5DI9B

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
128
Chain Sequence
b'HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Transport protein
source organism Homo sapiens
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
total genus 33
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5di9B00
2LYDA 5DHAB 1U5GA 2DTCA 2ROZB 2COAA 1WGUA 5KCVA 4HHVA 4HAVB 1WVHA 2W2XD 3SUZA 1OY2A 3GYPA 1P5TA 4K81A 1V5UA 4K2OA 5J3QA 2J0JA 2NZ8B 4DXAB 3UZTA 3DXCA 2VKIA 2J0MA 1BTKA 2IFSA 5FI1A 1MAIA 1GG3A 2MFQA 3DXDA 4WSFA 1TJ6A 1M7EA 4IOYX 2L2IA 4CYEA 1NTYA 5JHHA 2LG1A 3FM8C 2JP2A 1EVHA 1FHXA 1FHWA 2NMBA 1P6SA 2PZ1A 2EC1A 4C0AA 1H10A 4F7HA 2K2UA 1TQZA 4IFSA 3DXEA 3KRXA 2N23A 4NY0A 3T06A 2DN6A 2X18A 4WVFB 3TO1A 2YS3A 2CY4A 4TKNA 4GZUA 1X86A 1XKEA 1X1GA 3HQCA 2E2XA 2DKPA 3TCAA 2YT1A 3AU5A 1V61A 2ADZA 1FGYA 2RGNB 2YVCA 1FB8A 4KAXB 1Q67A 1DYNA 4HAZB 2KCJA 2DX5A 1PLSA 3ODXA 2N0YA 2UZRA 5DIFB 1W1GA 1DBHA 3TW1A 1SGHA 4Z2NA 5KQ4A 2MWNB 2P0DA 4GMXB 4K2PA 1WG7A 3A8QA 1I2HA 3VIAA 2COCA 2Z0QA 3D8FA 1ZVRA 3KZ1A 1UPRA 2AEHA 2K2JA 2RSGA 1AWEA 1DDWA 3N7CA 1X11A 1U2BA 2UVMA 3F0WA 3HK0A 4IAPA 1GC6A 2DLWA 1LW3A 2GCJA 2R0DA 2VRWB 4CHJA 1WJMA 4HB3B 3IVFA 4P7IA 2Y7BA 1NU2A 2Y8GA 2Z0PA 2YS1A 3CXBB 1Y5OA 2P0HA 1ZM0A 4KHAA 2RNRB 3WA0A 1MIZB 3MDBC 3PVLA 5CLQB 3BJIA 3CIKA 1QC6A 1OMWA 3O96A 5J3YA 3KSYA 1I7AA 1TXDA 4GPTB 3PVUA 3ODWA 4HB4B 3RCPA 2DHIA 3P7ZA 3U8ZA 4A6HA 3F5RA 1V89A 3A8PA 2EMSA 3QWMA 2D9YA 4PQ0A 1K5GB 5D3XA 1W1DA 1U29A 2CAYA 2D10A 3NSUA 5DHFB 3G9WA 1GC7A 2K00A 3VOQA 4DX90 1UPQA 1MPHA 2XQNM 5LONB 1XR0B 3AJ4A 4HAWB 3ZVRA 2Y8FA 1DROA 2D4QA 2EMTA 4ZRKA 2ROVA 2YT0A 3ODOA 3U7DA 3BINA 1MKEA 1Y19B 4HB0B 2I5CA 2LULA 2GJYA 2GS0A 2RVBB 2LOXA 3HW2B 3ULBA 5D3YA 2EJ8A 2W2XC 4GN1A 3FSSA 4KVGB 2D9WA 5DH9B 5CLLB 4KHOA 2GCLA 5HE0A 1N3HA 1FHOA 3PSCA 4A6FA 1SHCA 1AQCA 3A98B 2FJLA 1PFJA 2D9ZA 2VSZA 1FOEA 2ELAA 2MKRA 1XCGA 4A5KA 4GXBA 5EFXA 1BTNA 4B6HA 4EMOA 5J3TA 2YF0A 4F7GA 3V5WA 3D8EA 1Z87A 2HTHB 3PEGA 1UEFA 2D2QA 3LJUX 1OQNA 2CY5A 2DYNA 1MIXA 3M1IB 2LKOA 5C5BA 1U27A 5C5BB 1U5DA 1IRSA 5D27A 1P3RA 4H8SA 4DX8A 3PG7A 3KRWA 5HE3A 1B55A 2DFKA 3P6AA 2LOZA 3ML4A 2CODA 4EJNA 5D3WA 1XD4A 2I1JA 4A6KA 4HDOA 4L6EA 3PP2A 4HB2B 1BWNA 4DBBA 4WJ7A 1BAKA 2Q13A 2YSZA 1LB1A 4XWXA 1EAZA 2BCJA 1RRPB 1WJ1A 3OANA 4HAUB 5DI9B 3SO6A 2I1KA 3KY9A 2D9VA 5C16A 2W2WA 2MDXA 4F7UP 1FGZA 1U5EA 1DDMA 3QIJA 1ZC3B 1H4RA 3FEHA 2RLOA 1XODA 4ZRIA 4D0NB 4MY6A 2KUPA 4CHMA 5JP4A 1DDVA 1NI2A 1XX0A 3MPXA 2H7EA 2ZPYA 2M14A 1E5WA 1M7RA 2YRYA 2L1CA 4K17A 5FI0A 3GYOA 2QKMA 3X23A 2CRFA 2DX1A 3SV1A 5HE2A 3QBVB 1X05A 1WI1A 5JHGA 2J0KA 4BBKA 4HAXB 1U5FA 2V76A 1UNPA 1UNQA 1WGQA 1UNRA 3PVWA 5L81A 1W1HA 1EF1A 2D9XA 2H7DA 3SYXA 3TFMA 1NTVA 4TYZA 4EKUA 2D11A 2J59M 2P8VA 3WYFB 5C79A 4PNKA 2DA0A 5GOWB 1V88A 3SNHA 2ELBA 2OQBA 2YS5A 1V5MA 3ZDTA 2KGXB 1EGXA 4MK0A 2R09A 5D3VA 1ZSQA 2HE7A 3AU4A 4Z2MB 1ISNA 2G35A 5JLJB 3TVVA 1QQGA 3ULCA 2P0FA 4A6FB 1KZ7A 2Z0OA 4GMVA 3D8DA 1KI1B 2DYQA 2DHJA 4Y94A 2COFA 1MK9B 1FAOA 4MT7A 4HATB 3PZDA 5HE1A 1PMSA 2IYBA 5KQ1A 2RUKB 1V5PA 1J0WA 2DKQA 5C6RA 4YL8A 1K5DB 4HDQA 1MK7B 1J19A 4HAYB 4YONA 2QKLA 1ZC4B 2UZSA 1RJ2A 2I5FA 2AL6A 1KZGA 2OTXA 4KHBB 4ZRJA 4NSWA 1X1FA 5LOPB 2DHKA 2M38A
chains in the Genus database with same CATH superfamily
2LYDA 2GUMA 5DHAB 1U5GA 2DTCA 2ROZB 2COAA 1WGUA 5KCVA 4HHVA 4HAVB 1WVHA 2W2XD 3SUZA 1OY2A 3GYPA 1P5TA 5I2SA 4K81A 1V5UA 3DCXA 4K2OA 5J3QA 2J0JA 2NZ8B 4DXAB 3UZTA 3DXCA 2VKIA 2J0MA 1BTKA 2IFSA 5FI1A 5I2MA 1MAIA 1GG3A 2MFQA 3DXDA 4WSFA 1TJ6A 1M7EA 4IOYX 4OSNA 2L2IA 3A58A 4CYEA 1NTYA 5JHHA 2LG1A 3FM8C 2JP2A 2Z13A 1EVHA 1FHXA 1FHWA 2NMBA 1P6SA 2PZ1A 2EC1A 4C0AA 1H10A 4F7HA 2K2UA 1TQZA 4IFSA 3DXEA 2NBVA 3KRXA 2N23A 4NY0A 3T06A 4GOUA 2DN6A 2X18A 4WVFB 3TO1A 2YS3A 2CY4A 4TKNA 4GZUA 1X86A 1XKEA 1X1GA 4D6WA 3HQCA 2E2XA 2DKPA 3TCAA 2YT1A 2Z4DA 3AU5A 1V61A 2ADZA 3U12A 1FGYA 2RGNB 2YVCA 1FB8A 4KAXB 1Q67A 1DYNA 4HAZB 2KCJA 2DX5A 1PLSA 3ODXA 2N0YA 2UZRA 3NW8A 5DIFB 1W1GA 1DBHA 4KHBA 3TW1A 1SGHA 4Z2NA 5KQ4A 2MWNB 2P0DA 4GMXB 4K2PA 1WG7A 3A8QA 1I2HA 3VIAA 2COCA 2Z0QA 3D8FA 1ZVRA 3KZ1A 1UPRA 2AEHA 2K2JA 2RSGA 1AWEA 1DDWA 3N7CA 2Z14A 1X11A 1U2BA 2UVMA 3F0WA 3HK0A 4IAPA 1GC6A 2DLWA 1LW3A 2GCJA 2R0DA 2VRWB 4CHJA 1WJMA 4HB3B 3IVFA 4P7IA 2Y7BA 1NU2A 2Y8GA 2Z0PA 2YS1A 3CXBB 1Y5OA 2P0HA 4CSQA 1ZM0A 4KHAA 2RNRB 3WA0A 1MIZB 3MDBC 3PVLA 5CLQB 3BJIA 3CIKA 1QC6A 1OMWA 2K49A 3O96A 5J3YA 3KSYA 1I7AA 1TXDA 4GPTB 3PVUA 3ODWA 1T77A 4HB4B 3RCPA 2DHIA 3P7ZA 3U8ZA 4A6HA 3F5RA 2FJUB 1V89A 3A8PA 2EMSA 1ZYIA 2D9YA 3QWMA 4PQ0A 1K5GB 5D3XA 1W1DA 1U29A 2CAYA 2D10A 2KIGA 3NSUA 3OHMB 5DHFB 3G9WA 1GC7A 2K00A 3VOQA 4DX90 1MI1A 3FVCA 1UPQA 1MPHA 2XQNM 5LONB 1XR0B 3AJ4A 4HAWB 3ZVRA 2Y8FA 1DROA 2D4QA 2EMTA 4ZRKA 2ROVA 2YT0A 3ODOA 3U7DA 3BINA 1MKEA 1Y19B 4HB0B 2I5CA 2LULA 2GJYA 2GS0A 4QJ4B 2RVBB 2LOXA 3HW2B 3ULBA 5D3YA 2EJ8A 2W2XC 4GN1A 3FSSA 4KVGB 2D9WA 5DH9B 5CLLB 4KHOA 2GCLA 5HE0A 1N3HA 2KR0A 4L1RA 1FHOA 3PSCA 4A6FA 1SHCA 1AQCA 3A98B 2FJLA 2YT2A 1PFJA 2D9ZA 2R2YA 2VSZA 1FOEA 2ELAA 2MKRA 1XCGA 4A5KA 4GXBA 5EFXA 1BTNA 4B6HA 4EMOA 5J3TA 2YF0A 4F7GA 3V5WA 3D8EA 1Z87A 2HTHB 3PEGA 1UEFA 2D2QA 3LJUX 4QJ3B 1OQNA 2CY5A 2DYNA 1MIXA 3M1IB 2LKOA 5C5BA 1U27A 5C5BB 1U5DA 1IRSA 5D27A 1P3RA 4H8SA 4DX8A 2K8EA 3KRWA 3PG7A 5HE3A 3NWFA 1B55A 2DFKA 3P6AA 2LOZA 3ML4A 2CODA 4EJNA 5D3WA 1XD4A 2I1JA 4A6KA 4HDOA 4L6EA 3PP2A 4QJ5B 4HB2B 1BWNA 4DBBA 4WJ7A 1BAKA 3NWDA 2Q13A 4DIXA 2YSZA 1LB1A 4XWXA 5IRSA 1EAZA 2BCJA 1RRPB 1WJ1A 3OANA 4HAUB 5DI9B 3SO6A 2I1KA 3KY9A 2D9VA 5C16A 2W2WA 3HIEA 2MDXA 4F7UP 3NWAA 1FGZA 1U5EA 1DDMA 3QIJA 1ZC3B 1H4RA 3FEHA 2RLOA 1XODA 5M4YB 4ZRIA 4D0NB 4MY6A 2KUPA 4CHMA 5JP4A 1DDVA 1NI2A 4OT1A 1XX0A 3MPXA 2H7EA 2ZPYA 2M14A 1E5WA 1M7RA 2YRYA 2L1CA 4K17A 5FI0A 3GYOA 2QKMA 3X23A 2CRFA 2DX1A 3SV1A 5HE2A 3QBVB 1X05A 2KIEA 1WI1A 5JHGA 2J0KA 4BBKA 4HAXB 1U5FA 2V76A 1UNPA 1UNQA 1WGQA 1UNRA 3PVWA 5L81A 1W1HA 1EF1A 2D9XA 2H7DA 3SYXA 3TFMA 1NTVA 4TYZA 4EKUA 2D11A 5LG4B 2J59M 2P8VA 4GNKB 3WYFB 5C79A 4PNKA 2DA0A 5GOWB 1V88A 3SNHA 2ELBA 2OQBA 2YS5A 1V5MA 3ZDTA 2KGXB 3B77A 2KUQA 1EGXA 4MK0A 2R09A 5D3VA 1ZSQA 2HE7A 3AU4A 4Z2MB 1ISNA 3HSAA 2G35A 5JLJB 3TVVA 1QQGA 3ULCA 2P0FA 4A6FB 1KZ7A 2Z0OA 4GMVA 2ZKMX 3D8DA 1KI1B 2DYQA 2DHJA 4Y94A 2COFA 1MK9B 1FAOA 4MT7A 4HATB 3PZDA 5HE1A 2RRFA 1PMSA 2IYBA 5KQ1A 2RUKB 1V5PA 1J0WA 2DKQA 5C6RA 4YL8A 1K5DB 4HDQA 1MK7B 1J19A 4HAYB 4YONA 2QKLA 1ZC4B 4HSIA 2UZSA 1RJ2A 2I5FA 2AL6A 1KZGA 2Z59A 4QXAB 2OTXA 4KHBB 4ZRJA 4NSWA 1X1FA 5LOPB 2DHKA 2M38A
chains in the Genus database with same CATH topology
2LYDA 5DHAB 1U5GA 2DTCA 2ROZB 2COAA 1WGUA 5KCVA 4HHVA 4HAVB 1WVHA 2W2XD 3SUZA 1OY2A 3GYPA 1P5TA 4K81A 1V5UA 4K2OA 5J3QA 2J0JA 2NZ8B 4DXAB 3UZTA 3DXCA 2VKIA 2J0MA 1BTKA 2IFSA 5FI1A 1MAIA 1GG3A 2MFQA 3DXDA 4WSFA 1TJ6A 1M7EA 4IOYX 2L2IA 4CYEA 1NTYA 5JHHA 2LG1A 3FM8C 2JP2A 1EVHA 1FHXA 1FHWA 2NMBA 1P6SA 2PZ1A 2EC1A 4C0AA 1H10A 4F7HA 2K2UA 1TQZA 4IFSA 3DXEA 3KRXA 2N23A 4NY0A 3T06A 2DN6A 2X18A 4WVFB 3TO1A 2YS3A 2CY4A 4TKNA 4GZUA 1X86A 1XKEA 1X1GA 3HQCA 2E2XA 2DKPA 3TCAA 2YT1A 3AU5A 1V61A 2ADZA 1FGYA 2RGNB 2YVCA 1FB8A 4KAXB 1Q67A 1DYNA 4HAZB 2KCJA 2DX5A 1PLSA 3ODXA 2N0YA 2UZRA 5DIFB 1W1GA 1DBHA 3TW1A 1SGHA 4Z2NA 5KQ4A 2MWNB 2P0DA 4GMXB 4K2PA 1WG7A 3A8QA 1I2HA 3VIAA 2COCA 2Z0QA 3D8FA 1ZVRA 3KZ1A 1UPRA 2AEHA 2K2JA 2RSGA 1AWEA 1DDWA 3N7CA 1X11A 1U2BA 2UVMA 3F0WA 3HK0A 4IAPA 1GC6A 2DLWA 1LW3A 2GCJA 2R0DA 2VRWB 4CHJA 1WJMA 4HB3B 3IVFA 4P7IA 2Y7BA 1NU2A 2Y8GA 2Z0PA 2YS1A 3CXBB 1Y5OA 2P0HA 1ZM0A 4KHAA 2RNRB 3WA0A 1MIZB 3MDBC 3PVLA 5CLQB 3BJIA 3CIKA 1QC6A 1OMWA 3O96A 5J3YA 3KSYA 1I7AA 1TXDA 4GPTB 3PVUA 3ODWA 4HB4B 3RCPA 2DHIA 3P7ZA 3U8ZA 4A6HA 3F5RA 1V89A 3A8PA 2EMSA 3QWMA 2D9YA 4PQ0A 1K5GB 5D3XA 1W1DA 1U29A 2CAYA 2D10A 3NSUA 5DHFB 3G9WA 1GC7A 2K00A 3VOQA 4DX90 1UPQA 1MPHA 2XQNM 5LONB 1XR0B 3AJ4A 4HAWB 3ZVRA 2Y8FA 1DROA 2D4QA 2EMTA 4ZRKA 2ROVA 2YT0A 3ODOA 3U7DA 3BINA 1MKEA 1Y19B 4HB0B 2I5CA 2LULA 2GJYA 2GS0A 2RVBB 2LOXA 3HW2B 3ULBA 5D3YA 2EJ8A 2W2XC 4GN1A 3FSSA 4KVGB 2D9WA 5DH9B 5CLLB 4KHOA 2GCLA 5HE0A 1N3HA 1FHOA 3PSCA 4A6FA 1SHCA 1AQCA 3A98B 2FJLA 1PFJA 2D9ZA 2VSZA 1FOEA 2ELAA 2MKRA 1XCGA 4A5KA 4GXBA 5EFXA 1BTNA 4B6HA 4EMOA 5J3TA 2YF0A 4F7GA 3V5WA 3D8EA 1Z87A 2HTHB 3PEGA 1UEFA 2D2QA 3LJUX 1OQNA 2CY5A 2DYNA 1MIXA 3M1IB 2LKOA 5C5BA 1U27A 5C5BB 1U5DA 1IRSA 5D27A 1P3RA 4H8SA 4DX8A 3PG7A 3KRWA 5HE3A 1B55A 2DFKA 3P6AA 2LOZA 3ML4A 2CODA 4EJNA 5D3WA 1XD4A 2I1JA 4A6KA 4HDOA 4L6EA 3PP2A 4HB2B 1BWNA 4DBBA 4WJ7A 1BAKA 2Q13A 2YSZA 1LB1A 4XWXA 1EAZA 2BCJA 1RRPB 1WJ1A 3OANA 4HAUB 5DI9B 3SO6A 2I1KA 3KY9A 2D9VA 5C16A 2W2WA 2MDXA 4F7UP 1FGZA 1U5EA 1DDMA 3QIJA 1ZC3B 1H4RA 3FEHA 2RLOA 1XODA 4ZRIA 4D0NB 4MY6A 2KUPA 4CHMA 5JP4A 1DDVA 1NI2A 1XX0A 3MPXA 2H7EA 2ZPYA 2M14A 1E5WA 1M7RA 2YRYA 2L1CA 4K17A 5FI0A 3GYOA 2QKMA 3X23A 2CRFA 2DX1A 3SV1A 5HE2A 3QBVB 1X05A 1WI1A 5JHGA 2J0KA 4BBKA 4HAXB 1U5FA 2V76A 1UNPA 1UNQA 1WGQA 1UNRA 3PVWA 5L81A 1W1HA 1EF1A 2D9XA 2H7DA 3SYXA 3TFMA 1NTVA 4TYZA 4EKUA 2D11A 2J59M 2P8VA 3WYFB 5C79A 4PNKA 2DA0A 5GOWB 1V88A 3SNHA 2ELBA 2OQBA 2YS5A 1V5MA 3ZDTA 2KGXB 1EGXA 4MK0A 2R09A 5D3VA 1ZSQA 2HE7A 3AU4A 4Z2MB 1ISNA 2G35A 5JLJB 3TVVA 1QQGA 3ULCA 2P0FA 4A6FB 1KZ7A 2Z0OA 4GMVA 3D8DA 1KI1B 2DYQA 2DHJA 4Y94A 2COFA 1MK9B 1FAOA 4MT7A 4HATB 3PZDA 5HE1A 1PMSA 2IYBA 5KQ1A 2RUKB 1V5PA 1J0WA 2DKQA 5C6RA 4YL8A 1K5DB 4HDQA 1MK7B 1J19A 4HAYB 4YONA 2QKLA 1ZC4B 2UZSA 1RJ2A 2I5FA 2AL6A 1KZGA 2OTXA 4KHBB 4ZRJA 4NSWA 1X1FA 5LOPB 2DHKA 2M38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYD A;  5DHA B;  1U5G A;  2DTC A;  2ROZ B;  2COA A;  1WGU A;  5KCV A;  4HHV A;  4HAV B;  1WVH A;  2W2X D;  3SUZ A;  1OY2 A;  3GYP A;  1P5T A;  4K81 A;  1V5U A;  4K2O A;  5J3Q A;  2J0J A;  2NZ8 B;  4DXA B;  3UZT A;  3DXC A;  2VKI A;  2J0M A;  1BTK A;  2IFS A;  5FI1 A;  1MAI A;  1GG3 A;  2MFQ A;  3DXD A;  4WSF A;  1TJ6 A;  1M7E A;  4IOY X;  2L2I A;  4CYE A;  1NTY A;  5JHH A;  2LG1 A;  3FM8 C;  2JP2 A;  1EVH A;  1FHX A;  1FHW A;  2NMB A;  1P6S A;  2PZ1 A;  2EC1 A;  4C0A A;  1H10 A;  4F7H A;  2K2U A;  1TQZ A;  4IFS A;  3DXE A;  3KRX A;  2N23 A;  4NY0 A;  3T06 A;  2DN6 A;  2X18 A;  4WVF B;  3TO1 A;  2YS3 A;  2CY4 A;  4TKN A;  4GZU A;  1X86 A;  1XKE A;  1X1G A;  3HQC A;  2E2X A;  2DKP A;  3TCA A;  2YT1 A;  3AU5 A;  1V61 A;  2ADZ A;  1FGY A;  2RGN B;  2YVC A;  1FB8 A;  4KAX B;  1Q67 A;  1DYN A;  4HAZ B;  2KCJ A;  2DX5 A;  1PLS A;  3ODX A;  2N0Y A;  2UZR A;  5DIF B;  1W1G A;  1DBH A;  3TW1 A;  1SGH A;  4Z2N A;  5KQ4 A;  2MWN B;  2P0D A;  4GMX B;  4K2P A;  1WG7 A;  3A8Q A;  1I2H A;  3VIA A;  2COC A;  2Z0Q A;  3D8F A;  1ZVR A;  3KZ1 A;  1UPR A;  2AEH A;  2K2J A;  2RSG A;  1AWE A;  1DDW A;  3N7C A;  1X11 A;  1U2B A;  2UVM A;  3F0W A;  3HK0 A;  4IAP A;  1GC6 A;  2DLW A;  1LW3 A;  2GCJ A;  2R0D A;  2VRW B;  4CHJ A;  1WJM A;  4HB3 B;  3IVF A;  4P7I A;  2Y7B A;  1NU2 A;  2Y8G A;  2Z0P A;  2YS1 A;  3CXB B;  1Y5O A;  2P0H A;  1ZM0 A;  4KHA A;  2RNR B;  3WA0 A;  1MIZ B;  3MDB C;  3PVL A;  5CLQ B;  3BJI A;  3CIK A;  1QC6 A;  1OMW A;  3O96 A;  5J3Y A;  3KSY A;  1I7A A;  1TXD A;  4GPT B;  3PVU A;  3ODW A;  4HB4 B;  3RCP A;  2DHI A;  3P7Z A;  3U8Z A;  4A6H A;  3F5R A;  1V89 A;  3A8P A;  2EMS A;  3QWM A;  2D9Y A;  4PQ0 A;  1K5G B;  5D3X A;  1W1D A;  1U29 A;  2CAY A;  2D10 A;  3NSU A;  5DHF B;  3G9W A;  1GC7 A;  2K00 A;  3VOQ A;  4DX9 0;  1UPQ A;  1MPH A;  2XQN M;  5LON B;  1XR0 B;  3AJ4 A;  4HAW B;  3ZVR A;  2Y8F A;  1DRO A;  2D4Q A;  2EMT A;  4ZRK A;  2ROV A;  2YT0 A;  3ODO A;  3U7D A;  3BIN A;  1MKE A;  1Y19 B;  4HB0 B;  2I5C A;  2LUL A;  2GJY A;  2GS0 A;  2RVB B;  2LOX A;  3HW2 B;  3ULB A;  5D3Y A;  2EJ8 A;  2W2X C;  4GN1 A;  3FSS A;  4KVG B;  2D9W A;  5DH9 B;  5CLL B;  4KHO A;  2GCL A;  5HE0 A;  1N3H A;  1FHO A;  3PSC A;  4A6F A;  1SHC A;  1AQC A;  3A98 B;  2FJL A;  1PFJ A;  2D9Z A;  2VSZ A;  1FOE A;  2ELA A;  2MKR A;  1XCG A;  4A5K A;  4GXB A;  5EFX A;  1BTN A;  4B6H A;  4EMO A;  5J3T A;  2YF0 A;  4F7G A;  3V5W A;  3D8E A;  1Z87 A;  2HTH B;  3PEG A;  1UEF A;  2D2Q A;  3LJU X;  1OQN A;  2CY5 A;  2DYN A;  1MIX A;  3M1I B;  2LKO A;  5C5B A;  1U27 A;  5C5B B;  1U5D A;  1IRS A;  5D27 A;  1P3R A;  4H8S A;  4DX8 A;  3PG7 A;  3KRW A;  5HE3 A;  1B55 A;  2DFK A;  3P6A A;  2LOZ A;  3ML4 A;  2COD A;  4EJN A;  5D3W A;  1XD4 A;  2I1J A;  4A6K A;  4HDO A;  4L6E A;  3PP2 A;  4HB2 B;  1BWN A;  4DBB A;  4WJ7 A;  1BAK A;  2Q13 A;  2YSZ A;  1LB1 A;  4XWX A;  1EAZ A;  2BCJ A;  1RRP B;  1WJ1 A;  3OAN A;  4HAU B;  5DI9 B;  3SO6 A;  2I1K A;  3KY9 A;  2D9V A;  5C16 A;  2W2W A;  2MDX A;  4F7U P;  1FGZ A;  1U5E A;  1DDM A;  3QIJ A;  1ZC3 B;  1H4R A;  3FEH A;  2RLO A;  1XOD A;  4ZRI A;  4D0N B;  4MY6 A;  2KUP A;  4CHM A;  5JP4 A;  1DDV A;  1NI2 A;  1XX0 A;  3MPX A;  2H7E A;  2ZPY A;  2M14 A;  1E5W A;  1M7R A;  2YRY A;  2L1C A;  4K17 A;  5FI0 A;  3GYO A;  2QKM A;  3X23 A;  2CRF A;  2DX1 A;  3SV1 A;  5HE2 A;  3QBV B;  1X05 A;  1WI1 A;  5JHG A;  2J0K A;  4BBK A;  4HAX B;  1U5F A;  2V76 A;  1UNP A;  1UNQ A;  1WGQ A;  1UNR A;  3PVW A;  5L81 A;  1W1H A;  1EF1 A;  2D9X A;  2H7D A;  3SYX A;  3TFM A;  1NTV A;  4TYZ A;  4EKU A;  2D11 A;  2J59 M;  2P8V A;  3WYF B;  5C79 A;  4PNK A;  2DA0 A;  5GOW B;  1V88 A;  3SNH A;  2ELB A;  2OQB A;  2YS5 A;  1V5M A;  3ZDT A;  2KGX B;  1EGX A;  4MK0 A;  2R09 A;  5D3V A;  1ZSQ A;  2HE7 A;  3AU4 A;  4Z2M B;  1ISN A;  2G35 A;  5JLJ B;  3TVV A;  1QQG A;  3ULC A;  2P0F A;  4A6F B;  1KZ7 A;  2Z0O A;  4GMV A;  3D8D A;  1KI1 B;  2DYQ A;  2DHJ A;  4Y94 A;  2COF A;  1MK9 B;  1FAO A;  4MT7 A;  4HAT B;  3PZD A;  5HE1 A;  1PMS A;  2IYB A;  5KQ1 A;  2RUK B;  1V5P A;  1J0W A;  2DKQ A;  5C6R A;  4YL8 A;  1K5D B;  4HDQ A;  1MK7 B;  1J19 A;  4HAY B;  4YON A;  2QKL A;  1ZC4 B;  2UZS A;  1RJ2 A;  2I5F A;  2AL6 A;  1KZG A;  2OTX A;  4KHB B;  4ZRJ A;  4NSW A;  1X1F A;  5LOP B;  2DHK A;  2M38 A; 
#chains in the Genus database with same CATH topology
 2LYD A;  2GUM A;  5DHA B;  1U5G A;  2DTC A;  2ROZ B;  2COA A;  1WGU A;  5KCV A;  4HHV A;  4HAV B;  1WVH A;  2W2X D;  3SUZ A;  1OY2 A;  3GYP A;  1P5T A;  5I2S A;  4K81 A;  1V5U A;  3DCX A;  4K2O A;  5J3Q A;  2J0J A;  2NZ8 B;  4DXA B;  3UZT A;  3DXC A;  2VKI A;  2J0M A;  1BTK A;  2IFS A;  5FI1 A;  5I2M A;  1MAI A;  1GG3 A;  2MFQ A;  3DXD A;  4WSF A;  1TJ6 A;  1M7E A;  4IOY X;  4OSN A;  2L2I A;  3A58 A;  4CYE A;  1NTY A;  5JHH A;  2LG1 A;  3FM8 C;  2JP2 A;  2Z13 A;  1EVH A;  1FHX A;  1FHW A;  2NMB A;  1P6S A;  2PZ1 A;  2EC1 A;  4C0A A;  1H10 A;  4F7H A;  2K2U A;  1TQZ A;  4IFS A;  3DXE A;  2NBV A;  3KRX A;  2N23 A;  4NY0 A;  3T06 A;  4GOU A;  2DN6 A;  2X18 A;  4WVF B;  3TO1 A;  2YS3 A;  2CY4 A;  4TKN A;  4GZU A;  1X86 A;  1XKE A;  1X1G A;  4D6W A;  3HQC A;  2E2X A;  2DKP A;  3TCA A;  2YT1 A;  2Z4D A;  3AU5 A;  1V61 A;  2ADZ A;  3U12 A;  1FGY A;  2RGN B;  2YVC A;  1FB8 A;  4KAX B;  1Q67 A;  1DYN A;  4HAZ B;  2KCJ A;  2DX5 A;  1PLS A;  3ODX A;  2N0Y A;  2UZR A;  3NW8 A;  5DIF B;  1W1G A;  1DBH A;  4KHB A;  3TW1 A;  1SGH A;  4Z2N A;  5KQ4 A;  2MWN B;  2P0D A;  4GMX B;  4K2P A;  1WG7 A;  3A8Q A;  1I2H A;  3VIA A;  2COC A;  2Z0Q A;  3D8F A;  1ZVR A;  3KZ1 A;  1UPR A;  2AEH A;  2K2J A;  2RSG A;  1AWE A;  1DDW A;  3N7C A;  2Z14 A;  1X11 A;  1U2B A;  2UVM A;  3F0W A;  3HK0 A;  4IAP A;  1GC6 A;  2DLW A;  1LW3 A;  2GCJ A;  2R0D A;  2VRW B;  4CHJ A;  1WJM A;  4HB3 B;  3IVF A;  4P7I A;  2Y7B A;  1NU2 A;  2Y8G A;  2Z0P A;  2YS1 A;  3CXB B;  1Y5O A;  2P0H A;  4CSQ A;  1ZM0 A;  4KHA A;  2RNR B;  3WA0 A;  1MIZ B;  3MDB C;  3PVL A;  5CLQ B;  3BJI A;  3CIK A;  1QC6 A;  1OMW A;  2K49 A;  3O96 A;  5J3Y A;  3KSY A;  1I7A A;  1TXD A;  4GPT B;  3PVU A;  3ODW A;  1T77 A;  4HB4 B;  3RCP A;  2DHI A;  3P7Z A;  3U8Z A;  4A6H A;  3F5R A;  2FJU B;  1V89 A;  3A8P A;  2EMS A;  1ZYI A;  2D9Y A;  3QWM A;  4PQ0 A;  1K5G B;  5D3X A;  1W1D A;  1U29 A;  2CAY A;  2D10 A;  2KIG A;  3NSU A;  3OHM B;  5DHF B;  3G9W A;  1GC7 A;  2K00 A;  3VOQ A;  4DX9 0;  1MI1 A;  3FVC A;  1UPQ A;  1MPH A;  2XQN M;  5LON B;  1XR0 B;  3AJ4 A;  4HAW B;  3ZVR A;  2Y8F A;  1DRO A;  2D4Q A;  2EMT A;  4ZRK A;  2ROV A;  2YT0 A;  3ODO A;  3U7D A;  3BIN A;  1MKE A;  1Y19 B;  4HB0 B;  2I5C A;  2LUL A;  2GJY A;  2GS0 A;  4QJ4 B;  2RVB B;  2LOX A;  3HW2 B;  3ULB A;  5D3Y A;  2EJ8 A;  2W2X C;  4GN1 A;  3FSS A;  4KVG B;  2D9W A;  5DH9 B;  5CLL B;  4KHO A;  2GCL A;  5HE0 A;  1N3H A;  2KR0 A;  4L1R A;  1FHO A;  3PSC A;  4A6F A;  1SHC A;  1AQC A;  3A98 B;  2FJL A;  2YT2 A;  1PFJ A;  2D9Z A;  2R2Y A;  2VSZ A;  1FOE A;  2ELA A;  2MKR A;  1XCG A;  4A5K A;  4GXB A;  5EFX A;  1BTN A;  4B6H A;  4EMO A;  5J3T A;  2YF0 A;  4F7G A;  3V5W A;  3D8E A;  1Z87 A;  2HTH B;  3PEG A;  1UEF A;  2D2Q A;  3LJU X;  4QJ3 B;  1OQN A;  2CY5 A;  2DYN A;  1MIX A;  3M1I B;  2LKO A;  5C5B A;  1U27 A;  5C5B B;  1U5D A;  1IRS A;  5D27 A;  1P3R A;  4H8S A;  4DX8 A;  2K8E A;  3KRW A;  3PG7 A;  5HE3 A;  3NWF A;  1B55 A;  2DFK A;  3P6A A;  2LOZ A;  3ML4 A;  2COD A;  4EJN A;  5D3W A;  1XD4 A;  2I1J A;  4A6K A;  4HDO A;  4L6E A;  3PP2 A;  4QJ5 B;  4HB2 B;  1BWN A;  4DBB A;  4WJ7 A;  1BAK A;  3NWD A;  2Q13 A;  4DIX A;  2YSZ A;  1LB1 A;  4XWX A;  5IRS A;  1EAZ A;  2BCJ A;  1RRP B;  1WJ1 A;  3OAN A;  4HAU B;  5DI9 B;  3SO6 A;  2I1K A;  3KY9 A;  2D9V A;  5C16 A;  2W2W A;  3HIE A;  2MDX A;  4F7U P;  3NWA A;  1FGZ A;  1U5E A;  1DDM A;  3QIJ A;  1ZC3 B;  1H4R A;  3FEH A;  2RLO A;  1XOD A;  5M4Y B;  4ZRI A;  4D0N B;  4MY6 A;  2KUP A;  4CHM A;  5JP4 A;  1DDV A;  1NI2 A;  4OT1 A;  1XX0 A;  3MPX A;  2H7E A;  2ZPY A;  2M14 A;  1E5W A;  1M7R A;  2YRY A;  2L1C A;  4K17 A;  5FI0 A;  3GYO A;  2QKM A;  3X23 A;  2CRF A;  2DX1 A;  3SV1 A;  5HE2 A;  3QBV B;  1X05 A;  2KIE A;  1WI1 A;  5JHG A;  2J0K A;  4BBK A;  4HAX B;  1U5F A;  2V76 A;  1UNP A;  1UNQ A;  1WGQ A;  1UNR A;  3PVW A;  5L81 A;  1W1H A;  1EF1 A;  2D9X A;  2H7D A;  3SYX A;  3TFM A;  1NTV A;  4TYZ A;  4EKU A;  2D11 A;  5LG4 B;  2J59 M;  2P8V A;  4GNK B;  3WYF B;  5C79 A;  4PNK A;  2DA0 A;  5GOW B;  1V88 A;  3SNH A;  2ELB A;  2OQB A;  2YS5 A;  1V5M A;  3ZDT A;  2KGX B;  3B77 A;  2KUQ A;  1EGX A;  4MK0 A;  2R09 A;  5D3V A;  1ZSQ A;  2HE7 A;  3AU4 A;  4Z2M B;  1ISN A;  3HSA A;  2G35 A;  5JLJ B;  3TVV A;  1QQG A;  3ULC A;  2P0F A;  4A6F B;  1KZ7 A;  2Z0O A;  4GMV A;  2ZKM X;  3D8D A;  1KI1 B;  2DYQ A;  2DHJ A;  4Y94 A;  2COF A;  1MK9 B;  1FAO A;  4MT7 A;  4HAT B;  3PZD A;  5HE1 A;  2RRF A;  1PMS A;  2IYB A;  5KQ1 A;  2RUK B;  1V5P A;  1J0W A;  2DKQ A;  5C6R A;  4YL8 A;  1K5D B;  4HDQ A;  1MK7 B;  1J19 A;  4HAY B;  4YON A;  2QKL A;  1ZC4 B;  4HSI A;  2UZS A;  1RJ2 A;  2I5F A;  2AL6 A;  1KZG A;  2Z59 A;  4QXA B;  2OTX A;  4KHB B;  4ZRJ A;  4NSW A;  1X1F A;  5LOP B;  2DHK A;  2M38 A; 
#chains in the Genus database with same CATH homology
 2LYD A;  5DHA B;  1U5G A;  2DTC A;  2ROZ B;  2COA A;  1WGU A;  5KCV A;  4HHV A;  4HAV B;  1WVH A;  2W2X D;  3SUZ A;  1OY2 A;  3GYP A;  1P5T A;  4K81 A;  1V5U A;  4K2O A;  5J3Q A;  2J0J A;  2NZ8 B;  4DXA B;  3UZT A;  3DXC A;  2VKI A;  2J0M A;  1BTK A;  2IFS A;  5FI1 A;  1MAI A;  1GG3 A;  2MFQ A;  3DXD A;  4WSF A;  1TJ6 A;  1M7E A;  4IOY X;  2L2I A;  4CYE A;  1NTY A;  5JHH A;  2LG1 A;  3FM8 C;  2JP2 A;  1EVH A;  1FHX A;  1FHW A;  2NMB A;  1P6S A;  2PZ1 A;  2EC1 A;  4C0A A;  1H10 A;  4F7H A;  2K2U A;  1TQZ A;  4IFS A;  3DXE A;  3KRX A;  2N23 A;  4NY0 A;  3T06 A;  2DN6 A;  2X18 A;  4WVF B;  3TO1 A;  2YS3 A;  2CY4 A;  4TKN A;  4GZU A;  1X86 A;  1XKE A;  1X1G A;  3HQC A;  2E2X A;  2DKP A;  3TCA A;  2YT1 A;  3AU5 A;  1V61 A;  2ADZ A;  1FGY A;  2RGN B;  2YVC A;  1FB8 A;  4KAX B;  1Q67 A;  1DYN A;  4HAZ B;  2KCJ A;  2DX5 A;  1PLS A;  3ODX A;  2N0Y A;  2UZR A;  5DIF B;  1W1G A;  1DBH A;  3TW1 A;  1SGH A;  4Z2N A;  5KQ4 A;  2MWN B;  2P0D A;  4GMX B;  4K2P A;  1WG7 A;  3A8Q A;  1I2H A;  3VIA A;  2COC A;  2Z0Q A;  3D8F A;  1ZVR A;  3KZ1 A;  1UPR A;  2AEH A;  2K2J A;  2RSG A;  1AWE A;  1DDW A;  3N7C A;  1X11 A;  1U2B A;  2UVM A;  3F0W A;  3HK0 A;  4IAP A;  1GC6 A;  2DLW A;  1LW3 A;  2GCJ A;  2R0D A;  2VRW B;  4CHJ A;  1WJM A;  4HB3 B;  3IVF A;  4P7I A;  2Y7B A;  1NU2 A;  2Y8G A;  2Z0P A;  2YS1 A;  3CXB B;  1Y5O A;  2P0H A;  1ZM0 A;  4KHA A;  2RNR B;  3WA0 A;  1MIZ B;  3MDB C;  3PVL A;  5CLQ B;  3BJI A;  3CIK A;  1QC6 A;  1OMW A;  3O96 A;  5J3Y A;  3KSY A;  1I7A A;  1TXD A;  4GPT B;  3PVU A;  3ODW A;  4HB4 B;  3RCP A;  2DHI A;  3P7Z A;  3U8Z A;  4A6H A;  3F5R A;  1V89 A;  3A8P A;  2EMS A;  3QWM A;  2D9Y A;  4PQ0 A;  1K5G B;  5D3X A;  1W1D A;  1U29 A;  2CAY A;  2D10 A;  3NSU A;  5DHF B;  3G9W A;  1GC7 A;  2K00 A;  3VOQ A;  4DX9 0;  1UPQ A;  1MPH A;  2XQN M;  5LON B;  1XR0 B;  3AJ4 A;  4HAW B;  3ZVR A;  2Y8F A;  1DRO A;  2D4Q A;  2EMT A;  4ZRK A;  2ROV A;  2YT0 A;  3ODO A;  3U7D A;  3BIN A;  1MKE A;  1Y19 B;  4HB0 B;  2I5C A;  2LUL A;  2GJY A;  2GS0 A;  2RVB B;  2LOX A;  3HW2 B;  3ULB A;  5D3Y A;  2EJ8 A;  2W2X C;  4GN1 A;  3FSS A;  4KVG B;  2D9W A;  5DH9 B;  5CLL B;  4KHO A;  2GCL A;  5HE0 A;  1N3H A;  1FHO A;  3PSC A;  4A6F A;  1SHC A;  1AQC A;  3A98 B;  2FJL A;  1PFJ A;  2D9Z A;  2VSZ A;  1FOE A;  2ELA A;  2MKR A;  1XCG A;  4A5K A;  4GXB A;  5EFX A;  1BTN A;  4B6H A;  4EMO A;  5J3T A;  2YF0 A;  4F7G A;  3V5W A;  3D8E A;  1Z87 A;  2HTH B;  3PEG A;  1UEF A;  2D2Q A;  3LJU X;  1OQN A;  2CY5 A;  2DYN A;  1MIX A;  3M1I B;  2LKO A;  5C5B A;  1U27 A;  5C5B B;  1U5D A;  1IRS A;  5D27 A;  1P3R A;  4H8S A;  4DX8 A;  3PG7 A;  3KRW A;  5HE3 A;  1B55 A;  2DFK A;  3P6A A;  2LOZ A;  3ML4 A;  2COD A;  4EJN A;  5D3W A;  1XD4 A;  2I1J A;  4A6K A;  4HDO A;  4L6E A;  3PP2 A;  4HB2 B;  1BWN A;  4DBB A;  4WJ7 A;  1BAK A;  2Q13 A;  2YSZ A;  1LB1 A;  4XWX A;  1EAZ A;  2BCJ A;  1RRP B;  1WJ1 A;  3OAN A;  4HAU B;  5DI9 B;  3SO6 A;  2I1K A;  3KY9 A;  2D9V A;  5C16 A;  2W2W A;  2MDX A;  4F7U P;  1FGZ A;  1U5E A;  1DDM A;  3QIJ A;  1ZC3 B;  1H4R A;  3FEH A;  2RLO A;  1XOD A;  4ZRI A;  4D0N B;  4MY6 A;  2KUP A;  4CHM A;  5JP4 A;  1DDV A;  1NI2 A;  1XX0 A;  3MPX A;  2H7E A;  2ZPY A;  2M14 A;  1E5W A;  1M7R A;  2YRY A;  2L1C A;  4K17 A;  5FI0 A;  3GYO A;  2QKM A;  3X23 A;  2CRF A;  2DX1 A;  3SV1 A;  5HE2 A;  3QBV B;  1X05 A;  1WI1 A;  5JHG A;  2J0K A;  4BBK A;  4HAX B;  1U5F A;  2V76 A;  1UNP A;  1UNQ A;  1WGQ A;  1UNR A;  3PVW A;  5L81 A;  1W1H A;  1EF1 A;  2D9X A;  2H7D A;  3SYX A;  3TFM A;  1NTV A;  4TYZ A;  4EKU A;  2D11 A;  2J59 M;  2P8V A;  3WYF B;  5C79 A;  4PNK A;  2DA0 A;  5GOW B;  1V88 A;  3SNH A;  2ELB A;  2OQB A;  2YS5 A;  1V5M A;  3ZDT A;  2KGX B;  1EGX A;  4MK0 A;  2R09 A;  5D3V A;  1ZSQ A;  2HE7 A;  3AU4 A;  4Z2M B;  1ISN A;  2G35 A;  5JLJ B;  3TVV A;  1QQG A;  3ULC A;  2P0F A;  4A6F B;  1KZ7 A;  2Z0O A;  4GMV A;  3D8D A;  1KI1 B;  2DYQ A;  2DHJ A;  4Y94 A;  2COF A;  1MK9 B;  1FAO A;  4MT7 A;  4HAT B;  3PZD A;  5HE1 A;  1PMS A;  2IYB A;  5KQ1 A;  2RUK B;  1V5P A;  1J0W A;  2DKQ A;  5C6R A;  4YL8 A;  1K5D B;  4HDQ A;  1MK7 B;  1J19 A;  4HAY B;  4YON A;  2QKL A;  1ZC4 B;  2UZS A;  1RJ2 A;  2I5F A;  2AL6 A;  1KZG A;  2OTX A;  4KHB B;  4ZRJ A;  4NSW A;  1X1F A;  5LOP B;  2DHK A;  2M38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...