4QXAB

Crystal structure of the rab9a-rutbc2 rbd complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
147
Chain Sequence
ATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVATDYVFRIIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport/protein binding
molecule keywords Ras-related protein Rab-9A
publication title Crystal Structure of the Rab9A-RUTBC2 RBD Complex Reveals the Molecular Basis for the Binding Specificity of Rab9A with RUTBC2
doi rcsb
source organism Mus musculus
total genus 30
structure length 147
sequence length 171
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12068 PH_RBD Rab-binding domain (RBD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.230 Mainly Beta Roll PH-domain like PH-domain like 4qxaB00
4QXAB
chains in the Genus database with same CATH superfamily
1V5PA 4A6KA 2J0MA 2COAA 3SYXA 2COFA 1DBHA 2UZSA 2LOXA 1UPQA 1MIXA 1KZ7A 3ODOA 1TJ6A 2K49A 5KQ4A 1FGZA 3HK0A 1DDWA 2R2YA 2ELAA 2YT2A 1DYNA 4HATB 3DCXA 1RRPB 3A98B 2L1CA 1WI1A 4L1RA 1WG7A 3AJ4A 5DI9B 4KVGB 3PEGA 2W2WA 3SNHA 3X23A 4F7GA 2QKLA 4D6WA 1FGYA 1X05A 2AL6A 2CAYA 2X18A 3QBVB 3MDBC 1DDMA 3F5RA 5CLQB 2DYQA 1V5MA 2I5CA 1BTKA 3HSAA 5JHHA 2KUPA 3OHMB 1J19A 2YS5A 4C0AA 3G9WA 2UVMA 1MIZB 2LG1A 4EMOA 4KHBB 3UZTA 2COCA 1PFJA 1GC6A 4Z2NA 2EMTA 2GS0A 4ZRIA 2CRFA 4HB0B 5L81A 5DHAB 2UZRA 2J0JA 3CIKA 2RSGA 4HB2B 1V89A 3SUZA 5HE3A 4D0NB 2Q13A 1GC7A 4XWXA 3ULBA 5CLLB 2DKPA 2D4QA 1FAOA 2Y7BA 4CHMA 4P7IA 1MPHA 3GYPA 2DN6A 4F7UP 1U5FA 2W2XC 1TXDA 3NW8A 1U27A 1NI2A 3TCAA 1H10A 3A58A 2P8VA 5FI0A 3KSYA 3RCPA 2D9WA 4A6FB 2Z0QA 2N0YA 1MK7B 1J0WA 1FB8A 2AEHA 1TQZA 2Y8FA 1V61A 5C79A 1B55A 3GYOA 1MKEA 3PP2A 3D8EA 3KZ1A 2FJUB 4PQ0A 2DHJA 1BWNA 1U2BA 4MK0A 4Z2MB 2P0HA 1X1FA 3PVLA 2CODA 4EJNA 2P0FA 1V5UA 4ZRJA 2DA0A 4HDQA 2K2UA 2YS3A 2D11A 2KR0A 2H7DA 1U29A 4A6HA 2YS1A 3HQCA 3B77A 5J3QA 2YT0A 2H7EA 1UEFA 3P7ZA 4Y94A 4YONA 2Z0OA 1E5WA 4L6EA 1EVHA 4K17A 5KQ1A 4CSQA 3ZDTA 1AQCA 2I5FA 1Y19B 5DIFB 5FI1A 1GG3A 2D9XA 2GCLA 4GNKB 3SO6A 3NWFA 4CYEA 4GMXB 2RUKB 1SGHA 2Z59A 4A5KA 1XODA 2Z4DA 1PLSA 5JLJB 2VRWB 1XX0A 4GMVA 1EAZA 2P0DA 3OANA 3O96A 5D3VA 2LYDA 4HAXB 2RLOA 3ML4A 2W2XD 4GN1A 2KCJA 3FEHA 1DDVA 2R0DA 2L2IA 4KAXB 3P6AA 1SHCA 3QIJA 4K81A 4EKUA 1DROA 3CXBB 2GJYA 3ODWA 1W1DA 1LB1A 2DX5A 2LULA 2YSZA 3M1IB 2RVBB 2R09A 1K5DB 1XD4A 1WVHA 4HB3B 3NSUA 2ROZB 1KZGA 2J0KA 4QJ4B 1ZM0A 3FVCA 4OT1A 1OY2A 2M14A 2MKRA 1XR0B 1Q67A 2KUQA 4IOYX 2EMSA 3FM8C 3PZDA 3PG7A 4GPTB 3A8QA 2I1JA 5JHGA 2M38A 4NSWA 4MT7A 5M4YB 1Y5OA 5D3YA 2DTCA 4HAZB 3DXEA 3KRXA 2HE7A 2ZPYA 5HE1A 3WA0A 1WJ1A 1UPRA 1I2HA 2IYBA 2E2XA 3D8FA 1P6SA 3U8ZA 2ZKMX 1W1GA 1NTYA 4TYZA 2NBVA 1P5TA 1OMWA 3A8PA 3BINA 4K2PA 4CHJA 1EF1A 5D3XA 2G35A 5HE0A 1XKEA 2D9VA 5J3TA 2D2QA 5LOPB 4IFSA 1X1GA 4HDOA 3TW1A 4ZRKA 5GOWB 2YVCA 1V88A 4WVFB 3T06A 3AU4A 2ROVA 1KI1B 2IFSA 5D27A 2GUMA 4PNKA 4A6FA 2NMBA 4DXAB 4WSFA 2FJLA 2YRYA 3NWDA 2OQBA 2RRFA 4HB4B 1ZC3B 3PVWA 1MK9B 5LG4B 4DIXA 2QKMA 1LW3A 4HSIA 1K5GB 4KHAA 2J59M 5HE2A 3PVUA 1QC6A 4DX8A 1FOEA 2KIGA 2NZ8B 4DX90 2Z0PA 2D9ZA 5JP4A 1QQGA 1U5DA 1P3RA 3NWAA 4NY0A 3VOQA 4TKNA 5C5BA 2GCJA 5DHFB 1WGUA 2DHKA 5C16A 1N3HA 3TVVA 3HIEA 2BCJA 4HAYB 4DBBA 3BJIA 2MWNB 1M7RA 1OQNA 4HAWB 1WGQA 1XCGA 5J3YA 3DXDA 4YL8A 2PZ1A 2JP2A 2MDXA 3U12A 3KRWA 2D10A 1X86A 2EC1A 2RNRB 1MAIA 2D9YA 1FHWA 2ELBA 1U5EA 2LOZA 1BAKA 2LKOA 1M7EA 1NU2A 1AWEA 4BBKA 4QJ5B 3KY9A 1EGXA 1I7AA 3ULCA 2ADZA 4GXBA 3TFMA 3VIAA 4OSNA 1ISNA 2K2JA 5EFXA 1PMSA 5LONB 3HW2B 2DLWA 2HTHB 2Z14A 3DXCA 4WJ7A 3U7DA 1U5GA 1W1HA 1WJMA 2N23A 1T77A 4IAPA 1FHXA 1Z87A 3AU5A 3IVFA 4KHBA 5IRSA 2V76A 2OTXA 2Z13A 1X11A 3QWMA 3SV1A 5C6RA 4H8SA 4GZUA 1BTNA 3LJUX 4HAUB 1UNPA 2K00A 5I2SA 1ZC4B 2VSZA 4QJ3B 1RJ2A 2DHIA 3WYFB 4GOUA 1ZVRA 3PSCA 2DKQA 2EJ8A 2YF0A 5KCVA 3TO1A 4MY6A 4K2OA 3FSSA 4F7HA 2KGXB 2I1KA 4QXAB 2XQNM 1H4RA 2MFQA 3MPXA 2VKIA 2Y8GA 3ODXA 1NTVA 1UNQA 3F0WA 1FHOA 2DX1A 4HAVB 2RGNB 2DYNA 3D8DA 1UNRA 5I2MA 2DFKA 2K8EA 4B6HA 2CY4A 4KHOA 5D3WA 3ZVRA 1IRSA 1MI1A 5C5BB 3N7CA 5DH9B 1ZSQA 2CY5A 1ZYIA 3V5WA 2KIEA 2YT1A 4HHVA
chains in the Genus database with same CATH topology
4QXAB 2Z59A 3NW8A 3TVVA 2Z4DA 4Z2NA 3HIEA 4Z2MB 4OSNA 3A58A 5IRSA 5I2SA 5M4YB 2KIGA 2GUMA 4D6WA 4QJ3B 2Z14A 4GOUA 3NWAA 3U12A 4QJ4B 2K49A 3FVCA 5I2MA 4CSQA 3NWDA 4OT1A 2K8EA 4IFSA 2R2YA 2YT2A 2RRFA 4KHOA 2KUQA 3OHMB 3TO1A 3TW1A 2ZKMX 2KR0A 4KHBA 5LG4B 4DIXA 4IOYX 3FSSA 3GYOA 2GCLA 2GCJA 4GNKB 3NWFA 4L1RA 1ZYIA 4HSIA 4KHBB 4QJ5B 3GYPA 2NBVA 2FJUB 2KIEA 2Z13A 4KHAA 4PQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXA B; 
#chains in the Genus database with same CATH topology
 1V5P A;  4A6K A;  2J0M A;  2COA A;  3SYX A;  2COF A;  1DBH A;  2UZS A;  2LOX A;  1UPQ A;  1MIX A;  1KZ7 A;  3ODO A;  1TJ6 A;  2K49 A;  5KQ4 A;  1FGZ A;  3HK0 A;  1DDW A;  2R2Y A;  2ELA A;  2YT2 A;  1DYN A;  4HAT B;  3DCX A;  1RRP B;  3A98 B;  2L1C A;  1WI1 A;  4L1R A;  1WG7 A;  3AJ4 A;  5DI9 B;  4KVG B;  3PEG A;  2W2W A;  3SNH A;  3X23 A;  4F7G A;  2QKL A;  4D6W A;  1FGY A;  1X05 A;  2AL6 A;  2CAY A;  2X18 A;  3QBV B;  3MDB C;  1DDM A;  3F5R A;  5CLQ B;  2DYQ A;  1V5M A;  2I5C A;  1BTK A;  3HSA A;  5JHH A;  2KUP A;  3OHM B;  1J19 A;  2YS5 A;  4C0A A;  3G9W A;  2UVM A;  1MIZ B;  2LG1 A;  4EMO A;  4KHB B;  3UZT A;  2COC A;  1PFJ A;  1GC6 A;  4Z2N A;  2EMT A;  2GS0 A;  4ZRI A;  2CRF A;  4HB0 B;  5L81 A;  5DHA B;  2UZR A;  2J0J A;  3CIK A;  2RSG A;  4HB2 B;  1V89 A;  3SUZ A;  5HE3 A;  4D0N B;  2Q13 A;  1GC7 A;  4XWX A;  3ULB A;  5CLL B;  2DKP A;  2D4Q A;  1FAO A;  2Y7B A;  4CHM A;  4P7I A;  1MPH A;  3GYP A;  2DN6 A;  4F7U P;  1U5F A;  2W2X C;  1TXD A;  3NW8 A;  1U27 A;  1NI2 A;  3TCA A;  1H10 A;  3A58 A;  2P8V A;  5FI0 A;  3KSY A;  3RCP A;  2D9W A;  4A6F B;  2Z0Q A;  2N0Y A;  1MK7 B;  1J0W A;  1FB8 A;  2AEH A;  1TQZ A;  2Y8F A;  1V61 A;  5C79 A;  1B55 A;  3GYO A;  1MKE A;  3PP2 A;  3D8E A;  3KZ1 A;  2FJU B;  4PQ0 A;  2DHJ A;  1BWN A;  1U2B A;  4MK0 A;  4Z2M B;  2P0H A;  1X1F A;  3PVL A;  2COD A;  4EJN A;  2P0F A;  1V5U A;  4ZRJ A;  2DA0 A;  4HDQ A;  2K2U A;  2YS3 A;  2D11 A;  2KR0 A;  2H7D A;  1U29 A;  4A6H A;  2YS1 A;  3HQC A;  3B77 A;  5J3Q A;  2YT0 A;  2H7E A;  1UEF A;  3P7Z A;  4Y94 A;  4YON A;  2Z0O A;  1E5W A;  4L6E A;  1EVH A;  4K17 A;  5KQ1 A;  4CSQ A;  3ZDT A;  1AQC A;  2I5F A;  1Y19 B;  5DIF B;  5FI1 A;  1GG3 A;  2D9X A;  2GCL A;  4GNK B;  3SO6 A;  3NWF A;  4CYE A;  4GMX B;  2RUK B;  1SGH A;  2Z59 A;  4A5K A;  1XOD A;  2Z4D A;  1PLS A;  5JLJ B;  2VRW B;  1XX0 A;  4GMV A;  1EAZ A;  2P0D A;  3OAN A;  3O96 A;  5D3V A;  2LYD A;  4HAX B;  2RLO A;  3ML4 A;  2W2X D;  4GN1 A;  2KCJ A;  3FEH A;  1DDV A;  2R0D A;  2L2I A;  4KAX B;  3P6A A;  1SHC A;  3QIJ A;  4K81 A;  4EKU A;  1DRO A;  3CXB B;  2GJY A;  3ODW A;  1W1D A;  1LB1 A;  2DX5 A;  2LUL A;  2YSZ A;  3M1I B;  2RVB B;  2R09 A;  1K5D B;  1XD4 A;  1WVH A;  4HB3 B;  3NSU A;  2ROZ B;  1KZG A;  2J0K A;  4QJ4 B;  1ZM0 A;  3FVC A;  4OT1 A;  1OY2 A;  2M14 A;  2MKR A;  1XR0 B;  1Q67 A;  2KUQ A;  4IOY X;  2EMS A;  3FM8 C;  3PZD A;  3PG7 A;  4GPT B;  3A8Q A;  2I1J A;  5JHG A;  2M38 A;  4NSW A;  4MT7 A;  5M4Y B;  1Y5O A;  5D3Y A;  2DTC A;  4HAZ B;  3DXE A;  3KRX A;  2HE7 A;  2ZPY A;  5HE1 A;  3WA0 A;  1WJ1 A;  1UPR A;  1I2H A;  2IYB A;  2E2X A;  3D8F A;  1P6S A;  3U8Z A;  2ZKM X;  1W1G A;  1NTY A;  4TYZ A;  2NBV A;  1P5T A;  1OMW A;  3A8P A;  3BIN A;  4K2P A;  4CHJ A;  1EF1 A;  5D3X A;  2G35 A;  5HE0 A;  1XKE A;  2D9V A;  5J3T A;  2D2Q A;  5LOP B;  4IFS A;  1X1G A;  4HDO A;  3TW1 A;  4ZRK A;  5GOW B;  2YVC A;  1V88 A;  4WVF B;  3T06 A;  3AU4 A;  2ROV A;  1KI1 B;  2IFS A;  5D27 A;  2GUM A;  4PNK A;  4A6F A;  2NMB A;  4DXA B;  4WSF A;  2FJL A;  2YRY A;  3NWD A;  2OQB A;  2RRF A;  4HB4 B;  1ZC3 B;  3PVW A;  1MK9 B;  5LG4 B;  4DIX A;  2QKM A;  1LW3 A;  4HSI A;  1K5G B;  4KHA A;  2J59 M;  5HE2 A;  3PVU A;  1QC6 A;  4DX8 A;  1FOE A;  2KIG A;  2NZ8 B;  4DX9 0;  2Z0P A;  2D9Z A;  5JP4 A;  1QQG A;  1U5D A;  1P3R A;  3NWA A;  4NY0 A;  3VOQ A;  4TKN A;  5C5B A;  2GCJ A;  5DHF B;  1WGU A;  2DHK A;  5C16 A;  1N3H A;  3TVV A;  3HIE A;  2BCJ A;  4HAY B;  4DBB A;  3BJI A;  2MWN B;  1M7R A;  1OQN A;  4HAW B;  1WGQ A;  1XCG A;  5J3Y A;  3DXD A;  4YL8 A;  2PZ1 A;  2JP2 A;  2MDX A;  3U12 A;  3KRW A;  2D10 A;  1X86 A;  2EC1 A;  2RNR B;  1MAI A;  2D9Y A;  1FHW A;  2ELB A;  1U5E A;  2LOZ A;  1BAK A;  2LKO A;  1M7E A;  1NU2 A;  1AWE A;  4BBK A;  4QJ5 B;  3KY9 A;  1EGX A;  1I7A A;  3ULC A;  2ADZ A;  4GXB A;  3TFM A;  3VIA A;  4OSN A;  1ISN A;  2K2J A;  5EFX A;  1PMS A;  5LON B;  3HW2 B;  2DLW A;  2HTH B;  2Z14 A;  3DXC A;  4WJ7 A;  3U7D A;  1U5G A;  1W1H A;  1WJM A;  2N23 A;  1T77 A;  4IAP A;  1FHX A;  1Z87 A;  3AU5 A;  3IVF A;  4KHB A;  5IRS A;  2V76 A;  2OTX A;  2Z13 A;  1X11 A;  3QWM A;  3SV1 A;  5C6R A;  4H8S A;  4GZU A;  1BTN A;  3LJU X;  4HAU B;  1UNP A;  2K00 A;  5I2S A;  1ZC4 B;  2VSZ A;  4QJ3 B;  1RJ2 A;  2DHI A;  3WYF B;  4GOU A;  1ZVR A;  3PSC A;  2DKQ A;  2EJ8 A;  2YF0 A;  5KCV A;  3TO1 A;  4MY6 A;  4K2O A;  3FSS A;  4F7H A;  2KGX B;  2I1K A;  4QXA B;  2XQN M;  1H4R A;  2MFQ A;  3MPX A;  2VKI A;  2Y8G A;  3ODX A;  1NTV A;  1UNQ A;  3F0W A;  1FHO A;  2DX1 A;  4HAV B;  2RGN B;  2DYN A;  3D8D A;  1UNR A;  5I2M A;  2DFK A;  2K8E A;  4B6H A;  2CY4 A;  4KHO A;  5D3W A;  3ZVR A;  1IRS A;  1MI1 A;  5C5B B;  3N7C A;  5DH9 B;  1ZSQ A;  2CY5 A;  1ZYI A;  3V5W A;  2KIE A;  2YT1 A;  4HHV A; 
#chains in the Genus database with same CATH homology
 4QXA B;  2Z59 A;  3NW8 A;  3TVV A;  2Z4D A;  4Z2N A;  3HIE A;  4Z2M B;  4OSN A;  3A58 A;  5IRS A;  5I2S A;  5M4Y B;  2KIG A;  2GUM A;  4D6W A;  4QJ3 B;  2Z14 A;  4GOU A;  3NWA A;  3U12 A;  4QJ4 B;  2K49 A;  3FVC A;  5I2M A;  4CSQ A;  3NWD A;  4OT1 A;  2K8E A;  4IFS A;  2R2Y A;  2YT2 A;  2RRF A;  4KHO A;  2KUQ A;  3OHM B;  3TO1 A;  3TW1 A;  2ZKM X;  2KR0 A;  4KHB A;  5LG4 B;  4DIX A;  4IOY X;  3FSS A;  3GYO A;  2GCL A;  2GCJ A;  4GNK B;  3NWF A;  4L1R A;  1ZYI A;  4HSI A;  4KHB B;  4QJ5 B;  3GYP A;  2NBV A;  2FJU B;  2KIE A;  2Z13 A;  4KHA A;  4PQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...