3DXDA

Crystal structure of the intracellular domain of human app (t668e mutant) in complex with fe65-ptb2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
b'NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein-binding family B member 1
publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 37
structure length 131
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxdA00
4HAUB 3TW1A 1FAOA 3VIAA 4D0NB 2Z0QA 3CIKA 1B55A 3DXDA 2VRWB 4IAPA 3D8DA 1EF1A 1WJ1A 2LYDA 4EMOA 2CAYA 1EAZA 1P3RA 1MIXA 1UNQA 1UNPA 1WI1A 2GCLA 4GPTB 1I2HA 1NU2A 2CODA 1EVHA 2ADZA 3MDBC 3GYPA 3TCAA 1XCGA 5FI1A 2GJYA 1WVHA 2YT0A 5D3YA 1J0WA 2MDXA 3F0WA 2DHIA 2Y8GA 3ODXA 5GOWB 2E2XA 2YSZA 1MPHA 2DX5A 4HHVA 1XODA 2COFA 2EC1A 2YT1A 2KGXB 1PFJA 5C79A 2ELAA 2D9ZA 2GCJA 3X23A 2RSGA 4YONA 5J3YA 5HE1A 1PMSA 1BWNA 2DKPA 1ZM0A 1XKEA 2I1JA 2MKRA 3PP2A 4CHMA 2UZRA 1E5WA 3FM8C 4L6EA 2D9YA 5DH9B 3U8ZA 3P6AA 3ZDTA 3PVUA 5D3VA 3A8QA 2KCJA 3WA0A 2BCJA 1UEFA 5L81A 5DI9B 3BINA 2R09A 2DN6A 2IFSA 5HE0A 1LB1A 4HDOA 3DXEA 2YS3A 1NTVA 3HW2B 2I1KA 4HAWB 3V5WA 1MK9B 3BJIA 2OTXA 2Y8FA 3RCPA 1PLSA 1QQGA 4HB3B 4C0AA 3NSUA 4A6FB 1X1GA 4KVGB 2MFQA 4HB4B 4HAYB 1FHOA 1NTYA 1SGHA 3FSSA 3T06A 1OMWA 1P6SA 1U27A 3PSCA 2EMSA 3TVVA 1H4RA 2AEHA 4NY0A 3P7ZA 2ROZB 1V5PA 1DDMA 1TJ6A 3GYOA 2UVMA 3HQCA 5JLJB 1XX0A 3D8FA 5DHFB 2DYQA 2DLWA 4K81A 1LW3A 1U5GA 4ZRKA 5C5BB 1U29A 1ZSQA 5J3TA 5FI0A 1FGYA 2RUKB 2LKOA 4YL8A 1XD4A 3D8EA 2L1CA 1UNRA 1V88A 2OQBA 2ZPYA 1OY2A 4HB0B 4WVFB 1DBHA 3ML4A 1X05A 4Y94A 1ZC4B 1MAIA 4MT7A 1V5MA 1V5UA 1GC7A 2VKIA 1DROA 5C6RA 2K2UA 5J3QA 3PVWA 3F5RA 3SO6A 5LONB 2LOZA 2FJLA 2P0HA 1U5FA 3AJ4A 1BTNA 4MY6A 1DDVA 2DHJA 2P8VA 1U2BA 2D9XA 2COCA 2COAA 3SUZA 4A6KA 5KCVA 3CXBB 4MK0A 1FHXA 1X11A 2Y7BA 2DFKA 3M1IB 1NI2A 1U5DA 2H7EA 2DKQA 2EJ8A 1X1FA 1M7RA 2EMTA 4GMXB 4K17A 2KUPA 5DHAB 3KZ1A 5LOPB 2LOXA 2H7DA 4CHJA 1IRSA 1BAKA 3SNHA 5JHHA 4HAVB 2YS1A 3KY9A 1N3HA 1Z87A 1RRPB 2RLOA 5D27A 5DIFB 1X86A 5KQ4A 4IFSA 1FB8A 2N0YA 5CLQB 1GC6A 2QKLA 5HE3A 4K2OA 2D10A 5EFXA 2ELBA 1OQNA 2PZ1A 4XWXA 2RVBB 4ZRJA 4A5KA 4PNKA 4K2PA 2RGNB 4GMVA 2D2QA 3O96A 2DYNA 3SV1A 2UZSA 5JHGA 4ZRIA 5D3WA 1WG7A 3KSYA 4KHAA 4A6FA 2G35A 1FGZA 4DBBA 3SYXA 1WJMA 4EKUA 2YS5A 4IOYX 1J19A 2DX1A 5CLLB 1M7EA 2RNRB 3KRWA 2P0DA 3ODOA 1WGQA 1QC6A 2N23A 3PEGA 2K2JA 1V89A 2V76A 3LJUX 2D9WA 5HE2A 1KI1B 1Y19B 4HB2B 4A6HA 2J59M 2R0DA 5C5BA 1K5GB 1W1DA 2LULA 1BTKA 4BBKA 1RJ2A 1V61A 4WSFA 3A8PA 1Y5OA 1ISNA 3PG7A 1ZC3B 1XR0B 4HAXB 1MK7B 2P0FA 2ROVA 3OANA 2I5CA 2XQNM 3DXCA 2YRYA 2I5FA 2Z0OA 2HTHB 1FHWA 4KHOA 1W1GA 4B6HA 4KAXB 3ZVRA 4GN1A 2DTCA 2J0MA 3VOQA 1W1HA 3QIJA 2NMBA 3WYFB 2JP2A 3PVLA 4DXAB 1I7AA 1ZVRA 1TQZA 4TYZA 2AL6A 2M38A 4DX8A 1TXDA 2YVCA 3MPXA 3QBVB 3KRXA 2VSZA 2D9VA 1KZGA 3QWMA 1FOEA 5KQ1A 2X18A 2LG1A 4WJ7A 1MIZB 4KHBB 3AU5A 4H8SA 2IYBA 1MKEA 2Z0PA 3N7CA 3A98B 1KZ7A 1SHCA 4EJNA 4Z2NA 3U7DA 5C16A 4F7UP 2D4QA 4GXBA 4TKNA 2CY4A 2NZ8B 1DYNA 3TO1A 2D11A 4GZUA 1Q67A 3ODWA 2W2XC 2J0JA 1WGUA 2CY5A 4HDQA 2W2WA 5JP4A 1U5EA 4HAZB 2HE7A 2YF0A 4NSWA 2W2XD 4CYEA 3HK0A 1AWEA 3TFMA 4PQ0A 2DA0A 2DHKA 2L2IA 2CRFA 1P5TA 3PZDA 3ULCA 1UPRA 4HATB 4DX90 3ULBA 1EGXA 1K5DB 1H10A 3AU4A 4F7HA 2QKMA 2Q13A 2GS0A 1DDWA 3FEHA 2J0KA 2M14A 4Z2MB 3G9WA 1GG3A 5D3XA 2K00A 4P7IA 2MWNB 1AQCA 3IVFA 4F7GA 3UZTA 1UPQA
chains in the Genus database with same CATH superfamily
4HAUB 3TW1A 1FAOA 3VIAA 5IRSA 4D0NB 2Z0QA 3CIKA 1B55A 3DXDA 2VRWB 4IAPA 3D8DA 1EF1A 1WJ1A 2LYDA 4EMOA 2CAYA 1EAZA 1P3RA 1MIXA 1UNQA 1UNPA 1WI1A 2GCLA 4GPTB 1I2HA 3HIEA 1NU2A 2CODA 1EVHA 2RRFA 2ADZA 3MDBC 1ZYIA 3GYPA 3TCAA 1XCGA 5FI1A 2GJYA 1WVHA 2YT0A 5D3YA 1J0WA 3OHMB 2MDXA 3F0WA 3NWDA 2DHIA 5I2MA 2Y8GA 3ODXA 5GOWB 2E2XA 2YSZA 1MPHA 2DX5A 4HHVA 1XODA 2COFA 2EC1A 2YT1A 2KGXB 1PFJA 5C79A 2ELAA 2D9ZA 2GCJA 3X23A 2RSGA 4YONA 5J3YA 5HE1A 1PMSA 1MI1A 1BWNA 2DKPA 1ZM0A 1XKEA 2I1JA 2MKRA 3PP2A 4CHMA 2UZRA 1E5WA 3FM8C 4L6EA 2D9YA 5DH9B 3U8ZA 2ZKMX 2K49A 5I2SA 3P6AA 3ZDTA 3PVUA 5D3VA 3A8QA 2KCJA 3WA0A 2BCJA 1UEFA 5L81A 5DI9B 3BINA 2R09A 2DN6A 2IFSA 5HE0A 1LB1A 4HDOA 3DXEA 2YS3A 1NTVA 3HW2B 2I1KA 4HAWB 3V5WA 1MK9B 3BJIA 4KHBA 2OTXA 2KIGA 2Y8FA 3RCPA 1PLSA 1QQGA 4HB3B 4C0AA 3NSUA 4A6FB 1X1GA 4KVGB 2MFQA 4HB4B 4HAYB 1FHOA 1NTYA 1SGHA 3FSSA 3T06A 1OMWA 1P6SA 1U27A 3PSCA 2EMSA 3TVVA 1H4RA 2AEHA 4NY0A 3P7ZA 2ROZB 1V5PA 1DDMA 4CSQA 1TJ6A 3GYOA 2UVMA 3HQCA 5JLJB 1XX0A 3D8FA 5DHFB 2R2YA 2DYQA 2DLWA 4K81A 1LW3A 1U5GA 4ZRKA 5C5BB 1U29A 4QJ5B 1ZSQA 5J3TA 5FI0A 1FGYA 2RUKB 2LKOA 3NW8A 4YL8A 1XD4A 3D8EA 2L1CA 1UNRA 1V88A 2OQBA 2ZPYA 1OY2A 4HB0B 4WVFB 1DBHA 4L1RA 3ML4A 1X05A 2KUQA 4D6WA 4Y94A 1ZC4B 1MAIA 4MT7A 1T77A 1V5MA 1V5UA 1GC7A 2VKIA 1DROA 2YT2A 5C6RA 2K2UA 5J3QA 3PVWA 3F5RA 3SO6A 5LONB 2LOZA 2FJLA 2P0HA 1U5FA 3AJ4A 1BTNA 4MY6A 2Z4DA 1DDVA 4QXAB 2DHJA 2P8VA 1U2BA 2D9XA 2COCA 2COAA 2Z14A 3SUZA 4A6KA 2FJUB 5KCVA 3CXBB 4MK0A 1FHXA 1X11A 2Y7BA 3HSAA 2KR0A 2NBVA 2DFKA 3M1IB 1NI2A 3U12A 1U5DA 2H7EA 2DKQA 2EJ8A 1X1FA 1M7RA 2EMTA 4GMXB 4K17A 2KUPA 5DHAB 3KZ1A 2K8EA 5LOPB 2GUMA 2LOXA 2H7DA 4CHJA 1IRSA 1BAKA 3SNHA 5JHHA 4HAVB 2YS1A 3KY9A 1N3HA 1Z87A 1RRPB 2RLOA 5D27A 5DIFB 1X86A 5KQ4A 4IFSA 1FB8A 2N0YA 5CLQB 1GC6A 2QKLA 5HE3A 4K2OA 2D10A 5EFXA 2ELBA 1OQNA 2PZ1A 4XWXA 2RVBB 4OT1A 4ZRJA 4A5KA 3B77A 4PNKA 4K2PA 2RGNB 4GMVA 2D2QA 3O96A 2DYNA 3SV1A 2UZSA 5JHGA 4ZRIA 5D3WA 1WG7A 3KSYA 4KHAA 4A6FA 3FVCA 2G35A 1FGZA 4DBBA 3SYXA 1WJMA 4EKUA 2YS5A 4IOYX 1J19A 2DX1A 5CLLB 1M7EA 2RNRB 3KRWA 2P0DA 3ODOA 1WGQA 1QC6A 2N23A 3PEGA 4OSNA 4QJ3B 2K2JA 5M4YB 1V89A 2V76A 3LJUX 2D9WA 5HE2A 1KI1B 1Y19B 4HB2B 4A6HA 2J59M 2R0DA 5C5BA 1K5GB 1W1DA 2LULA 1BTKA 4BBKA 1RJ2A 1V61A 4WSFA 3A8PA 1Y5OA 1ISNA 3PG7A 1ZC3B 1XR0B 4HAXB 1MK7B 2P0FA 2ROVA 5LG4B 3OANA 2I5CA 2XQNM 3DXCA 2YRYA 2I5FA 2Z0OA 2HTHB 1FHWA 4KHOA 1W1GA 4B6HA 2Z59A 4KAXB 3ZVRA 4GN1A 2DTCA 2J0MA 3VOQA 1W1HA 3QIJA 2NMBA 3WYFB 2JP2A 2Z13A 3PVLA 4DXAB 1I7AA 1ZVRA 1TQZA 4TYZA 2AL6A 2M38A 4DX8A 1TXDA 2YVCA 3MPXA 3QBVB 3KRXA 2VSZA 2D9VA 1KZGA 3QWMA 1FOEA 5KQ1A 2X18A 2LG1A 4WJ7A 1MIZB 4KHBB 3AU5A 4H8SA 2IYBA 1MKEA 2Z0PA 2KIEA 3N7CA 3A98B 1KZ7A 1SHCA 4EJNA 4Z2NA 3U7DA 5C16A 4F7UP 2D4QA 4GNKB 4GXBA 4TKNA 2CY4A 2NZ8B 1DYNA 3TO1A 2D11A 4GZUA 1Q67A 3ODWA 2W2XC 2J0JA 1WGUA 4QJ4B 4HSIA 2CY5A 4HDQA 2W2WA 5JP4A 1U5EA 4HAZB 2HE7A 2YF0A 4NSWA 2W2XD 4CYEA 3HK0A 1AWEA 4GOUA 3TFMA 3A58A 4PQ0A 4DIXA 2DA0A 2DHKA 2L2IA 2CRFA 3NWAA 1P5TA 3PZDA 3ULCA 1UPRA 4HATB 4DX90 3ULBA 1EGXA 1K5DB 1H10A 3AU4A 3NWFA 4F7HA 2QKMA 2Q13A 2GS0A 1DDWA 3FEHA 2J0KA 2M14A 4Z2MB 3G9WA 1GG3A 5D3XA 2K00A 4P7IA 3DCXA 2MWNB 1AQCA 3IVFA 4F7GA 3UZTA 1UPQA
chains in the Genus database with same CATH topology
4HAUB 3TW1A 1FAOA 3VIAA 4D0NB 2Z0QA 3CIKA 1B55A 3DXDA 2VRWB 4IAPA 3D8DA 1EF1A 1WJ1A 2LYDA 4EMOA 2CAYA 1EAZA 1P3RA 1MIXA 1UNQA 1UNPA 1WI1A 2GCLA 4GPTB 1I2HA 1NU2A 2CODA 1EVHA 2ADZA 3MDBC 3GYPA 3TCAA 1XCGA 5FI1A 2GJYA 1WVHA 2YT0A 5D3YA 1J0WA 2MDXA 3F0WA 2DHIA 2Y8GA 3ODXA 5GOWB 2E2XA 2YSZA 1MPHA 2DX5A 4HHVA 1XODA 2COFA 2EC1A 2YT1A 2KGXB 1PFJA 5C79A 2ELAA 2D9ZA 2GCJA 3X23A 2RSGA 4YONA 5J3YA 5HE1A 1PMSA 1BWNA 2DKPA 1ZM0A 1XKEA 2I1JA 2MKRA 3PP2A 4CHMA 2UZRA 1E5WA 3FM8C 4L6EA 2D9YA 5DH9B 3U8ZA 3P6AA 3ZDTA 3PVUA 5D3VA 3A8QA 2KCJA 3WA0A 2BCJA 1UEFA 5L81A 5DI9B 3BINA 2R09A 2DN6A 2IFSA 5HE0A 1LB1A 4HDOA 3DXEA 2YS3A 1NTVA 3HW2B 2I1KA 4HAWB 3V5WA 1MK9B 3BJIA 2OTXA 2Y8FA 3RCPA 1PLSA 1QQGA 4HB3B 4C0AA 3NSUA 4A6FB 1X1GA 4KVGB 2MFQA 4HB4B 4HAYB 1FHOA 1NTYA 1SGHA 3FSSA 3T06A 1OMWA 1P6SA 1U27A 3PSCA 2EMSA 3TVVA 1H4RA 2AEHA 4NY0A 3P7ZA 2ROZB 1V5PA 1DDMA 1TJ6A 3GYOA 2UVMA 3HQCA 5JLJB 1XX0A 3D8FA 5DHFB 2DYQA 2DLWA 4K81A 1LW3A 1U5GA 4ZRKA 5C5BB 1U29A 1ZSQA 5J3TA 5FI0A 1FGYA 2RUKB 2LKOA 4YL8A 1XD4A 3D8EA 2L1CA 1UNRA 1V88A 2OQBA 2ZPYA 1OY2A 4HB0B 4WVFB 1DBHA 3ML4A 1X05A 4Y94A 1ZC4B 1MAIA 4MT7A 1V5MA 1V5UA 1GC7A 2VKIA 1DROA 5C6RA 2K2UA 5J3QA 3PVWA 3F5RA 3SO6A 5LONB 2LOZA 2FJLA 2P0HA 1U5FA 3AJ4A 1BTNA 4MY6A 1DDVA 2DHJA 2P8VA 1U2BA 2D9XA 2COCA 2COAA 3SUZA 4A6KA 5KCVA 3CXBB 4MK0A 1FHXA 1X11A 2Y7BA 2DFKA 3M1IB 1NI2A 1U5DA 2H7EA 2DKQA 2EJ8A 1X1FA 1M7RA 2EMTA 4GMXB 4K17A 2KUPA 5DHAB 3KZ1A 5LOPB 2LOXA 2H7DA 4CHJA 1IRSA 1BAKA 3SNHA 5JHHA 4HAVB 2YS1A 3KY9A 1N3HA 1Z87A 1RRPB 2RLOA 5D27A 5DIFB 1X86A 5KQ4A 4IFSA 1FB8A 2N0YA 5CLQB 1GC6A 2QKLA 5HE3A 4K2OA 2D10A 5EFXA 2ELBA 1OQNA 2PZ1A 4XWXA 2RVBB 4ZRJA 4A5KA 4PNKA 4K2PA 2RGNB 4GMVA 2D2QA 3O96A 2DYNA 3SV1A 2UZSA 5JHGA 4ZRIA 5D3WA 1WG7A 3KSYA 4KHAA 4A6FA 2G35A 1FGZA 4DBBA 3SYXA 1WJMA 4EKUA 2YS5A 4IOYX 1J19A 2DX1A 5CLLB 1M7EA 2RNRB 3KRWA 2P0DA 3ODOA 1WGQA 1QC6A 2N23A 3PEGA 2K2JA 1V89A 2V76A 3LJUX 2D9WA 5HE2A 1KI1B 1Y19B 4HB2B 4A6HA 2J59M 2R0DA 5C5BA 1K5GB 1W1DA 2LULA 1BTKA 4BBKA 1RJ2A 1V61A 4WSFA 3A8PA 1Y5OA 1ISNA 3PG7A 1ZC3B 1XR0B 4HAXB 1MK7B 2P0FA 2ROVA 3OANA 2I5CA 2XQNM 3DXCA 2YRYA 2I5FA 2Z0OA 2HTHB 1FHWA 4KHOA 1W1GA 4B6HA 4KAXB 3ZVRA 4GN1A 2DTCA 2J0MA 3VOQA 1W1HA 3QIJA 2NMBA 3WYFB 2JP2A 3PVLA 4DXAB 1I7AA 1ZVRA 1TQZA 4TYZA 2AL6A 2M38A 4DX8A 1TXDA 2YVCA 3MPXA 3QBVB 3KRXA 2VSZA 2D9VA 1KZGA 3QWMA 1FOEA 5KQ1A 2X18A 2LG1A 4WJ7A 1MIZB 4KHBB 3AU5A 4H8SA 2IYBA 1MKEA 2Z0PA 3N7CA 3A98B 1KZ7A 1SHCA 4EJNA 4Z2NA 3U7DA 5C16A 4F7UP 2D4QA 4GXBA 4TKNA 2CY4A 2NZ8B 1DYNA 3TO1A 2D11A 4GZUA 1Q67A 3ODWA 2W2XC 2J0JA 1WGUA 2CY5A 4HDQA 2W2WA 5JP4A 1U5EA 4HAZB 2HE7A 2YF0A 4NSWA 2W2XD 4CYEA 3HK0A 1AWEA 3TFMA 4PQ0A 2DA0A 2DHKA 2L2IA 2CRFA 1P5TA 3PZDA 3ULCA 1UPRA 4HATB 4DX90 3ULBA 1EGXA 1K5DB 1H10A 3AU4A 4F7HA 2QKMA 2Q13A 2GS0A 1DDWA 3FEHA 2J0KA 2M14A 4Z2MB 3G9WA 1GG3A 5D3XA 2K00A 4P7IA 2MWNB 1AQCA 3IVFA 4F7GA 3UZTA 1UPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAU B;  3TW1 A;  1FAO A;  3VIA A;  4D0N B;  2Z0Q A;  3CIK A;  1B55 A;  3DXD A;  2VRW B;  4IAP A;  3D8D A;  1EF1 A;  1WJ1 A;  2LYD A;  4EMO A;  2CAY A;  1EAZ A;  1P3R A;  1MIX A;  1UNQ A;  1UNP A;  1WI1 A;  2GCL A;  4GPT B;  1I2H A;  1NU2 A;  2COD A;  1EVH A;  2ADZ A;  3MDB C;  3GYP A;  3TCA A;  1XCG A;  5FI1 A;  2GJY A;  1WVH A;  2YT0 A;  5D3Y A;  1J0W A;  2MDX A;  3F0W A;  2DHI A;  2Y8G A;  3ODX A;  5GOW B;  2E2X A;  2YSZ A;  1MPH A;  2DX5 A;  4HHV A;  1XOD A;  2COF A;  2EC1 A;  2YT1 A;  2KGX B;  1PFJ A;  5C79 A;  2ELA A;  2D9Z A;  2GCJ A;  3X23 A;  2RSG A;  4YON A;  5J3Y A;  5HE1 A;  1PMS A;  1BWN A;  2DKP A;  1ZM0 A;  1XKE A;  2I1J A;  2MKR A;  3PP2 A;  4CHM A;  2UZR A;  1E5W A;  3FM8 C;  4L6E A;  2D9Y A;  5DH9 B;  3U8Z A;  3P6A A;  3ZDT A;  3PVU A;  5D3V A;  3A8Q A;  2KCJ A;  3WA0 A;  2BCJ A;  1UEF A;  5L81 A;  5DI9 B;  3BIN A;  2R09 A;  2DN6 A;  2IFS A;  5HE0 A;  1LB1 A;  4HDO A;  3DXE A;  2YS3 A;  1NTV A;  3HW2 B;  2I1K A;  4HAW B;  3V5W A;  1MK9 B;  3BJI A;  2OTX A;  2Y8F A;  3RCP A;  1PLS A;  1QQG A;  4HB3 B;  4C0A A;  3NSU A;  4A6F B;  1X1G A;  4KVG B;  2MFQ A;  4HB4 B;  4HAY B;  1FHO A;  1NTY A;  1SGH A;  3FSS A;  3T06 A;  1OMW A;  1P6S A;  1U27 A;  3PSC A;  2EMS A;  3TVV A;  1H4R A;  2AEH A;  4NY0 A;  3P7Z A;  2ROZ B;  1V5P A;  1DDM A;  1TJ6 A;  3GYO A;  2UVM A;  3HQC A;  5JLJ B;  1XX0 A;  3D8F A;  5DHF B;  2DYQ A;  2DLW A;  4K81 A;  1LW3 A;  1U5G A;  4ZRK A;  5C5B B;  1U29 A;  1ZSQ A;  5J3T A;  5FI0 A;  1FGY A;  2RUK B;  2LKO A;  4YL8 A;  1XD4 A;  3D8E A;  2L1C A;  1UNR A;  1V88 A;  2OQB A;  2ZPY A;  1OY2 A;  4HB0 B;  4WVF B;  1DBH A;  3ML4 A;  1X05 A;  4Y94 A;  1ZC4 B;  1MAI A;  4MT7 A;  1V5M A;  1V5U A;  1GC7 A;  2VKI A;  1DRO A;  5C6R A;  2K2U A;  5J3Q A;  3PVW A;  3F5R A;  3SO6 A;  5LON B;  2LOZ A;  2FJL A;  2P0H A;  1U5F A;  3AJ4 A;  1BTN A;  4MY6 A;  1DDV A;  2DHJ A;  2P8V A;  1U2B A;  2D9X A;  2COC A;  2COA A;  3SUZ A;  4A6K A;  5KCV A;  3CXB B;  4MK0 A;  1FHX A;  1X11 A;  2Y7B A;  2DFK A;  3M1I B;  1NI2 A;  1U5D A;  2H7E A;  2DKQ A;  2EJ8 A;  1X1F A;  1M7R A;  2EMT A;  4GMX B;  4K17 A;  2KUP A;  5DHA B;  3KZ1 A;  5LOP B;  2LOX A;  2H7D A;  4CHJ A;  1IRS A;  1BAK A;  3SNH A;  5JHH A;  4HAV B;  2YS1 A;  3KY9 A;  1N3H A;  1Z87 A;  1RRP B;  2RLO A;  5D27 A;  5DIF B;  1X86 A;  5KQ4 A;  4IFS A;  1FB8 A;  2N0Y A;  5CLQ B;  1GC6 A;  2QKL A;  5HE3 A;  4K2O A;  2D10 A;  5EFX A;  2ELB A;  1OQN A;  2PZ1 A;  4XWX A;  2RVB B;  4ZRJ A;  4A5K A;  4PNK A;  4K2P A;  2RGN B;  4GMV A;  2D2Q A;  3O96 A;  2DYN A;  3SV1 A;  2UZS A;  5JHG A;  4ZRI A;  5D3W A;  1WG7 A;  3KSY A;  4KHA A;  4A6F A;  2G35 A;  1FGZ A;  4DBB A;  3SYX A;  1WJM A;  4EKU A;  2YS5 A;  4IOY X;  1J19 A;  2DX1 A;  5CLL B;  1M7E A;  2RNR B;  3KRW A;  2P0D A;  3ODO A;  1WGQ A;  1QC6 A;  2N23 A;  3PEG A;  2K2J A;  1V89 A;  2V76 A;  3LJU X;  2D9W A;  5HE2 A;  1KI1 B;  1Y19 B;  4HB2 B;  4A6H A;  2J59 M;  2R0D A;  5C5B A;  1K5G B;  1W1D A;  2LUL A;  1BTK A;  4BBK A;  1RJ2 A;  1V61 A;  4WSF A;  3A8P A;  1Y5O A;  1ISN A;  3PG7 A;  1ZC3 B;  1XR0 B;  4HAX B;  1MK7 B;  2P0F A;  2ROV A;  3OAN A;  2I5C A;  2XQN M;  3DXC A;  2YRY A;  2I5F A;  2Z0O A;  2HTH B;  1FHW A;  4KHO A;  1W1G A;  4B6H A;  4KAX B;  3ZVR A;  4GN1 A;  2DTC A;  2J0M A;  3VOQ A;  1W1H A;  3QIJ A;  2NMB A;  3WYF B;  2JP2 A;  3PVL A;  4DXA B;  1I7A A;  1ZVR A;  1TQZ A;  4TYZ A;  2AL6 A;  2M38 A;  4DX8 A;  1TXD A;  2YVC A;  3MPX A;  3QBV B;  3KRX A;  2VSZ A;  2D9V A;  1KZG A;  3QWM A;  1FOE A;  5KQ1 A;  2X18 A;  2LG1 A;  4WJ7 A;  1MIZ B;  4KHB B;  3AU5 A;  4H8S A;  2IYB A;  1MKE A;  2Z0P A;  3N7C A;  3A98 B;  1KZ7 A;  1SHC A;  4EJN A;  4Z2N A;  3U7D A;  5C16 A;  4F7U P;  2D4Q A;  4GXB A;  4TKN A;  2CY4 A;  2NZ8 B;  1DYN A;  3TO1 A;  2D11 A;  4GZU A;  1Q67 A;  3ODW A;  2W2X C;  2J0J A;  1WGU A;  2CY5 A;  4HDQ A;  2W2W A;  5JP4 A;  1U5E A;  4HAZ B;  2HE7 A;  2YF0 A;  4NSW A;  2W2X D;  4CYE A;  3HK0 A;  1AWE A;  3TFM A;  4PQ0 A;  2DA0 A;  2DHK A;  2L2I A;  2CRF A;  1P5T A;  3PZD A;  3ULC A;  1UPR A;  4HAT B;  4DX9 0;  3ULB A;  1EGX A;  1K5D B;  1H10 A;  3AU4 A;  4F7H A;  2QKM A;  2Q13 A;  2GS0 A;  1DDW A;  3FEH A;  2J0K A;  2M14 A;  4Z2M B;  3G9W A;  1GG3 A;  5D3X A;  2K00 A;  4P7I A;  2MWN B;  1AQC A;  3IVF A;  4F7G A;  3UZT A;  1UPQ A; 
#chains in the Genus database with same CATH topology
 4HAU B;  3TW1 A;  1FAO A;  3VIA A;  5IRS A;  4D0N B;  2Z0Q A;  3CIK A;  1B55 A;  3DXD A;  2VRW B;  4IAP A;  3D8D A;  1EF1 A;  1WJ1 A;  2LYD A;  4EMO A;  2CAY A;  1EAZ A;  1P3R A;  1MIX A;  1UNQ A;  1UNP A;  1WI1 A;  2GCL A;  4GPT B;  1I2H A;  3HIE A;  1NU2 A;  2COD A;  1EVH A;  2RRF A;  2ADZ A;  3MDB C;  1ZYI A;  3GYP A;  3TCA A;  1XCG A;  5FI1 A;  2GJY A;  1WVH A;  2YT0 A;  5D3Y A;  1J0W A;  3OHM B;  2MDX A;  3F0W A;  3NWD A;  2DHI A;  5I2M A;  2Y8G A;  3ODX A;  5GOW B;  2E2X A;  2YSZ A;  1MPH A;  2DX5 A;  4HHV A;  1XOD A;  2COF A;  2EC1 A;  2YT1 A;  2KGX B;  1PFJ A;  5C79 A;  2ELA A;  2D9Z A;  2GCJ A;  3X23 A;  2RSG A;  4YON A;  5J3Y A;  5HE1 A;  1PMS A;  1MI1 A;  1BWN A;  2DKP A;  1ZM0 A;  1XKE A;  2I1J A;  2MKR A;  3PP2 A;  4CHM A;  2UZR A;  1E5W A;  3FM8 C;  4L6E A;  2D9Y A;  5DH9 B;  3U8Z A;  2ZKM X;  2K49 A;  5I2S A;  3P6A A;  3ZDT A;  3PVU A;  5D3V A;  3A8Q A;  2KCJ A;  3WA0 A;  2BCJ A;  1UEF A;  5L81 A;  5DI9 B;  3BIN A;  2R09 A;  2DN6 A;  2IFS A;  5HE0 A;  1LB1 A;  4HDO A;  3DXE A;  2YS3 A;  1NTV A;  3HW2 B;  2I1K A;  4HAW B;  3V5W A;  1MK9 B;  3BJI A;  4KHB A;  2OTX A;  2KIG A;  2Y8F A;  3RCP A;  1PLS A;  1QQG A;  4HB3 B;  4C0A A;  3NSU A;  4A6F B;  1X1G A;  4KVG B;  2MFQ A;  4HB4 B;  4HAY B;  1FHO A;  1NTY A;  1SGH A;  3FSS A;  3T06 A;  1OMW A;  1P6S A;  1U27 A;  3PSC A;  2EMS A;  3TVV A;  1H4R A;  2AEH A;  4NY0 A;  3P7Z A;  2ROZ B;  1V5P A;  1DDM A;  4CSQ A;  1TJ6 A;  3GYO A;  2UVM A;  3HQC A;  5JLJ B;  1XX0 A;  3D8F A;  5DHF B;  2R2Y A;  2DYQ A;  2DLW A;  4K81 A;  1LW3 A;  1U5G A;  4ZRK A;  5C5B B;  1U29 A;  4QJ5 B;  1ZSQ A;  5J3T A;  5FI0 A;  1FGY A;  2RUK B;  2LKO A;  3NW8 A;  4YL8 A;  1XD4 A;  3D8E A;  2L1C A;  1UNR A;  1V88 A;  2OQB A;  2ZPY A;  1OY2 A;  4HB0 B;  4WVF B;  1DBH A;  4L1R A;  3ML4 A;  1X05 A;  2KUQ A;  4D6W A;  4Y94 A;  1ZC4 B;  1MAI A;  4MT7 A;  1T77 A;  1V5M A;  1V5U A;  1GC7 A;  2VKI A;  1DRO A;  2YT2 A;  5C6R A;  2K2U A;  5J3Q A;  3PVW A;  3F5R A;  3SO6 A;  5LON B;  2LOZ A;  2FJL A;  2P0H A;  1U5F A;  3AJ4 A;  1BTN A;  4MY6 A;  2Z4D A;  1DDV A;  4QXA B;  2DHJ A;  2P8V A;  1U2B A;  2D9X A;  2COC A;  2COA A;  2Z14 A;  3SUZ A;  4A6K A;  2FJU B;  5KCV A;  3CXB B;  4MK0 A;  1FHX A;  1X11 A;  2Y7B A;  3HSA A;  2KR0 A;  2NBV A;  2DFK A;  3M1I B;  1NI2 A;  3U12 A;  1U5D A;  2H7E A;  2DKQ A;  2EJ8 A;  1X1F A;  1M7R A;  2EMT A;  4GMX B;  4K17 A;  2KUP A;  5DHA B;  3KZ1 A;  2K8E A;  5LOP B;  2GUM A;  2LOX A;  2H7D A;  4CHJ A;  1IRS A;  1BAK A;  3SNH A;  5JHH A;  4HAV B;  2YS1 A;  3KY9 A;  1N3H A;  1Z87 A;  1RRP B;  2RLO A;  5D27 A;  5DIF B;  1X86 A;  5KQ4 A;  4IFS A;  1FB8 A;  2N0Y A;  5CLQ B;  1GC6 A;  2QKL A;  5HE3 A;  4K2O A;  2D10 A;  5EFX A;  2ELB A;  1OQN A;  2PZ1 A;  4XWX A;  2RVB B;  4OT1 A;  4ZRJ A;  4A5K A;  3B77 A;  4PNK A;  4K2P A;  2RGN B;  4GMV A;  2D2Q A;  3O96 A;  2DYN A;  3SV1 A;  2UZS A;  5JHG A;  4ZRI A;  5D3W A;  1WG7 A;  3KSY A;  4KHA A;  4A6F A;  3FVC A;  2G35 A;  1FGZ A;  4DBB A;  3SYX A;  1WJM A;  4EKU A;  2YS5 A;  4IOY X;  1J19 A;  2DX1 A;  5CLL B;  1M7E A;  2RNR B;  3KRW A;  2P0D A;  3ODO A;  1WGQ A;  1QC6 A;  2N23 A;  3PEG A;  4OSN A;  4QJ3 B;  2K2J A;  5M4Y B;  1V89 A;  2V76 A;  3LJU X;  2D9W A;  5HE2 A;  1KI1 B;  1Y19 B;  4HB2 B;  4A6H A;  2J59 M;  2R0D A;  5C5B A;  1K5G B;  1W1D A;  2LUL A;  1BTK A;  4BBK A;  1RJ2 A;  1V61 A;  4WSF A;  3A8P A;  1Y5O A;  1ISN A;  3PG7 A;  1ZC3 B;  1XR0 B;  4HAX B;  1MK7 B;  2P0F A;  2ROV A;  5LG4 B;  3OAN A;  2I5C A;  2XQN M;  3DXC A;  2YRY A;  2I5F A;  2Z0O A;  2HTH B;  1FHW A;  4KHO A;  1W1G A;  4B6H A;  2Z59 A;  4KAX B;  3ZVR A;  4GN1 A;  2DTC A;  2J0M A;  3VOQ A;  1W1H A;  3QIJ A;  2NMB A;  3WYF B;  2JP2 A;  2Z13 A;  3PVL A;  4DXA B;  1I7A A;  1ZVR A;  1TQZ A;  4TYZ A;  2AL6 A;  2M38 A;  4DX8 A;  1TXD A;  2YVC A;  3MPX A;  3QBV B;  3KRX A;  2VSZ A;  2D9V A;  1KZG A;  3QWM A;  1FOE A;  5KQ1 A;  2X18 A;  2LG1 A;  4WJ7 A;  1MIZ B;  4KHB B;  3AU5 A;  4H8S A;  2IYB A;  1MKE A;  2Z0P A;  2KIE A;  3N7C A;  3A98 B;  1KZ7 A;  1SHC A;  4EJN A;  4Z2N A;  3U7D A;  5C16 A;  4F7U P;  2D4Q A;  4GNK B;  4GXB A;  4TKN A;  2CY4 A;  2NZ8 B;  1DYN A;  3TO1 A;  2D11 A;  4GZU A;  1Q67 A;  3ODW A;  2W2X C;  2J0J A;  1WGU A;  4QJ4 B;  4HSI A;  2CY5 A;  4HDQ A;  2W2W A;  5JP4 A;  1U5E A;  4HAZ B;  2HE7 A;  2YF0 A;  4NSW A;  2W2X D;  4CYE A;  3HK0 A;  1AWE A;  4GOU A;  3TFM A;  3A58 A;  4PQ0 A;  4DIX A;  2DA0 A;  2DHK A;  2L2I A;  2CRF A;  3NWA A;  1P5T A;  3PZD A;  3ULC A;  1UPR A;  4HAT B;  4DX9 0;  3ULB A;  1EGX A;  1K5D B;  1H10 A;  3AU4 A;  3NWF A;  4F7H A;  2QKM A;  2Q13 A;  2GS0 A;  1DDW A;  3FEH A;  2J0K A;  2M14 A;  4Z2M B;  3G9W A;  1GG3 A;  5D3X A;  2K00 A;  4P7I A;  3DCX A;  2MWN B;  1AQC A;  3IVF A;  4F7G A;  3UZT A;  1UPQ A; 
#chains in the Genus database with same CATH homology
 4HAU B;  3TW1 A;  1FAO A;  3VIA A;  4D0N B;  2Z0Q A;  3CIK A;  1B55 A;  3DXD A;  2VRW B;  4IAP A;  3D8D A;  1EF1 A;  1WJ1 A;  2LYD A;  4EMO A;  2CAY A;  1EAZ A;  1P3R A;  1MIX A;  1UNQ A;  1UNP A;  1WI1 A;  2GCL A;  4GPT B;  1I2H A;  1NU2 A;  2COD A;  1EVH A;  2ADZ A;  3MDB C;  3GYP A;  3TCA A;  1XCG A;  5FI1 A;  2GJY A;  1WVH A;  2YT0 A;  5D3Y A;  1J0W A;  2MDX A;  3F0W A;  2DHI A;  2Y8G A;  3ODX A;  5GOW B;  2E2X A;  2YSZ A;  1MPH A;  2DX5 A;  4HHV A;  1XOD A;  2COF A;  2EC1 A;  2YT1 A;  2KGX B;  1PFJ A;  5C79 A;  2ELA A;  2D9Z A;  2GCJ A;  3X23 A;  2RSG A;  4YON A;  5J3Y A;  5HE1 A;  1PMS A;  1BWN A;  2DKP A;  1ZM0 A;  1XKE A;  2I1J A;  2MKR A;  3PP2 A;  4CHM A;  2UZR A;  1E5W A;  3FM8 C;  4L6E A;  2D9Y A;  5DH9 B;  3U8Z A;  3P6A A;  3ZDT A;  3PVU A;  5D3V A;  3A8Q A;  2KCJ A;  3WA0 A;  2BCJ A;  1UEF A;  5L81 A;  5DI9 B;  3BIN A;  2R09 A;  2DN6 A;  2IFS A;  5HE0 A;  1LB1 A;  4HDO A;  3DXE A;  2YS3 A;  1NTV A;  3HW2 B;  2I1K A;  4HAW B;  3V5W A;  1MK9 B;  3BJI A;  2OTX A;  2Y8F A;  3RCP A;  1PLS A;  1QQG A;  4HB3 B;  4C0A A;  3NSU A;  4A6F B;  1X1G A;  4KVG B;  2MFQ A;  4HB4 B;  4HAY B;  1FHO A;  1NTY A;  1SGH A;  3FSS A;  3T06 A;  1OMW A;  1P6S A;  1U27 A;  3PSC A;  2EMS A;  3TVV A;  1H4R A;  2AEH A;  4NY0 A;  3P7Z A;  2ROZ B;  1V5P A;  1DDM A;  1TJ6 A;  3GYO A;  2UVM A;  3HQC A;  5JLJ B;  1XX0 A;  3D8F A;  5DHF B;  2DYQ A;  2DLW A;  4K81 A;  1LW3 A;  1U5G A;  4ZRK A;  5C5B B;  1U29 A;  1ZSQ A;  5J3T A;  5FI0 A;  1FGY A;  2RUK B;  2LKO A;  4YL8 A;  1XD4 A;  3D8E A;  2L1C A;  1UNR A;  1V88 A;  2OQB A;  2ZPY A;  1OY2 A;  4HB0 B;  4WVF B;  1DBH A;  3ML4 A;  1X05 A;  4Y94 A;  1ZC4 B;  1MAI A;  4MT7 A;  1V5M A;  1V5U A;  1GC7 A;  2VKI A;  1DRO A;  5C6R A;  2K2U A;  5J3Q A;  3PVW A;  3F5R A;  3SO6 A;  5LON B;  2LOZ A;  2FJL A;  2P0H A;  1U5F A;  3AJ4 A;  1BTN A;  4MY6 A;  1DDV A;  2DHJ A;  2P8V A;  1U2B A;  2D9X A;  2COC A;  2COA A;  3SUZ A;  4A6K A;  5KCV A;  3CXB B;  4MK0 A;  1FHX A;  1X11 A;  2Y7B A;  2DFK A;  3M1I B;  1NI2 A;  1U5D A;  2H7E A;  2DKQ A;  2EJ8 A;  1X1F A;  1M7R A;  2EMT A;  4GMX B;  4K17 A;  2KUP A;  5DHA B;  3KZ1 A;  5LOP B;  2LOX A;  2H7D A;  4CHJ A;  1IRS A;  1BAK A;  3SNH A;  5JHH A;  4HAV B;  2YS1 A;  3KY9 A;  1N3H A;  1Z87 A;  1RRP B;  2RLO A;  5D27 A;  5DIF B;  1X86 A;  5KQ4 A;  4IFS A;  1FB8 A;  2N0Y A;  5CLQ B;  1GC6 A;  2QKL A;  5HE3 A;  4K2O A;  2D10 A;  5EFX A;  2ELB A;  1OQN A;  2PZ1 A;  4XWX A;  2RVB B;  4ZRJ A;  4A5K A;  4PNK A;  4K2P A;  2RGN B;  4GMV A;  2D2Q A;  3O96 A;  2DYN A;  3SV1 A;  2UZS A;  5JHG A;  4ZRI A;  5D3W A;  1WG7 A;  3KSY A;  4KHA A;  4A6F A;  2G35 A;  1FGZ A;  4DBB A;  3SYX A;  1WJM A;  4EKU A;  2YS5 A;  4IOY X;  1J19 A;  2DX1 A;  5CLL B;  1M7E A;  2RNR B;  3KRW A;  2P0D A;  3ODO A;  1WGQ A;  1QC6 A;  2N23 A;  3PEG A;  2K2J A;  1V89 A;  2V76 A;  3LJU X;  2D9W A;  5HE2 A;  1KI1 B;  1Y19 B;  4HB2 B;  4A6H A;  2J59 M;  2R0D A;  5C5B A;  1K5G B;  1W1D A;  2LUL A;  1BTK A;  4BBK A;  1RJ2 A;  1V61 A;  4WSF A;  3A8P A;  1Y5O A;  1ISN A;  3PG7 A;  1ZC3 B;  1XR0 B;  4HAX B;  1MK7 B;  2P0F A;  2ROV A;  3OAN A;  2I5C A;  2XQN M;  3DXC A;  2YRY A;  2I5F A;  2Z0O A;  2HTH B;  1FHW A;  4KHO A;  1W1G A;  4B6H A;  4KAX B;  3ZVR A;  4GN1 A;  2DTC A;  2J0M A;  3VOQ A;  1W1H A;  3QIJ A;  2NMB A;  3WYF B;  2JP2 A;  3PVL A;  4DXA B;  1I7A A;  1ZVR A;  1TQZ A;  4TYZ A;  2AL6 A;  2M38 A;  4DX8 A;  1TXD A;  2YVC A;  3MPX A;  3QBV B;  3KRX A;  2VSZ A;  2D9V A;  1KZG A;  3QWM A;  1FOE A;  5KQ1 A;  2X18 A;  2LG1 A;  4WJ7 A;  1MIZ B;  4KHB B;  3AU5 A;  4H8S A;  2IYB A;  1MKE A;  2Z0P A;  3N7C A;  3A98 B;  1KZ7 A;  1SHC A;  4EJN A;  4Z2N A;  3U7D A;  5C16 A;  4F7U P;  2D4Q A;  4GXB A;  4TKN A;  2CY4 A;  2NZ8 B;  1DYN A;  3TO1 A;  2D11 A;  4GZU A;  1Q67 A;  3ODW A;  2W2X C;  2J0J A;  1WGU A;  2CY5 A;  4HDQ A;  2W2W A;  5JP4 A;  1U5E A;  4HAZ B;  2HE7 A;  2YF0 A;  4NSW A;  2W2X D;  4CYE A;  3HK0 A;  1AWE A;  3TFM A;  4PQ0 A;  2DA0 A;  2DHK A;  2L2I A;  2CRF A;  1P5T A;  3PZD A;  3ULC A;  1UPR A;  4HAT B;  4DX9 0;  3ULB A;  1EGX A;  1K5D B;  1H10 A;  3AU4 A;  4F7H A;  2QKM A;  2Q13 A;  2GS0 A;  1DDW A;  3FEH A;  2J0K A;  2M14 A;  4Z2M B;  3G9W A;  1GG3 A;  5D3X A;  2K00 A;  4P7I A;  2MWN B;  1AQC A;  3IVF A;  4F7G A;  3UZT A;  1UPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...