5DI9B

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5di9B00
1XCGA 4KAXB 5EFXA 2ADZA 2K00A 2DYNA 1XKEA 2DTCA 4KHAA 2W2XD 1KZGA 3PVWA 4EJNA 4A5KA 2D11A 2YF0A 1U5FA 4HB3B 3GYPA 3PP2A 5CLQB 1NU2A 2OTXA 3IVFA 5LONB 4MT7A 4GPTB 3ZDTA 4ZRIA 1TXDA 4A6KA 4D0NB 4KHOA 3V5WA 1WJ1A 2P0HA 5L81A 4A6HA 3N7CA 2CY5A 3KRXA 2P0FA 5C79A 3NSUA 2Q13A 1X1GA 2D9YA 5LOPB 3TO1A 1ZC3B 4BBKA 2DLWA 4WVFB 1EF1A 4C0AA 1FGZA 3PG7A 1PLSA 1AWEA 3VOQA 4B6HA 4DX90 3X23A 2V76A 1K5GB 2K2UA 1GC6A 2AL6A 3M1IB 5J3QA 2J0MA 4K2OA 5FI0A 2Y8FA 2EC1A 2DFKA 3HW2B 2JP2A 4KVGB 3U7DA 1QC6A 2N0YA 1N3HA 2LULA 1X05A 1J0WA 1MIZB 2D4QA 3VIAA 2D2QA 3A8PA 2AEHA 2ELBA 4HB4B 5C5BB 1KZ7A 5C6RA 5CLLB 1DROA 2YSZA 2GJYA 2J0JA 1P6SA 2N23A 2PZ1A 4L6EA 1I2HA 2YVCA 3O96A 1WGQA 1P5TA 2RUKB 1U5DA 5KQ1A 4HHVA 1FOEA 2IFSA 2MDXA 2X18A 3AU5A 2UVMA 5DHAB 1MAIA 5JLJB 2COFA 3DXDA 1FHWA 2LOXA 3F0WA 2RNRB 5JP4A 4TYZA 3PSCA 3ULCA 1DDMA 3P6AA 4IFSA 2ROVA 1XD4A 2I5FA 4YONA 1RRPB 2R0DA 1WJMA 1Y5OA 5D27A 3TFMA 1MKEA 3F5RA 2P0DA 2FJLA 4HAVB 2L2IA 2D9WA 5DI9B 4ZRJA 3ML4A 5D3XA 2CY4A 5JHGA 1PMSA 1GG3A 2CRFA 2RLOA 5C16A 1XX0A 1TQZA 2MFQA 1EAZA 1BTKA 4H8SA 1U2BA 2ZPYA 1AQCA 2DX5A 1MIXA 4A6FA 1OMWA 5HE0A 2I5CA 2GS0A 4NSWA 1GC7A 1X1FA 3D8DA 3ODOA 3D8FA 1ISNA 2LKOA 3FEHA 4K81A 5KQ4A 3DXEA 4HDOA 4HAXB 3QIJA 1M7RA 3ODXA 4GMXB 5D3VA 2D9ZA 1DBHA 4HAWB 4PQ0A 3KSYA 4KHBB 1V5PA 1ZC4B 1Y19B 1MK9B 3DXCA 2UZSA 5HE1A 1UNPA 1EVHA 2KUPA 1WG7A 4MK0A 2CAYA 4EKUA 2MKRA 1SHCA 3ULBA 2OQBA 1IRSA 3A98B 4XWXA 2DHIA 2M38A 1UNRA 2VKIA 3RCPA 1H4RA 2YT0A 1KI1B 5KCVA 4IOYX 4HAUB 5J3YA 2D9XA 4Z2MB 2W2WA 2YRYA 3SO6A 2CODA 2RSGA 2GCLA 2KCJA 4HAZB 2Z0OA 2G35A 5GOWB 5J3TA 3GYOA 2ROZB 4TKNA 1UEFA 1DDVA 3D8EA 4A6FB 4EMOA 1ZVRA 4GZUA 4MY6A 3PZDA 4K17A 2K2JA 3PEGA 4GXBA 4HDQA 3CXBB 1W1DA 5DH9B 3QWMA 2D9VA 3WYFB 2YT1A 1OQNA 3HQCA 4HB0B 3AJ4A 2HE7A 4HAYB 1V61A 3SNHA 3G9WA 4DXAB 2E2XA 1H10A 1U5GA 2RGNB 1UPQA 2W2XC 5C5BA 2COCA 4P7IA 5HE2A 1X86A 2R09A 3HK0A 2UZRA 2H7EA 2YS5A 1Q67A 1BWNA 2I1KA 2DKPA 2LOZA 4HATB 4F7HA 3PVLA 2P8VA 3SYXA 2GCJA 1FB8A 1FHOA 3TCAA 3P7ZA 4HB2B 2DA0A 3A8QA 4YL8A 3AU4A 1FHXA 1SGHA 3ODWA 1FAOA 2I1JA 4F7UP 3SUZA 1Z87A 1MK7B 3KY9A 2L1CA 1WI1A 3T06A 3U8ZA 3CIKA 1U5EA 4PNKA 3ZVRA 2J0KA 2YS1A 1TJ6A 1WVHA 1ZM0A 4DBBA 4K2PA 2BCJA 2NZ8B 2EMSA 1EGXA 2NMBA 2HTHB 1XODA 4ZRKA 2KGXB 1V5UA 1W1GA 2ELAA 1P3RA 1FGYA 5HE3A 3QBVB 1V89A 2Y8GA 2DYQA 2VSZA 1UPRA 1V88A 2QKLA 3FSSA 4GMVA 4CHMA 2EMTA 3KZ1A 2YS3A 1BAKA 1LW3A 1DYNA 2MWNB 2QKMA 2IYBA 2J59M 2DHJA 5D3WA 1DDWA 1X11A 1V5MA 1B55A 2Y7BA 2VRWB 1NTVA 3MPXA 3LJUX 5DIFB 5FI1A 4DX8A 4CYEA 2RVBB 2COAA 3FM8C 2D10A 1RJ2A 2Z0QA 3KRWA 1W1HA 2EJ8A 4CHJA 1LB1A 3WA0A 1U27A 1QQGA 1M7EA 4Z2NA 1E5WA 1BTNA 4F7GA 4NY0A 3BJIA 3TVVA 1J19A 3MDBC 1XR0B 2M14A 3OANA 1WGUA 4GN1A 2H7DA 1U29A 2DKQA 1NTYA 2XQNM 2DHKA 1PFJA 1MPHA 2DX1A 1OY2A 5D3YA 5JHHA 4IAPA 4WSFA 3PVUA 1ZSQA 4Y94A 3TW1A 3BINA 5DHFB 1NI2A 2LYDA 1K5DB 1I7AA 3UZTA 2DN6A 2LG1A 4WJ7A 2Z0PA 3SV1A 1UNQA
chains in the Genus database with same CATH superfamily
1XCGA 4KAXB 4QJ4B 5EFXA 2R2YA 3OHMB 3B77A 2ADZA 2K00A 2DYNA 1XKEA 2DTCA 4KHAA 2W2XD 1KZGA 3PVWA 4EJNA 4A5KA 2D11A 2YF0A 1U5FA 4HB3B 3GYPA 3PP2A 5CLQB 1NU2A 2OTXA 4OT1A 3IVFA 5LONB 4MT7A 4GPTB 3ZDTA 4ZRIA 1TXDA 4A6KA 4D0NB 4KHOA 3V5WA 1WJ1A 2P0HA 2KIGA 4QJ3B 5L81A 4A6HA 3N7CA 2CY5A 3KRXA 2P0FA 5C79A 3NSUA 2Q13A 1X1GA 2D9YA 5LOPB 3TO1A 2ZKMX 1ZC3B 4BBKA 2DLWA 4WVFB 1EF1A 4C0AA 1FGZA 3PG7A 1PLSA 1AWEA 3VOQA 4B6HA 3HSAA 4DX90 3X23A 5M4YB 2V76A 1K5GB 2K2UA 1GC6A 2AL6A 3M1IB 5J3QA 2J0MA 4K2OA 5FI0A 2Y8FA 2EC1A 2DFKA 2Z13A 3HW2B 2JP2A 4KVGB 3U7DA 1T77A 1QC6A 2N0YA 1N3HA 2LULA 1X05A 1J0WA 1MIZB 2D4QA 2K49A 3VIAA 2D2QA 3A8PA 2AEHA 2ELBA 4HB4B 5C5BB 1KZ7A 5C6RA 2NBVA 5CLLB 1DROA 3NWAA 2YSZA 2GJYA 2J0JA 1P6SA 2N23A 2PZ1A 4L6EA 1I2HA 2YVCA 2Z4DA 4KHBA 3O96A 1WGQA 1P5TA 2RUKB 1U5DA 4QJ5B 5KQ1A 2GUMA 4HHVA 1FOEA 2IFSA 4HSIA 2MDXA 2X18A 3AU5A 2UVMA 5DHAB 1MAIA 5JLJB 2COFA 3DXDA 4D6WA 1FHWA 2LOXA 3F0WA 2RNRB 5JP4A 4TYZA 3PSCA 3ULCA 3NWFA 1DDMA 3P6AA 4IFSA 2ROVA 1XD4A 2I5FA 4YONA 1RRPB 2R0DA 1WJMA 1Y5OA 5D27A 3TFMA 3FVCA 3HIEA 1MKEA 3F5RA 2P0DA 2FJLA 4HAVB 2L2IA 2D9WA 5DI9B 4ZRJA 3ML4A 5D3XA 2CY4A 5LG4B 5JHGA 1PMSA 1GG3A 2CRFA 2RLOA 4GOUA 5C16A 1XX0A 1TQZA 2MFQA 1EAZA 1BTKA 4H8SA 1U2BA 2ZPYA 1AQCA 2DX5A 1MIXA 4A6FA 1OMWA 5HE0A 2I5CA 2GS0A 4NSWA 1GC7A 2RRFA 2FJUB 1X1FA 3NW8A 3D8DA 3ODOA 3D8FA 1ISNA 2LKOA 3FEHA 4K81A 5KQ4A 4OSNA 3DXEA 4HDOA 4HAXB 3QIJA 1M7RA 3ODXA 4GMXB 5D3VA 2D9ZA 1DBHA 4HAWB 3U12A 4PQ0A 5I2SA 3KSYA 4KHBB 1V5PA 1ZC4B 1Y19B 1MK9B 3DXCA 2UZSA 5HE1A 1UNPA 1EVHA 2KUPA 1WG7A 4MK0A 2CAYA 4EKUA 2MKRA 1SHCA 3ULBA 2OQBA 1IRSA 3A98B 4XWXA 4CSQA 2DHIA 2M38A 1UNRA 2VKIA 3RCPA 1H4RA 2YT0A 1KI1B 4L1RA 5KCVA 2K8EA 4IOYX 4HAUB 5J3YA 2D9XA 4Z2MB 4GNKB 2W2WA 2YRYA 3SO6A 2CODA 2RSGA 2GCLA 2KCJA 4HAZB 2Z0OA 2G35A 5GOWB 5J3TA 3GYOA 2ROZB 4TKNA 1UEFA 1DDVA 3D8EA 4A6FB 5IRSA 4EMOA 1ZVRA 4QXAB 4GZUA 4MY6A 3PZDA 4K17A 2K2JA 3PEGA 4GXBA 4HDQA 3CXBB 3DCXA 1W1DA 5DH9B 3QWMA 2D9VA 2Z14A 3WYFB 2YT1A 1OQNA 2KIEA 2KUQA 3HQCA 2KR0A 4HB0B 3AJ4A 2HE7A 4HAYB 1V61A 3SNHA 3G9WA 4DXAB 2E2XA 1H10A 1U5GA 2RGNB 1UPQA 2W2XC 5C5BA 2COCA 4P7IA 5HE2A 1X86A 2R09A 3HK0A 2UZRA 2H7EA 2YS5A 1Q67A 1BWNA 2I1KA 2DKPA 2LOZA 3NWDA 4HATB 4F7HA 3PVLA 2P8VA 3SYXA 2GCJA 1FB8A 1FHOA 3TCAA 3P7ZA 4HB2B 2DA0A 3A8QA 4YL8A 3AU4A 1FHXA 1SGHA 3ODWA 1FAOA 2I1JA 4F7UP 3SUZA 1Z87A 1MK7B 3KY9A 2L1CA 1WI1A 3T06A 3U8ZA 3CIKA 1U5EA 4PNKA 3ZVRA 2J0KA 2YS1A 1TJ6A 1WVHA 1ZM0A 4DBBA 4K2PA 2BCJA 2NZ8B 2EMSA 1EGXA 2NMBA 2HTHB 1XODA 2Z59A 4ZRKA 2KGXB 1V5UA 1W1GA 1MI1A 4DIXA 2ELAA 1P3RA 1FGYA 5HE3A 3QBVB 1V89A 2Y8GA 2DYQA 2VSZA 1UPRA 1V88A 2QKLA 3FSSA 4GMVA 4CHMA 2EMTA 3KZ1A 2YS3A 1BAKA 1LW3A 1DYNA 2MWNB 2QKMA 2IYBA 2J59M 2DHJA 5D3WA 1DDWA 1X11A 1V5MA 1B55A 2Y7BA 2VRWB 1NTVA 3MPXA 3LJUX 5DIFB 5FI1A 4DX8A 4CYEA 2RVBB 2COAA 3FM8C 2D10A 1RJ2A 2Z0QA 3KRWA 1W1HA 2EJ8A 4CHJA 1LB1A 3WA0A 1U27A 1QQGA 1M7EA 4Z2NA 1E5WA 1BTNA 1ZYIA 4F7GA 4NY0A 3BJIA 3TVVA 1J19A 3MDBC 1XR0B 2M14A 3OANA 1WGUA 4GN1A 2H7DA 1U29A 2DKQA 1NTYA 2XQNM 2DHKA 1PFJA 1MPHA 2DX1A 1OY2A 5D3YA 5JHHA 3A58A 4IAPA 4WSFA 3PVUA 1ZSQA 4Y94A 3TW1A 3BINA 5DHFB 1NI2A 2LYDA 1K5DB 1I7AA 5I2MA 3UZTA 2DN6A 2LG1A 4WJ7A 2Z0PA 3SV1A 2YT2A 1UNQA
chains in the Genus database with same CATH topology
1XCGA 4KAXB 5EFXA 2ADZA 2K00A 2DYNA 1XKEA 2DTCA 4KHAA 2W2XD 1KZGA 3PVWA 4EJNA 4A5KA 2D11A 2YF0A 1U5FA 4HB3B 3GYPA 3PP2A 5CLQB 1NU2A 2OTXA 3IVFA 5LONB 4MT7A 4GPTB 3ZDTA 4ZRIA 1TXDA 4A6KA 4D0NB 4KHOA 3V5WA 1WJ1A 2P0HA 5L81A 4A6HA 3N7CA 2CY5A 3KRXA 2P0FA 5C79A 3NSUA 2Q13A 1X1GA 2D9YA 5LOPB 3TO1A 1ZC3B 4BBKA 2DLWA 4WVFB 1EF1A 4C0AA 1FGZA 3PG7A 1PLSA 1AWEA 3VOQA 4B6HA 4DX90 3X23A 2V76A 1K5GB 2K2UA 1GC6A 2AL6A 3M1IB 5J3QA 2J0MA 4K2OA 5FI0A 2Y8FA 2EC1A 2DFKA 3HW2B 2JP2A 4KVGB 3U7DA 1QC6A 2N0YA 1N3HA 2LULA 1X05A 1J0WA 1MIZB 2D4QA 3VIAA 2D2QA 3A8PA 2AEHA 2ELBA 4HB4B 5C5BB 1KZ7A 5C6RA 5CLLB 1DROA 2YSZA 2GJYA 2J0JA 1P6SA 2N23A 2PZ1A 4L6EA 1I2HA 2YVCA 3O96A 1WGQA 1P5TA 2RUKB 1U5DA 5KQ1A 4HHVA 1FOEA 2IFSA 2MDXA 2X18A 3AU5A 2UVMA 5DHAB 1MAIA 5JLJB 2COFA 3DXDA 1FHWA 2LOXA 3F0WA 2RNRB 5JP4A 4TYZA 3PSCA 3ULCA 1DDMA 3P6AA 4IFSA 2ROVA 1XD4A 2I5FA 4YONA 1RRPB 2R0DA 1WJMA 1Y5OA 5D27A 3TFMA 1MKEA 3F5RA 2P0DA 2FJLA 4HAVB 2L2IA 2D9WA 5DI9B 4ZRJA 3ML4A 5D3XA 2CY4A 5JHGA 1PMSA 1GG3A 2CRFA 2RLOA 5C16A 1XX0A 1TQZA 2MFQA 1EAZA 1BTKA 4H8SA 1U2BA 2ZPYA 1AQCA 2DX5A 1MIXA 4A6FA 1OMWA 5HE0A 2I5CA 2GS0A 4NSWA 1GC7A 1X1FA 3D8DA 3ODOA 3D8FA 1ISNA 2LKOA 3FEHA 4K81A 5KQ4A 3DXEA 4HDOA 4HAXB 3QIJA 1M7RA 3ODXA 4GMXB 5D3VA 2D9ZA 1DBHA 4HAWB 4PQ0A 3KSYA 4KHBB 1V5PA 1ZC4B 1Y19B 1MK9B 3DXCA 2UZSA 5HE1A 1UNPA 1EVHA 2KUPA 1WG7A 4MK0A 2CAYA 4EKUA 2MKRA 1SHCA 3ULBA 2OQBA 1IRSA 3A98B 4XWXA 2DHIA 2M38A 1UNRA 2VKIA 3RCPA 1H4RA 2YT0A 1KI1B 5KCVA 4IOYX 4HAUB 5J3YA 2D9XA 4Z2MB 2W2WA 2YRYA 3SO6A 2CODA 2RSGA 2GCLA 2KCJA 4HAZB 2Z0OA 2G35A 5GOWB 5J3TA 3GYOA 2ROZB 4TKNA 1UEFA 1DDVA 3D8EA 4A6FB 4EMOA 1ZVRA 4GZUA 4MY6A 3PZDA 4K17A 2K2JA 3PEGA 4GXBA 4HDQA 3CXBB 1W1DA 5DH9B 3QWMA 2D9VA 3WYFB 2YT1A 1OQNA 3HQCA 4HB0B 3AJ4A 2HE7A 4HAYB 1V61A 3SNHA 3G9WA 4DXAB 2E2XA 1H10A 1U5GA 2RGNB 1UPQA 2W2XC 5C5BA 2COCA 4P7IA 5HE2A 1X86A 2R09A 3HK0A 2UZRA 2H7EA 2YS5A 1Q67A 1BWNA 2I1KA 2DKPA 2LOZA 4HATB 4F7HA 3PVLA 2P8VA 3SYXA 2GCJA 1FB8A 1FHOA 3TCAA 3P7ZA 4HB2B 2DA0A 3A8QA 4YL8A 3AU4A 1FHXA 1SGHA 3ODWA 1FAOA 2I1JA 4F7UP 3SUZA 1Z87A 1MK7B 3KY9A 2L1CA 1WI1A 3T06A 3U8ZA 3CIKA 1U5EA 4PNKA 3ZVRA 2J0KA 2YS1A 1TJ6A 1WVHA 1ZM0A 4DBBA 4K2PA 2BCJA 2NZ8B 2EMSA 1EGXA 2NMBA 2HTHB 1XODA 4ZRKA 2KGXB 1V5UA 1W1GA 2ELAA 1P3RA 1FGYA 5HE3A 3QBVB 1V89A 2Y8GA 2DYQA 2VSZA 1UPRA 1V88A 2QKLA 3FSSA 4GMVA 4CHMA 2EMTA 3KZ1A 2YS3A 1BAKA 1LW3A 1DYNA 2MWNB 2QKMA 2IYBA 2J59M 2DHJA 5D3WA 1DDWA 1X11A 1V5MA 1B55A 2Y7BA 2VRWB 1NTVA 3MPXA 3LJUX 5DIFB 5FI1A 4DX8A 4CYEA 2RVBB 2COAA 3FM8C 2D10A 1RJ2A 2Z0QA 3KRWA 1W1HA 2EJ8A 4CHJA 1LB1A 3WA0A 1U27A 1QQGA 1M7EA 4Z2NA 1E5WA 1BTNA 4F7GA 4NY0A 3BJIA 3TVVA 1J19A 3MDBC 1XR0B 2M14A 3OANA 1WGUA 4GN1A 2H7DA 1U29A 2DKQA 1NTYA 2XQNM 2DHKA 1PFJA 1MPHA 2DX1A 1OY2A 5D3YA 5JHHA 4IAPA 4WSFA 3PVUA 1ZSQA 4Y94A 3TW1A 3BINA 5DHFB 1NI2A 2LYDA 1K5DB 1I7AA 3UZTA 2DN6A 2LG1A 4WJ7A 2Z0PA 3SV1A 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCG A;  4KAX B;  5EFX A;  2ADZ A;  2K00 A;  2DYN A;  1XKE A;  2DTC A;  4KHA A;  2W2X D;  1KZG A;  3PVW A;  4EJN A;  4A5K A;  2D11 A;  2YF0 A;  1U5F A;  4HB3 B;  3GYP A;  3PP2 A;  5CLQ B;  1NU2 A;  2OTX A;  3IVF A;  5LON B;  4MT7 A;  4GPT B;  3ZDT A;  4ZRI A;  1TXD A;  4A6K A;  4D0N B;  4KHO A;  3V5W A;  1WJ1 A;  2P0H A;  5L81 A;  4A6H A;  3N7C A;  2CY5 A;  3KRX A;  2P0F A;  5C79 A;  3NSU A;  2Q13 A;  1X1G A;  2D9Y A;  5LOP B;  3TO1 A;  1ZC3 B;  4BBK A;  2DLW A;  4WVF B;  1EF1 A;  4C0A A;  1FGZ A;  3PG7 A;  1PLS A;  1AWE A;  3VOQ A;  4B6H A;  4DX9 0;  3X23 A;  2V76 A;  1K5G B;  2K2U A;  1GC6 A;  2AL6 A;  3M1I B;  5J3Q A;  2J0M A;  4K2O A;  5FI0 A;  2Y8F A;  2EC1 A;  2DFK A;  3HW2 B;  2JP2 A;  4KVG B;  3U7D A;  1QC6 A;  2N0Y A;  1N3H A;  2LUL A;  1X05 A;  1J0W A;  1MIZ B;  2D4Q A;  3VIA A;  2D2Q A;  3A8P A;  2AEH A;  2ELB A;  4HB4 B;  5C5B B;  1KZ7 A;  5C6R A;  5CLL B;  1DRO A;  2YSZ A;  2GJY A;  2J0J A;  1P6S A;  2N23 A;  2PZ1 A;  4L6E A;  1I2H A;  2YVC A;  3O96 A;  1WGQ A;  1P5T A;  2RUK B;  1U5D A;  5KQ1 A;  4HHV A;  1FOE A;  2IFS A;  2MDX A;  2X18 A;  3AU5 A;  2UVM A;  5DHA B;  1MAI A;  5JLJ B;  2COF A;  3DXD A;  1FHW A;  2LOX A;  3F0W A;  2RNR B;  5JP4 A;  4TYZ A;  3PSC A;  3ULC A;  1DDM A;  3P6A A;  4IFS A;  2ROV A;  1XD4 A;  2I5F A;  4YON A;  1RRP B;  2R0D A;  1WJM A;  1Y5O A;  5D27 A;  3TFM A;  1MKE A;  3F5R A;  2P0D A;  2FJL A;  4HAV B;  2L2I A;  2D9W A;  5DI9 B;  4ZRJ A;  3ML4 A;  5D3X A;  2CY4 A;  5JHG A;  1PMS A;  1GG3 A;  2CRF A;  2RLO A;  5C16 A;  1XX0 A;  1TQZ A;  2MFQ A;  1EAZ A;  1BTK A;  4H8S A;  1U2B A;  2ZPY A;  1AQC A;  2DX5 A;  1MIX A;  4A6F A;  1OMW A;  5HE0 A;  2I5C A;  2GS0 A;  4NSW A;  1GC7 A;  1X1F A;  3D8D A;  3ODO A;  3D8F A;  1ISN A;  2LKO A;  3FEH A;  4K81 A;  5KQ4 A;  3DXE A;  4HDO A;  4HAX B;  3QIJ A;  1M7R A;  3ODX A;  4GMX B;  5D3V A;  2D9Z A;  1DBH A;  4HAW B;  4PQ0 A;  3KSY A;  4KHB B;  1V5P A;  1ZC4 B;  1Y19 B;  1MK9 B;  3DXC A;  2UZS A;  5HE1 A;  1UNP A;  1EVH A;  2KUP A;  1WG7 A;  4MK0 A;  2CAY A;  4EKU A;  2MKR A;  1SHC A;  3ULB A;  2OQB A;  1IRS A;  3A98 B;  4XWX A;  2DHI A;  2M38 A;  1UNR A;  2VKI A;  3RCP A;  1H4R A;  2YT0 A;  1KI1 B;  5KCV A;  4IOY X;  4HAU B;  5J3Y A;  2D9X A;  4Z2M B;  2W2W A;  2YRY A;  3SO6 A;  2COD A;  2RSG A;  2GCL A;  2KCJ A;  4HAZ B;  2Z0O A;  2G35 A;  5GOW B;  5J3T A;  3GYO A;  2ROZ B;  4TKN A;  1UEF A;  1DDV A;  3D8E A;  4A6F B;  4EMO A;  1ZVR A;  4GZU A;  4MY6 A;  3PZD A;  4K17 A;  2K2J A;  3PEG A;  4GXB A;  4HDQ A;  3CXB B;  1W1D A;  5DH9 B;  3QWM A;  2D9V A;  3WYF B;  2YT1 A;  1OQN A;  3HQC A;  4HB0 B;  3AJ4 A;  2HE7 A;  4HAY B;  1V61 A;  3SNH A;  3G9W A;  4DXA B;  2E2X A;  1H10 A;  1U5G A;  2RGN B;  1UPQ A;  2W2X C;  5C5B A;  2COC A;  4P7I A;  5HE2 A;  1X86 A;  2R09 A;  3HK0 A;  2UZR A;  2H7E A;  2YS5 A;  1Q67 A;  1BWN A;  2I1K A;  2DKP A;  2LOZ A;  4HAT B;  4F7H A;  3PVL A;  2P8V A;  3SYX A;  2GCJ A;  1FB8 A;  1FHO A;  3TCA A;  3P7Z A;  4HB2 B;  2DA0 A;  3A8Q A;  4YL8 A;  3AU4 A;  1FHX A;  1SGH A;  3ODW A;  1FAO A;  2I1J A;  4F7U P;  3SUZ A;  1Z87 A;  1MK7 B;  3KY9 A;  2L1C A;  1WI1 A;  3T06 A;  3U8Z A;  3CIK A;  1U5E A;  4PNK A;  3ZVR A;  2J0K A;  2YS1 A;  1TJ6 A;  1WVH A;  1ZM0 A;  4DBB A;  4K2P A;  2BCJ A;  2NZ8 B;  2EMS A;  1EGX A;  2NMB A;  2HTH B;  1XOD A;  4ZRK A;  2KGX B;  1V5U A;  1W1G A;  2ELA A;  1P3R A;  1FGY A;  5HE3 A;  3QBV B;  1V89 A;  2Y8G A;  2DYQ A;  2VSZ A;  1UPR A;  1V88 A;  2QKL A;  3FSS A;  4GMV A;  4CHM A;  2EMT A;  3KZ1 A;  2YS3 A;  1BAK A;  1LW3 A;  1DYN A;  2MWN B;  2QKM A;  2IYB A;  2J59 M;  2DHJ A;  5D3W A;  1DDW A;  1X11 A;  1V5M A;  1B55 A;  2Y7B A;  2VRW B;  1NTV A;  3MPX A;  3LJU X;  5DIF B;  5FI1 A;  4DX8 A;  4CYE A;  2RVB B;  2COA A;  3FM8 C;  2D10 A;  1RJ2 A;  2Z0Q A;  3KRW A;  1W1H A;  2EJ8 A;  4CHJ A;  1LB1 A;  3WA0 A;  1U27 A;  1QQG A;  1M7E A;  4Z2N A;  1E5W A;  1BTN A;  4F7G A;  4NY0 A;  3BJI A;  3TVV A;  1J19 A;  3MDB C;  1XR0 B;  2M14 A;  3OAN A;  1WGU A;  4GN1 A;  2H7D A;  1U29 A;  2DKQ A;  1NTY A;  2XQN M;  2DHK A;  1PFJ A;  1MPH A;  2DX1 A;  1OY2 A;  5D3Y A;  5JHH A;  4IAP A;  4WSF A;  3PVU A;  1ZSQ A;  4Y94 A;  3TW1 A;  3BIN A;  5DHF B;  1NI2 A;  2LYD A;  1K5D B;  1I7A A;  3UZT A;  2DN6 A;  2LG1 A;  4WJ7 A;  2Z0P A;  3SV1 A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 1XCG A;  4KAX B;  4QJ4 B;  5EFX A;  2R2Y A;  3OHM B;  3B77 A;  2ADZ A;  2K00 A;  2DYN A;  1XKE A;  2DTC A;  4KHA A;  2W2X D;  1KZG A;  3PVW A;  4EJN A;  4A5K A;  2D11 A;  2YF0 A;  1U5F A;  4HB3 B;  3GYP A;  3PP2 A;  5CLQ B;  1NU2 A;  2OTX A;  4OT1 A;  3IVF A;  5LON B;  4MT7 A;  4GPT B;  3ZDT A;  4ZRI A;  1TXD A;  4A6K A;  4D0N B;  4KHO A;  3V5W A;  1WJ1 A;  2P0H A;  2KIG A;  4QJ3 B;  5L81 A;  4A6H A;  3N7C A;  2CY5 A;  3KRX A;  2P0F A;  5C79 A;  3NSU A;  2Q13 A;  1X1G A;  2D9Y A;  5LOP B;  3TO1 A;  2ZKM X;  1ZC3 B;  4BBK A;  2DLW A;  4WVF B;  1EF1 A;  4C0A A;  1FGZ A;  3PG7 A;  1PLS A;  1AWE A;  3VOQ A;  4B6H A;  3HSA A;  4DX9 0;  3X23 A;  5M4Y B;  2V76 A;  1K5G B;  2K2U A;  1GC6 A;  2AL6 A;  3M1I B;  5J3Q A;  2J0M A;  4K2O A;  5FI0 A;  2Y8F A;  2EC1 A;  2DFK A;  2Z13 A;  3HW2 B;  2JP2 A;  4KVG B;  3U7D A;  1T77 A;  1QC6 A;  2N0Y A;  1N3H A;  2LUL A;  1X05 A;  1J0W A;  1MIZ B;  2D4Q A;  2K49 A;  3VIA A;  2D2Q A;  3A8P A;  2AEH A;  2ELB A;  4HB4 B;  5C5B B;  1KZ7 A;  5C6R A;  2NBV A;  5CLL B;  1DRO A;  3NWA A;  2YSZ A;  2GJY A;  2J0J A;  1P6S A;  2N23 A;  2PZ1 A;  4L6E A;  1I2H A;  2YVC A;  2Z4D A;  4KHB A;  3O96 A;  1WGQ A;  1P5T A;  2RUK B;  1U5D A;  4QJ5 B;  5KQ1 A;  2GUM A;  4HHV A;  1FOE A;  2IFS A;  4HSI A;  2MDX A;  2X18 A;  3AU5 A;  2UVM A;  5DHA B;  1MAI A;  5JLJ B;  2COF A;  3DXD A;  4D6W A;  1FHW A;  2LOX A;  3F0W A;  2RNR B;  5JP4 A;  4TYZ A;  3PSC A;  3ULC A;  3NWF A;  1DDM A;  3P6A A;  4IFS A;  2ROV A;  1XD4 A;  2I5F A;  4YON A;  1RRP B;  2R0D A;  1WJM A;  1Y5O A;  5D27 A;  3TFM A;  3FVC A;  3HIE A;  1MKE A;  3F5R A;  2P0D A;  2FJL A;  4HAV B;  2L2I A;  2D9W A;  5DI9 B;  4ZRJ A;  3ML4 A;  5D3X A;  2CY4 A;  5LG4 B;  5JHG A;  1PMS A;  1GG3 A;  2CRF A;  2RLO A;  4GOU A;  5C16 A;  1XX0 A;  1TQZ A;  2MFQ A;  1EAZ A;  1BTK A;  4H8S A;  1U2B A;  2ZPY A;  1AQC A;  2DX5 A;  1MIX A;  4A6F A;  1OMW A;  5HE0 A;  2I5C A;  2GS0 A;  4NSW A;  1GC7 A;  2RRF A;  2FJU B;  1X1F A;  3NW8 A;  3D8D A;  3ODO A;  3D8F A;  1ISN A;  2LKO A;  3FEH A;  4K81 A;  5KQ4 A;  4OSN A;  3DXE A;  4HDO A;  4HAX B;  3QIJ A;  1M7R A;  3ODX A;  4GMX B;  5D3V A;  2D9Z A;  1DBH A;  4HAW B;  3U12 A;  4PQ0 A;  5I2S A;  3KSY A;  4KHB B;  1V5P A;  1ZC4 B;  1Y19 B;  1MK9 B;  3DXC A;  2UZS A;  5HE1 A;  1UNP A;  1EVH A;  2KUP A;  1WG7 A;  4MK0 A;  2CAY A;  4EKU A;  2MKR A;  1SHC A;  3ULB A;  2OQB A;  1IRS A;  3A98 B;  4XWX A;  4CSQ A;  2DHI A;  2M38 A;  1UNR A;  2VKI A;  3RCP A;  1H4R A;  2YT0 A;  1KI1 B;  4L1R A;  5KCV A;  2K8E A;  4IOY X;  4HAU B;  5J3Y A;  2D9X A;  4Z2M B;  4GNK B;  2W2W A;  2YRY A;  3SO6 A;  2COD A;  2RSG A;  2GCL A;  2KCJ A;  4HAZ B;  2Z0O A;  2G35 A;  5GOW B;  5J3T A;  3GYO A;  2ROZ B;  4TKN A;  1UEF A;  1DDV A;  3D8E A;  4A6F B;  5IRS A;  4EMO A;  1ZVR A;  4QXA B;  4GZU A;  4MY6 A;  3PZD A;  4K17 A;  2K2J A;  3PEG A;  4GXB A;  4HDQ A;  3CXB B;  3DCX A;  1W1D A;  5DH9 B;  3QWM A;  2D9V A;  2Z14 A;  3WYF B;  2YT1 A;  1OQN A;  2KIE A;  2KUQ A;  3HQC A;  2KR0 A;  4HB0 B;  3AJ4 A;  2HE7 A;  4HAY B;  1V61 A;  3SNH A;  3G9W A;  4DXA B;  2E2X A;  1H10 A;  1U5G A;  2RGN B;  1UPQ A;  2W2X C;  5C5B A;  2COC A;  4P7I A;  5HE2 A;  1X86 A;  2R09 A;  3HK0 A;  2UZR A;  2H7E A;  2YS5 A;  1Q67 A;  1BWN A;  2I1K A;  2DKP A;  2LOZ A;  3NWD A;  4HAT B;  4F7H A;  3PVL A;  2P8V A;  3SYX A;  2GCJ A;  1FB8 A;  1FHO A;  3TCA A;  3P7Z A;  4HB2 B;  2DA0 A;  3A8Q A;  4YL8 A;  3AU4 A;  1FHX A;  1SGH A;  3ODW A;  1FAO A;  2I1J A;  4F7U P;  3SUZ A;  1Z87 A;  1MK7 B;  3KY9 A;  2L1C A;  1WI1 A;  3T06 A;  3U8Z A;  3CIK A;  1U5E A;  4PNK A;  3ZVR A;  2J0K A;  2YS1 A;  1TJ6 A;  1WVH A;  1ZM0 A;  4DBB A;  4K2P A;  2BCJ A;  2NZ8 B;  2EMS A;  1EGX A;  2NMB A;  2HTH B;  1XOD A;  2Z59 A;  4ZRK A;  2KGX B;  1V5U A;  1W1G A;  1MI1 A;  4DIX A;  2ELA A;  1P3R A;  1FGY A;  5HE3 A;  3QBV B;  1V89 A;  2Y8G A;  2DYQ A;  2VSZ A;  1UPR A;  1V88 A;  2QKL A;  3FSS A;  4GMV A;  4CHM A;  2EMT A;  3KZ1 A;  2YS3 A;  1BAK A;  1LW3 A;  1DYN A;  2MWN B;  2QKM A;  2IYB A;  2J59 M;  2DHJ A;  5D3W A;  1DDW A;  1X11 A;  1V5M A;  1B55 A;  2Y7B A;  2VRW B;  1NTV A;  3MPX A;  3LJU X;  5DIF B;  5FI1 A;  4DX8 A;  4CYE A;  2RVB B;  2COA A;  3FM8 C;  2D10 A;  1RJ2 A;  2Z0Q A;  3KRW A;  1W1H A;  2EJ8 A;  4CHJ A;  1LB1 A;  3WA0 A;  1U27 A;  1QQG A;  1M7E A;  4Z2N A;  1E5W A;  1BTN A;  1ZYI A;  4F7G A;  4NY0 A;  3BJI A;  3TVV A;  1J19 A;  3MDB C;  1XR0 B;  2M14 A;  3OAN A;  1WGU A;  4GN1 A;  2H7D A;  1U29 A;  2DKQ A;  1NTY A;  2XQN M;  2DHK A;  1PFJ A;  1MPH A;  2DX1 A;  1OY2 A;  5D3Y A;  5JHH A;  3A58 A;  4IAP A;  4WSF A;  3PVU A;  1ZSQ A;  4Y94 A;  3TW1 A;  3BIN A;  5DHF B;  1NI2 A;  2LYD A;  1K5D B;  1I7A A;  5I2M A;  3UZT A;  2DN6 A;  2LG1 A;  4WJ7 A;  2Z0P A;  3SV1 A;  2YT2 A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 1XCG A;  4KAX B;  5EFX A;  2ADZ A;  2K00 A;  2DYN A;  1XKE A;  2DTC A;  4KHA A;  2W2X D;  1KZG A;  3PVW A;  4EJN A;  4A5K A;  2D11 A;  2YF0 A;  1U5F A;  4HB3 B;  3GYP A;  3PP2 A;  5CLQ B;  1NU2 A;  2OTX A;  3IVF A;  5LON B;  4MT7 A;  4GPT B;  3ZDT A;  4ZRI A;  1TXD A;  4A6K A;  4D0N B;  4KHO A;  3V5W A;  1WJ1 A;  2P0H A;  5L81 A;  4A6H A;  3N7C A;  2CY5 A;  3KRX A;  2P0F A;  5C79 A;  3NSU A;  2Q13 A;  1X1G A;  2D9Y A;  5LOP B;  3TO1 A;  1ZC3 B;  4BBK A;  2DLW A;  4WVF B;  1EF1 A;  4C0A A;  1FGZ A;  3PG7 A;  1PLS A;  1AWE A;  3VOQ A;  4B6H A;  4DX9 0;  3X23 A;  2V76 A;  1K5G B;  2K2U A;  1GC6 A;  2AL6 A;  3M1I B;  5J3Q A;  2J0M A;  4K2O A;  5FI0 A;  2Y8F A;  2EC1 A;  2DFK A;  3HW2 B;  2JP2 A;  4KVG B;  3U7D A;  1QC6 A;  2N0Y A;  1N3H A;  2LUL A;  1X05 A;  1J0W A;  1MIZ B;  2D4Q A;  3VIA A;  2D2Q A;  3A8P A;  2AEH A;  2ELB A;  4HB4 B;  5C5B B;  1KZ7 A;  5C6R A;  5CLL B;  1DRO A;  2YSZ A;  2GJY A;  2J0J A;  1P6S A;  2N23 A;  2PZ1 A;  4L6E A;  1I2H A;  2YVC A;  3O96 A;  1WGQ A;  1P5T A;  2RUK B;  1U5D A;  5KQ1 A;  4HHV A;  1FOE A;  2IFS A;  2MDX A;  2X18 A;  3AU5 A;  2UVM A;  5DHA B;  1MAI A;  5JLJ B;  2COF A;  3DXD A;  1FHW A;  2LOX A;  3F0W A;  2RNR B;  5JP4 A;  4TYZ A;  3PSC A;  3ULC A;  1DDM A;  3P6A A;  4IFS A;  2ROV A;  1XD4 A;  2I5F A;  4YON A;  1RRP B;  2R0D A;  1WJM A;  1Y5O A;  5D27 A;  3TFM A;  1MKE A;  3F5R A;  2P0D A;  2FJL A;  4HAV B;  2L2I A;  2D9W A;  5DI9 B;  4ZRJ A;  3ML4 A;  5D3X A;  2CY4 A;  5JHG A;  1PMS A;  1GG3 A;  2CRF A;  2RLO A;  5C16 A;  1XX0 A;  1TQZ A;  2MFQ A;  1EAZ A;  1BTK A;  4H8S A;  1U2B A;  2ZPY A;  1AQC A;  2DX5 A;  1MIX A;  4A6F A;  1OMW A;  5HE0 A;  2I5C A;  2GS0 A;  4NSW A;  1GC7 A;  1X1F A;  3D8D A;  3ODO A;  3D8F A;  1ISN A;  2LKO A;  3FEH A;  4K81 A;  5KQ4 A;  3DXE A;  4HDO A;  4HAX B;  3QIJ A;  1M7R A;  3ODX A;  4GMX B;  5D3V A;  2D9Z A;  1DBH A;  4HAW B;  4PQ0 A;  3KSY A;  4KHB B;  1V5P A;  1ZC4 B;  1Y19 B;  1MK9 B;  3DXC A;  2UZS A;  5HE1 A;  1UNP A;  1EVH A;  2KUP A;  1WG7 A;  4MK0 A;  2CAY A;  4EKU A;  2MKR A;  1SHC A;  3ULB A;  2OQB A;  1IRS A;  3A98 B;  4XWX A;  2DHI A;  2M38 A;  1UNR A;  2VKI A;  3RCP A;  1H4R A;  2YT0 A;  1KI1 B;  5KCV A;  4IOY X;  4HAU B;  5J3Y A;  2D9X A;  4Z2M B;  2W2W A;  2YRY A;  3SO6 A;  2COD A;  2RSG A;  2GCL A;  2KCJ A;  4HAZ B;  2Z0O A;  2G35 A;  5GOW B;  5J3T A;  3GYO A;  2ROZ B;  4TKN A;  1UEF A;  1DDV A;  3D8E A;  4A6F B;  4EMO A;  1ZVR A;  4GZU A;  4MY6 A;  3PZD A;  4K17 A;  2K2J A;  3PEG A;  4GXB A;  4HDQ A;  3CXB B;  1W1D A;  5DH9 B;  3QWM A;  2D9V A;  3WYF B;  2YT1 A;  1OQN A;  3HQC A;  4HB0 B;  3AJ4 A;  2HE7 A;  4HAY B;  1V61 A;  3SNH A;  3G9W A;  4DXA B;  2E2X A;  1H10 A;  1U5G A;  2RGN B;  1UPQ A;  2W2X C;  5C5B A;  2COC A;  4P7I A;  5HE2 A;  1X86 A;  2R09 A;  3HK0 A;  2UZR A;  2H7E A;  2YS5 A;  1Q67 A;  1BWN A;  2I1K A;  2DKP A;  2LOZ A;  4HAT B;  4F7H A;  3PVL A;  2P8V A;  3SYX A;  2GCJ A;  1FB8 A;  1FHO A;  3TCA A;  3P7Z A;  4HB2 B;  2DA0 A;  3A8Q A;  4YL8 A;  3AU4 A;  1FHX A;  1SGH A;  3ODW A;  1FAO A;  2I1J A;  4F7U P;  3SUZ A;  1Z87 A;  1MK7 B;  3KY9 A;  2L1C A;  1WI1 A;  3T06 A;  3U8Z A;  3CIK A;  1U5E A;  4PNK A;  3ZVR A;  2J0K A;  2YS1 A;  1TJ6 A;  1WVH A;  1ZM0 A;  4DBB A;  4K2P A;  2BCJ A;  2NZ8 B;  2EMS A;  1EGX A;  2NMB A;  2HTH B;  1XOD A;  4ZRK A;  2KGX B;  1V5U A;  1W1G A;  2ELA A;  1P3R A;  1FGY A;  5HE3 A;  3QBV B;  1V89 A;  2Y8G A;  2DYQ A;  2VSZ A;  1UPR A;  1V88 A;  2QKL A;  3FSS A;  4GMV A;  4CHM A;  2EMT A;  3KZ1 A;  2YS3 A;  1BAK A;  1LW3 A;  1DYN A;  2MWN B;  2QKM A;  2IYB A;  2J59 M;  2DHJ A;  5D3W A;  1DDW A;  1X11 A;  1V5M A;  1B55 A;  2Y7B A;  2VRW B;  1NTV A;  3MPX A;  3LJU X;  5DIF B;  5FI1 A;  4DX8 A;  4CYE A;  2RVB B;  2COA A;  3FM8 C;  2D10 A;  1RJ2 A;  2Z0Q A;  3KRW A;  1W1H A;  2EJ8 A;  4CHJ A;  1LB1 A;  3WA0 A;  1U27 A;  1QQG A;  1M7E A;  4Z2N A;  1E5W A;  1BTN A;  4F7G A;  4NY0 A;  3BJI A;  3TVV A;  1J19 A;  3MDB C;  1XR0 B;  2M14 A;  3OAN A;  1WGU A;  4GN1 A;  2H7D A;  1U29 A;  2DKQ A;  1NTY A;  2XQN M;  2DHK A;  1PFJ A;  1MPH A;  2DX1 A;  1OY2 A;  5D3Y A;  5JHH A;  4IAP A;  4WSF A;  3PVU A;  1ZSQ A;  4Y94 A;  3TW1 A;  3BIN A;  5DHF B;  1NI2 A;  2LYD A;  1K5D B;  1I7A A;  3UZT A;  2DN6 A;  2LG1 A;  4WJ7 A;  2Z0P A;  3SV1 A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...