3DXDA

Crystal structure of the intracellular domain of human app (t668e mutant) in complex with fe65-ptb2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein-binding family B member 1
total genus 37
structure length 131
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxdA00
3TCAA 2X18A 2BCJA 2I5CA 2LOZA 1U5FA 3FSSA 2Z0OA 4DX8A 1I2HA 1DYNA 1H10A 2DKQA 5DH9B 5J3YA 5LOPB 1U2BA 1X1GA 2E2XA 3N7CA 2MKRA 2EJ8A 2P0DA 3HW2B 4MY6A 3U7DA 3A98B 2DA0A 1V89A 1W1HA 4KAXB 3MDBC 1X11A 3PSCA 2J59M 3SUZA 1BTKA 3P6AA 4KVGB 5EFXA 1UNQA 1XODA 4KHBB 3KZ1A 1AWEA 4NSWA 2QKLA 5D3WA 1FHOA 4PQ0A 5JHHA 2D9YA 2ADZA 5C6RA 1PLSA 2COFA 1GG3A 3ULBA 3OANA 1MAIA 1V5PA 2XQNM 5J3QA 1OMWA 2CY4A 3O96A 4K81A 2K2JA 2YS1A 4F7GA 5L81A 1ZM0A 5CLQB 1P5TA 1UNPA 2MWNB 4HB3B 5JHGA 4HATB 1WJ1A 2KUPA 1E5WA 4YONA 1AQCA 2ZPYA 3PP2A 1J19A 3ZVRA 1WI1A 4TKNA 2IFSA 2YVCA 2HE7A 2DX1A 4KHAA 3QIJA 2D9ZA 2DTCA 3X23A 2CY5A 3NSUA 4GN1A 2L1CA 3FM8C 3PVUA 1BWNA 2I1JA 2ELAA 4MK0A 3GYPA 4HB0B 4B6HA 3KY9A 1B55A 3AJ4A 4Z2MB 1Q67A 2Q13A 5C16A 3KSYA 5DHFB 4HDOA 1FGZA 2I1KA 4GMVA 4F7HA 2VKIA 1WJMA 2N0YA 1FAOA 3TW1A 1FGYA 2VRWB 2EMSA 3GYOA 4WJ7A 4KHOA 1MK7B 1Y19B 1X1FA 2J0MA 2K00A 4WVFB 3ULCA 4ZRKA 3VOQA 5FI0A 1W1GA 1RJ2A 1I7AA 2RLOA 1TJ6A 2D9WA 4K17A 2JP2A 2W2XD 2GS0A 5C79A 4A6FA 5KCVA 2NMBA 5C5BB 4EMOA 2KGXB 3SNHA 2R0DA 5KQ4A 3G9WA 1NU2A 2RSGA 1UEFA 3V5WA 4IAPA 4A6HA 3HQCA 3HK0A 3WA0A 3UZTA 2P0HA 3BINA 4P7IA 1M7RA 2K2UA 4K2PA 3ODXA 5D3YA 1LB1A 1MK9B 1Y5OA 3AU5A 5LONB 2M38A 3A8PA 3PEGA 1MIXA 4EKUA 2J0KA 1QC6A 4A6KA 2COAA 3D8EA 1LW3A 3D8FA 5JP4A 1V88A 3TO1A 2P0FA 1U5EA 4PNKA 1NTVA 1KZGA 1PFJA 2J0JA 3DXCA 1FOEA 4C0AA 4GMXB 1PMSA 4H8SA 4L6EA 3FEHA 1U5GA 2RUKB 2DFKA 4ZRIA 1ZVRA 2RVBB 5GOWB 3RCPA 2KCJA 1P3RA 2OTXA 4F7UP 1FHWA 1SGHA 2MFQA 3IVFA 4HAXB 1U5DA 2CAYA 1UPRA 4IOYX 2NZ8B 3M1IB 3P7ZA 3U8ZA 1WGQA 3PVLA 5DIFB 2MDXA 4TYZA 2LKOA 3LJUX 2D9VA 5CLLB 4HB4B 5D27A 1X05A 1EAZA 2YS5A 4IFSA 1WVHA 5J3TA 4HB2B 1TXDA 2VSZA 2UVMA 1FHXA 1EGXA 4EJNA 1X86A 4CHMA 3ODOA 2YSZA 2CRFA 2V76A 4A6FB 1N3HA 4GZUA 5HE2A 1BTNA 2W2XC 4K2OA 5DHAB 3DXDA 4HAVB 3WYFB 3QWMA 2LOXA 4HAYB 2HTHB 2COCA 3QBVB 1DDWA 4Y94A 4HAZB 2PZ1A 4XWXA 4DBBA 4BBKA 3ODWA 1K5DB 1ZC4B 1ISNA 2ROZB 3BJIA 2W2WA 1SHCA 2YRYA 1XD4A 2ELBA 1H4RA 1IRSA 2LULA 2CODA 2H7DA 1U27A 4A5KA 2D4QA 2LG1A 4YL8A 1W1DA 3SYXA 3F0WA 5HE1A 4HAUB 1MPHA 2Z0QA 1XKEA 2RGNB 2UZSA 2DYQA 2DYNA 5D3XA 1DBHA 1OQNA 2R09A 2DHIA 2ROVA 3ZDTA 3KRWA 1GC6A 4CYEA 2AL6A 5DI9B 5HE0A 4NY0A 1NTYA 2GCJA 1MIZB 3TVVA 1V5UA 1FB8A 4D0NB 2EC1A 2D2QA 2M14A 5HE3A 1Z87A 1TQZA 1WG7A 2GCLA 4GPTB 3PVWA 3DXEA 4Z2NA 2G35A 2LYDA 3SV1A 2UZRA 1U29A 1V5MA 2AEHA 1DROA 1V61A 2DN6A 5C5BA 4HHVA 5KQ1A 2QKMA 2Y7BA 3T06A 2DLWA 1EVHA 2YT0A 5FI1A 4WSFA 1M7EA 2GJYA 2OQBA 2DHKA 1DDMA 1MKEA 3CIKA 1GC7A 3A8QA 1NI2A 1P6SA 2RNRB 1ZSQA 4GXBA 1QQGA 3VIAA 1WGUA 1XCGA 2N23A 2IYBA 1OY2A 1KZ7A 2Y8GA 4MT7A 2D11A 1DDVA 3F5RA 1ZC3B 5D3VA 1J0WA 2D9XA 1RRPB 4DX90 2Y8FA 4DXAB 3CXBB 1KI1B 2FJLA 2DHJA 1EF1A 2YS3A 1BAKA 2DKPA 3TFMA 1UPQA 4CHJA 2I5FA 1XX0A 3MPXA 2Z0PA 2YF0A 2DX5A 2EMTA 2L2IA 1K5GB 3SO6A 3PG7A 3AU4A 2P8VA 4ZRJA 2D10A 4HAWB 1XR0B 3PZDA 1UNRA 2H7EA 3KRXA 4HDQA 5JLJB 3ML4A 2YT1A 3D8DA
chains in the Genus database with same CATH superfamily
3TCAA 2X18A 2BCJA 2I5CA 2LOZA 1U5FA 4OT1A 3FSSA 2Z0OA 4DX8A 1I2HA 1DYNA 1H10A 2DKQA 5DH9B 5J3YA 5LOPB 1U2BA 1X1GA 2E2XA 3N7CA 2Z59A 2MKRA 2EJ8A 2P0DA 3HW2B 4MY6A 3U7DA 3A98B 2DA0A 1V89A 1W1HA 4KAXB 3MDBC 5M4YB 2YT2A 1X11A 3PSCA 2J59M 3SUZA 1BTKA 3P6AA 4KVGB 5EFXA 1UNQA 1XODA 4KHBB 3KZ1A 1AWEA 4NSWA 2QKLA 5D3WA 4D6WA 1FHOA 4PQ0A 5JHHA 2D9YA 2ADZA 5C6RA 1PLSA 2COFA 1GG3A 3ULBA 3OANA 1MAIA 1V5PA 2XQNM 5J3QA 1OMWA 2CY4A 3O96A 4K81A 2K2JA 2YS1A 4F7GA 5L81A 1ZM0A 5CLQB 1P5TA 1UNPA 2MWNB 4HB3B 1T77A 5JHGA 4HATB 1WJ1A 2KUPA 2Z14A 1E5WA 4YONA 1AQCA 2ZPYA 3PP2A 1J19A 3ZVRA 1WI1A 2KR0A 4TKNA 2IFSA 2YVCA 2HE7A 2DX1A 4KHAA 3QIJA 2D9ZA 3HSAA 2K8EA 2DTCA 2KIEA 3X23A 2CY5A 3NSUA 4GN1A 2L1CA 3FM8C 3PVUA 1BWNA 2I1JA 2ELAA 4MK0A 3GYPA 4HB0B 4B6HA 3KY9A 1B55A 3AJ4A 4Z2MB 1Q67A 2Q13A 5C16A 3KSYA 5DHFB 4HDOA 1FGZA 2I1KA 4GMVA 4F7HA 2VKIA 1WJMA 2N0YA 1FAOA 3TW1A 4DIXA 2KIGA 1FGYA 2VRWB 2EMSA 3GYOA 4WJ7A 4KHOA 1MK7B 1Y19B 1X1FA 2J0MA 2K00A 4WVFB 3ULCA 4ZRKA 3VOQA 5FI0A 1W1GA 1RJ2A 1I7AA 2RLOA 1TJ6A 2D9WA 4K17A 2JP2A 2W2XD 2GS0A 5C79A 4A6FA 5KCVA 2NMBA 5C5BB 4EMOA 2KGXB 3SNHA 5I2MA 2R0DA 4KHBA 5KQ4A 3G9WA 1NU2A 2RSGA 1UEFA 4HSIA 4L1RA 3V5WA 2R2YA 4IAPA 4A6HA 3HQCA 3HK0A 3WA0A 3UZTA 2P0HA 2ZKMX 3BINA 4P7IA 1M7RA 2K2UA 4K2PA 4CSQA 3ODXA 3NWDA 5D3YA 1LB1A 1MK9B 1Y5OA 3AU5A 5LONB 2M38A 3A8PA 3PEGA 1MIXA 4EKUA 1MI1A 2J0KA 1QC6A 4A6KA 2COAA 3D8EA 1LW3A 3D8FA 5JP4A 1V88A 3TO1A 2P0FA 1U5EA 4PNKA 2Z4DA 5I2SA 1NTVA 1KZGA 1PFJA 3FVCA 2J0JA 3DXCA 1FOEA 4C0AA 4GMXB 1PMSA 4H8SA 4L6EA 3FEHA 1U5GA 2RUKB 2DFKA 4ZRIA 1ZVRA 2RVBB 5GOWB 3RCPA 2KCJA 1P3RA 2OTXA 4F7UP 1FHWA 1SGHA 2MFQA 3IVFA 4HAXB 1U5DA 2CAYA 1UPRA 4IOYX 3DCXA 2NZ8B 3HIEA 3M1IB 3P7ZA 3U8ZA 1WGQA 3PVLA 5DIFB 2MDXA 4TYZA 2LKOA 3LJUX 2D9VA 5CLLB 4HB4B 4GOUA 5D27A 1X05A 1EAZA 2YS5A 4IFSA 1WVHA 5J3TA 4HB2B 1TXDA 2VSZA 2UVMA 1FHXA 1EGXA 4EJNA 1X86A 4CHMA 3ODOA 2YSZA 2CRFA 2V76A 4A6FB 1N3HA 4GZUA 5HE2A 1BTNA 2W2XC 4K2OA 5DHAB 3A58A 3DXDA 4HAVB 3WYFB 4OSNA 3QWMA 2LOXA 4HAYB 2HTHB 3U12A 2COCA 3QBVB 1DDWA 4Y94A 4HAZB 2PZ1A 4XWXA 4DBBA 4BBKA 3ODWA 1K5DB 1ZC4B 1ISNA 2ROZB 3BJIA 2W2WA 1SHCA 2YRYA 1XD4A 2ELBA 1H4RA 1IRSA 2GUMA 2LULA 2CODA 2H7DA 1U27A 4A5KA 2D4QA 2LG1A 3B77A 4YL8A 1W1DA 3SYXA 3NW8A 3F0WA 5HE1A 4HAUB 1MPHA 2Z0QA 1XKEA 2RGNB 2UZSA 2DYQA 2DYNA 5D3XA 1DBHA 1OQNA 2R09A 2DHIA 2ROVA 3ZDTA 3KRWA 1GC6A 5IRSA 4CYEA 2AL6A 5DI9B 3OHMB 5HE0A 4NY0A 1NTYA 2GCJA 1MIZB 3TVVA 1V5UA 1FB8A 2NBVA 2Z13A 4D0NB 2EC1A 2D2QA 2M14A 5HE3A 1Z87A 1TQZA 4QJ4B 1WG7A 2GCLA 4GPTB 3PVWA 3DXEA 4Z2NA 4QJ5B 2G35A 2LYDA 4QJ3B 3SV1A 2FJUB 2UZRA 1U29A 1V5MA 2AEHA 3NWFA 1DROA 2KUQA 1V61A 2DN6A 5C5BA 3NWAA 4HHVA 5KQ1A 2QKMA 2Y7BA 3T06A 2DLWA 1EVHA 2YT0A 5FI1A 4WSFA 1M7EA 2GJYA 2OQBA 2DHKA 1DDMA 1MKEA 3CIKA 1GC7A 3A8QA 1NI2A 1P6SA 2RNRB 2RRFA 5LG4B 1ZSQA 4GXBA 1QQGA 3VIAA 1WGUA 1XCGA 2N23A 2IYBA 1OY2A 1KZ7A 2Y8GA 4MT7A 2D11A 1DDVA 3F5RA 1ZC3B 5D3VA 1J0WA 2D9XA 1RRPB 1ZYIA 4DX90 4GNKB 2Y8FA 4DXAB 3CXBB 1KI1B 2FJLA 2DHJA 1EF1A 2YS3A 1BAKA 2DKPA 3TFMA 1UPQA 4CHJA 2I5FA 1XX0A 3MPXA 2Z0PA 2YF0A 2DX5A 2EMTA 2L2IA 1K5GB 2K49A 3SO6A 3PG7A 3AU4A 2P8VA 4ZRJA 2D10A 4HAWB 1XR0B 3PZDA 1UNRA 2H7EA 3KRXA 4HDQA 4QXAB 3ML4A 5JLJB 2YT1A 3D8DA
chains in the Genus database with same CATH topology
3TCAA 2X18A 2BCJA 2I5CA 2LOZA 1U5FA 3FSSA 2Z0OA 4DX8A 1I2HA 1DYNA 1H10A 2DKQA 5DH9B 5J3YA 5LOPB 1U2BA 1X1GA 2E2XA 3N7CA 2MKRA 2EJ8A 2P0DA 3HW2B 4MY6A 3U7DA 3A98B 2DA0A 1V89A 1W1HA 4KAXB 3MDBC 1X11A 3PSCA 2J59M 3SUZA 1BTKA 3P6AA 4KVGB 5EFXA 1UNQA 1XODA 4KHBB 3KZ1A 1AWEA 4NSWA 2QKLA 5D3WA 1FHOA 4PQ0A 5JHHA 2D9YA 2ADZA 5C6RA 1PLSA 2COFA 1GG3A 3ULBA 3OANA 1MAIA 1V5PA 2XQNM 5J3QA 1OMWA 2CY4A 3O96A 4K81A 2K2JA 2YS1A 4F7GA 5L81A 1ZM0A 5CLQB 1P5TA 1UNPA 2MWNB 4HB3B 5JHGA 4HATB 1WJ1A 2KUPA 1E5WA 4YONA 1AQCA 2ZPYA 3PP2A 1J19A 3ZVRA 1WI1A 4TKNA 2IFSA 2YVCA 2HE7A 2DX1A 4KHAA 3QIJA 2D9ZA 2DTCA 3X23A 2CY5A 3NSUA 4GN1A 2L1CA 3FM8C 3PVUA 1BWNA 2I1JA 2ELAA 4MK0A 3GYPA 4HB0B 4B6HA 3KY9A 1B55A 3AJ4A 4Z2MB 1Q67A 2Q13A 5C16A 3KSYA 5DHFB 4HDOA 1FGZA 2I1KA 4GMVA 4F7HA 2VKIA 1WJMA 2N0YA 1FAOA 3TW1A 1FGYA 2VRWB 2EMSA 3GYOA 4WJ7A 4KHOA 1MK7B 1Y19B 1X1FA 2J0MA 2K00A 4WVFB 3ULCA 4ZRKA 3VOQA 5FI0A 1W1GA 1RJ2A 1I7AA 2RLOA 1TJ6A 2D9WA 4K17A 2JP2A 2W2XD 2GS0A 5C79A 4A6FA 5KCVA 2NMBA 5C5BB 4EMOA 2KGXB 3SNHA 2R0DA 5KQ4A 3G9WA 1NU2A 2RSGA 1UEFA 3V5WA 4IAPA 4A6HA 3HQCA 3HK0A 3WA0A 3UZTA 2P0HA 3BINA 4P7IA 1M7RA 2K2UA 4K2PA 3ODXA 5D3YA 1LB1A 1MK9B 1Y5OA 3AU5A 5LONB 2M38A 3A8PA 3PEGA 1MIXA 4EKUA 2J0KA 1QC6A 4A6KA 2COAA 3D8EA 1LW3A 3D8FA 5JP4A 1V88A 3TO1A 2P0FA 1U5EA 4PNKA 1NTVA 1KZGA 1PFJA 2J0JA 3DXCA 1FOEA 4C0AA 4GMXB 1PMSA 4H8SA 4L6EA 3FEHA 1U5GA 2RUKB 2DFKA 4ZRIA 1ZVRA 2RVBB 5GOWB 3RCPA 2KCJA 1P3RA 2OTXA 4F7UP 1FHWA 1SGHA 2MFQA 3IVFA 4HAXB 1U5DA 2CAYA 1UPRA 4IOYX 2NZ8B 3M1IB 3P7ZA 3U8ZA 1WGQA 3PVLA 5DIFB 2MDXA 4TYZA 2LKOA 3LJUX 2D9VA 5CLLB 4HB4B 5D27A 1X05A 1EAZA 2YS5A 4IFSA 1WVHA 5J3TA 4HB2B 1TXDA 2VSZA 2UVMA 1FHXA 1EGXA 4EJNA 1X86A 4CHMA 3ODOA 2YSZA 2CRFA 2V76A 4A6FB 1N3HA 4GZUA 5HE2A 1BTNA 2W2XC 4K2OA 5DHAB 3DXDA 4HAVB 3WYFB 3QWMA 2LOXA 4HAYB 2HTHB 2COCA 3QBVB 1DDWA 4Y94A 4HAZB 2PZ1A 4XWXA 4DBBA 4BBKA 3ODWA 1K5DB 1ZC4B 1ISNA 2ROZB 3BJIA 2W2WA 1SHCA 2YRYA 1XD4A 2ELBA 1H4RA 1IRSA 2LULA 2CODA 2H7DA 1U27A 4A5KA 2D4QA 2LG1A 4YL8A 1W1DA 3SYXA 3F0WA 5HE1A 4HAUB 1MPHA 2Z0QA 1XKEA 2RGNB 2UZSA 2DYQA 2DYNA 5D3XA 1DBHA 1OQNA 2R09A 2DHIA 2ROVA 3ZDTA 3KRWA 1GC6A 4CYEA 2AL6A 5DI9B 5HE0A 4NY0A 1NTYA 2GCJA 1MIZB 3TVVA 1V5UA 1FB8A 4D0NB 2EC1A 2D2QA 2M14A 5HE3A 1Z87A 1TQZA 1WG7A 2GCLA 4GPTB 3PVWA 3DXEA 4Z2NA 2G35A 2LYDA 3SV1A 2UZRA 1U29A 1V5MA 2AEHA 1DROA 1V61A 2DN6A 5C5BA 4HHVA 5KQ1A 2QKMA 2Y7BA 3T06A 2DLWA 1EVHA 2YT0A 5FI1A 4WSFA 1M7EA 2GJYA 2OQBA 2DHKA 1DDMA 1MKEA 3CIKA 1GC7A 3A8QA 1NI2A 1P6SA 2RNRB 1ZSQA 4GXBA 1QQGA 3VIAA 1WGUA 1XCGA 2N23A 2IYBA 1OY2A 1KZ7A 2Y8GA 4MT7A 2D11A 1DDVA 3F5RA 1ZC3B 5D3VA 1J0WA 2D9XA 1RRPB 4DX90 2Y8FA 4DXAB 3CXBB 1KI1B 2FJLA 2DHJA 1EF1A 2YS3A 1BAKA 2DKPA 3TFMA 1UPQA 4CHJA 2I5FA 1XX0A 3MPXA 2Z0PA 2YF0A 2DX5A 2EMTA 2L2IA 1K5GB 3SO6A 3PG7A 3AU4A 2P8VA 4ZRJA 2D10A 4HAWB 1XR0B 3PZDA 1UNRA 2H7EA 3KRXA 4HDQA 5JLJB 3ML4A 2YT1A 3D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  2X18 A;  2BCJ A;  2I5C A;  2LOZ A;  1U5F A;  3FSS A;  2Z0O A;  4DX8 A;  1I2H A;  1DYN A;  1H10 A;  2DKQ A;  5DH9 B;  5J3Y A;  5LOP B;  1U2B A;  1X1G A;  2E2X A;  3N7C A;  2MKR A;  2EJ8 A;  2P0D A;  3HW2 B;  4MY6 A;  3U7D A;  3A98 B;  2DA0 A;  1V89 A;  1W1H A;  4KAX B;  3MDB C;  1X11 A;  3PSC A;  2J59 M;  3SUZ A;  1BTK A;  3P6A A;  4KVG B;  5EFX A;  1UNQ A;  1XOD A;  4KHB B;  3KZ1 A;  1AWE A;  4NSW A;  2QKL A;  5D3W A;  1FHO A;  4PQ0 A;  5JHH A;  2D9Y A;  2ADZ A;  5C6R A;  1PLS A;  2COF A;  1GG3 A;  3ULB A;  3OAN A;  1MAI A;  1V5P A;  2XQN M;  5J3Q A;  1OMW A;  2CY4 A;  3O96 A;  4K81 A;  2K2J A;  2YS1 A;  4F7G A;  5L81 A;  1ZM0 A;  5CLQ B;  1P5T A;  1UNP A;  2MWN B;  4HB3 B;  5JHG A;  4HAT B;  1WJ1 A;  2KUP A;  1E5W A;  4YON A;  1AQC A;  2ZPY A;  3PP2 A;  1J19 A;  3ZVR A;  1WI1 A;  4TKN A;  2IFS A;  2YVC A;  2HE7 A;  2DX1 A;  4KHA A;  3QIJ A;  2D9Z A;  2DTC A;  3X23 A;  2CY5 A;  3NSU A;  4GN1 A;  2L1C A;  3FM8 C;  3PVU A;  1BWN A;  2I1J A;  2ELA A;  4MK0 A;  3GYP A;  4HB0 B;  4B6H A;  3KY9 A;  1B55 A;  3AJ4 A;  4Z2M B;  1Q67 A;  2Q13 A;  5C16 A;  3KSY A;  5DHF B;  4HDO A;  1FGZ A;  2I1K A;  4GMV A;  4F7H A;  2VKI A;  1WJM A;  2N0Y A;  1FAO A;  3TW1 A;  1FGY A;  2VRW B;  2EMS A;  3GYO A;  4WJ7 A;  4KHO A;  1MK7 B;  1Y19 B;  1X1F A;  2J0M A;  2K00 A;  4WVF B;  3ULC A;  4ZRK A;  3VOQ A;  5FI0 A;  1W1G A;  1RJ2 A;  1I7A A;  2RLO A;  1TJ6 A;  2D9W A;  4K17 A;  2JP2 A;  2W2X D;  2GS0 A;  5C79 A;  4A6F A;  5KCV A;  2NMB A;  5C5B B;  4EMO A;  2KGX B;  3SNH A;  2R0D A;  5KQ4 A;  3G9W A;  1NU2 A;  2RSG A;  1UEF A;  3V5W A;  4IAP A;  4A6H A;  3HQC A;  3HK0 A;  3WA0 A;  3UZT A;  2P0H A;  3BIN A;  4P7I A;  1M7R A;  2K2U A;  4K2P A;  3ODX A;  5D3Y A;  1LB1 A;  1MK9 B;  1Y5O A;  3AU5 A;  5LON B;  2M38 A;  3A8P A;  3PEG A;  1MIX A;  4EKU A;  2J0K A;  1QC6 A;  4A6K A;  2COA A;  3D8E A;  1LW3 A;  3D8F A;  5JP4 A;  1V88 A;  3TO1 A;  2P0F A;  1U5E A;  4PNK A;  1NTV A;  1KZG A;  1PFJ A;  2J0J A;  3DXC A;  1FOE A;  4C0A A;  4GMX B;  1PMS A;  4H8S A;  4L6E A;  3FEH A;  1U5G A;  2RUK B;  2DFK A;  4ZRI A;  1ZVR A;  2RVB B;  5GOW B;  3RCP A;  2KCJ A;  1P3R A;  2OTX A;  4F7U P;  1FHW A;  1SGH A;  2MFQ A;  3IVF A;  4HAX B;  1U5D A;  2CAY A;  1UPR A;  4IOY X;  2NZ8 B;  3M1I B;  3P7Z A;  3U8Z A;  1WGQ A;  3PVL A;  5DIF B;  2MDX A;  4TYZ A;  2LKO A;  3LJU X;  2D9V A;  5CLL B;  4HB4 B;  5D27 A;  1X05 A;  1EAZ A;  2YS5 A;  4IFS A;  1WVH A;  5J3T A;  4HB2 B;  1TXD A;  2VSZ A;  2UVM A;  1FHX A;  1EGX A;  4EJN A;  1X86 A;  4CHM A;  3ODO A;  2YSZ A;  2CRF A;  2V76 A;  4A6F B;  1N3H A;  4GZU A;  5HE2 A;  1BTN A;  2W2X C;  4K2O A;  5DHA B;  3DXD A;  4HAV B;  3WYF B;  3QWM A;  2LOX A;  4HAY B;  2HTH B;  2COC A;  3QBV B;  1DDW A;  4Y94 A;  4HAZ B;  2PZ1 A;  4XWX A;  4DBB A;  4BBK A;  3ODW A;  1K5D B;  1ZC4 B;  1ISN A;  2ROZ B;  3BJI A;  2W2W A;  1SHC A;  2YRY A;  1XD4 A;  2ELB A;  1H4R A;  1IRS A;  2LUL A;  2COD A;  2H7D A;  1U27 A;  4A5K A;  2D4Q A;  2LG1 A;  4YL8 A;  1W1D A;  3SYX A;  3F0W A;  5HE1 A;  4HAU B;  1MPH A;  2Z0Q A;  1XKE A;  2RGN B;  2UZS A;  2DYQ A;  2DYN A;  5D3X A;  1DBH A;  1OQN A;  2R09 A;  2DHI A;  2ROV A;  3ZDT A;  3KRW A;  1GC6 A;  4CYE A;  2AL6 A;  5DI9 B;  5HE0 A;  4NY0 A;  1NTY A;  2GCJ A;  1MIZ B;  3TVV A;  1V5U A;  1FB8 A;  4D0N B;  2EC1 A;  2D2Q A;  2M14 A;  5HE3 A;  1Z87 A;  1TQZ A;  1WG7 A;  2GCL A;  4GPT B;  3PVW A;  3DXE A;  4Z2N A;  2G35 A;  2LYD A;  3SV1 A;  2UZR A;  1U29 A;  1V5M A;  2AEH A;  1DRO A;  1V61 A;  2DN6 A;  5C5B A;  4HHV A;  5KQ1 A;  2QKM A;  2Y7B A;  3T06 A;  2DLW A;  1EVH A;  2YT0 A;  5FI1 A;  4WSF A;  1M7E A;  2GJY A;  2OQB A;  2DHK A;  1DDM A;  1MKE A;  3CIK A;  1GC7 A;  3A8Q A;  1NI2 A;  1P6S A;  2RNR B;  1ZSQ A;  4GXB A;  1QQG A;  3VIA A;  1WGU A;  1XCG A;  2N23 A;  2IYB A;  1OY2 A;  1KZ7 A;  2Y8G A;  4MT7 A;  2D11 A;  1DDV A;  3F5R A;  1ZC3 B;  5D3V A;  1J0W A;  2D9X A;  1RRP B;  4DX9 0;  2Y8F A;  4DXA B;  3CXB B;  1KI1 B;  2FJL A;  2DHJ A;  1EF1 A;  2YS3 A;  1BAK A;  2DKP A;  3TFM A;  1UPQ A;  4CHJ A;  2I5F A;  1XX0 A;  3MPX A;  2Z0P A;  2YF0 A;  2DX5 A;  2EMT A;  2L2I A;  1K5G B;  3SO6 A;  3PG7 A;  3AU4 A;  2P8V A;  4ZRJ A;  2D10 A;  4HAW B;  1XR0 B;  3PZD A;  1UNR A;  2H7E A;  3KRX A;  4HDQ A;  5JLJ B;  3ML4 A;  2YT1 A;  3D8D A; 
#chains in the Genus database with same CATH topology
 3TCA A;  2X18 A;  2BCJ A;  2I5C A;  2LOZ A;  1U5F A;  4OT1 A;  3FSS A;  2Z0O A;  4DX8 A;  1I2H A;  1DYN A;  1H10 A;  2DKQ A;  5DH9 B;  5J3Y A;  5LOP B;  1U2B A;  1X1G A;  2E2X A;  3N7C A;  2Z59 A;  2MKR A;  2EJ8 A;  2P0D A;  3HW2 B;  4MY6 A;  3U7D A;  3A98 B;  2DA0 A;  1V89 A;  1W1H A;  4KAX B;  3MDB C;  5M4Y B;  2YT2 A;  1X11 A;  3PSC A;  2J59 M;  3SUZ A;  1BTK A;  3P6A A;  4KVG B;  5EFX A;  1UNQ A;  1XOD A;  4KHB B;  3KZ1 A;  1AWE A;  4NSW A;  2QKL A;  5D3W A;  4D6W A;  1FHO A;  4PQ0 A;  5JHH A;  2D9Y A;  2ADZ A;  5C6R A;  1PLS A;  2COF A;  1GG3 A;  3ULB A;  3OAN A;  1MAI A;  1V5P A;  2XQN M;  5J3Q A;  1OMW A;  2CY4 A;  3O96 A;  4K81 A;  2K2J A;  2YS1 A;  4F7G A;  5L81 A;  1ZM0 A;  5CLQ B;  1P5T A;  1UNP A;  2MWN B;  4HB3 B;  1T77 A;  5JHG A;  4HAT B;  1WJ1 A;  2KUP A;  2Z14 A;  1E5W A;  4YON A;  1AQC A;  2ZPY A;  3PP2 A;  1J19 A;  3ZVR A;  1WI1 A;  2KR0 A;  4TKN A;  2IFS A;  2YVC A;  2HE7 A;  2DX1 A;  4KHA A;  3QIJ A;  2D9Z A;  3HSA A;  2K8E A;  2DTC A;  2KIE A;  3X23 A;  2CY5 A;  3NSU A;  4GN1 A;  2L1C A;  3FM8 C;  3PVU A;  1BWN A;  2I1J A;  2ELA A;  4MK0 A;  3GYP A;  4HB0 B;  4B6H A;  3KY9 A;  1B55 A;  3AJ4 A;  4Z2M B;  1Q67 A;  2Q13 A;  5C16 A;  3KSY A;  5DHF B;  4HDO A;  1FGZ A;  2I1K A;  4GMV A;  4F7H A;  2VKI A;  1WJM A;  2N0Y A;  1FAO A;  3TW1 A;  4DIX A;  2KIG A;  1FGY A;  2VRW B;  2EMS A;  3GYO A;  4WJ7 A;  4KHO A;  1MK7 B;  1Y19 B;  1X1F A;  2J0M A;  2K00 A;  4WVF B;  3ULC A;  4ZRK A;  3VOQ A;  5FI0 A;  1W1G A;  1RJ2 A;  1I7A A;  2RLO A;  1TJ6 A;  2D9W A;  4K17 A;  2JP2 A;  2W2X D;  2GS0 A;  5C79 A;  4A6F A;  5KCV A;  2NMB A;  5C5B B;  4EMO A;  2KGX B;  3SNH A;  5I2M A;  2R0D A;  4KHB A;  5KQ4 A;  3G9W A;  1NU2 A;  2RSG A;  1UEF A;  4HSI A;  4L1R A;  3V5W A;  2R2Y A;  4IAP A;  4A6H A;  3HQC A;  3HK0 A;  3WA0 A;  3UZT A;  2P0H A;  2ZKM X;  3BIN A;  4P7I A;  1M7R A;  2K2U A;  4K2P A;  4CSQ A;  3ODX A;  3NWD A;  5D3Y A;  1LB1 A;  1MK9 B;  1Y5O A;  3AU5 A;  5LON B;  2M38 A;  3A8P A;  3PEG A;  1MIX A;  4EKU A;  1MI1 A;  2J0K A;  1QC6 A;  4A6K A;  2COA A;  3D8E A;  1LW3 A;  3D8F A;  5JP4 A;  1V88 A;  3TO1 A;  2P0F A;  1U5E A;  4PNK A;  2Z4D A;  5I2S A;  1NTV A;  1KZG A;  1PFJ A;  3FVC A;  2J0J A;  3DXC A;  1FOE A;  4C0A A;  4GMX B;  1PMS A;  4H8S A;  4L6E A;  3FEH A;  1U5G A;  2RUK B;  2DFK A;  4ZRI A;  1ZVR A;  2RVB B;  5GOW B;  3RCP A;  2KCJ A;  1P3R A;  2OTX A;  4F7U P;  1FHW A;  1SGH A;  2MFQ A;  3IVF A;  4HAX B;  1U5D A;  2CAY A;  1UPR A;  4IOY X;  3DCX A;  2NZ8 B;  3HIE A;  3M1I B;  3P7Z A;  3U8Z A;  1WGQ A;  3PVL A;  5DIF B;  2MDX A;  4TYZ A;  2LKO A;  3LJU X;  2D9V A;  5CLL B;  4HB4 B;  4GOU A;  5D27 A;  1X05 A;  1EAZ A;  2YS5 A;  4IFS A;  1WVH A;  5J3T A;  4HB2 B;  1TXD A;  2VSZ A;  2UVM A;  1FHX A;  1EGX A;  4EJN A;  1X86 A;  4CHM A;  3ODO A;  2YSZ A;  2CRF A;  2V76 A;  4A6F B;  1N3H A;  4GZU A;  5HE2 A;  1BTN A;  2W2X C;  4K2O A;  5DHA B;  3A58 A;  3DXD A;  4HAV B;  3WYF B;  4OSN A;  3QWM A;  2LOX A;  4HAY B;  2HTH B;  3U12 A;  2COC A;  3QBV B;  1DDW A;  4Y94 A;  4HAZ B;  2PZ1 A;  4XWX A;  4DBB A;  4BBK A;  3ODW A;  1K5D B;  1ZC4 B;  1ISN A;  2ROZ B;  3BJI A;  2W2W A;  1SHC A;  2YRY A;  1XD4 A;  2ELB A;  1H4R A;  1IRS A;  2GUM A;  2LUL A;  2COD A;  2H7D A;  1U27 A;  4A5K A;  2D4Q A;  2LG1 A;  3B77 A;  4YL8 A;  1W1D A;  3SYX A;  3NW8 A;  3F0W A;  5HE1 A;  4HAU B;  1MPH A;  2Z0Q A;  1XKE A;  2RGN B;  2UZS A;  2DYQ A;  2DYN A;  5D3X A;  1DBH A;  1OQN A;  2R09 A;  2DHI A;  2ROV A;  3ZDT A;  3KRW A;  1GC6 A;  5IRS A;  4CYE A;  2AL6 A;  5DI9 B;  3OHM B;  5HE0 A;  4NY0 A;  1NTY A;  2GCJ A;  1MIZ B;  3TVV A;  1V5U A;  1FB8 A;  2NBV A;  2Z13 A;  4D0N B;  2EC1 A;  2D2Q A;  2M14 A;  5HE3 A;  1Z87 A;  1TQZ A;  4QJ4 B;  1WG7 A;  2GCL A;  4GPT B;  3PVW A;  3DXE A;  4Z2N A;  4QJ5 B;  2G35 A;  2LYD A;  4QJ3 B;  3SV1 A;  2FJU B;  2UZR A;  1U29 A;  1V5M A;  2AEH A;  3NWF A;  1DRO A;  2KUQ A;  1V61 A;  2DN6 A;  5C5B A;  3NWA A;  4HHV A;  5KQ1 A;  2QKM A;  2Y7B A;  3T06 A;  2DLW A;  1EVH A;  2YT0 A;  5FI1 A;  4WSF A;  1M7E A;  2GJY A;  2OQB A;  2DHK A;  1DDM A;  1MKE A;  3CIK A;  1GC7 A;  3A8Q A;  1NI2 A;  1P6S A;  2RNR B;  2RRF A;  5LG4 B;  1ZSQ A;  4GXB A;  1QQG A;  3VIA A;  1WGU A;  1XCG A;  2N23 A;  2IYB A;  1OY2 A;  1KZ7 A;  2Y8G A;  4MT7 A;  2D11 A;  1DDV A;  3F5R A;  1ZC3 B;  5D3V A;  1J0W A;  2D9X A;  1RRP B;  1ZYI A;  4DX9 0;  4GNK B;  2Y8F A;  4DXA B;  3CXB B;  1KI1 B;  2FJL A;  2DHJ A;  1EF1 A;  2YS3 A;  1BAK A;  2DKP A;  3TFM A;  1UPQ A;  4CHJ A;  2I5F A;  1XX0 A;  3MPX A;  2Z0P A;  2YF0 A;  2DX5 A;  2EMT A;  2L2I A;  1K5G B;  2K49 A;  3SO6 A;  3PG7 A;  3AU4 A;  2P8V A;  4ZRJ A;  2D10 A;  4HAW B;  1XR0 B;  3PZD A;  1UNR A;  2H7E A;  3KRX A;  4HDQ A;  4QXA B;  3ML4 A;  5JLJ B;  2YT1 A;  3D8D A; 
#chains in the Genus database with same CATH homology
 3TCA A;  2X18 A;  2BCJ A;  2I5C A;  2LOZ A;  1U5F A;  3FSS A;  2Z0O A;  4DX8 A;  1I2H A;  1DYN A;  1H10 A;  2DKQ A;  5DH9 B;  5J3Y A;  5LOP B;  1U2B A;  1X1G A;  2E2X A;  3N7C A;  2MKR A;  2EJ8 A;  2P0D A;  3HW2 B;  4MY6 A;  3U7D A;  3A98 B;  2DA0 A;  1V89 A;  1W1H A;  4KAX B;  3MDB C;  1X11 A;  3PSC A;  2J59 M;  3SUZ A;  1BTK A;  3P6A A;  4KVG B;  5EFX A;  1UNQ A;  1XOD A;  4KHB B;  3KZ1 A;  1AWE A;  4NSW A;  2QKL A;  5D3W A;  1FHO A;  4PQ0 A;  5JHH A;  2D9Y A;  2ADZ A;  5C6R A;  1PLS A;  2COF A;  1GG3 A;  3ULB A;  3OAN A;  1MAI A;  1V5P A;  2XQN M;  5J3Q A;  1OMW A;  2CY4 A;  3O96 A;  4K81 A;  2K2J A;  2YS1 A;  4F7G A;  5L81 A;  1ZM0 A;  5CLQ B;  1P5T A;  1UNP A;  2MWN B;  4HB3 B;  5JHG A;  4HAT B;  1WJ1 A;  2KUP A;  1E5W A;  4YON A;  1AQC A;  2ZPY A;  3PP2 A;  1J19 A;  3ZVR A;  1WI1 A;  4TKN A;  2IFS A;  2YVC A;  2HE7 A;  2DX1 A;  4KHA A;  3QIJ A;  2D9Z A;  2DTC A;  3X23 A;  2CY5 A;  3NSU A;  4GN1 A;  2L1C A;  3FM8 C;  3PVU A;  1BWN A;  2I1J A;  2ELA A;  4MK0 A;  3GYP A;  4HB0 B;  4B6H A;  3KY9 A;  1B55 A;  3AJ4 A;  4Z2M B;  1Q67 A;  2Q13 A;  5C16 A;  3KSY A;  5DHF B;  4HDO A;  1FGZ A;  2I1K A;  4GMV A;  4F7H A;  2VKI A;  1WJM A;  2N0Y A;  1FAO A;  3TW1 A;  1FGY A;  2VRW B;  2EMS A;  3GYO A;  4WJ7 A;  4KHO A;  1MK7 B;  1Y19 B;  1X1F A;  2J0M A;  2K00 A;  4WVF B;  3ULC A;  4ZRK A;  3VOQ A;  5FI0 A;  1W1G A;  1RJ2 A;  1I7A A;  2RLO A;  1TJ6 A;  2D9W A;  4K17 A;  2JP2 A;  2W2X D;  2GS0 A;  5C79 A;  4A6F A;  5KCV A;  2NMB A;  5C5B B;  4EMO A;  2KGX B;  3SNH A;  2R0D A;  5KQ4 A;  3G9W A;  1NU2 A;  2RSG A;  1UEF A;  3V5W A;  4IAP A;  4A6H A;  3HQC A;  3HK0 A;  3WA0 A;  3UZT A;  2P0H A;  3BIN A;  4P7I A;  1M7R A;  2K2U A;  4K2P A;  3ODX A;  5D3Y A;  1LB1 A;  1MK9 B;  1Y5O A;  3AU5 A;  5LON B;  2M38 A;  3A8P A;  3PEG A;  1MIX A;  4EKU A;  2J0K A;  1QC6 A;  4A6K A;  2COA A;  3D8E A;  1LW3 A;  3D8F A;  5JP4 A;  1V88 A;  3TO1 A;  2P0F A;  1U5E A;  4PNK A;  1NTV A;  1KZG A;  1PFJ A;  2J0J A;  3DXC A;  1FOE A;  4C0A A;  4GMX B;  1PMS A;  4H8S A;  4L6E A;  3FEH A;  1U5G A;  2RUK B;  2DFK A;  4ZRI A;  1ZVR A;  2RVB B;  5GOW B;  3RCP A;  2KCJ A;  1P3R A;  2OTX A;  4F7U P;  1FHW A;  1SGH A;  2MFQ A;  3IVF A;  4HAX B;  1U5D A;  2CAY A;  1UPR A;  4IOY X;  2NZ8 B;  3M1I B;  3P7Z A;  3U8Z A;  1WGQ A;  3PVL A;  5DIF B;  2MDX A;  4TYZ A;  2LKO A;  3LJU X;  2D9V A;  5CLL B;  4HB4 B;  5D27 A;  1X05 A;  1EAZ A;  2YS5 A;  4IFS A;  1WVH A;  5J3T A;  4HB2 B;  1TXD A;  2VSZ A;  2UVM A;  1FHX A;  1EGX A;  4EJN A;  1X86 A;  4CHM A;  3ODO A;  2YSZ A;  2CRF A;  2V76 A;  4A6F B;  1N3H A;  4GZU A;  5HE2 A;  1BTN A;  2W2X C;  4K2O A;  5DHA B;  3DXD A;  4HAV B;  3WYF B;  3QWM A;  2LOX A;  4HAY B;  2HTH B;  2COC A;  3QBV B;  1DDW A;  4Y94 A;  4HAZ B;  2PZ1 A;  4XWX A;  4DBB A;  4BBK A;  3ODW A;  1K5D B;  1ZC4 B;  1ISN A;  2ROZ B;  3BJI A;  2W2W A;  1SHC A;  2YRY A;  1XD4 A;  2ELB A;  1H4R A;  1IRS A;  2LUL A;  2COD A;  2H7D A;  1U27 A;  4A5K A;  2D4Q A;  2LG1 A;  4YL8 A;  1W1D A;  3SYX A;  3F0W A;  5HE1 A;  4HAU B;  1MPH A;  2Z0Q A;  1XKE A;  2RGN B;  2UZS A;  2DYQ A;  2DYN A;  5D3X A;  1DBH A;  1OQN A;  2R09 A;  2DHI A;  2ROV A;  3ZDT A;  3KRW A;  1GC6 A;  4CYE A;  2AL6 A;  5DI9 B;  5HE0 A;  4NY0 A;  1NTY A;  2GCJ A;  1MIZ B;  3TVV A;  1V5U A;  1FB8 A;  4D0N B;  2EC1 A;  2D2Q A;  2M14 A;  5HE3 A;  1Z87 A;  1TQZ A;  1WG7 A;  2GCL A;  4GPT B;  3PVW A;  3DXE A;  4Z2N A;  2G35 A;  2LYD A;  3SV1 A;  2UZR A;  1U29 A;  1V5M A;  2AEH A;  1DRO A;  1V61 A;  2DN6 A;  5C5B A;  4HHV A;  5KQ1 A;  2QKM A;  2Y7B A;  3T06 A;  2DLW A;  1EVH A;  2YT0 A;  5FI1 A;  4WSF A;  1M7E A;  2GJY A;  2OQB A;  2DHK A;  1DDM A;  1MKE A;  3CIK A;  1GC7 A;  3A8Q A;  1NI2 A;  1P6S A;  2RNR B;  1ZSQ A;  4GXB A;  1QQG A;  3VIA A;  1WGU A;  1XCG A;  2N23 A;  2IYB A;  1OY2 A;  1KZ7 A;  2Y8G A;  4MT7 A;  2D11 A;  1DDV A;  3F5R A;  1ZC3 B;  5D3V A;  1J0W A;  2D9X A;  1RRP B;  4DX9 0;  2Y8F A;  4DXA B;  3CXB B;  1KI1 B;  2FJL A;  2DHJ A;  1EF1 A;  2YS3 A;  1BAK A;  2DKP A;  3TFM A;  1UPQ A;  4CHJ A;  2I5F A;  1XX0 A;  3MPX A;  2Z0P A;  2YF0 A;  2DX5 A;  2EMT A;  2L2I A;  1K5G B;  3SO6 A;  3PG7 A;  3AU4 A;  2P8V A;  4ZRJ A;  2D10 A;  4HAW B;  1XR0 B;  3PZD A;  1UNR A;  2H7E A;  3KRX A;  4HDQ A;  5JLJ B;  3ML4 A;  2YT1 A;  3D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...