4QXAB

Crystal structure of the rab9a-rutbc2 rbd complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
147
Chain Sequence
b'ATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVATDYVFRIIYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-9A
publication title Crystal Structure of the Rab9A-RUTBC2 RBD Complex Reveals the Molecular Basis for the Binding Specificity of Rab9A with RUTBC2
doi rcsb
source organism Mus musculus
molecule tags Protein transport/protein binding
total genus 30
structure length 147
sequence length 171
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12068 PH_RBD Rab-binding domain (RBD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.230 Mainly Beta Roll PH-domain like PH-domain like 4qxaB00
4QXAB
chains in the Genus database with same CATH superfamily
1LW3A 4MT7A 5J3YA 2Z13A 2UZSA 1N3HA 1PFJA 4KAXB 1BAKA 2YS1A 3A8PA 3DXEA 1UEFA 2KIEA 2GS0A 2DLWA 2G35A 2Z59A 1SHCA 2J0KA 4WJ7A 1P6SA 1Y5OA 4HB0B 2VKIA 5FI0A 1FB8A 2KCJA 3TVVA 2CY5A 3PG7A 4PQ0A 3TFMA 2YS3A 2HE7A 4YONA 2OQBA 2M38A 5JLJB 1UNPA 2OTXA 4K17A 1X11A 4HAYB 3LJUX 3N7CA 1X05A 3F5RA 3X23A 2DKQA 2DN6A 3PVLA 5D3YA 4PNKA 2KIGA 3QWMA 4MK0A 5D3VA 5LG4B 4BBKA 4HHVA 3HW2B 2P8VA 3BINA 3KSYA 4HB3B 2VRWB 4F7GA 1IRSA 1DYNA 3MPXA 1TQZA 3SUZA 5I2SA 4QJ4B 1FHWA 5C5BB 3KRWA 1AQCA 1J19A 4A5KA 3D8DA 2RLOA 4EJNA 2IFSA 3HSAA 3B77A 1BTKA 1T77A 5J3TA 2W2XD 1V5UA 3ODOA 2YS5A 3P7ZA 4L6EA 2LOZA 2V76A 2YSZA 3WA0A 2H7DA 2LOXA 2Z4DA 5C79A 2IYBA 1X1GA 4KHBB 2DHJA 1X1FA 2D2QA 2GCJA 1KZGA 3PVWA 2I5CA 2K2JA 3KZ1A 2DHIA 2GUMA 4ZRJA 2YT2A 4WSFA 1ISNA 2CY4A 4IOYX 2NMBA 1EAZA 2MKRA 2L1CA 1MAIA 1MIZB 2ZKMX 1NTYA 2I5FA 1OY2A 3NW8A 1NU2A 3OHMB 5DI9B 1W1GA 1MIXA 2Z0OA 5DH9B 4HDQA 1U5EA 2L2IA 1Z87A 2Y8FA 5HE3A 5GOWB 1GC6A 3AU4A 1PMSA 2K2UA 1BWNA 2Y7BA 2QKLA 2Y8GA 5KQ4A 1MK7B 2RSGA 3HK0A 2N23A 2CAYA 2NZ8B 3SYXA 3FVCA 5KCVA 2MWNB 2EMSA 2RGNB 2E2XA 2GJYA 1ZM0A 4F7UP 5I2MA 2COCA 3U8ZA 4CSQA 1QC6A 2XQNM 2ELAA 2X18A 1H10A 3ODXA 3ZVRA 4DX8A 2K49A 4DXAB 5HE2A 2D10A 3PEGA 3O96A 1J0WA 2N0YA 2EMTA 1M7RA 1I2HA 4C0AA 3DXCA 1MK9B 3PVUA 1WI1A 2UVMA 3GYOA 1U29A 3CXBB 2R09A 4ZRIA 4GMVA 2ROVA 4L1RA 1FGZA 4HAZB 1FGYA 2RNRB 2RVBB 3MDBC 3FEHA 3PSCA 1U5DA 1TJ6A 1Y19B 3KY9A 3DCXA 2COFA 4Z2MB 2D9VA 5HE1A 1K5DB 3U7DA 4XWXA 2RUKB 2YF0A 2UZRA 4GZUA 5DHAB 2RRFA 2DX1A 2Z0QA 3NWAA 3ULBA 4CHJA 4Z2NA 3CIKA 3NSUA 1XR0B 4CHMA 3FM8C 2P0HA 4OT1A 4EKUA 1ZC4B 4TKNA 5C16A 3M1IB 2CODA 3RCPA 3SNHA 3U12A 5D3XA 4A6KA 2FJUB 5D27A 2EC1A 2DYNA 5C6RA 2ELBA 2M14A 1RRPB 3VIAA 1MPHA 2KGXB 3VOQA 5CLLB 1XKEA 1LB1A 3QBVB 4HB2B 2R0DA 5C5BA 1E5WA 2DA0A 3F0WA 2J0JA 3TCAA 2ADZA 4GOUA 5FI1A 1V5PA 2LULA 1U27A 1KZ7A 2I1JA 4IFSA 4NY0A 4A6FB 5JHHA 1DDVA 1EGXA 1UNQA 4EMOA 1XD4A 2DTCA 3ODWA 5JP4A 3NWDA 4H8SA 5KQ1A 2DX5A 1XODA 1ZVRA 2KR0A 2Q13A 1UNRA 2YT1A 4HAVB 4P7IA 4D0NB 2KUQA 1V89A 3T06A 1MKEA 4KHBA 3SO6A 5DIFB 1H4RA 5IRSA 3TO1A 1DBHA 2K00A 2COAA 1DROA 3ML4A 2HTHB 4HAUB 4HATB 1RJ2A 5D3WA 2DHKA 4WVFB 2J59M 2VSZA 2H7EA 1NTVA 1BTNA 3A98B 1FAOA 5J3QA 1XCGA 3GYPA 2AL6A 5LONB 5DHFB 3AJ4A 4KHOA 4NSWA 1MI1A 1ZSQA 1W1HA 2YRYA 4GXBA 1AWEA 2LG1A 2DFKA 4GPTB 5L81A 2D9XA 4KHAA 1B55A 3AU5A 1ZYIA 2AEHA 3D8EA 4K2OA 5HE0A 4QJ5B 4DX90 1DDMA 4K2PA 5EFXA 4F7HA 4D6WA 2QKMA 2EJ8A 2GCLA 1K5GB 3OANA 1Q67A 1KI1B 4HSIA 1U5GA 2YVCA 1I7AA 3P6AA 5JHGA 4QJ3B 1FHXA 2MFQA 1UPQA 1TXDA 2LYDA 2P0FA 1WJMA 1EVHA 4QXAB 3A58A 4TYZA 4MY6A 1WGUA 1NI2A 1PLSA 3NWFA 1P5TA 2FJLA 2ROZB 1XX0A 1FOEA 4ZRKA 1EF1A 1WG7A 4A6HA 1ZC3B 3WYFB 2Z0PA 1V5MA 1WGQA 3HQCA 4OSNA 3TW1A 3DXDA 5LOPB 4DBBA 5M4YB 1WJ1A 2D11A 3ZDTA 4HB4B 1V88A 4YL8A 2D9ZA 1FHOA 1M7EA 4GN1A 2JP2A 3D8FA 1X86A 2KUPA 4Y94A 3SV1A 2P0DA 2CRFA 3UZTA 3HIEA 2ZPYA 2W2WA 3FSSA 4HAXB 1DDWA 4IAPA 1U5FA 4CYEA 2PZ1A 2DKPA 3A8QA 1OMWA 1P3RA 4HAWB 4GMXB 4B6HA 1SGHA 2NBVA 3IVFA 3KRXA 3G9WA 3PP2A 2LKOA 2BCJA 4K81A 2D9WA 2J0MA 3V5WA 1GC7A 3QIJA 3ULCA 2W2XC 3PZDA 2D9YA 1W1DA 1QQGA 2YT0A 5CLQB 4DIXA 1OQNA 2K8EA 1GG3A 1WVHA 4A6FA 4KVGB 1UPRA 4HDOA 2MDXA 2R2YA 2D4QA 1V61A 4GNKB 2I1KA 2Z14A 3BJIA 1U2BA 2DYQA
chains in the Genus database with same CATH topology
4KHBA 2K49A 2GUMA 4KHOA 2Z13A 3NWFA 4Z2MB 3TO1A 5IRSA 2GCLA 2YT2A 3U12A 4GOUA 4IOYX 2FJUB 4IFSA 3HIEA 3GYOA 4HSIA 2ZKMX 2KIEA 2RRFA 3FVCA 4OSNA 4DIXA 3TW1A 3NWAA 4QJ3B 2K8EA 2Z59A 3FSSA 4KHAA 5I2MA 5M4YB 3NW8A 4CSQA 3OHMB 4Z2NA 5I2SA 2Z4DA 2R2YA 1ZYIA 3NWDA 4QJ4B 4QJ5B 4L1RA 4QXAB 2KIGA 2KR0A 3A58A 4GNKB 4KHBB 4OT1A 4D6WA 3GYPA 2GCJA 2NBVA 2Z14A 3TVVA 4PQ0A 2KUQA 5LG4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXA B; 
#chains in the Genus database with same CATH topology
 1LW3 A;  4MT7 A;  5J3Y A;  2Z13 A;  2UZS A;  1N3H A;  1PFJ A;  4KAX B;  1BAK A;  2YS1 A;  3A8P A;  3DXE A;  1UEF A;  2KIE A;  2GS0 A;  2DLW A;  2G35 A;  2Z59 A;  1SHC A;  2J0K A;  4WJ7 A;  1P6S A;  1Y5O A;  4HB0 B;  2VKI A;  5FI0 A;  1FB8 A;  2KCJ A;  3TVV A;  2CY5 A;  3PG7 A;  4PQ0 A;  3TFM A;  2YS3 A;  2HE7 A;  4YON A;  2OQB A;  2M38 A;  5JLJ B;  1UNP A;  2OTX A;  4K17 A;  1X11 A;  4HAY B;  3LJU X;  3N7C A;  1X05 A;  3F5R A;  3X23 A;  2DKQ A;  2DN6 A;  3PVL A;  5D3Y A;  4PNK A;  2KIG A;  3QWM A;  4MK0 A;  5D3V A;  5LG4 B;  4BBK A;  4HHV A;  3HW2 B;  2P8V A;  3BIN A;  3KSY A;  4HB3 B;  2VRW B;  4F7G A;  1IRS A;  1DYN A;  3MPX A;  1TQZ A;  3SUZ A;  5I2S A;  4QJ4 B;  1FHW A;  5C5B B;  3KRW A;  1AQC A;  1J19 A;  4A5K A;  3D8D A;  2RLO A;  4EJN A;  2IFS A;  3HSA A;  3B77 A;  1BTK A;  1T77 A;  5J3T A;  2W2X D;  1V5U A;  3ODO A;  2YS5 A;  3P7Z A;  4L6E A;  2LOZ A;  2V76 A;  2YSZ A;  3WA0 A;  2H7D A;  2LOX A;  2Z4D A;  5C79 A;  2IYB A;  1X1G A;  4KHB B;  2DHJ A;  1X1F A;  2D2Q A;  2GCJ A;  1KZG A;  3PVW A;  2I5C A;  2K2J A;  3KZ1 A;  2DHI A;  2GUM A;  4ZRJ A;  2YT2 A;  4WSF A;  1ISN A;  2CY4 A;  4IOY X;  2NMB A;  1EAZ A;  2MKR A;  2L1C A;  1MAI A;  1MIZ B;  2ZKM X;  1NTY A;  2I5F A;  1OY2 A;  3NW8 A;  1NU2 A;  3OHM B;  5DI9 B;  1W1G A;  1MIX A;  2Z0O A;  5DH9 B;  4HDQ A;  1U5E A;  2L2I A;  1Z87 A;  2Y8F A;  5HE3 A;  5GOW B;  1GC6 A;  3AU4 A;  1PMS A;  2K2U A;  1BWN A;  2Y7B A;  2QKL A;  2Y8G A;  5KQ4 A;  1MK7 B;  2RSG A;  3HK0 A;  2N23 A;  2CAY A;  2NZ8 B;  3SYX A;  3FVC A;  5KCV A;  2MWN B;  2EMS A;  2RGN B;  2E2X A;  2GJY A;  1ZM0 A;  4F7U P;  5I2M A;  2COC A;  3U8Z A;  4CSQ A;  1QC6 A;  2XQN M;  2ELA A;  2X18 A;  1H10 A;  3ODX A;  3ZVR A;  4DX8 A;  2K49 A;  4DXA B;  5HE2 A;  2D10 A;  3PEG A;  3O96 A;  1J0W A;  2N0Y A;  2EMT A;  1M7R A;  1I2H A;  4C0A A;  3DXC A;  1MK9 B;  3PVU A;  1WI1 A;  2UVM A;  3GYO A;  1U29 A;  3CXB B;  2R09 A;  4ZRI A;  4GMV A;  2ROV A;  4L1R A;  1FGZ A;  4HAZ B;  1FGY A;  2RNR B;  2RVB B;  3MDB C;  3FEH A;  3PSC A;  1U5D A;  1TJ6 A;  1Y19 B;  3KY9 A;  3DCX A;  2COF A;  4Z2M B;  2D9V A;  5HE1 A;  1K5D B;  3U7D A;  4XWX A;  2RUK B;  2YF0 A;  2UZR A;  4GZU A;  5DHA B;  2RRF A;  2DX1 A;  2Z0Q A;  3NWA A;  3ULB A;  4CHJ A;  4Z2N A;  3CIK A;  3NSU A;  1XR0 B;  4CHM A;  3FM8 C;  2P0H A;  4OT1 A;  4EKU A;  1ZC4 B;  4TKN A;  5C16 A;  3M1I B;  2COD A;  3RCP A;  3SNH A;  3U12 A;  5D3X A;  4A6K A;  2FJU B;  5D27 A;  2EC1 A;  2DYN A;  5C6R A;  2ELB A;  2M14 A;  1RRP B;  3VIA A;  1MPH A;  2KGX B;  3VOQ A;  5CLL B;  1XKE A;  1LB1 A;  3QBV B;  4HB2 B;  2R0D A;  5C5B A;  1E5W A;  2DA0 A;  3F0W A;  2J0J A;  3TCA A;  2ADZ A;  4GOU A;  5FI1 A;  1V5P A;  2LUL A;  1U27 A;  1KZ7 A;  2I1J A;  4IFS A;  4NY0 A;  4A6F B;  5JHH A;  1DDV A;  1EGX A;  1UNQ A;  4EMO A;  1XD4 A;  2DTC A;  3ODW A;  5JP4 A;  3NWD A;  4H8S A;  5KQ1 A;  2DX5 A;  1XOD A;  1ZVR A;  2KR0 A;  2Q13 A;  1UNR A;  2YT1 A;  4HAV B;  4P7I A;  4D0N B;  2KUQ A;  1V89 A;  3T06 A;  1MKE A;  4KHB A;  3SO6 A;  5DIF B;  1H4R A;  5IRS A;  3TO1 A;  1DBH A;  2K00 A;  2COA A;  1DRO A;  3ML4 A;  2HTH B;  4HAU B;  4HAT B;  1RJ2 A;  5D3W A;  2DHK A;  4WVF B;  2J59 M;  2VSZ A;  2H7E A;  1NTV A;  1BTN A;  3A98 B;  1FAO A;  5J3Q A;  1XCG A;  3GYP A;  2AL6 A;  5LON B;  5DHF B;  3AJ4 A;  4KHO A;  4NSW A;  1MI1 A;  1ZSQ A;  1W1H A;  2YRY A;  4GXB A;  1AWE A;  2LG1 A;  2DFK A;  4GPT B;  5L81 A;  2D9X A;  4KHA A;  1B55 A;  3AU5 A;  1ZYI A;  2AEH A;  3D8E A;  4K2O A;  5HE0 A;  4QJ5 B;  4DX9 0;  1DDM A;  4K2P A;  5EFX A;  4F7H A;  4D6W A;  2QKM A;  2EJ8 A;  2GCL A;  1K5G B;  3OAN A;  1Q67 A;  1KI1 B;  4HSI A;  1U5G A;  2YVC A;  1I7A A;  3P6A A;  5JHG A;  4QJ3 B;  1FHX A;  2MFQ A;  1UPQ A;  1TXD A;  2LYD A;  2P0F A;  1WJM A;  1EVH A;  4QXA B;  3A58 A;  4TYZ A;  4MY6 A;  1WGU A;  1NI2 A;  1PLS A;  3NWF A;  1P5T A;  2FJL A;  2ROZ B;  1XX0 A;  1FOE A;  4ZRK A;  1EF1 A;  1WG7 A;  4A6H A;  1ZC3 B;  3WYF B;  2Z0P A;  1V5M A;  1WGQ A;  3HQC A;  4OSN A;  3TW1 A;  3DXD A;  5LOP B;  4DBB A;  5M4Y B;  1WJ1 A;  2D11 A;  3ZDT A;  4HB4 B;  1V88 A;  4YL8 A;  2D9Z A;  1FHO A;  1M7E A;  4GN1 A;  2JP2 A;  3D8F A;  1X86 A;  2KUP A;  4Y94 A;  3SV1 A;  2P0D A;  2CRF A;  3UZT A;  3HIE A;  2ZPY A;  2W2W A;  3FSS A;  4HAX B;  1DDW A;  4IAP A;  1U5F A;  4CYE A;  2PZ1 A;  2DKP A;  3A8Q A;  1OMW A;  1P3R A;  4HAW B;  4GMX B;  4B6H A;  1SGH A;  2NBV A;  3IVF A;  3KRX A;  3G9W A;  3PP2 A;  2LKO A;  2BCJ A;  4K81 A;  2D9W A;  2J0M A;  3V5W A;  1GC7 A;  3QIJ A;  3ULC A;  2W2X C;  3PZD A;  2D9Y A;  1W1D A;  1QQG A;  2YT0 A;  5CLQ B;  4DIX A;  1OQN A;  2K8E A;  1GG3 A;  1WVH A;  4A6F A;  4KVG B;  1UPR A;  4HDO A;  2MDX A;  2R2Y A;  2D4Q A;  1V61 A;  4GNK B;  2I1K A;  2Z14 A;  3BJI A;  1U2B A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 4KHB A;  2K49 A;  2GUM A;  4KHO A;  2Z13 A;  3NWF A;  4Z2M B;  3TO1 A;  5IRS A;  2GCL A;  2YT2 A;  3U12 A;  4GOU A;  4IOY X;  2FJU B;  4IFS A;  3HIE A;  3GYO A;  4HSI A;  2ZKM X;  2KIE A;  2RRF A;  3FVC A;  4OSN A;  4DIX A;  3TW1 A;  3NWA A;  4QJ3 B;  2K8E A;  2Z59 A;  3FSS A;  4KHA A;  5I2M A;  5M4Y B;  3NW8 A;  4CSQ A;  3OHM B;  4Z2N A;  5I2S A;  2Z4D A;  2R2Y A;  1ZYI A;  3NWD A;  4QJ4 B;  4QJ5 B;  4L1R A;  4QXA B;  2KIG A;  2KR0 A;  3A58 A;  4GNK B;  4KHB B;  4OT1 A;  4D6W A;  3GYP A;  2GCJ A;  2NBV A;  2Z14 A;  3TVV A;  4PQ0 A;  2KUQ A;  5LG4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...