3DXDA

Crystal structure of the intracellular domain of human app (t668e mutant) in complex with fe65-ptb2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Amyloid beta A4 protein-binding family B member 1
publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 131
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxdA00
3PVLA 1KI1B 1UPRA 2LYDA 3D8EA 2CY4A 4DXAB 4HDOA 1GC7A 5C5BA 2I1JA 3LJUX 2Q13A 4PNKA 2IYBA 1U2BA 1Q67A 3UZTA 3ODOA 1ZC4B 4Z2MB 2BCJA 3AJ4A 2DHKA 4P7IA 4HAYB 4PQ0A 4GMXB 4HATB 2YS5A 3ML4A 1FOEA 1ZVRA 1EGXA 1UNRA 2VKIA 1GC6A 1WJ1A 2J0MA 3O96A 3TCAA 1V5MA 2Z0QA 1NI2A 4A5KA 3QBVB 2DLWA 3FM8C 1MPHA 2RSGA 2X18A 4TYZA 3BJIA 3M1IB 2UVMA 4K2PA 4HHVA 3SUZA 1N3HA 1U5EA 3TVVA 1X05A 2DX1A 2L2IA 4Z2NA 3PZDA 3MPXA 5CLQB 2DA0A 3SV1A 1J19A 2EJ8A 2Y8GA 2CAYA 2AL6A 1AWEA 5HE0A 1XR0B 1U5DA 2GS0A 1KZGA 3HQCA 1U5FA 2DKQA 2OTXA 2DYNA 2P0FA 5LONB 1WI1A 1NU2A 1PMSA 3D8FA 1FB8A 5CLLB 5C16A 1TXDA 1DDWA 2RNRB 2YT1A 5JHGA 1XCGA 1RRPB 2COFA 3U7DA 4HB3B 2D11A 1W1HA 2ADZA 4TKNA 3KRWA 5HE3A 3X23A 2ELAA 1V89A 2R09A 2D9WA 4K17A 2LG1A 1J0WA 3ODWA 1P3RA 2RGNB 1U5GA 1LW3A 4YONA 4IOYX 1DYNA 3A8PA 4HAXB 5C6RA 3WYFB 1PLSA 4ZRKA 4NSWA 1LB1A 1WVHA 3T06A 1PFJA 1MAIA 2Z0PA 2MFQA 5DHFB 3VIAA 3AU5A 4XWXA 5DIFB 1X1FA 2J0JA 3HK0A 1B55A 3G9WA 4ZRJA 3SYXA 4WJ7A 2ROZB 5HE1A 4DX90 2YRYA 2DHIA 2ZPYA 1NTYA 3AU4A 3ULCA 4A6KA 1I2HA 4C0AA 1WGUA 2D4QA 4KVGB 1GG3A 1MK7B 1WGQA 1KZ7A 3V5WA 2CRFA 4Y94A 2Y8FA 2RVBB 4ZRIA 2QKMA 2W2WA 2EMSA 1DDMA 5JP4A 3FSSA 1TQZA 2I5FA 2K2UA 2LKOA 3IVFA 2W2XD 1P5TA 2KGXB 3F0WA 2YSZA 4CHMA 2LOXA 3ZVRA 2DHJA 4HB4B 2ELBA 4GN1A 3D8DA 2N0YA 4EKUA 3ODXA 2DFKA 2G35A 5D3WA 5KQ4A 2COCA 1Z87A 2H7EA 3P6AA 4K81A 3OANA 2UZRA 5L81A 4GMVA 1OMWA 2NMBA 1WG7A 4MK0A 2I1KA 5LOPB 3PEGA 2R0DA 5FI0A 1MIXA 3N7CA 5DI9B 1V61A 3DXCA 5J3TA 3GYPA 1FHWA 2RLOA 2K2JA 5D3XA 1SGHA 5J3QA 2J59M 3TO1A 1ZC3B 4H8SA 3BINA 1FHOA 4WSFA 2P0HA 2M14A 1XKEA 3TFMA 4HB0B 1W1DA 1DBHA 2I5CA 2OQBA 3CXBB 5D3YA 1IRSA 2VSZA 4NY0A 3CIKA 4MT7A 3DXEA 3KRXA 4YL8A 1U29A 4DBBA 1U27A 3F5RA 4GZUA 3ULBA 4BBKA 3NSUA 2CY5A 1QQGA 1UEFA 2Z0OA 2J0KA 3SO6A 2RUKB 5EFXA 1MK9B 4IFSA 2K00A 1FGYA 5C79A 2YVCA 1XD4A 2IFSA 2COAA 4HAUB 1TJ6A 1V5UA 3KSYA 1UPQA 3A8QA 1BTKA 5JLJB 3GYOA 4GXBA 4A6FB 2EMTA 5D3VA 3FEHA 3RCPA 1V5PA 3P7ZA 1BAKA 2GCLA 4HB2B 4F7UP 1ISNA 1UNQA 4EJNA 5DHAB 4WVFB 5HE2A 1BWNA 4F7HA 2GJYA 3QIJA 1MIZB 1H4RA 1MKEA 2YF0A 2HTHB 2VRWB 3HW2B 3U8ZA 2JP2A 2YS1A 1M7RA 5D27A 2DTCA 1M7EA 2M38A 5FI1A 2LOZA 2HE7A 3MDBC 3PVUA 5JHHA 1E5WA 3TW1A 2MDXA 2KUPA 1OY2A 1X11A 2DX5A 2EC1A 2YS3A 4CYEA 2QKLA 3PVWA 2CODA 4HAWB 4DX8A 2PZ1A 5J3YA 1I7AA 1K5DB 1P6SA 2FJLA 2GCJA 2MWNB 2ROVA 3KZ1A 5C5BB 4F7GA 1DDVA 4KHOA 1ZSQA 2D10A 2MKRA 2LULA 4A6HA 1AQCA 1FGZA 1W1GA 3WA0A 2AEHA 2D9ZA 4HAVB 4CHJA 2D9XA 1EF1A 1EVHA 2YT0A 4B6HA 2P8VA 3SNHA 2DKPA 2D9YA 1EAZA 1K5GB 5KQ1A 1Y19B 4KHAA 2N23A 2D2QA 5KCVA 1SHCA 4KHBB 1BTNA 4HAZB 2D9VA 2XQNM 3PG7A 4A6FA 2V76A 4K2OA 1QC6A 1H10A 2NZ8B 5GOWB 4KAXB 5DH9B 1FHXA 2KCJA 1XODA 1NTVA 1FAOA 1ZM0A 3A98B 1X86A 2DYQA 3ZDTA 1OQNA 3QWMA 2L1CA 2UZSA 1XX0A 2P0DA 3PP2A 3PSCA 4IAPA 3KY9A 1V88A 4L6EA 1Y5OA 1RJ2A 1WJMA 2E2XA 3VOQA 4D0NB 2DN6A 4GPTB 4MY6A 1X1GA 1UNPA 2W2XC 3DXDA 4HDQA 2Y7BA 1DROA 4EMOA 2H7DA
chains in the Genus database with same CATH superfamily
3PVLA 1KI1B 1UPRA 2LYDA 3D8EA 4OSNA 2CY4A 4DXAB 4HDOA 1GC7A 5C5BA 2I1JA 3LJUX 2Q13A 4PNKA 2IYBA 1U2BA 1Q67A 3UZTA 3ODOA 2ZKMX 1ZC4B 4Z2MB 2BCJA 3AJ4A 2DHKA 4P7IA 4HAYB 4PQ0A 4GMXB 4HATB 2YS5A 1ZVRA 1FOEA 3ML4A 1EGXA 1UNRA 2VKIA 1GC6A 4D6WA 1WJ1A 2J0MA 3O96A 3TCAA 1V5MA 2Z0QA 1NI2A 4A5KA 3QBVB 2DLWA 3FM8C 1MPHA 2Z13A 2RSGA 2X18A 4TYZA 4KHBA 3BJIA 3M1IB 2UVMA 2KR0A 4K2PA 4HHVA 3SUZA 1N3HA 4DIXA 5I2MA 1U5EA 3TVVA 1X05A 2DX1A 2L2IA 4Z2NA 3PZDA 3MPXA 5CLQB 2DA0A 3SV1A 1J19A 2EJ8A 4GNKB 2Y8GA 2CAYA 2AL6A 1AWEA 5HE0A 1XR0B 1U5DA 2GS0A 1KZGA 3HQCA 1U5FA 4HSIA 1MI1A 2DKQA 2OTXA 2DYNA 2P0FA 5LONB 1WI1A 1NU2A 1PMSA 3D8FA 1FB8A 5CLLB 2R2YA 5C16A 3OHMB 1TXDA 1DDWA 2RNRB 2YT1A 5JHGA 1XCGA 1RRPB 2COFA 3U7DA 4HB3B 2RRFA 2D11A 1W1HA 2ADZA 4TKNA 3KRWA 5HE3A 3X23A 4CSQA 2ELAA 1V89A 2R09A 2D9WA 3NWFA 4K17A 2LG1A 1J0WA 3ODWA 1P3RA 2RGNB 1U5GA 1LW3A 4YONA 4IOYX 1DYNA 5I2SA 3A8PA 4HAXB 5C6RA 3WYFB 1PLSA 4ZRKA 2GUMA 4NSWA 1LB1A 1WVHA 3T06A 1PFJA 1MAIA 2Z0PA 2MFQA 5DHFB 3VIAA 3AU5A 4OT1A 4QJ4B 4XWXA 5DIFB 1X1FA 2J0JA 3HK0A 1B55A 3G9WA 2FJUB 4ZRJA 3SYXA 4WJ7A 5LG4B 2ROZB 5HE1A 4DX90 2YRYA 2DHIA 2ZPYA 1NTYA 3AU4A 3ULCA 4A6KA 1I2HA 5IRSA 4C0AA 1WGUA 2D4QA 4KVGB 1T77A 1GG3A 1MK7B 1WGQA 1KZ7A 3V5WA 2CRFA 4Y94A 2Y8FA 2RVBB 4ZRIA 2QKMA 2W2WA 2EMSA 1DDMA 5JP4A 3FSSA 1TQZA 2I5FA 2K2UA 2LKOA 3IVFA 2W2XD 1P5TA 2KGXB 3F0WA 2YSZA 4CHMA 2KUQA 2LOXA 3ZVRA 2DHJA 4HB4B 2ELBA 4GN1A 3D8DA 2N0YA 4EKUA 3ODXA 3A58A 3DCXA 2DFKA 2G35A 5D3WA 5KQ4A 2COCA 1Z87A 2H7EA 3P6AA 4K81A 3OANA 2Z4DA 2UZRA 5L81A 4GMVA 1OMWA 2NMBA 1WG7A 2Z14A 4MK0A 2I1KA 5LOPB 3PEGA 2R0DA 5FI0A 1MIXA 3N7CA 5DI9B 1V61A 3DXCA 5J3TA 3GYPA 1FHWA 2RLOA 2K2JA 5D3XA 1SGHA 5J3QA 2J59M 3TO1A 1ZC3B 4H8SA 3BINA 1FHOA 4WSFA 2P0HA 4GOUA 2M14A 1XKEA 3TFMA 2YT2A 4HB0B 1W1DA 1DBHA 3FVCA 2I5CA 2OQBA 3CXBB 1ZYIA 5D3YA 1IRSA 2VSZA 3NWAA 4NY0A 3CIKA 4MT7A 3DXEA 2NBVA 3KRXA 4YL8A 1U29A 4DBBA 1U27A 3F5RA 4GZUA 3HSAA 3ULBA 4BBKA 3NSUA 2CY5A 1QQGA 1UEFA 2Z0OA 2J0KA 3SO6A 2RUKB 5EFXA 1MK9B 4IFSA 2K00A 1FGYA 3B77A 5C79A 2YVCA 1XD4A 2IFSA 2KIEA 2COAA 4HAUB 1TJ6A 1V5UA 3KSYA 1UPQA 3A8QA 1BTKA 5JLJB 3GYOA 4QJ5B 4GXBA 4A6FB 2EMTA 5D3VA 3FEHA 3RCPA 1V5PA 3P7ZA 1BAKA 2GCLA 3HIEA 4HB2B 4F7UP 1ISNA 1UNQA 4EJNA 5DHAB 4WVFB 5HE2A 1BWNA 3NW8A 4F7HA 2GJYA 3QIJA 1MIZB 1H4RA 1MKEA 2YF0A 2HTHB 2VRWB 3HW2B 3U8ZA 2JP2A 2YS1A 1M7RA 5D27A 2DTCA 1M7EA 2M38A 5FI1A 2LOZA 2HE7A 3MDBC 3PVUA 5JHHA 1E5WA 3TW1A 2MDXA 3NWDA 2KIGA 2KUPA 1OY2A 1X11A 2DX5A 2EC1A 2YS3A 4CYEA 2QKLA 3PVWA 2CODA 4HAWB 4QXAB 4DX8A 2PZ1A 5J3YA 1I7AA 1K5DB 1P6SA 2FJLA 2GCJA 2MWNB 2ROVA 3KZ1A 5C5BB 2Z59A 4F7GA 1DDVA 4KHOA 1ZSQA 2D10A 2MKRA 2LULA 4A6HA 1AQCA 1FGZA 1W1GA 3WA0A 2AEHA 2D9ZA 4HAVB 4CHJA 2D9XA 1EF1A 1EVHA 2YT0A 4B6HA 2P8VA 3SNHA 2K8EA 2DKPA 2D9YA 1EAZA 1K5GB 5KQ1A 1Y19B 4KHAA 2N23A 2D2QA 5KCVA 1SHCA 4KHBB 4L1RA 1BTNA 4HAZB 2D9VA 2XQNM 3PG7A 4A6FA 2V76A 4K2OA 4QJ3B 1QC6A 1H10A 2NZ8B 5GOWB 4KAXB 5DH9B 3U12A 1FHXA 2KCJA 1XODA 1NTVA 1FAOA 1ZM0A 3A98B 1X86A 2DYQA 3ZDTA 1OQNA 3QWMA 2L1CA 2UZSA 1XX0A 2P0DA 3PP2A 3PSCA 4IAPA 3KY9A 1V88A 4L6EA 1Y5OA 1RJ2A 1WJMA 2E2XA 3VOQA 4D0NB 2DN6A 4GPTB 4MY6A 1X1GA 1UNPA 2W2XC 3DXDA 5M4YB 4HDQA 2Y7BA 1DROA 4EMOA 2K49A 2H7DA
chains in the Genus database with same CATH topology
3PVLA 1KI1B 1UPRA 2LYDA 3D8EA 2CY4A 4DXAB 4HDOA 1GC7A 5C5BA 2I1JA 3LJUX 2Q13A 4PNKA 2IYBA 1U2BA 1Q67A 3UZTA 3ODOA 1ZC4B 4Z2MB 2BCJA 3AJ4A 2DHKA 4P7IA 4HAYB 4PQ0A 4GMXB 4HATB 2YS5A 3ML4A 1FOEA 1ZVRA 1EGXA 1UNRA 2VKIA 1GC6A 1WJ1A 2J0MA 3O96A 3TCAA 1V5MA 2Z0QA 1NI2A 4A5KA 3QBVB 2DLWA 3FM8C 1MPHA 2RSGA 2X18A 4TYZA 3BJIA 3M1IB 2UVMA 4K2PA 4HHVA 3SUZA 1N3HA 1U5EA 3TVVA 1X05A 2DX1A 2L2IA 4Z2NA 3PZDA 3MPXA 5CLQB 2DA0A 3SV1A 1J19A 2EJ8A 2Y8GA 2CAYA 2AL6A 1AWEA 5HE0A 1XR0B 1U5DA 2GS0A 1KZGA 3HQCA 1U5FA 2DKQA 2OTXA 2DYNA 2P0FA 5LONB 1WI1A 1NU2A 1PMSA 3D8FA 1FB8A 5CLLB 5C16A 1TXDA 1DDWA 2RNRB 2YT1A 5JHGA 1XCGA 1RRPB 2COFA 3U7DA 4HB3B 2D11A 1W1HA 2ADZA 4TKNA 3KRWA 5HE3A 3X23A 2ELAA 1V89A 2R09A 2D9WA 4K17A 2LG1A 1J0WA 3ODWA 1P3RA 2RGNB 1U5GA 1LW3A 4YONA 4IOYX 1DYNA 3A8PA 4HAXB 5C6RA 3WYFB 1PLSA 4ZRKA 4NSWA 1LB1A 1WVHA 3T06A 1PFJA 1MAIA 2Z0PA 2MFQA 5DHFB 3VIAA 3AU5A 4XWXA 5DIFB 1X1FA 2J0JA 3HK0A 1B55A 3G9WA 4ZRJA 3SYXA 4WJ7A 2ROZB 5HE1A 4DX90 2YRYA 2DHIA 2ZPYA 1NTYA 3AU4A 3ULCA 4A6KA 1I2HA 4C0AA 1WGUA 2D4QA 4KVGB 1GG3A 1MK7B 1WGQA 1KZ7A 3V5WA 2CRFA 4Y94A 2Y8FA 2RVBB 4ZRIA 2QKMA 2W2WA 2EMSA 1DDMA 5JP4A 3FSSA 1TQZA 2I5FA 2K2UA 2LKOA 3IVFA 2W2XD 1P5TA 2KGXB 3F0WA 2YSZA 4CHMA 2LOXA 3ZVRA 2DHJA 4HB4B 2ELBA 4GN1A 3D8DA 2N0YA 4EKUA 3ODXA 2DFKA 2G35A 5D3WA 5KQ4A 2COCA 1Z87A 2H7EA 3P6AA 4K81A 3OANA 2UZRA 5L81A 4GMVA 1OMWA 2NMBA 1WG7A 4MK0A 2I1KA 5LOPB 3PEGA 2R0DA 5FI0A 1MIXA 3N7CA 5DI9B 1V61A 3DXCA 5J3TA 3GYPA 1FHWA 2RLOA 2K2JA 5D3XA 1SGHA 5J3QA 2J59M 3TO1A 1ZC3B 4H8SA 3BINA 1FHOA 4WSFA 2P0HA 2M14A 1XKEA 3TFMA 4HB0B 1W1DA 1DBHA 2I5CA 2OQBA 3CXBB 5D3YA 1IRSA 2VSZA 4NY0A 3CIKA 4MT7A 3DXEA 3KRXA 4YL8A 1U29A 4DBBA 1U27A 3F5RA 4GZUA 3ULBA 4BBKA 3NSUA 2CY5A 1QQGA 1UEFA 2Z0OA 2J0KA 3SO6A 2RUKB 5EFXA 1MK9B 4IFSA 2K00A 1FGYA 5C79A 2YVCA 1XD4A 2IFSA 2COAA 4HAUB 1TJ6A 1V5UA 3KSYA 1UPQA 3A8QA 1BTKA 5JLJB 3GYOA 4GXBA 4A6FB 2EMTA 5D3VA 3FEHA 3RCPA 1V5PA 3P7ZA 1BAKA 2GCLA 4HB2B 4F7UP 1ISNA 1UNQA 4EJNA 5DHAB 4WVFB 5HE2A 1BWNA 4F7HA 2GJYA 3QIJA 1MIZB 1H4RA 1MKEA 2YF0A 2HTHB 2VRWB 3HW2B 3U8ZA 2JP2A 2YS1A 1M7RA 5D27A 2DTCA 1M7EA 2M38A 5FI1A 2LOZA 2HE7A 3MDBC 3PVUA 5JHHA 1E5WA 3TW1A 2MDXA 2KUPA 1OY2A 1X11A 2DX5A 2EC1A 2YS3A 4CYEA 2QKLA 3PVWA 2CODA 4HAWB 4DX8A 2PZ1A 5J3YA 1I7AA 1K5DB 1P6SA 2FJLA 2GCJA 2MWNB 2ROVA 3KZ1A 5C5BB 4F7GA 1DDVA 4KHOA 1ZSQA 2D10A 2MKRA 2LULA 4A6HA 1AQCA 1FGZA 1W1GA 3WA0A 2AEHA 2D9ZA 4HAVB 4CHJA 2D9XA 1EF1A 1EVHA 2YT0A 4B6HA 2P8VA 3SNHA 2DKPA 2D9YA 1EAZA 1K5GB 5KQ1A 1Y19B 4KHAA 2N23A 2D2QA 5KCVA 1SHCA 4KHBB 1BTNA 4HAZB 2D9VA 2XQNM 3PG7A 4A6FA 2V76A 4K2OA 1QC6A 1H10A 2NZ8B 5GOWB 4KAXB 5DH9B 1FHXA 2KCJA 1XODA 1NTVA 1FAOA 1ZM0A 3A98B 1X86A 2DYQA 3ZDTA 1OQNA 3QWMA 2L1CA 2UZSA 1XX0A 2P0DA 3PP2A 3PSCA 4IAPA 3KY9A 1V88A 4L6EA 1Y5OA 1RJ2A 1WJMA 2E2XA 3VOQA 4D0NB 2DN6A 4GPTB 4MY6A 1X1GA 1UNPA 2W2XC 3DXDA 4HDQA 2Y7BA 1DROA 4EMOA 2H7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  1KI1 B;  1UPR A;  2LYD A;  3D8E A;  2CY4 A;  4DXA B;  4HDO A;  1GC7 A;  5C5B A;  2I1J A;  3LJU X;  2Q13 A;  4PNK A;  2IYB A;  1U2B A;  1Q67 A;  3UZT A;  3ODO A;  1ZC4 B;  4Z2M B;  2BCJ A;  3AJ4 A;  2DHK A;  4P7I A;  4HAY B;  4PQ0 A;  4GMX B;  4HAT B;  2YS5 A;  3ML4 A;  1FOE A;  1ZVR A;  1EGX A;  1UNR A;  2VKI A;  1GC6 A;  1WJ1 A;  2J0M A;  3O96 A;  3TCA A;  1V5M A;  2Z0Q A;  1NI2 A;  4A5K A;  3QBV B;  2DLW A;  3FM8 C;  1MPH A;  2RSG A;  2X18 A;  4TYZ A;  3BJI A;  3M1I B;  2UVM A;  4K2P A;  4HHV A;  3SUZ A;  1N3H A;  1U5E A;  3TVV A;  1X05 A;  2DX1 A;  2L2I A;  4Z2N A;  3PZD A;  3MPX A;  5CLQ B;  2DA0 A;  3SV1 A;  1J19 A;  2EJ8 A;  2Y8G A;  2CAY A;  2AL6 A;  1AWE A;  5HE0 A;  1XR0 B;  1U5D A;  2GS0 A;  1KZG A;  3HQC A;  1U5F A;  2DKQ A;  2OTX A;  2DYN A;  2P0F A;  5LON B;  1WI1 A;  1NU2 A;  1PMS A;  3D8F A;  1FB8 A;  5CLL B;  5C16 A;  1TXD A;  1DDW A;  2RNR B;  2YT1 A;  5JHG A;  1XCG A;  1RRP B;  2COF A;  3U7D A;  4HB3 B;  2D11 A;  1W1H A;  2ADZ A;  4TKN A;  3KRW A;  5HE3 A;  3X23 A;  2ELA A;  1V89 A;  2R09 A;  2D9W A;  4K17 A;  2LG1 A;  1J0W A;  3ODW A;  1P3R A;  2RGN B;  1U5G A;  1LW3 A;  4YON A;  4IOY X;  1DYN A;  3A8P A;  4HAX B;  5C6R A;  3WYF B;  1PLS A;  4ZRK A;  4NSW A;  1LB1 A;  1WVH A;  3T06 A;  1PFJ A;  1MAI A;  2Z0P A;  2MFQ A;  5DHF B;  3VIA A;  3AU5 A;  4XWX A;  5DIF B;  1X1F A;  2J0J A;  3HK0 A;  1B55 A;  3G9W A;  4ZRJ A;  3SYX A;  4WJ7 A;  2ROZ B;  5HE1 A;  4DX9 0;  2YRY A;  2DHI A;  2ZPY A;  1NTY A;  3AU4 A;  3ULC A;  4A6K A;  1I2H A;  4C0A A;  1WGU A;  2D4Q A;  4KVG B;  1GG3 A;  1MK7 B;  1WGQ A;  1KZ7 A;  3V5W A;  2CRF A;  4Y94 A;  2Y8F A;  2RVB B;  4ZRI A;  2QKM A;  2W2W A;  2EMS A;  1DDM A;  5JP4 A;  3FSS A;  1TQZ A;  2I5F A;  2K2U A;  2LKO A;  3IVF A;  2W2X D;  1P5T A;  2KGX B;  3F0W A;  2YSZ A;  4CHM A;  2LOX A;  3ZVR A;  2DHJ A;  4HB4 B;  2ELB A;  4GN1 A;  3D8D A;  2N0Y A;  4EKU A;  3ODX A;  2DFK A;  2G35 A;  5D3W A;  5KQ4 A;  2COC A;  1Z87 A;  2H7E A;  3P6A A;  4K81 A;  3OAN A;  2UZR A;  5L81 A;  4GMV A;  1OMW A;  2NMB A;  1WG7 A;  4MK0 A;  2I1K A;  5LOP B;  3PEG A;  2R0D A;  5FI0 A;  1MIX A;  3N7C A;  5DI9 B;  1V61 A;  3DXC A;  5J3T A;  3GYP A;  1FHW A;  2RLO A;  2K2J A;  5D3X A;  1SGH A;  5J3Q A;  2J59 M;  3TO1 A;  1ZC3 B;  4H8S A;  3BIN A;  1FHO A;  4WSF A;  2P0H A;  2M14 A;  1XKE A;  3TFM A;  4HB0 B;  1W1D A;  1DBH A;  2I5C A;  2OQB A;  3CXB B;  5D3Y A;  1IRS A;  2VSZ A;  4NY0 A;  3CIK A;  4MT7 A;  3DXE A;  3KRX A;  4YL8 A;  1U29 A;  4DBB A;  1U27 A;  3F5R A;  4GZU A;  3ULB A;  4BBK A;  3NSU A;  2CY5 A;  1QQG A;  1UEF A;  2Z0O A;  2J0K A;  3SO6 A;  2RUK B;  5EFX A;  1MK9 B;  4IFS A;  2K00 A;  1FGY A;  5C79 A;  2YVC A;  1XD4 A;  2IFS A;  2COA A;  4HAU B;  1TJ6 A;  1V5U A;  3KSY A;  1UPQ A;  3A8Q A;  1BTK A;  5JLJ B;  3GYO A;  4GXB A;  4A6F B;  2EMT A;  5D3V A;  3FEH A;  3RCP A;  1V5P A;  3P7Z A;  1BAK A;  2GCL A;  4HB2 B;  4F7U P;  1ISN A;  1UNQ A;  4EJN A;  5DHA B;  4WVF B;  5HE2 A;  1BWN A;  4F7H A;  2GJY A;  3QIJ A;  1MIZ B;  1H4R A;  1MKE A;  2YF0 A;  2HTH B;  2VRW B;  3HW2 B;  3U8Z A;  2JP2 A;  2YS1 A;  1M7R A;  5D27 A;  2DTC A;  1M7E A;  2M38 A;  5FI1 A;  2LOZ A;  2HE7 A;  3MDB C;  3PVU A;  5JHH A;  1E5W A;  3TW1 A;  2MDX A;  2KUP A;  1OY2 A;  1X11 A;  2DX5 A;  2EC1 A;  2YS3 A;  4CYE A;  2QKL A;  3PVW A;  2COD A;  4HAW B;  4DX8 A;  2PZ1 A;  5J3Y A;  1I7A A;  1K5D B;  1P6S A;  2FJL A;  2GCJ A;  2MWN B;  2ROV A;  3KZ1 A;  5C5B B;  4F7G A;  1DDV A;  4KHO A;  1ZSQ A;  2D10 A;  2MKR A;  2LUL A;  4A6H A;  1AQC A;  1FGZ A;  1W1G A;  3WA0 A;  2AEH A;  2D9Z A;  4HAV B;  4CHJ A;  2D9X A;  1EF1 A;  1EVH A;  2YT0 A;  4B6H A;  2P8V A;  3SNH A;  2DKP A;  2D9Y A;  1EAZ A;  1K5G B;  5KQ1 A;  1Y19 B;  4KHA A;  2N23 A;  2D2Q A;  5KCV A;  1SHC A;  4KHB B;  1BTN A;  4HAZ B;  2D9V A;  2XQN M;  3PG7 A;  4A6F A;  2V76 A;  4K2O A;  1QC6 A;  1H10 A;  2NZ8 B;  5GOW B;  4KAX B;  5DH9 B;  1FHX A;  2KCJ A;  1XOD A;  1NTV A;  1FAO A;  1ZM0 A;  3A98 B;  1X86 A;  2DYQ A;  3ZDT A;  1OQN A;  3QWM A;  2L1C A;  2UZS A;  1XX0 A;  2P0D A;  3PP2 A;  3PSC A;  4IAP A;  3KY9 A;  1V88 A;  4L6E A;  1Y5O A;  1RJ2 A;  1WJM A;  2E2X A;  3VOQ A;  4D0N B;  2DN6 A;  4GPT B;  4MY6 A;  1X1G A;  1UNP A;  2W2X C;  3DXD A;  4HDQ A;  2Y7B A;  1DRO A;  4EMO A;  2H7D A; 
#chains in the Genus database with same CATH topology
 3PVL A;  1KI1 B;  1UPR A;  2LYD A;  3D8E A;  4OSN A;  2CY4 A;  4DXA B;  4HDO A;  1GC7 A;  5C5B A;  2I1J A;  3LJU X;  2Q13 A;  4PNK A;  2IYB A;  1U2B A;  1Q67 A;  3UZT A;  3ODO A;  2ZKM X;  1ZC4 B;  4Z2M B;  2BCJ A;  3AJ4 A;  2DHK A;  4P7I A;  4HAY B;  4PQ0 A;  4GMX B;  4HAT B;  2YS5 A;  1ZVR A;  1FOE A;  3ML4 A;  1EGX A;  1UNR A;  2VKI A;  1GC6 A;  4D6W A;  1WJ1 A;  2J0M A;  3O96 A;  3TCA A;  1V5M A;  2Z0Q A;  1NI2 A;  4A5K A;  3QBV B;  2DLW A;  3FM8 C;  1MPH A;  2Z13 A;  2RSG A;  2X18 A;  4TYZ A;  4KHB A;  3BJI A;  3M1I B;  2UVM A;  2KR0 A;  4K2P A;  4HHV A;  3SUZ A;  1N3H A;  4DIX A;  5I2M A;  1U5E A;  3TVV A;  1X05 A;  2DX1 A;  2L2I A;  4Z2N A;  3PZD A;  3MPX A;  5CLQ B;  2DA0 A;  3SV1 A;  1J19 A;  2EJ8 A;  4GNK B;  2Y8G A;  2CAY A;  2AL6 A;  1AWE A;  5HE0 A;  1XR0 B;  1U5D A;  2GS0 A;  1KZG A;  3HQC A;  1U5F A;  4HSI A;  1MI1 A;  2DKQ A;  2OTX A;  2DYN A;  2P0F A;  5LON B;  1WI1 A;  1NU2 A;  1PMS A;  3D8F A;  1FB8 A;  5CLL B;  2R2Y A;  5C16 A;  3OHM B;  1TXD A;  1DDW A;  2RNR B;  2YT1 A;  5JHG A;  1XCG A;  1RRP B;  2COF A;  3U7D A;  4HB3 B;  2RRF A;  2D11 A;  1W1H A;  2ADZ A;  4TKN A;  3KRW A;  5HE3 A;  3X23 A;  4CSQ A;  2ELA A;  1V89 A;  2R09 A;  2D9W A;  3NWF A;  4K17 A;  2LG1 A;  1J0W A;  3ODW A;  1P3R A;  2RGN B;  1U5G A;  1LW3 A;  4YON A;  4IOY X;  1DYN A;  5I2S A;  3A8P A;  4HAX B;  5C6R A;  3WYF B;  1PLS A;  4ZRK A;  2GUM A;  4NSW A;  1LB1 A;  1WVH A;  3T06 A;  1PFJ A;  1MAI A;  2Z0P A;  2MFQ A;  5DHF B;  3VIA A;  3AU5 A;  4OT1 A;  4QJ4 B;  4XWX A;  5DIF B;  1X1F A;  2J0J A;  3HK0 A;  1B55 A;  3G9W A;  2FJU B;  4ZRJ A;  3SYX A;  4WJ7 A;  5LG4 B;  2ROZ B;  5HE1 A;  4DX9 0;  2YRY A;  2DHI A;  2ZPY A;  1NTY A;  3AU4 A;  3ULC A;  4A6K A;  1I2H A;  5IRS A;  4C0A A;  1WGU A;  2D4Q A;  4KVG B;  1T77 A;  1GG3 A;  1MK7 B;  1WGQ A;  1KZ7 A;  3V5W A;  2CRF A;  4Y94 A;  2Y8F A;  2RVB B;  4ZRI A;  2QKM A;  2W2W A;  2EMS A;  1DDM A;  5JP4 A;  3FSS A;  1TQZ A;  2I5F A;  2K2U A;  2LKO A;  3IVF A;  2W2X D;  1P5T A;  2KGX B;  3F0W A;  2YSZ A;  4CHM A;  2KUQ A;  2LOX A;  3ZVR A;  2DHJ A;  4HB4 B;  2ELB A;  4GN1 A;  3D8D A;  2N0Y A;  4EKU A;  3ODX A;  3A58 A;  3DCX A;  2DFK A;  2G35 A;  5D3W A;  5KQ4 A;  2COC A;  1Z87 A;  2H7E A;  3P6A A;  4K81 A;  3OAN A;  2Z4D A;  2UZR A;  5L81 A;  4GMV A;  1OMW A;  2NMB A;  1WG7 A;  2Z14 A;  4MK0 A;  2I1K A;  5LOP B;  3PEG A;  2R0D A;  5FI0 A;  1MIX A;  3N7C A;  5DI9 B;  1V61 A;  3DXC A;  5J3T A;  3GYP A;  1FHW A;  2RLO A;  2K2J A;  5D3X A;  1SGH A;  5J3Q A;  2J59 M;  3TO1 A;  1ZC3 B;  4H8S A;  3BIN A;  1FHO A;  4WSF A;  2P0H A;  4GOU A;  2M14 A;  1XKE A;  3TFM A;  2YT2 A;  4HB0 B;  1W1D A;  1DBH A;  3FVC A;  2I5C A;  2OQB A;  3CXB B;  1ZYI A;  5D3Y A;  1IRS A;  2VSZ A;  3NWA A;  4NY0 A;  3CIK A;  4MT7 A;  3DXE A;  2NBV A;  3KRX A;  4YL8 A;  1U29 A;  4DBB A;  1U27 A;  3F5R A;  4GZU A;  3HSA A;  3ULB A;  4BBK A;  3NSU A;  2CY5 A;  1QQG A;  1UEF A;  2Z0O A;  2J0K A;  3SO6 A;  2RUK B;  5EFX A;  1MK9 B;  4IFS A;  2K00 A;  1FGY A;  3B77 A;  5C79 A;  2YVC A;  1XD4 A;  2IFS A;  2KIE A;  2COA A;  4HAU B;  1TJ6 A;  1V5U A;  3KSY A;  1UPQ A;  3A8Q A;  1BTK A;  5JLJ B;  3GYO A;  4QJ5 B;  4GXB A;  4A6F B;  2EMT A;  5D3V A;  3FEH A;  3RCP A;  1V5P A;  3P7Z A;  1BAK A;  2GCL A;  3HIE A;  4HB2 B;  4F7U P;  1ISN A;  1UNQ A;  4EJN A;  5DHA B;  4WVF B;  5HE2 A;  1BWN A;  3NW8 A;  4F7H A;  2GJY A;  3QIJ A;  1MIZ B;  1H4R A;  1MKE A;  2YF0 A;  2HTH B;  2VRW B;  3HW2 B;  3U8Z A;  2JP2 A;  2YS1 A;  1M7R A;  5D27 A;  2DTC A;  1M7E A;  2M38 A;  5FI1 A;  2LOZ A;  2HE7 A;  3MDB C;  3PVU A;  5JHH A;  1E5W A;  3TW1 A;  2MDX A;  3NWD A;  2KIG A;  2KUP A;  1OY2 A;  1X11 A;  2DX5 A;  2EC1 A;  2YS3 A;  4CYE A;  2QKL A;  3PVW A;  2COD A;  4HAW B;  4QXA B;  4DX8 A;  2PZ1 A;  5J3Y A;  1I7A A;  1K5D B;  1P6S A;  2FJL A;  2GCJ A;  2MWN B;  2ROV A;  3KZ1 A;  5C5B B;  2Z59 A;  4F7G A;  1DDV A;  4KHO A;  1ZSQ A;  2D10 A;  2MKR A;  2LUL A;  4A6H A;  1AQC A;  1FGZ A;  1W1G A;  3WA0 A;  2AEH A;  2D9Z A;  4HAV B;  4CHJ A;  2D9X A;  1EF1 A;  1EVH A;  2YT0 A;  4B6H A;  2P8V A;  3SNH A;  2K8E A;  2DKP A;  2D9Y A;  1EAZ A;  1K5G B;  5KQ1 A;  1Y19 B;  4KHA A;  2N23 A;  2D2Q A;  5KCV A;  1SHC A;  4KHB B;  4L1R A;  1BTN A;  4HAZ B;  2D9V A;  2XQN M;  3PG7 A;  4A6F A;  2V76 A;  4K2O A;  4QJ3 B;  1QC6 A;  1H10 A;  2NZ8 B;  5GOW B;  4KAX B;  5DH9 B;  3U12 A;  1FHX A;  2KCJ A;  1XOD A;  1NTV A;  1FAO A;  1ZM0 A;  3A98 B;  1X86 A;  2DYQ A;  3ZDT A;  1OQN A;  3QWM A;  2L1C A;  2UZS A;  1XX0 A;  2P0D A;  3PP2 A;  3PSC A;  4IAP A;  3KY9 A;  1V88 A;  4L6E A;  1Y5O A;  1RJ2 A;  1WJM A;  2E2X A;  3VOQ A;  4D0N B;  2DN6 A;  4GPT B;  4MY6 A;  1X1G A;  1UNP A;  2W2X C;  3DXD A;  5M4Y B;  4HDQ A;  2Y7B A;  1DRO A;  4EMO A;  2K49 A;  2H7D A; 
#chains in the Genus database with same CATH homology
 3PVL A;  1KI1 B;  1UPR A;  2LYD A;  3D8E A;  2CY4 A;  4DXA B;  4HDO A;  1GC7 A;  5C5B A;  2I1J A;  3LJU X;  2Q13 A;  4PNK A;  2IYB A;  1U2B A;  1Q67 A;  3UZT A;  3ODO A;  1ZC4 B;  4Z2M B;  2BCJ A;  3AJ4 A;  2DHK A;  4P7I A;  4HAY B;  4PQ0 A;  4GMX B;  4HAT B;  2YS5 A;  3ML4 A;  1FOE A;  1ZVR A;  1EGX A;  1UNR A;  2VKI A;  1GC6 A;  1WJ1 A;  2J0M A;  3O96 A;  3TCA A;  1V5M A;  2Z0Q A;  1NI2 A;  4A5K A;  3QBV B;  2DLW A;  3FM8 C;  1MPH A;  2RSG A;  2X18 A;  4TYZ A;  3BJI A;  3M1I B;  2UVM A;  4K2P A;  4HHV A;  3SUZ A;  1N3H A;  1U5E A;  3TVV A;  1X05 A;  2DX1 A;  2L2I A;  4Z2N A;  3PZD A;  3MPX A;  5CLQ B;  2DA0 A;  3SV1 A;  1J19 A;  2EJ8 A;  2Y8G A;  2CAY A;  2AL6 A;  1AWE A;  5HE0 A;  1XR0 B;  1U5D A;  2GS0 A;  1KZG A;  3HQC A;  1U5F A;  2DKQ A;  2OTX A;  2DYN A;  2P0F A;  5LON B;  1WI1 A;  1NU2 A;  1PMS A;  3D8F A;  1FB8 A;  5CLL B;  5C16 A;  1TXD A;  1DDW A;  2RNR B;  2YT1 A;  5JHG A;  1XCG A;  1RRP B;  2COF A;  3U7D A;  4HB3 B;  2D11 A;  1W1H A;  2ADZ A;  4TKN A;  3KRW A;  5HE3 A;  3X23 A;  2ELA A;  1V89 A;  2R09 A;  2D9W A;  4K17 A;  2LG1 A;  1J0W A;  3ODW A;  1P3R A;  2RGN B;  1U5G A;  1LW3 A;  4YON A;  4IOY X;  1DYN A;  3A8P A;  4HAX B;  5C6R A;  3WYF B;  1PLS A;  4ZRK A;  4NSW A;  1LB1 A;  1WVH A;  3T06 A;  1PFJ A;  1MAI A;  2Z0P A;  2MFQ A;  5DHF B;  3VIA A;  3AU5 A;  4XWX A;  5DIF B;  1X1F A;  2J0J A;  3HK0 A;  1B55 A;  3G9W A;  4ZRJ A;  3SYX A;  4WJ7 A;  2ROZ B;  5HE1 A;  4DX9 0;  2YRY A;  2DHI A;  2ZPY A;  1NTY A;  3AU4 A;  3ULC A;  4A6K A;  1I2H A;  4C0A A;  1WGU A;  2D4Q A;  4KVG B;  1GG3 A;  1MK7 B;  1WGQ A;  1KZ7 A;  3V5W A;  2CRF A;  4Y94 A;  2Y8F A;  2RVB B;  4ZRI A;  2QKM A;  2W2W A;  2EMS A;  1DDM A;  5JP4 A;  3FSS A;  1TQZ A;  2I5F A;  2K2U A;  2LKO A;  3IVF A;  2W2X D;  1P5T A;  2KGX B;  3F0W A;  2YSZ A;  4CHM A;  2LOX A;  3ZVR A;  2DHJ A;  4HB4 B;  2ELB A;  4GN1 A;  3D8D A;  2N0Y A;  4EKU A;  3ODX A;  2DFK A;  2G35 A;  5D3W A;  5KQ4 A;  2COC A;  1Z87 A;  2H7E A;  3P6A A;  4K81 A;  3OAN A;  2UZR A;  5L81 A;  4GMV A;  1OMW A;  2NMB A;  1WG7 A;  4MK0 A;  2I1K A;  5LOP B;  3PEG A;  2R0D A;  5FI0 A;  1MIX A;  3N7C A;  5DI9 B;  1V61 A;  3DXC A;  5J3T A;  3GYP A;  1FHW A;  2RLO A;  2K2J A;  5D3X A;  1SGH A;  5J3Q A;  2J59 M;  3TO1 A;  1ZC3 B;  4H8S A;  3BIN A;  1FHO A;  4WSF A;  2P0H A;  2M14 A;  1XKE A;  3TFM A;  4HB0 B;  1W1D A;  1DBH A;  2I5C A;  2OQB A;  3CXB B;  5D3Y A;  1IRS A;  2VSZ A;  4NY0 A;  3CIK A;  4MT7 A;  3DXE A;  3KRX A;  4YL8 A;  1U29 A;  4DBB A;  1U27 A;  3F5R A;  4GZU A;  3ULB A;  4BBK A;  3NSU A;  2CY5 A;  1QQG A;  1UEF A;  2Z0O A;  2J0K A;  3SO6 A;  2RUK B;  5EFX A;  1MK9 B;  4IFS A;  2K00 A;  1FGY A;  5C79 A;  2YVC A;  1XD4 A;  2IFS A;  2COA A;  4HAU B;  1TJ6 A;  1V5U A;  3KSY A;  1UPQ A;  3A8Q A;  1BTK A;  5JLJ B;  3GYO A;  4GXB A;  4A6F B;  2EMT A;  5D3V A;  3FEH A;  3RCP A;  1V5P A;  3P7Z A;  1BAK A;  2GCL A;  4HB2 B;  4F7U P;  1ISN A;  1UNQ A;  4EJN A;  5DHA B;  4WVF B;  5HE2 A;  1BWN A;  4F7H A;  2GJY A;  3QIJ A;  1MIZ B;  1H4R A;  1MKE A;  2YF0 A;  2HTH B;  2VRW B;  3HW2 B;  3U8Z A;  2JP2 A;  2YS1 A;  1M7R A;  5D27 A;  2DTC A;  1M7E A;  2M38 A;  5FI1 A;  2LOZ A;  2HE7 A;  3MDB C;  3PVU A;  5JHH A;  1E5W A;  3TW1 A;  2MDX A;  2KUP A;  1OY2 A;  1X11 A;  2DX5 A;  2EC1 A;  2YS3 A;  4CYE A;  2QKL A;  3PVW A;  2COD A;  4HAW B;  4DX8 A;  2PZ1 A;  5J3Y A;  1I7A A;  1K5D B;  1P6S A;  2FJL A;  2GCJ A;  2MWN B;  2ROV A;  3KZ1 A;  5C5B B;  4F7G A;  1DDV A;  4KHO A;  1ZSQ A;  2D10 A;  2MKR A;  2LUL A;  4A6H A;  1AQC A;  1FGZ A;  1W1G A;  3WA0 A;  2AEH A;  2D9Z A;  4HAV B;  4CHJ A;  2D9X A;  1EF1 A;  1EVH A;  2YT0 A;  4B6H A;  2P8V A;  3SNH A;  2DKP A;  2D9Y A;  1EAZ A;  1K5G B;  5KQ1 A;  1Y19 B;  4KHA A;  2N23 A;  2D2Q A;  5KCV A;  1SHC A;  4KHB B;  1BTN A;  4HAZ B;  2D9V A;  2XQN M;  3PG7 A;  4A6F A;  2V76 A;  4K2O A;  1QC6 A;  1H10 A;  2NZ8 B;  5GOW B;  4KAX B;  5DH9 B;  1FHX A;  2KCJ A;  1XOD A;  1NTV A;  1FAO A;  1ZM0 A;  3A98 B;  1X86 A;  2DYQ A;  3ZDT A;  1OQN A;  3QWM A;  2L1C A;  2UZS A;  1XX0 A;  2P0D A;  3PP2 A;  3PSC A;  4IAP A;  3KY9 A;  1V88 A;  4L6E A;  1Y5O A;  1RJ2 A;  1WJM A;  2E2X A;  3VOQ A;  4D0N B;  2DN6 A;  4GPT B;  4MY6 A;  1X1G A;  1UNP A;  2W2X C;  3DXD A;  4HDQ A;  2Y7B A;  1DRO A;  4EMO A;  2H7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...