5DI9B

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 33
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5di9B00
2COFA 2LULA 2YS1A 3F0WA 2YT1A 1ZVRA 3LJUX 2CRFA 4MK0A 2CY4A 1QC6A 1J0WA 4WSFA 2HTHB 5DIFB 4HAUB 5KQ1A 5C5BA 2Y7BA 2N23A 1UPQA 2QKMA 1WVHA 2ELBA 1FAOA 4C0AA 2J0KA 3T06A 3SV1A 2NZ8B 3SNHA 3BINA 4K17A 2LOZA 3CXBB 2M14A 2MFQA 3O96A 3D8FA 1ZC3B 4F7UP 2OQBA 3KY9A 2D11A 3P7ZA 2RVBB 1U5EA 3IVFA 3PVWA 1X1FA 1BAKA 4PQ0A 2RNRB 1M7EA 1MPHA 1DDWA 1TXDA 1MK7B 2EC1A 5KQ4A 1FHOA 1QQGA 5C6RA 2KCJA 2YF0A 3TCAA 1AWEA 1KI1B 4HAXB 1U5GA 1Y5OA 2DFKA 1I7AA 1V5UA 2MKRA 3KZ1A 2KUPA 5DH9B 2ADZA 4MY6A 3A8PA 2QKLA 4L6EA 1KZGA 1XR0B 2W2XC 3SO6A 1OY2A 4DBBA 2N0YA 3OANA 1PFJA 4MT7A 2K2UA 1P5TA 2GJYA 3FM8C 3NSUA 3SUZA 1UNRA 3ODXA 1V5MA 2I1JA 2DN6A 1W1GA 4HB3B 4EJNA 1X1GA 4A6FB 5HE1A 3PEGA 1H10A 2W2XD 1XKEA 3BJIA 1UNPA 3D8DA 1TJ6A 3KRWA 3PVUA 5FI0A 3MPXA 5CLLB 1WG7A 5CLQB 3FEHA 5DHAB 4HAZB 3U7DA 4A6KA 4A6FA 2LYDA 2R09A 3TVVA 1GG3A 2L2IA 5C5BB 3QWMA 2D9XA 2D9ZA 2DKQA 1DDMA 2DX1A 1V5PA 1FHXA 2LKOA 1U27A 2RSGA 1V89A 4CYEA 1I2HA 2G35A 3AJ4A 1U5DA 1ZM0A 4CHJA 2LG1A 2P8VA 4CHMA 2DA0A 2EJ8A 2L1CA 1NTVA 1GC6A 2VSZA 3ODOA 1ISNA 2P0FA 1XODA 3ML4A 4HHVA 3A98B 2EMSA 4HAWB 5DI9B 1MK9B 3D8EA 3HK0A 3PG7A 3UZTA 4K2PA 1V61A 3CIKA 1EGXA 2VKIA 1PLSA 5J3TA 1IRSA 2D9WA 1Y19B 1U29A 1GC7A 1PMSA 2ROZB 3ZVRA 3TFMA 3RCPA 1U2BA 1NTYA 4NSWA 2YSZA 4EKUA 3WYFB 2CY5A 1FB8A 4H8SA 1ZSQA 1EAZA 4GXBA 4K2OA 1NI2A 2UZSA 5C79A 4HB0B 4DX8A 2PZ1A 2Q13A 2NMBA 1X05A 3PVLA 1SGHA 5LONB 1WGUA 1P3RA 2MWNB 4YL8A 2XQNM 3M1IB 5D3YA 2GCLA 3KRXA 2RLOA 1DDVA 3ZDTA 4ZRIA 1Z87A 1TQZA 4F7GA 1N3HA 2I1KA 3GYOA 3F5RA 1DYNA 1NU2A 1EF1A 2E2XA 5D3VA 5D3WA 1ZC4B 2GCJA 2DHJA 3AU5A 2I5FA 4F7HA 2YVCA 5J3QA 5L81A 4DXAB 2J0JA 4Z2NA 1BTKA 2BCJA 1W1HA 1MKEA 4EMOA 1Q67A 2EMTA 3WA0A 3DXCA 1UNQA 2COCA 2D4QA 4B6HA 4KHBB 5JLJB 4IOYX 1LB1A 3VOQA 1K5GB 1MIXA 1XCGA 3ULBA 2CAYA 5HE2A 1E5WA 5JHGA 1BTNA 1FGZA 2CODA 5DHFB 2FJLA 2W2WA 1DBHA 2I5CA 4D0NB 4Y94A 4KHOA 5EFXA 1FHWA 1AQCA 3PP2A 2IFSA 2JP2A 1FGYA 2HE7A 2V76A 1OMWA 2YS3A 4HAVB 4A5KA 2YT0A 2RUKB 5KCVA 2YRYA 3ULCA 5FI1A 4ZRKA 3DXDA 2ELAA 4IAPA 2DX5A 4KAXB 5J3YA 2YS5A 2H7DA 4GN1A 3SYXA 4A6HA 1WJMA 3PZDA 2LOXA 3TW1A 2X18A 1XD4A 4TKNA 4IFSA 1M7RA 4KHAA 4NY0A 2DYNA 1EVHA 1K5DB 3X23A 1P6SA 1J19A 1KZ7A 4GMXB 4BBKA 3HQCA 4KVGB 3U8ZA 1BWNA 2AL6A 1V88A 2M38A 4HDQA 2ZPYA 1MIZB 3GYPA 1RRPB 4TYZA 2K2JA 2VRWB 2GS0A 2D2QA 2J0MA 2MDXA 2K00A 2R0DA 1WJ1A 2DKPA 5D27A 3DXEA 2Z0OA 4HB2B 3VIAA 3P6AA 5GOWB 3FSSA 4GPTB 3HW2B 4WVFB 5D3XA 1B55A 4HB4B 1OQNA 2AEHA 1U5FA 2D10A 4HAYB 2DTCA 3A8QA 1X11A 4HDOA 1UPRA 3MDBC 4GZUA 3ODWA 2UZRA 1WI1A 3PSCA 2Z0PA 2IYBA 3KSYA 5LOPB 4YONA 2D9VA 2DHKA 5C16A 5JP4A 1FOEA 2J59M 2H7EA 2RGNB 1LW3A 1UEFA 3QIJA 3G9WA 4P7IA 2UVMA 3V5WA 2Y8FA 1H4RA 4DX90 4HATB 2Z0QA 2OTXA 2D9YA 2ROVA 4K81A 3TO1A 4WJ7A 1W1DA 4ZRJA 1RJ2A 1XX0A 2DLWA 2Y8GA 1MAIA 1X86A 3N7CA 2DHIA 5HE3A 2KGXB 2P0HA 4PNKA 1WGQA 2P0DA 5JHHA 3QBVB 1DROA 3AU4A 4GMVA 5HE0A 2DYQA 4XWXA 4Z2MB 1SHCA 2COAA
chains in the Genus database with same CATH superfamily
2COFA 2LULA 2YS1A 3F0WA 2YT1A 1ZVRA 3LJUX 2CRFA 4MK0A 2CY4A 3B77A 1QC6A 1J0WA 4WSFA 2HTHB 2KUQA 5DIFB 4GNKB 2ZKMX 3HIEA 4HAUB 5KQ1A 5C5BA 2Y7BA 2N23A 1UPQA 2QKMA 1WVHA 2ELBA 1FAOA 4C0AA 2J0KA 3T06A 3SV1A 2NZ8B 3SNHA 3BINA 4K17A 2LOZA 3CXBB 2M14A 2MFQA 3O96A 3D8FA 1ZC3B 4F7UP 2OQBA 3KY9A 2D11A 3P7ZA 2RVBB 1U5EA 3IVFA 3PVWA 1X1FA 2Z14A 2FJUB 4QXAB 1BAKA 4PQ0A 2RNRB 4OT1A 1M7EA 1MPHA 1DDWA 1TXDA 1MK7B 2EC1A 5KQ4A 1FHOA 1QQGA 5C6RA 4QJ3B 2KCJA 2YF0A 3TCAA 1AWEA 1KI1B 4HAXB 1U5GA 1Y5OA 2DFKA 1I7AA 1V5UA 2MKRA 3KZ1A 2KUPA 5DH9B 2ADZA 4MY6A 3A8PA 4GOUA 2QKLA 4L6EA 1KZGA 1XR0B 2W2XC 3SO6A 1OY2A 4DBBA 2N0YA 3OANA 1PFJA 4MT7A 2K2UA 1P5TA 2GJYA 3FM8C 3NSUA 4DIXA 3SUZA 1UNRA 3ODXA 1V5MA 2I1JA 2DN6A 1W1GA 4HB3B 4EJNA 1X1GA 4A6FB 3DCXA 5HE1A 3PEGA 1H10A 2W2XD 1XKEA 3BJIA 1UNPA 3D8DA 1TJ6A 3KRWA 3PVUA 5FI0A 3MPXA 5CLLB 1WG7A 5CLQB 3FEHA 5DHAB 2KIGA 4HAZB 3U7DA 4A6KA 4A6FA 5I2MA 2LYDA 2R09A 3TVVA 1GG3A 2L2IA 2YT2A 5C5BB 3QWMA 2D9XA 2D9ZA 2DKQA 1DDMA 2DX1A 1V5PA 1FHXA 2LKOA 1U27A 2RSGA 1V89A 4CYEA 1I2HA 2G35A 3AJ4A 2NBVA 1U5DA 1ZM0A 4CHJA 2LG1A 2P8VA 4CHMA 2DA0A 2EJ8A 2L1CA 1NTVA 5LG4B 1GC6A 2VSZA 3ODOA 1ISNA 4CSQA 2KR0A 2P0FA 2GUMA 1XODA 3ML4A 4HHVA 3A98B 2EMSA 4HAWB 5DI9B 1MK9B 3D8EA 3HK0A 3PG7A 3UZTA 4K2PA 1V61A 4L1RA 3CIKA 1EGXA 2VKIA 1PLSA 5J3TA 1IRSA 2D9WA 5IRSA 1Y19B 1U29A 1GC7A 1PMSA 2ROZB 3ZVRA 3TFMA 3RCPA 1U2BA 1NTYA 4NSWA 2YSZA 4EKUA 3WYFB 2CY5A 1FB8A 4H8SA 1ZSQA 1EAZA 4GXBA 4K2OA 1NI2A 2UZSA 5C79A 4HB0B 4DX8A 2PZ1A 2Q13A 2NMBA 1X05A 3PVLA 1SGHA 5LONB 1WGUA 1P3RA 2MWNB 4YL8A 2XQNM 3M1IB 5D3YA 2R2YA 2GCLA 3KRXA 2RLOA 1DDVA 3ZDTA 4ZRIA 1Z87A 3U12A 1TQZA 4F7GA 1N3HA 2I1KA 3NW8A 3GYOA 3F5RA 1DYNA 1NU2A 1EF1A 2E2XA 5D3VA 2Z4DA 5D3WA 1ZC4B 2GCJA 2DHJA 3AU5A 2I5FA 4F7HA 2YVCA 5J3QA 5L81A 4DXAB 2J0JA 4Z2NA 1BTKA 2BCJA 1W1HA 5M4YB 1MKEA 4EMOA 1Q67A 2EMTA 3WA0A 3DXCA 1UNQA 4D6WA 2COCA 2D4QA 4B6HA 4KHBB 5JLJB 4IOYX 1LB1A 3VOQA 1K5GB 1MIXA 1XCGA 3ULBA 2CAYA 5HE2A 1E5WA 5JHGA 1BTNA 5I2SA 1FGZA 2CODA 5DHFB 4OSNA 2FJLA 2W2WA 1DBHA 2I5CA 3NWAA 4D0NB 4Y94A 4KHOA 5EFXA 1FHWA 1AQCA 3PP2A 2IFSA 2JP2A 1FGYA 1MI1A 4HSIA 2HE7A 2V76A 4KHBA 1OMWA 2YS3A 4HAVB 4A5KA 2YT0A 2RUKB 5KCVA 2YRYA 3NWFA 3ULCA 5FI1A 2K49A 4ZRKA 3DXDA 2ELAA 4IAPA 2DX5A 4KAXB 5J3YA 2YS5A 2H7DA 3NWDA 3A58A 4GN1A 3SYXA 4A6HA 1WJMA 3PZDA 2LOXA 3TW1A 3HSAA 2X18A 1XD4A 4TKNA 4IFSA 2RRFA 1M7RA 4KHAA 4NY0A 2DYNA 1EVHA 1K5DB 3X23A 1P6SA 1J19A 1KZ7A 4GMXB 4BBKA 3HQCA 4KVGB 3U8ZA 1BWNA 1T77A 2AL6A 1V88A 2M38A 4HDQA 2ZPYA 1MIZB 3GYPA 1RRPB 2Z13A 4TYZA 2K2JA 2VRWB 2GS0A 2D2QA 2J0MA 2MDXA 2K00A 2R0DA 1WJ1A 2DKPA 5D27A 3DXEA 2Z0OA 4HB2B 3VIAA 3P6AA 5GOWB 3FSSA 4GPTB 3HW2B 4WVFB 5D3XA 1B55A 4HB4B 1OQNA 4QJ5B 2AEHA 2KIEA 1U5FA 2D10A 4HAYB 2DTCA 3A8QA 1X11A 4HDOA 1UPRA 3MDBC 4GZUA 3ODWA 2UZRA 1WI1A 2Z59A 2Z0PA 3PSCA 2IYBA 3KSYA 5LOPB 4YONA 2D9VA 2DHKA 5C16A 5JP4A 1FOEA 2J59M 2H7EA 2RGNB 1LW3A 1UEFA 3QIJA 3G9WA 4P7IA 2UVMA 3V5WA 2Y8FA 1H4RA 4DX90 4HATB 2Z0QA 2OTXA 2D9YA 2ROVA 4K81A 3FVCA 3TO1A 4WJ7A 1W1DA 1ZYIA 4ZRJA 1RJ2A 1XX0A 2DLWA 2K8EA 2Y8GA 1MAIA 1X86A 3N7CA 2DHIA 3OHMB 2KGXB 2P0HA 5HE3A 4PNKA 1WGQA 2P0DA 5JHHA 3QBVB 1DROA 3AU4A 4GMVA 5HE0A 2DYQA 4XWXA 4QJ4B 4Z2MB 1SHCA 2COAA
chains in the Genus database with same CATH topology
2COFA 2LULA 2YS1A 3F0WA 2YT1A 1ZVRA 3LJUX 2CRFA 4MK0A 2CY4A 1QC6A 1J0WA 4WSFA 2HTHB 5DIFB 4HAUB 5KQ1A 5C5BA 2Y7BA 2N23A 1UPQA 2QKMA 1WVHA 2ELBA 1FAOA 4C0AA 2J0KA 3T06A 3SV1A 2NZ8B 3SNHA 3BINA 4K17A 2LOZA 3CXBB 2M14A 2MFQA 3O96A 3D8FA 1ZC3B 4F7UP 2OQBA 3KY9A 2D11A 3P7ZA 2RVBB 1U5EA 3IVFA 3PVWA 1X1FA 1BAKA 4PQ0A 2RNRB 1M7EA 1MPHA 1DDWA 1TXDA 1MK7B 2EC1A 5KQ4A 1FHOA 1QQGA 5C6RA 2KCJA 2YF0A 3TCAA 1AWEA 1KI1B 4HAXB 1U5GA 1Y5OA 2DFKA 1I7AA 1V5UA 2MKRA 3KZ1A 2KUPA 5DH9B 2ADZA 4MY6A 3A8PA 2QKLA 4L6EA 1KZGA 1XR0B 2W2XC 3SO6A 1OY2A 4DBBA 2N0YA 3OANA 1PFJA 4MT7A 2K2UA 1P5TA 2GJYA 3FM8C 3NSUA 3SUZA 1UNRA 3ODXA 1V5MA 2I1JA 2DN6A 1W1GA 4HB3B 4EJNA 1X1GA 4A6FB 5HE1A 3PEGA 1H10A 2W2XD 1XKEA 3BJIA 1UNPA 3D8DA 1TJ6A 3KRWA 3PVUA 5FI0A 3MPXA 5CLLB 1WG7A 5CLQB 3FEHA 5DHAB 4HAZB 3U7DA 4A6KA 4A6FA 2LYDA 2R09A 3TVVA 1GG3A 2L2IA 5C5BB 3QWMA 2D9XA 2D9ZA 2DKQA 1DDMA 2DX1A 1V5PA 1FHXA 2LKOA 1U27A 2RSGA 1V89A 4CYEA 1I2HA 2G35A 3AJ4A 1U5DA 1ZM0A 4CHJA 2LG1A 2P8VA 4CHMA 2DA0A 2EJ8A 2L1CA 1NTVA 1GC6A 2VSZA 3ODOA 1ISNA 2P0FA 1XODA 3ML4A 4HHVA 3A98B 2EMSA 4HAWB 5DI9B 1MK9B 3D8EA 3HK0A 3PG7A 3UZTA 4K2PA 1V61A 3CIKA 1EGXA 2VKIA 1PLSA 5J3TA 1IRSA 2D9WA 1Y19B 1U29A 1GC7A 1PMSA 2ROZB 3ZVRA 3TFMA 3RCPA 1U2BA 1NTYA 4NSWA 2YSZA 4EKUA 3WYFB 2CY5A 1FB8A 4H8SA 1ZSQA 1EAZA 4GXBA 4K2OA 1NI2A 2UZSA 5C79A 4HB0B 4DX8A 2PZ1A 2Q13A 2NMBA 1X05A 3PVLA 1SGHA 5LONB 1WGUA 1P3RA 2MWNB 4YL8A 2XQNM 3M1IB 5D3YA 2GCLA 3KRXA 2RLOA 1DDVA 3ZDTA 4ZRIA 1Z87A 1TQZA 4F7GA 1N3HA 2I1KA 3GYOA 3F5RA 1DYNA 1NU2A 1EF1A 2E2XA 5D3VA 5D3WA 1ZC4B 2GCJA 2DHJA 3AU5A 2I5FA 4F7HA 2YVCA 5J3QA 5L81A 4DXAB 2J0JA 4Z2NA 1BTKA 2BCJA 1W1HA 1MKEA 4EMOA 1Q67A 2EMTA 3WA0A 3DXCA 1UNQA 2COCA 2D4QA 4B6HA 4KHBB 5JLJB 4IOYX 1LB1A 3VOQA 1K5GB 1MIXA 1XCGA 3ULBA 2CAYA 5HE2A 1E5WA 5JHGA 1BTNA 1FGZA 2CODA 5DHFB 2FJLA 2W2WA 1DBHA 2I5CA 4D0NB 4Y94A 4KHOA 5EFXA 1FHWA 1AQCA 3PP2A 2IFSA 2JP2A 1FGYA 2HE7A 2V76A 1OMWA 2YS3A 4HAVB 4A5KA 2YT0A 2RUKB 5KCVA 2YRYA 3ULCA 5FI1A 4ZRKA 3DXDA 2ELAA 4IAPA 2DX5A 4KAXB 5J3YA 2YS5A 2H7DA 4GN1A 3SYXA 4A6HA 1WJMA 3PZDA 2LOXA 3TW1A 2X18A 1XD4A 4TKNA 4IFSA 1M7RA 4KHAA 4NY0A 2DYNA 1EVHA 1K5DB 3X23A 1P6SA 1J19A 1KZ7A 4GMXB 4BBKA 3HQCA 4KVGB 3U8ZA 1BWNA 2AL6A 1V88A 2M38A 4HDQA 2ZPYA 1MIZB 3GYPA 1RRPB 4TYZA 2K2JA 2VRWB 2GS0A 2D2QA 2J0MA 2MDXA 2K00A 2R0DA 1WJ1A 2DKPA 5D27A 3DXEA 2Z0OA 4HB2B 3VIAA 3P6AA 5GOWB 3FSSA 4GPTB 3HW2B 4WVFB 5D3XA 1B55A 4HB4B 1OQNA 2AEHA 1U5FA 2D10A 4HAYB 2DTCA 3A8QA 1X11A 4HDOA 1UPRA 3MDBC 4GZUA 3ODWA 2UZRA 1WI1A 3PSCA 2Z0PA 2IYBA 3KSYA 5LOPB 4YONA 2D9VA 2DHKA 5C16A 5JP4A 1FOEA 2J59M 2H7EA 2RGNB 1LW3A 1UEFA 3QIJA 3G9WA 4P7IA 2UVMA 3V5WA 2Y8FA 1H4RA 4DX90 4HATB 2Z0QA 2OTXA 2D9YA 2ROVA 4K81A 3TO1A 4WJ7A 1W1DA 4ZRJA 1RJ2A 1XX0A 2DLWA 2Y8GA 1MAIA 1X86A 3N7CA 2DHIA 5HE3A 2KGXB 2P0HA 4PNKA 1WGQA 2P0DA 5JHHA 3QBVB 1DROA 3AU4A 4GMVA 5HE0A 2DYQA 4XWXA 4Z2MB 1SHCA 2COAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  2LUL A;  2YS1 A;  3F0W A;  2YT1 A;  1ZVR A;  3LJU X;  2CRF A;  4MK0 A;  2CY4 A;  1QC6 A;  1J0W A;  4WSF A;  2HTH B;  5DIF B;  4HAU B;  5KQ1 A;  5C5B A;  2Y7B A;  2N23 A;  1UPQ A;  2QKM A;  1WVH A;  2ELB A;  1FAO A;  4C0A A;  2J0K A;  3T06 A;  3SV1 A;  2NZ8 B;  3SNH A;  3BIN A;  4K17 A;  2LOZ A;  3CXB B;  2M14 A;  2MFQ A;  3O96 A;  3D8F A;  1ZC3 B;  4F7U P;  2OQB A;  3KY9 A;  2D11 A;  3P7Z A;  2RVB B;  1U5E A;  3IVF A;  3PVW A;  1X1F A;  1BAK A;  4PQ0 A;  2RNR B;  1M7E A;  1MPH A;  1DDW A;  1TXD A;  1MK7 B;  2EC1 A;  5KQ4 A;  1FHO A;  1QQG A;  5C6R A;  2KCJ A;  2YF0 A;  3TCA A;  1AWE A;  1KI1 B;  4HAX B;  1U5G A;  1Y5O A;  2DFK A;  1I7A A;  1V5U A;  2MKR A;  3KZ1 A;  2KUP A;  5DH9 B;  2ADZ A;  4MY6 A;  3A8P A;  2QKL A;  4L6E A;  1KZG A;  1XR0 B;  2W2X C;  3SO6 A;  1OY2 A;  4DBB A;  2N0Y A;  3OAN A;  1PFJ A;  4MT7 A;  2K2U A;  1P5T A;  2GJY A;  3FM8 C;  3NSU A;  3SUZ A;  1UNR A;  3ODX A;  1V5M A;  2I1J A;  2DN6 A;  1W1G A;  4HB3 B;  4EJN A;  1X1G A;  4A6F B;  5HE1 A;  3PEG A;  1H10 A;  2W2X D;  1XKE A;  3BJI A;  1UNP A;  3D8D A;  1TJ6 A;  3KRW A;  3PVU A;  5FI0 A;  3MPX A;  5CLL B;  1WG7 A;  5CLQ B;  3FEH A;  5DHA B;  4HAZ B;  3U7D A;  4A6K A;  4A6F A;  2LYD A;  2R09 A;  3TVV A;  1GG3 A;  2L2I A;  5C5B B;  3QWM A;  2D9X A;  2D9Z A;  2DKQ A;  1DDM A;  2DX1 A;  1V5P A;  1FHX A;  2LKO A;  1U27 A;  2RSG A;  1V89 A;  4CYE A;  1I2H A;  2G35 A;  3AJ4 A;  1U5D A;  1ZM0 A;  4CHJ A;  2LG1 A;  2P8V A;  4CHM A;  2DA0 A;  2EJ8 A;  2L1C A;  1NTV A;  1GC6 A;  2VSZ A;  3ODO A;  1ISN A;  2P0F A;  1XOD A;  3ML4 A;  4HHV A;  3A98 B;  2EMS A;  4HAW B;  5DI9 B;  1MK9 B;  3D8E A;  3HK0 A;  3PG7 A;  3UZT A;  4K2P A;  1V61 A;  3CIK A;  1EGX A;  2VKI A;  1PLS A;  5J3T A;  1IRS A;  2D9W A;  1Y19 B;  1U29 A;  1GC7 A;  1PMS A;  2ROZ B;  3ZVR A;  3TFM A;  3RCP A;  1U2B A;  1NTY A;  4NSW A;  2YSZ A;  4EKU A;  3WYF B;  2CY5 A;  1FB8 A;  4H8S A;  1ZSQ A;  1EAZ A;  4GXB A;  4K2O A;  1NI2 A;  2UZS A;  5C79 A;  4HB0 B;  4DX8 A;  2PZ1 A;  2Q13 A;  2NMB A;  1X05 A;  3PVL A;  1SGH A;  5LON B;  1WGU A;  1P3R A;  2MWN B;  4YL8 A;  2XQN M;  3M1I B;  5D3Y A;  2GCL A;  3KRX A;  2RLO A;  1DDV A;  3ZDT A;  4ZRI A;  1Z87 A;  1TQZ A;  4F7G A;  1N3H A;  2I1K A;  3GYO A;  3F5R A;  1DYN A;  1NU2 A;  1EF1 A;  2E2X A;  5D3V A;  5D3W A;  1ZC4 B;  2GCJ A;  2DHJ A;  3AU5 A;  2I5F A;  4F7H A;  2YVC A;  5J3Q A;  5L81 A;  4DXA B;  2J0J A;  4Z2N A;  1BTK A;  2BCJ A;  1W1H A;  1MKE A;  4EMO A;  1Q67 A;  2EMT A;  3WA0 A;  3DXC A;  1UNQ A;  2COC A;  2D4Q A;  4B6H A;  4KHB B;  5JLJ B;  4IOY X;  1LB1 A;  3VOQ A;  1K5G B;  1MIX A;  1XCG A;  3ULB A;  2CAY A;  5HE2 A;  1E5W A;  5JHG A;  1BTN A;  1FGZ A;  2COD A;  5DHF B;  2FJL A;  2W2W A;  1DBH A;  2I5C A;  4D0N B;  4Y94 A;  4KHO A;  5EFX A;  1FHW A;  1AQC A;  3PP2 A;  2IFS A;  2JP2 A;  1FGY A;  2HE7 A;  2V76 A;  1OMW A;  2YS3 A;  4HAV B;  4A5K A;  2YT0 A;  2RUK B;  5KCV A;  2YRY A;  3ULC A;  5FI1 A;  4ZRK A;  3DXD A;  2ELA A;  4IAP A;  2DX5 A;  4KAX B;  5J3Y A;  2YS5 A;  2H7D A;  4GN1 A;  3SYX A;  4A6H A;  1WJM A;  3PZD A;  2LOX A;  3TW1 A;  2X18 A;  1XD4 A;  4TKN A;  4IFS A;  1M7R A;  4KHA A;  4NY0 A;  2DYN A;  1EVH A;  1K5D B;  3X23 A;  1P6S A;  1J19 A;  1KZ7 A;  4GMX B;  4BBK A;  3HQC A;  4KVG B;  3U8Z A;  1BWN A;  2AL6 A;  1V88 A;  2M38 A;  4HDQ A;  2ZPY A;  1MIZ B;  3GYP A;  1RRP B;  4TYZ A;  2K2J A;  2VRW B;  2GS0 A;  2D2Q A;  2J0M A;  2MDX A;  2K00 A;  2R0D A;  1WJ1 A;  2DKP A;  5D27 A;  3DXE A;  2Z0O A;  4HB2 B;  3VIA A;  3P6A A;  5GOW B;  3FSS A;  4GPT B;  3HW2 B;  4WVF B;  5D3X A;  1B55 A;  4HB4 B;  1OQN A;  2AEH A;  1U5F A;  2D10 A;  4HAY B;  2DTC A;  3A8Q A;  1X11 A;  4HDO A;  1UPR A;  3MDB C;  4GZU A;  3ODW A;  2UZR A;  1WI1 A;  3PSC A;  2Z0P A;  2IYB A;  3KSY A;  5LOP B;  4YON A;  2D9V A;  2DHK A;  5C16 A;  5JP4 A;  1FOE A;  2J59 M;  2H7E A;  2RGN B;  1LW3 A;  1UEF A;  3QIJ A;  3G9W A;  4P7I A;  2UVM A;  3V5W A;  2Y8F A;  1H4R A;  4DX9 0;  4HAT B;  2Z0Q A;  2OTX A;  2D9Y A;  2ROV A;  4K81 A;  3TO1 A;  4WJ7 A;  1W1D A;  4ZRJ A;  1RJ2 A;  1XX0 A;  2DLW A;  2Y8G A;  1MAI A;  1X86 A;  3N7C A;  2DHI A;  5HE3 A;  2KGX B;  2P0H A;  4PNK A;  1WGQ A;  2P0D A;  5JHH A;  3QBV B;  1DRO A;  3AU4 A;  4GMV A;  5HE0 A;  2DYQ A;  4XWX A;  4Z2M B;  1SHC A;  2COA A; 
#chains in the Genus database with same CATH topology
 2COF A;  2LUL A;  2YS1 A;  3F0W A;  2YT1 A;  1ZVR A;  3LJU X;  2CRF A;  4MK0 A;  2CY4 A;  3B77 A;  1QC6 A;  1J0W A;  4WSF A;  2HTH B;  2KUQ A;  5DIF B;  4GNK B;  2ZKM X;  3HIE A;  4HAU B;  5KQ1 A;  5C5B A;  2Y7B A;  2N23 A;  1UPQ A;  2QKM A;  1WVH A;  2ELB A;  1FAO A;  4C0A A;  2J0K A;  3T06 A;  3SV1 A;  2NZ8 B;  3SNH A;  3BIN A;  4K17 A;  2LOZ A;  3CXB B;  2M14 A;  2MFQ A;  3O96 A;  3D8F A;  1ZC3 B;  4F7U P;  2OQB A;  3KY9 A;  2D11 A;  3P7Z A;  2RVB B;  1U5E A;  3IVF A;  3PVW A;  1X1F A;  2Z14 A;  2FJU B;  4QXA B;  1BAK A;  4PQ0 A;  2RNR B;  4OT1 A;  1M7E A;  1MPH A;  1DDW A;  1TXD A;  1MK7 B;  2EC1 A;  5KQ4 A;  1FHO A;  1QQG A;  5C6R A;  4QJ3 B;  2KCJ A;  2YF0 A;  3TCA A;  1AWE A;  1KI1 B;  4HAX B;  1U5G A;  1Y5O A;  2DFK A;  1I7A A;  1V5U A;  2MKR A;  3KZ1 A;  2KUP A;  5DH9 B;  2ADZ A;  4MY6 A;  3A8P A;  4GOU A;  2QKL A;  4L6E A;  1KZG A;  1XR0 B;  2W2X C;  3SO6 A;  1OY2 A;  4DBB A;  2N0Y A;  3OAN A;  1PFJ A;  4MT7 A;  2K2U A;  1P5T A;  2GJY A;  3FM8 C;  3NSU A;  4DIX A;  3SUZ A;  1UNR A;  3ODX A;  1V5M A;  2I1J A;  2DN6 A;  1W1G A;  4HB3 B;  4EJN A;  1X1G A;  4A6F B;  3DCX A;  5HE1 A;  3PEG A;  1H10 A;  2W2X D;  1XKE A;  3BJI A;  1UNP A;  3D8D A;  1TJ6 A;  3KRW A;  3PVU A;  5FI0 A;  3MPX A;  5CLL B;  1WG7 A;  5CLQ B;  3FEH A;  5DHA B;  2KIG A;  4HAZ B;  3U7D A;  4A6K A;  4A6F A;  5I2M A;  2LYD A;  2R09 A;  3TVV A;  1GG3 A;  2L2I A;  2YT2 A;  5C5B B;  3QWM A;  2D9X A;  2D9Z A;  2DKQ A;  1DDM A;  2DX1 A;  1V5P A;  1FHX A;  2LKO A;  1U27 A;  2RSG A;  1V89 A;  4CYE A;  1I2H A;  2G35 A;  3AJ4 A;  2NBV A;  1U5D A;  1ZM0 A;  4CHJ A;  2LG1 A;  2P8V A;  4CHM A;  2DA0 A;  2EJ8 A;  2L1C A;  1NTV A;  5LG4 B;  1GC6 A;  2VSZ A;  3ODO A;  1ISN A;  4CSQ A;  2KR0 A;  2P0F A;  2GUM A;  1XOD A;  3ML4 A;  4HHV A;  3A98 B;  2EMS A;  4HAW B;  5DI9 B;  1MK9 B;  3D8E A;  3HK0 A;  3PG7 A;  3UZT A;  4K2P A;  1V61 A;  4L1R A;  3CIK A;  1EGX A;  2VKI A;  1PLS A;  5J3T A;  1IRS A;  2D9W A;  5IRS A;  1Y19 B;  1U29 A;  1GC7 A;  1PMS A;  2ROZ B;  3ZVR A;  3TFM A;  3RCP A;  1U2B A;  1NTY A;  4NSW A;  2YSZ A;  4EKU A;  3WYF B;  2CY5 A;  1FB8 A;  4H8S A;  1ZSQ A;  1EAZ A;  4GXB A;  4K2O A;  1NI2 A;  2UZS A;  5C79 A;  4HB0 B;  4DX8 A;  2PZ1 A;  2Q13 A;  2NMB A;  1X05 A;  3PVL A;  1SGH A;  5LON B;  1WGU A;  1P3R A;  2MWN B;  4YL8 A;  2XQN M;  3M1I B;  5D3Y A;  2R2Y A;  2GCL A;  3KRX A;  2RLO A;  1DDV A;  3ZDT A;  4ZRI A;  1Z87 A;  3U12 A;  1TQZ A;  4F7G A;  1N3H A;  2I1K A;  3NW8 A;  3GYO A;  3F5R A;  1DYN A;  1NU2 A;  1EF1 A;  2E2X A;  5D3V A;  2Z4D A;  5D3W A;  1ZC4 B;  2GCJ A;  2DHJ A;  3AU5 A;  2I5F A;  4F7H A;  2YVC A;  5J3Q A;  5L81 A;  4DXA B;  2J0J A;  4Z2N A;  1BTK A;  2BCJ A;  1W1H A;  5M4Y B;  1MKE A;  4EMO A;  1Q67 A;  2EMT A;  3WA0 A;  3DXC A;  1UNQ A;  4D6W A;  2COC A;  2D4Q A;  4B6H A;  4KHB B;  5JLJ B;  4IOY X;  1LB1 A;  3VOQ A;  1K5G B;  1MIX A;  1XCG A;  3ULB A;  2CAY A;  5HE2 A;  1E5W A;  5JHG A;  1BTN A;  5I2S A;  1FGZ A;  2COD A;  5DHF B;  4OSN A;  2FJL A;  2W2W A;  1DBH A;  2I5C A;  3NWA A;  4D0N B;  4Y94 A;  4KHO A;  5EFX A;  1FHW A;  1AQC A;  3PP2 A;  2IFS A;  2JP2 A;  1FGY A;  1MI1 A;  4HSI A;  2HE7 A;  2V76 A;  4KHB A;  1OMW A;  2YS3 A;  4HAV B;  4A5K A;  2YT0 A;  2RUK B;  5KCV A;  2YRY A;  3NWF A;  3ULC A;  5FI1 A;  2K49 A;  4ZRK A;  3DXD A;  2ELA A;  4IAP A;  2DX5 A;  4KAX B;  5J3Y A;  2YS5 A;  2H7D A;  3NWD A;  3A58 A;  4GN1 A;  3SYX A;  4A6H A;  1WJM A;  3PZD A;  2LOX A;  3TW1 A;  3HSA A;  2X18 A;  1XD4 A;  4TKN A;  4IFS A;  2RRF A;  1M7R A;  4KHA A;  4NY0 A;  2DYN A;  1EVH A;  1K5D B;  3X23 A;  1P6S A;  1J19 A;  1KZ7 A;  4GMX B;  4BBK A;  3HQC A;  4KVG B;  3U8Z A;  1BWN A;  1T77 A;  2AL6 A;  1V88 A;  2M38 A;  4HDQ A;  2ZPY A;  1MIZ B;  3GYP A;  1RRP B;  2Z13 A;  4TYZ A;  2K2J A;  2VRW B;  2GS0 A;  2D2Q A;  2J0M A;  2MDX A;  2K00 A;  2R0D A;  1WJ1 A;  2DKP A;  5D27 A;  3DXE A;  2Z0O A;  4HB2 B;  3VIA A;  3P6A A;  5GOW B;  3FSS A;  4GPT B;  3HW2 B;  4WVF B;  5D3X A;  1B55 A;  4HB4 B;  1OQN A;  4QJ5 B;  2AEH A;  2KIE A;  1U5F A;  2D10 A;  4HAY B;  2DTC A;  3A8Q A;  1X11 A;  4HDO A;  1UPR A;  3MDB C;  4GZU A;  3ODW A;  2UZR A;  1WI1 A;  2Z59 A;  2Z0P A;  3PSC A;  2IYB A;  3KSY A;  5LOP B;  4YON A;  2D9V A;  2DHK A;  5C16 A;  5JP4 A;  1FOE A;  2J59 M;  2H7E A;  2RGN B;  1LW3 A;  1UEF A;  3QIJ A;  3G9W A;  4P7I A;  2UVM A;  3V5W A;  2Y8F A;  1H4R A;  4DX9 0;  4HAT B;  2Z0Q A;  2OTX A;  2D9Y A;  2ROV A;  4K81 A;  3FVC A;  3TO1 A;  4WJ7 A;  1W1D A;  1ZYI A;  4ZRJ A;  1RJ2 A;  1XX0 A;  2DLW A;  2K8E A;  2Y8G A;  1MAI A;  1X86 A;  3N7C A;  2DHI A;  3OHM B;  2KGX B;  2P0H A;  5HE3 A;  4PNK A;  1WGQ A;  2P0D A;  5JHH A;  3QBV B;  1DRO A;  3AU4 A;  4GMV A;  5HE0 A;  2DYQ A;  4XWX A;  4QJ4 B;  4Z2M B;  1SHC A;  2COA A; 
#chains in the Genus database with same CATH homology
 2COF A;  2LUL A;  2YS1 A;  3F0W A;  2YT1 A;  1ZVR A;  3LJU X;  2CRF A;  4MK0 A;  2CY4 A;  1QC6 A;  1J0W A;  4WSF A;  2HTH B;  5DIF B;  4HAU B;  5KQ1 A;  5C5B A;  2Y7B A;  2N23 A;  1UPQ A;  2QKM A;  1WVH A;  2ELB A;  1FAO A;  4C0A A;  2J0K A;  3T06 A;  3SV1 A;  2NZ8 B;  3SNH A;  3BIN A;  4K17 A;  2LOZ A;  3CXB B;  2M14 A;  2MFQ A;  3O96 A;  3D8F A;  1ZC3 B;  4F7U P;  2OQB A;  3KY9 A;  2D11 A;  3P7Z A;  2RVB B;  1U5E A;  3IVF A;  3PVW A;  1X1F A;  1BAK A;  4PQ0 A;  2RNR B;  1M7E A;  1MPH A;  1DDW A;  1TXD A;  1MK7 B;  2EC1 A;  5KQ4 A;  1FHO A;  1QQG A;  5C6R A;  2KCJ A;  2YF0 A;  3TCA A;  1AWE A;  1KI1 B;  4HAX B;  1U5G A;  1Y5O A;  2DFK A;  1I7A A;  1V5U A;  2MKR A;  3KZ1 A;  2KUP A;  5DH9 B;  2ADZ A;  4MY6 A;  3A8P A;  2QKL A;  4L6E A;  1KZG A;  1XR0 B;  2W2X C;  3SO6 A;  1OY2 A;  4DBB A;  2N0Y A;  3OAN A;  1PFJ A;  4MT7 A;  2K2U A;  1P5T A;  2GJY A;  3FM8 C;  3NSU A;  3SUZ A;  1UNR A;  3ODX A;  1V5M A;  2I1J A;  2DN6 A;  1W1G A;  4HB3 B;  4EJN A;  1X1G A;  4A6F B;  5HE1 A;  3PEG A;  1H10 A;  2W2X D;  1XKE A;  3BJI A;  1UNP A;  3D8D A;  1TJ6 A;  3KRW A;  3PVU A;  5FI0 A;  3MPX A;  5CLL B;  1WG7 A;  5CLQ B;  3FEH A;  5DHA B;  4HAZ B;  3U7D A;  4A6K A;  4A6F A;  2LYD A;  2R09 A;  3TVV A;  1GG3 A;  2L2I A;  5C5B B;  3QWM A;  2D9X A;  2D9Z A;  2DKQ A;  1DDM A;  2DX1 A;  1V5P A;  1FHX A;  2LKO A;  1U27 A;  2RSG A;  1V89 A;  4CYE A;  1I2H A;  2G35 A;  3AJ4 A;  1U5D A;  1ZM0 A;  4CHJ A;  2LG1 A;  2P8V A;  4CHM A;  2DA0 A;  2EJ8 A;  2L1C A;  1NTV A;  1GC6 A;  2VSZ A;  3ODO A;  1ISN A;  2P0F A;  1XOD A;  3ML4 A;  4HHV A;  3A98 B;  2EMS A;  4HAW B;  5DI9 B;  1MK9 B;  3D8E A;  3HK0 A;  3PG7 A;  3UZT A;  4K2P A;  1V61 A;  3CIK A;  1EGX A;  2VKI A;  1PLS A;  5J3T A;  1IRS A;  2D9W A;  1Y19 B;  1U29 A;  1GC7 A;  1PMS A;  2ROZ B;  3ZVR A;  3TFM A;  3RCP A;  1U2B A;  1NTY A;  4NSW A;  2YSZ A;  4EKU A;  3WYF B;  2CY5 A;  1FB8 A;  4H8S A;  1ZSQ A;  1EAZ A;  4GXB A;  4K2O A;  1NI2 A;  2UZS A;  5C79 A;  4HB0 B;  4DX8 A;  2PZ1 A;  2Q13 A;  2NMB A;  1X05 A;  3PVL A;  1SGH A;  5LON B;  1WGU A;  1P3R A;  2MWN B;  4YL8 A;  2XQN M;  3M1I B;  5D3Y A;  2GCL A;  3KRX A;  2RLO A;  1DDV A;  3ZDT A;  4ZRI A;  1Z87 A;  1TQZ A;  4F7G A;  1N3H A;  2I1K A;  3GYO A;  3F5R A;  1DYN A;  1NU2 A;  1EF1 A;  2E2X A;  5D3V A;  5D3W A;  1ZC4 B;  2GCJ A;  2DHJ A;  3AU5 A;  2I5F A;  4F7H A;  2YVC A;  5J3Q A;  5L81 A;  4DXA B;  2J0J A;  4Z2N A;  1BTK A;  2BCJ A;  1W1H A;  1MKE A;  4EMO A;  1Q67 A;  2EMT A;  3WA0 A;  3DXC A;  1UNQ A;  2COC A;  2D4Q A;  4B6H A;  4KHB B;  5JLJ B;  4IOY X;  1LB1 A;  3VOQ A;  1K5G B;  1MIX A;  1XCG A;  3ULB A;  2CAY A;  5HE2 A;  1E5W A;  5JHG A;  1BTN A;  1FGZ A;  2COD A;  5DHF B;  2FJL A;  2W2W A;  1DBH A;  2I5C A;  4D0N B;  4Y94 A;  4KHO A;  5EFX A;  1FHW A;  1AQC A;  3PP2 A;  2IFS A;  2JP2 A;  1FGY A;  2HE7 A;  2V76 A;  1OMW A;  2YS3 A;  4HAV B;  4A5K A;  2YT0 A;  2RUK B;  5KCV A;  2YRY A;  3ULC A;  5FI1 A;  4ZRK A;  3DXD A;  2ELA A;  4IAP A;  2DX5 A;  4KAX B;  5J3Y A;  2YS5 A;  2H7D A;  4GN1 A;  3SYX A;  4A6H A;  1WJM A;  3PZD A;  2LOX A;  3TW1 A;  2X18 A;  1XD4 A;  4TKN A;  4IFS A;  1M7R A;  4KHA A;  4NY0 A;  2DYN A;  1EVH A;  1K5D B;  3X23 A;  1P6S A;  1J19 A;  1KZ7 A;  4GMX B;  4BBK A;  3HQC A;  4KVG B;  3U8Z A;  1BWN A;  2AL6 A;  1V88 A;  2M38 A;  4HDQ A;  2ZPY A;  1MIZ B;  3GYP A;  1RRP B;  4TYZ A;  2K2J A;  2VRW B;  2GS0 A;  2D2Q A;  2J0M A;  2MDX A;  2K00 A;  2R0D A;  1WJ1 A;  2DKP A;  5D27 A;  3DXE A;  2Z0O A;  4HB2 B;  3VIA A;  3P6A A;  5GOW B;  3FSS A;  4GPT B;  3HW2 B;  4WVF B;  5D3X A;  1B55 A;  4HB4 B;  1OQN A;  2AEH A;  1U5F A;  2D10 A;  4HAY B;  2DTC A;  3A8Q A;  1X11 A;  4HDO A;  1UPR A;  3MDB C;  4GZU A;  3ODW A;  2UZR A;  1WI1 A;  3PSC A;  2Z0P A;  2IYB A;  3KSY A;  5LOP B;  4YON A;  2D9V A;  2DHK A;  5C16 A;  5JP4 A;  1FOE A;  2J59 M;  2H7E A;  2RGN B;  1LW3 A;  1UEF A;  3QIJ A;  3G9W A;  4P7I A;  2UVM A;  3V5W A;  2Y8F A;  1H4R A;  4DX9 0;  4HAT B;  2Z0Q A;  2OTX A;  2D9Y A;  2ROV A;  4K81 A;  3TO1 A;  4WJ7 A;  1W1D A;  4ZRJ A;  1RJ2 A;  1XX0 A;  2DLW A;  2Y8G A;  1MAI A;  1X86 A;  3N7C A;  2DHI A;  5HE3 A;  2KGX B;  2P0H A;  4PNK A;  1WGQ A;  2P0D A;  5JHH A;  3QBV B;  1DRO A;  3AU4 A;  4GMV A;  5HE0 A;  2DYQ A;  4XWX A;  4Z2M B;  1SHC A;  2COA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...