ULBA 2J59M 2KGXB 4IOYX 2RNRB 4HAVB 2DLWA 2DA0A 4EMOA 3D8FA 1TJ6A 1UEFA 2NMBA 1WGUA 4A6FB 5CLLB 5EFXA 2FJUB 2CY4A 1XR0B 1N3HA 1M7RA 2X18A 3TVVA 4WSFA 3HIEA 1P6SA 2YT2A 1DYNA 1GG3A 3KRXA 4PNKA 1DDWA 1QQGA 1ZVRA 1P3RA 2GS0A 2UZRA 3DXCA 1I7AA 2EC1A 3OHMB 2P0DA 4HAZB 4MY6A 2YVCA 4ZRKA 2DKQA 3KY9A 4KHAA 3HW2B 1ZC3B 4HAXB 1P5TA 1FGYA 2Z4DA 4D0NB 4TKNA 1WVHA 2J0MA 1ISNA 1H10A 1U5DA 1BTNA 1TQZA 2K49A 1X1FA 2GJYA 1MK9B 2CAYA 1U29A 2NBVA 2D11A 2RRFA 1Y5OA 1FHOA 2P8VA 3PP2A 2N23A 3TFMA 5I2MA 2D2QA 3RCPA 1W1HA 1M7EA 2D9YA 4DX90 2MFQA 1X86A 1XCGA 3CIKA 1XD4A 2ROVA 4HB3B 1DDVA 4HAWB 3AU4A 3DCXA 1OMWA 1OY2A 1K5DB 2K8EA 3BJIA 3NW8A 4GPTB 1NTVA 4DBBA 1PMSA 3NWAA 1X11A 2DN6A 3NWFA 1WGQA 3FEHA 4HATB 5D3WA 5HE3A 2GUMA 2V76A 1RRPB 1NI2A 2ELAA 2YS5A 5GOWB 2K2JA 1BWNA 2L1CA 2N0YA 4K81A 2RSGA 2CODA 1ZM0A 2J0JA 1MPHA 1MKEA 2YT1A 3QIJA 1U5FA 2D4QA 3ULCA 5JHGA 4KHOA 2CRFA 3ODXA 2DYQA 4HDOA 4KHBB 4HB4B 4GXBA 4A6KA 4TYZA 4KAXB 2IFSA 4HAYB 2I5FA 3A98B 2VKIA 2DHIA 2KUQA 2Z0PA 3FSSA 3WA0A 3U7DA 1FB8A 5D3YA 4K2PA 2P0HA 3VIAA 3MDBC 4YONA 3SV1A 2D10A 4DIXA
chains in the Genus database with same CATH topology
2GCJA 2K49A 3TW1A 5M4YB 2K8EA 4IOYX 4QXAB 3TO1A 3NW8A 4GOUA 4KHOA 2NBVA 2ZKMX 4D6WA 4OT1A 2Z13A 3A58A 3FVCA 3GYPA 2RRFA 3OHMB 3NWAA 4KHBB 2Z59A 4OSNA 4Z2MB 3NWFA 4L1RA 2R2YA 4PQ0A 4QJ3B 2FJUB 5I2MA 5I2SA 4HSIA 4KHAA 4QJ5B 2KIEA 2Z14A 2GUMA 4GNKB 1ZYIA 4QJ4B 5IRSA 3U12A 2KUQA 2GCLA 2KR0A 3FSSA 4IFSA 4KHBA 3TVVA 3NWDA 2Z4DA 3HIEA 5LG4B 2YT2A 2KIGA 4Z2NA 4DIXA 4CSQA 3GYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXA B; 
#chains in the Genus database with same CATH topology
 3AJ4 A;  2RLO A;  3TO1 A;  3DXD A;  2J0K A;  3D8E A;  2MWN B;  5D3X A;  4L1R A;  2DYN A;  1FHX A;  2DHK A;  3PG7 A;  2W2X D;  4GMV A;  4HSI A;  2KIE A;  2BCJ A;  5DI9 B;  5DH9 B;  4F7U P;  1GC7 A;  3IVF A;  1UNP A;  4Z2N A;  2Z0O A;  3GYO A;  1EVH A;  3KSY A;  2QKL A;  3HK0 A;  2DFK A;  2I5C A;  5J3T A;  3FM8 C;  1WG7 A;  2EJ8 A;  1WI1 A;  4A6F A;  4EKU A;  1XOD A;  1FHW A;  2K00 A;  2VSZ A;  2H7D A;  5HE2 A;  2GCL A;  2KUP A;  5C16 A;  1AWE A;  3LJU X;  1E5W A;  2UVM A;  1T77 A;  1V5M A;  3TW1 A;  4F7G A;  4CYE A;  1X1G A;  4OT1 A;  1GC6 A;  2Z13 A;  3A58 A;  3SO6 A;  3HSA A;  4HAU B;  1Q67 A;  4PQ0 A;  3ODW A;  4QJ3 B;  1AQC A;  4CHM A;  1LB1 A;  2R09 A;  1WJM A;  2LUL A;  3HQC A;  4ZRJ A;  2QKM A;  2LOZ A;  3SYX A;  1UPR A;  2YS3 A;  3X23 A;  5LON B;  1FOE A;  1WJ1 A;  1Z87 A;  3DXE A;  2HTH B;  2JP2 A;  2VRW B;  3OAN A;  4MT7 A;  3FVC A;  2Y8F A;  1V5U A;  2M14 A;  1U27 A;  3PSC A;  1FGZ A;  2EMS A;  1BAK A;  1KI1 B;  4QJ4 B;  5C5B B;  3P7Z A;  4KHB A;  2LG1 A;  4P7I A;  4BBK A;  1QC6 A;  1MK7 B;  2IYB A;  2OTX A;  4XWX A;  4F7H A;  2HE7 A;  5C79 A;  4CSQ A;  5LG4 B;  2DX5 A;  3MPX A;  4NSW A;  1ZSQ A;  3ML4 A;  1V61 A;  5LOP B;  5KCV A;  3QWM A;  3V5W A;  2Z59 A;  5JLJ B;  4Z2M B;  2I1J A;  4B6H A;  2R0D A;  2W2W A;  2Z0Q A;  4WJ7 A;  3NSU A;  1XX0 A;  1NTY A;  5FI0 A;  3ZDT A;  2DTC A;  2AEH A;  3NWD A;  5D27 A;  2EMT A;  2W2X C;  3N7C A;  5HE1 A;  2DKP A;  1UNR A;  5JP4 A;  1U5G A;  1J0W A;  4CHJ A;  5DHF B;  1NU2 A;  1H4R A;  2COC A;  5J3Y A;  1SHC A;  2ZPY A;  3TCA A;  1PFJ A;  2CY5 A;  3O96 A;  4GN1 A;  2RUK B;  5KQ4 A;  4A5K A;  2OQB A;  5FI1 A;  1BTK A;  3PVL A;  3ZVR A;  2KCJ A;  1RJ2 A;  1Y19 B;  2RGN B;  5KQ1 A;  1UNQ A;  2LYD A;  1U5E A;  4HHV A;  1V89 A;  4DXA B;  4HB0 B;  1DDM A;  1V5P A;  1DBH A;  2D9X A;  5JHH A;  4D6W A;  2M38 A;  3PZD A;  4OSN A;  2LKO A;  3F0W A;  5D3V A;  5J3Q A;  2Y7B A;  1KZ7 A;  5I2S A;  1B55 A;  1X05 A;  2P0F A;  4QJ5 B;  1W1G A;  3CXB B;  2MKR A;  3WYF B;  3D8D A;  1EAZ A;  2KR0 A;  3BIN A;  2COF A;  4L6E A;  1TXD A;  5DIF B;  1SGH A;  2PZ1 A;  2YRY A;  3QBV B;  3U8Z A;  4MK0 A;  4Y94 A;  5M4Y B;  3VOQ A;  4GMX B;  4QXA B;  1K5G B;  2ELB A;  1W1D A;  4GOU A;  1MIX A;  1LW3 A;  2D9V A;  3GYP A;  3A8P A;  5HE0 A;  4HDQ A;  1J19 A;  2FJL A;  1KZG A;  3A8Q A;  1DRO A;  5DHA B;  2Z14 A;  2YS1 A;  2H7E A;  4GZU A;  3M1I B;  2Q13 A;  2KIG A;  4NY0 A;  2I1K A;  1EGX A;  2AL6 A;  1OQN A;  1V88 A;  5CLQ B;  4C0A A;  3G9W A;  1I2H A;  1EF1 A;  1U2B A;  3KRW A;  2COA A;  2YT0 A;  2ZKM X;  4ZRI A;  3F5R A;  2NZ8 B;  4HB2 B;  4K17 A;  2R2Y A;  2MDX A;  4EJN A;  5C6R A;  5L81 A;  1PLS A;  2LOX A;  2YSZ A;  3U12 A;  2UZS A;  3SUZ A;  3PVW A;  3PEG A;  2XQN M;  2Y8G A;  1UPQ A;  2ADZ A;  2DHJ A;  1IRS A;  1MIZ B;  2GCJ A;  3T06 A;  4H8S A;  2ROZ B;  3B77 A;  1FAO A;  3UZT A;  1MI1 A;  2DX1 A;  3ODO A;  4IAP A;  4K2O A;  4GNK B;  3P6A A;  2G35 A;  4A6H A;  4YL8 A;  2D9W A;  4KVG B;  2RVB B;  3KZ1 A;  2YF0 A;  5C5B A;  2K2U A;  1XKE A;  2L2I A;  2E2X A;  4DX8 A;  1ZYI A;  5IRS A;  2D9Z A;  4WVF B;  4IFS A;  1ZC4 B;  3SNH A;  3AU5 A;  3PVU A;  1MAI A;  3ULB A;  2J59 M;  2KGX B;  4IOY X;  2RNR B;  4HAV B;  2DLW A;  2DA0 A;  4EMO A;  3D8F A;  1TJ6 A;  1UEF A;  2NMB A;  1WGU A;  4A6F B;  5CLL B;  5EFX A;  2FJU B;  2CY4 A;  1XR0 B;  1N3H A;  1M7R A;  2X18 A;  3TVV A;  4WSF A;  3HIE A;  1P6S A;  2YT2 A;  1DYN A;  1GG3 A;  3KRX A;  4PNK A;  1DDW A;  1QQG A;  1ZVR A;  1P3R A;  2GS0 A;  2UZR A;  3DXC A;  1I7A A;  2EC1 A;  3OHM B;  2P0D A;  4HAZ B;  4MY6 A;  2YVC A;  4ZRK A;  2DKQ A;  3KY9 A;  4KHA A;  3HW2 B;  1ZC3 B;  4HAX B;  1P5T A;  1FGY A;  2Z4D A;  4D0N B;  4TKN A;  1WVH A;  2J0M A;  1ISN A;  1H10 A;  1U5D A;  1BTN A;  1TQZ A;  2K49 A;  1X1F A;  2GJY A;  1MK9 B;  2CAY A;  1U29 A;  2NBV A;  2D11 A;  2RRF A;  1Y5O A;  1FHO A;  2P8V A;  3PP2 A;  2N23 A;  3TFM A;  5I2M A;  2D2Q A;  3RCP A;  1W1H A;  1M7E A;  2D9Y A;  4DX9 0;  2MFQ A;  1X86 A;  1XCG A;  3CIK A;  1XD4 A;  2ROV A;  4HB3 B;  1DDV A;  4HAW B;  3AU4 A;  3DCX A;  1OMW A;  1OY2 A;  1K5D B;  2K8E A;  3BJI A;  3NW8 A;  4GPT B;  1NTV A;  4DBB A;  1PMS A;  3NWA A;  1X11 A;  2DN6 A;  3NWF A;  1WGQ A;  3FEH A;  4HAT B;  5D3W A;  5HE3 A;  2GUM A;  2V76 A;  1RRP B;  1NI2 A;  2ELA A;  2YS5 A;  5GOW B;  2K2J A;  1BWN A;  2L1C A;  2N0Y A;  4K81 A;  2RSG A;  2COD A;  1ZM0 A;  2J0J A;  1MPH A;  1MKE A;  2YT1 A;  3QIJ A;  1U5F A;  2D4Q A;  3ULC A;  5JHG A;  4KHO A;  2CRF A;  3ODX A;  2DYQ A;  4HDO A;  4KHB B;  4HB4 B;  4GXB A;  4A6K A;  4TYZ A;  4KAX B;  2IFS A;  4HAY B;  2I5F A;  3A98 B;  2VKI A;  2DHI A;  2KUQ A;  2Z0P A;  3FSS A;  3WA0 A;  3U7D A;  1FB8 A;  5D3Y A;  4K2P A;  2P0H A;  3VIA A;  3MDB C;  4YON A;  3SV1 A;  2D10 A;  4DIX A; 
#chains in the Genus database with same CATH homology
 2GCJ A;  2K49 A;  3TW1 A;  5M4Y B;  2K8E A;  4IOY X;  4QXA B;  3TO1 A;  3NW8 A;  4GOU A;  4KHO A;  2NBV A;  2ZKM X;  4D6W A;  4OT1 A;  2Z13 A;  3A58 A;  3FVC A;  3GYP A;  2RRF A;  3OHM B;  3NWA A;  4KHB B;  2Z59 A;  4OSN A;  4Z2M B;  3NWF A;  4L1R A;  2R2Y A;  4PQ0 A;  4QJ3 B;  2FJU B;  5I2M A;  5I2S A;  4HSI A;  4KHA A;  4QJ5 B;  2KIE A;  2Z14 A;  2GUM A;  4GNK B;  1ZYI A;  4QJ4 B;  5IRS A;  3U12 A;  2KUQ A;  2GCL A;  2KR0 A;  3FSS A;  4IFS A;  4KHB A;  3TVV A;  3NWD A;  2Z4D A;  3HIE A;  5LG4 B;  2YT2 A;  2KIG A;  4Z2N A;  4DIX A;  4CSQ A;  3GYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...