2RVBB

Solution structure of the complex between xpc acidic domain and tfiih p62 ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein complementing XP-C cells
publication title Structural Insight into the Mechanism of TFIIH Recognition by the Acidic String of the Nucleotide Excision Repair Factor XPC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/transcription
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rvbB00
1WVHA 2M38A 1FHWA 1DDMA 3M1IB 1FHXA 2RNRB 4HAVB 1QQGA 2Q13A 2LKOA 1IRSA 2D9VA 3MDBC 2NMBA 2DHJA 1LB1A 2D11A 1U29A 5JHGA 1W1GA 1ZC3B 4MT7A 2H7DA 1RRPB 4CYEA 4KVGB 2P0FA 3GYOA 1TXDA 1ZM0A 4MK0A 3CIKA 2Y7BA 2I5FA 3OANA 2CY4A 2UZRA 1OQNA 2D2QA 1FGZA 4F7HA 1U5GA 1PLSA 4WJ7A 2IFSA 1B55A 1MIZB 2LOZA 3P7ZA 3A8QA 1OMWA 3G9WA 3IVFA 1NI2A 3DXDA 2YS5A 3CXBB 3WA0A 1XCGA 1MK7B 1XX0A 1GC6A 2QKLA 1K5GB 1H10A 2DYNA 3TCAA 5HE3A 2P0HA 1I2HA 2VKIA 4GMVA 1FAOA 2IYBA 5JHHA 1ZSQA 2H7EA 1J19A 3TVVA 1TJ6A 2NZ8B 5J3QA 1E5WA 2P8VA 1V89A 4K2PA 3SYXA 2DLWA 4ZRKA 2HE7A 2YT0A 2L2IA 1V5UA 3UZTA 2COCA 1EVHA 2FJLA 3FM8C 1WJ1A 2ZPYA 4DBBA 4HAUB 3DXCA 3V5WA 2I1KA 2MKRA 5DHFB 5D3WA 4DX90 4HB4B 1EAZA 2KUPA 3FSSA 2R0DA 3PEGA 1MKEA 3TO1A 4IAPA 4YL8A 5HE2A 5HE1A 2M14A 1N3HA 2Z0PA 1U5FA 1WGQA 1KI1B 1PFJA 1X86A 3WYFB 5JP4A 1U5EA 1MPHA 1PMSA 3AJ4A 4L6EA 5J3TA 4P7IA 4K2OA 2D10A 1K5DB 4HAYB 4XWXA 4HAWB 2MWNB 4BBKA 2DX1A 2VSZA 2K2JA 2D4QA 1RJ2A 1BWNA 2GS0A 2GJYA 3SV1A 2W2XD 3X23A 5DH9B 2JP2A 3PVWA 2DHKA 5D27A 4NY0A 2RLOA 4EJNA 2HTHB 2YSZA 3QWMA 1MK9B 5DHAB 1X1FA 4PQ0A 2UZSA 3KRWA 2DX5A 3BJIA 3ODWA 1NTYA 4IFSA 1U5DA 4HATB 5FI0A 4KHAA 2GCJA 2ELAA 2DN6A 2QKMA 3HK0A 2YT1A 2I5CA 1GG3A 1BAKA 2ELBA 2DKPA 2J0KA 3AU4A 1WJMA 1DROA 2LULA 2ROZB 1WGUA 3ULBA 3ODXA 1AWEA 4IOYX 5D3YA 4H8SA 4K17A 3SO6A 4WSFA 3HQCA 4A6KA 2YF0A 1I7AA 3FEHA 3LJUX 1TQZA 5KQ1A 2DTCA 3MPXA 4Z2NA 2LOXA 1J0WA 5KCVA 1QC6A 3O96A 1X05A 1EGXA 1XD4A 1M7EA 1KZGA 5JLJB 3PVLA 3PVUA 3A98B 2YS3A 5HE0A 3PP2A 2PZ1A 2GCLA 4Y94A 1XKEA 1UPRA 1DDWA 1XR0B 3PSCA 4NSWA 5EFXA 4EMOA 1FHOA 1UEFA 3PZDA 2DA0A 2EJ8A 2Z0OA 4HHVA 4TKNA 3ML4A 5LONB 1OY2A 3D8FA 3ODOA 4HB2B 5KQ4A 5FI1A 4CHJA 5CLQB 2DHIA 1U2BA 2RGNB 3A8PA 1SHCA 1WI1A 5DI9B 2CY5A 2K00A 1UPQA 3U8ZA 2AEHA 1MIXA 3F5RA 3D8EA 2EMTA 2CRFA 1Z87A 1AQCA 5CLLB 3KZ1A 4KAXB 4B6HA 1Y5OA 4EKUA 1UNRA 2AL6A 1WG7A 2ADZA 2J59M 3D8DA 2R09A 3F0WA 5C5BB 2W2XC 1ISNA 2X18A 3ULCA 3DXEA 2Y8FA 2COFA 5L81A 1DBHA 3RCPA 2LG1A 2MDXA 1P5TA 1FGYA 4TYZA 1W1HA 3GYPA 4GN1A 2D9XA 4GZUA 4A6FB 3TW1A 4KHBB 4K81A 4HAXB 3P6AA 3PG7A 1V5MA 3N7CA 1DYNA 2DFKA 2DKQA 2RVBB 3KY9A 1W1DA 3VOQA 3NSUA 2CODA 1XODA 1KZ7A 2OQBA 1GC7A 2BCJA 2KGXB 1V88A 5C6RA 3KRXA 2LYDA 1DDVA 1P3RA 2N0YA 4Z2MB 4HB3B 4DX8A 1BTKA 4GXBA 4HAZB 2Y8GA 2KCJA 2MFQA 3QBVB 5D3VA 3SUZA 4MY6A 2D9YA 2EC1A 2J0JA 1X1GA 5C5BA 1NU2A 2CAYA 2COAA 1H4RA 4HB0B 2RUKB 4GPTB 1NTVA 3TFMA 4ZRJA 1MAIA 5J3YA 3T06A 4WVFB 3AU5A 1Q67A 5DIFB 4A6FA 2D9ZA 2YRYA 4PNKA 1V61A 2G35A 2RSGA 4A5KA 3QIJA 5LOPB 1ZVRA 4GMXB 2XQNM 2W2WA 1M7RA 4YONA 2YS1A 1EF1A 2OTXA 2N23A 4KHOA 3ZVRA 5GOWB 1Y19B 2ROVA 3HW2B 1UNPA 2YVCA 1ZC4B 2I1JA 1FOEA 4DXAB 2Z0QA 2EMSA 3VIAA 4CHMA 4HDOA 2K2UA 5C79A 1LW3A 2UVMA 1X11A 2V76A 5D3XA 1BTNA 2P0DA 4F7UP 3ZDTA 3BINA 4F7GA 1P6SA 1FB8A 4ZRIA 4C0AA 1V5PA 2DYQA 1U27A 4HDQA 5C16A 1UNQA 2D9WA 3SNHA 4A6HA 2J0MA 2E2XA 1SGHA 4D0NB 2L1CA 2VRWB 3KSYA 3U7DA
chains in the Genus database with same CATH superfamily
1WVHA 2M38A 1FHWA 1DDMA 4GOUA 3M1IB 1FHXA 3DCXA 4DIXA 2RNRB 4HAVB 1QQGA 2Q13A 2LKOA 3FVCA 1IRSA 2D9VA 3MDBC 2NMBA 1ZYIA 2DHJA 1LB1A 2D11A 1U29A 5JHGA 2Z13A 1W1GA 1ZC3B 4MT7A 2H7DA 1RRPB 4CYEA 4QJ3B 2RRFA 4KVGB 2P0FA 3GYOA 1TXDA 1ZM0A 4MK0A 3CIKA 2FJUB 2Y7BA 2I5FA 3OANA 2CY4A 2UZRA 1OQNA 2D2QA 1FGZA 4F7HA 1U5GA 1PLSA 4WJ7A 2IFSA 1B55A 1MIZB 2LOZA 3P7ZA 3A8QA 1OMWA 3G9WA 3IVFA 1NI2A 3DXDA 2YS5A 3CXBB 3WA0A 5LG4B 1XCGA 1MK7B 1XX0A 1GC6A 2QKLA 1K5GB 1H10A 2DYNA 3TCAA 5HE3A 2P0HA 1I2HA 2VKIA 4GMVA 1FAOA 2IYBA 5JHHA 1ZSQA 2H7EA 1J19A 3TVVA 1TJ6A 2NZ8B 5J3QA 1E5WA 2P8VA 1V89A 4K2PA 4GNKB 3SYXA 2DLWA 4ZRKA 2HE7A 2YT0A 2L2IA 1V5UA 3UZTA 2COCA 1EVHA 2FJLA 3FM8C 1WJ1A 2ZPYA 4DBBA 4HAUB 3DXCA 4L1RA 3V5WA 2I1KA 2MKRA 5DHFB 5D3WA 4DX90 4HB4B 1EAZA 2KUPA 3FSSA 2R0DA 3PEGA 1MKEA 3TO1A 4IAPA 4YL8A 2R2YA 5HE2A 5HE1A 2M14A 1N3HA 2Z0PA 1U5FA 1WGQA 4D6WA 1KI1B 5I2SA 1PFJA 1X86A 2Z59A 3WYFB 5JP4A 2K49A 1U5EA 1MPHA 1PMSA 3AJ4A 4L6EA 5J3TA 4P7IA 4K2OA 2D10A 1K5DB 4HAYB 4XWXA 4HAWB 2MWNB 4BBKA 2DX1A 2VSZA 2K2JA 2D4QA 1RJ2A 1BWNA 2GS0A 2GJYA 3SV1A 2W2XD 3X23A 5DH9B 2JP2A 3PVWA 2DHKA 5D27A 4NY0A 2RLOA 4EJNA 2HTHB 2YSZA 3QWMA 1MK9B 3NWDA 5DHAB 1X1FA 4PQ0A 2UZSA 3KRWA 2DX5A 3BJIA 3ODWA 1NTYA 4IFSA 1U5DA 2YT2A 4HATB 5FI0A 4KHAA 2GCJA 2ELAA 2DN6A 4OT1A 2QKMA 3HK0A 1MI1A 2YT1A 2I5CA 1GG3A 1BAKA 2ELBA 2DKPA 2J0KA 3AU4A 1WJMA 1DROA 2LULA 2ROZB 1WGUA 3ULBA 5I2MA 3ODXA 1AWEA 4IOYX 5D3YA 4H8SA 4K17A 3SO6A 4WSFA 3HQCA 4A6KA 2YF0A 1I7AA 3FEHA 3LJUX 1TQZA 5KQ1A 2DTCA 3MPXA 4Z2NA 2LOXA 1J0WA 5KCVA 1QC6A 3O96A 1X05A 4KHBA 1EGXA 1XD4A 5IRSA 1M7EA 1KZGA 5JLJB 3PVLA 3OHMB 3PVUA 3A98B 2YS3A 5HE0A 3PP2A 2PZ1A 2GCLA 4Y94A 1XKEA 1UPRA 1DDWA 1XR0B 3B77A 3PSCA 4NSWA 5EFXA 4EMOA 1FHOA 1UEFA 3PZDA 2DA0A 2EJ8A 2Z0OA 4HHVA 4TKNA 3ML4A 5LONB 1OY2A 3D8FA 3ODOA 4HB2B 5KQ4A 5FI1A 4CHJA 5CLQB 2DHIA 1U2BA 2RGNB 3A8PA 1SHCA 1WI1A 5DI9B 2CY5A 2KIGA 2K00A 1UPQA 3U8ZA 2AEHA 1MIXA 2Z14A 2KR0A 3F5RA 3D8EA 2EMTA 2CRFA 1Z87A 1AQCA 5CLLB 3KZ1A 4KAXB 4B6HA 1Y5OA 4EKUA 1UNRA 2AL6A 1WG7A 2ADZA 2J59M 3D8DA 2R09A 3F0WA 4QXAB 5C5BB 2W2XC 1ISNA 3A58A 2X18A 3ULCA 3DXEA 3U12A 2Y8FA 2Z4DA 2COFA 5L81A 1DBHA 3RCPA 3HSAA 2LG1A 1T77A 1P5TA 2MDXA 1FGYA 4TYZA 1W1HA 3GYPA 4GN1A 2D9XA 4GZUA 4A6FB 3TW1A 4KHBB 4K81A 4HAXB 4QJ4B 2NBVA 3P6AA 3PG7A 1V5MA 3N7CA 1DYNA 2DFKA 2DKQA 2RVBB 3KY9A 1W1DA 3VOQA 3NSUA 2CODA 1XODA 1KZ7A 2OQBA 1GC7A 2BCJA 3NW8A 2KGXB 1V88A 5C6RA 3KRXA 2LYDA 1DDVA 1P3RA 2N0YA 4Z2MB 4HB3B 4DX8A 1BTKA 4GXBA 4HAZB 2Y8GA 2KCJA 2MFQA 3QBVB 3HIEA 5D3VA 3SUZA 4MY6A 2D9YA 2EC1A 2J0JA 1X1GA 5C5BA 1NU2A 2CAYA 2COAA 1H4RA 4HB0B 2KUQA 2RUKB 4GPTB 1NTVA 3TFMA 2ZKMX 2KIEA 4ZRJA 3NWAA 1MAIA 5J3YA 3T06A 4WVFB 3AU5A 1Q67A 5DIFB 4A6FA 4QJ5B 2D9ZA 2YRYA 4PNKA 5M4YB 1V61A 2G35A 2RSGA 4A5KA 3QIJA 5LOPB 1ZVRA 4GMXB 2XQNM 2W2WA 1M7RA 4YONA 2YS1A 1EF1A 2OTXA 2N23A 4KHOA 3NWFA 3ZVRA 5GOWB 1Y19B 2ROVA 3HW2B 4OSNA 1UNPA 2YVCA 1ZC4B 4HSIA 2I1JA 1FOEA 4DXAB 2Z0QA 2EMSA 3VIAA 4CHMA 4HDOA 4CSQA 2K2UA 5C79A 1LW3A 2UVMA 1X11A 2V76A 5D3XA 1BTNA 2P0DA 4F7UP 3ZDTA 3BINA 4F7GA 1P6SA 1FB8A 4ZRIA 4C0AA 1V5PA 2DYQA 1U27A 4HDQA 5C16A 1UNQA 2D9WA 3SNHA 4A6HA 2J0MA 2E2XA 1SGHA 2GUMA 2K8EA 4D0NB 2L1CA 2VRWB 3KSYA 3U7DA
chains in the Genus database with same CATH topology
1WVHA 2M38A 1FHWA 1DDMA 3M1IB 1FHXA 2RNRB 4HAVB 1QQGA 2Q13A 2LKOA 1IRSA 2D9VA 3MDBC 2NMBA 2DHJA 1LB1A 2D11A 1U29A 5JHGA 1W1GA 1ZC3B 4MT7A 2H7DA 1RRPB 4CYEA 4KVGB 2P0FA 3GYOA 1TXDA 1ZM0A 4MK0A 3CIKA 2Y7BA 2I5FA 3OANA 2CY4A 2UZRA 1OQNA 2D2QA 1FGZA 4F7HA 1U5GA 1PLSA 4WJ7A 2IFSA 1B55A 1MIZB 2LOZA 3P7ZA 3A8QA 1OMWA 3G9WA 3IVFA 1NI2A 3DXDA 2YS5A 3CXBB 3WA0A 1XCGA 1MK7B 1XX0A 1GC6A 2QKLA 1K5GB 1H10A 2DYNA 3TCAA 5HE3A 2P0HA 1I2HA 2VKIA 4GMVA 1FAOA 2IYBA 5JHHA 1ZSQA 2H7EA 1J19A 3TVVA 1TJ6A 2NZ8B 5J3QA 1E5WA 2P8VA 1V89A 4K2PA 3SYXA 2DLWA 4ZRKA 2HE7A 2YT0A 2L2IA 1V5UA 3UZTA 2COCA 1EVHA 2FJLA 3FM8C 1WJ1A 2ZPYA 4DBBA 4HAUB 3DXCA 3V5WA 2I1KA 2MKRA 5DHFB 5D3WA 4DX90 4HB4B 1EAZA 2KUPA 3FSSA 2R0DA 3PEGA 1MKEA 3TO1A 4IAPA 4YL8A 5HE2A 5HE1A 2M14A 1N3HA 2Z0PA 1U5FA 1WGQA 1KI1B 1PFJA 1X86A 3WYFB 5JP4A 1U5EA 1MPHA 1PMSA 3AJ4A 4L6EA 5J3TA 4P7IA 4K2OA 2D10A 1K5DB 4HAYB 4XWXA 4HAWB 2MWNB 4BBKA 2DX1A 2VSZA 2K2JA 2D4QA 1RJ2A 1BWNA 2GS0A 2GJYA 3SV1A 2W2XD 3X23A 5DH9B 2JP2A 3PVWA 2DHKA 5D27A 4NY0A 2RLOA 4EJNA 2HTHB 2YSZA 3QWMA 1MK9B 5DHAB 1X1FA 4PQ0A 2UZSA 3KRWA 2DX5A 3BJIA 3ODWA 1NTYA 4IFSA 1U5DA 4HATB 5FI0A 4KHAA 2GCJA 2ELAA 2DN6A 2QKMA 3HK0A 2YT1A 2I5CA 1GG3A 1BAKA 2ELBA 2DKPA 2J0KA 3AU4A 1WJMA 1DROA 2LULA 2ROZB 1WGUA 3ULBA 3ODXA 1AWEA 4IOYX 5D3YA 4H8SA 4K17A 3SO6A 4WSFA 3HQCA 4A6KA 2YF0A 1I7AA 3FEHA 3LJUX 1TQZA 5KQ1A 2DTCA 3MPXA 4Z2NA 2LOXA 1J0WA 5KCVA 1QC6A 3O96A 1X05A 1EGXA 1XD4A 1M7EA 1KZGA 5JLJB 3PVLA 3PVUA 3A98B 2YS3A 5HE0A 3PP2A 2PZ1A 2GCLA 4Y94A 1XKEA 1UPRA 1DDWA 1XR0B 3PSCA 4NSWA 5EFXA 4EMOA 1FHOA 1UEFA 3PZDA 2DA0A 2EJ8A 2Z0OA 4HHVA 4TKNA 3ML4A 5LONB 1OY2A 3D8FA 3ODOA 4HB2B 5KQ4A 5FI1A 4CHJA 5CLQB 2DHIA 1U2BA 2RGNB 3A8PA 1SHCA 1WI1A 5DI9B 2CY5A 2K00A 1UPQA 3U8ZA 2AEHA 1MIXA 3F5RA 3D8EA 2EMTA 2CRFA 1Z87A 1AQCA 5CLLB 3KZ1A 4KAXB 4B6HA 1Y5OA 4EKUA 1UNRA 2AL6A 1WG7A 2ADZA 2J59M 3D8DA 2R09A 3F0WA 5C5BB 2W2XC 1ISNA 2X18A 3ULCA 3DXEA 2Y8FA 2COFA 5L81A 1DBHA 3RCPA 2LG1A 2MDXA 1P5TA 1FGYA 4TYZA 1W1HA 3GYPA 4GN1A 2D9XA 4GZUA 4A6FB 3TW1A 4KHBB 4K81A 4HAXB 3P6AA 3PG7A 1V5MA 3N7CA 1DYNA 2DFKA 2DKQA 2RVBB 3KY9A 1W1DA 3VOQA 3NSUA 2CODA 1XODA 1KZ7A 2OQBA 1GC7A 2BCJA 2KGXB 1V88A 5C6RA 3KRXA 2LYDA 1DDVA 1P3RA 2N0YA 4Z2MB 4HB3B 4DX8A 1BTKA 4GXBA 4HAZB 2Y8GA 2KCJA 2MFQA 3QBVB 5D3VA 3SUZA 4MY6A 2D9YA 2EC1A 2J0JA 1X1GA 5C5BA 1NU2A 2CAYA 2COAA 1H4RA 4HB0B 2RUKB 4GPTB 1NTVA 3TFMA 4ZRJA 1MAIA 5J3YA 3T06A 4WVFB 3AU5A 1Q67A 5DIFB 4A6FA 2D9ZA 2YRYA 4PNKA 1V61A 2G35A 2RSGA 4A5KA 3QIJA 5LOPB 1ZVRA 4GMXB 2XQNM 2W2WA 1M7RA 4YONA 2YS1A 1EF1A 2OTXA 2N23A 4KHOA 3ZVRA 5GOWB 1Y19B 2ROVA 3HW2B 1UNPA 2YVCA 1ZC4B 2I1JA 1FOEA 4DXAB 2Z0QA 2EMSA 3VIAA 4CHMA 4HDOA 2K2UA 5C79A 1LW3A 2UVMA 1X11A 2V76A 5D3XA 1BTNA 2P0DA 4F7UP 3ZDTA 3BINA 4F7GA 1P6SA 1FB8A 4ZRIA 4C0AA 1V5PA 2DYQA 1U27A 4HDQA 5C16A 1UNQA 2D9WA 3SNHA 4A6HA 2J0MA 2E2XA 1SGHA 4D0NB 2L1CA 2VRWB 3KSYA 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVH A;  2M38 A;  1FHW A;  1DDM A;  3M1I B;  1FHX A;  2RNR B;  4HAV B;  1QQG A;  2Q13 A;  2LKO A;  1IRS A;  2D9V A;  3MDB C;  2NMB A;  2DHJ A;  1LB1 A;  2D11 A;  1U29 A;  5JHG A;  1W1G A;  1ZC3 B;  4MT7 A;  2H7D A;  1RRP B;  4CYE A;  4KVG B;  2P0F A;  3GYO A;  1TXD A;  1ZM0 A;  4MK0 A;  3CIK A;  2Y7B A;  2I5F A;  3OAN A;  2CY4 A;  2UZR A;  1OQN A;  2D2Q A;  1FGZ A;  4F7H A;  1U5G A;  1PLS A;  4WJ7 A;  2IFS A;  1B55 A;  1MIZ B;  2LOZ A;  3P7Z A;  3A8Q A;  1OMW A;  3G9W A;  3IVF A;  1NI2 A;  3DXD A;  2YS5 A;  3CXB B;  3WA0 A;  1XCG A;  1MK7 B;  1XX0 A;  1GC6 A;  2QKL A;  1K5G B;  1H10 A;  2DYN A;  3TCA A;  5HE3 A;  2P0H A;  1I2H A;  2VKI A;  4GMV A;  1FAO A;  2IYB A;  5JHH A;  1ZSQ A;  2H7E A;  1J19 A;  3TVV A;  1TJ6 A;  2NZ8 B;  5J3Q A;  1E5W A;  2P8V A;  1V89 A;  4K2P A;  3SYX A;  2DLW A;  4ZRK A;  2HE7 A;  2YT0 A;  2L2I A;  1V5U A;  3UZT A;  2COC A;  1EVH A;  2FJL A;  3FM8 C;  1WJ1 A;  2ZPY A;  4DBB A;  4HAU B;  3DXC A;  3V5W A;  2I1K A;  2MKR A;  5DHF B;  5D3W A;  4DX9 0;  4HB4 B;  1EAZ A;  2KUP A;  3FSS A;  2R0D A;  3PEG A;  1MKE A;  3TO1 A;  4IAP A;  4YL8 A;  5HE2 A;  5HE1 A;  2M14 A;  1N3H A;  2Z0P A;  1U5F A;  1WGQ A;  1KI1 B;  1PFJ A;  1X86 A;  3WYF B;  5JP4 A;  1U5E A;  1MPH A;  1PMS A;  3AJ4 A;  4L6E A;  5J3T A;  4P7I A;  4K2O A;  2D10 A;  1K5D B;  4HAY B;  4XWX A;  4HAW B;  2MWN B;  4BBK A;  2DX1 A;  2VSZ A;  2K2J A;  2D4Q A;  1RJ2 A;  1BWN A;  2GS0 A;  2GJY A;  3SV1 A;  2W2X D;  3X23 A;  5DH9 B;  2JP2 A;  3PVW A;  2DHK A;  5D27 A;  4NY0 A;  2RLO A;  4EJN A;  2HTH B;  2YSZ A;  3QWM A;  1MK9 B;  5DHA B;  1X1F A;  4PQ0 A;  2UZS A;  3KRW A;  2DX5 A;  3BJI A;  3ODW A;  1NTY A;  4IFS A;  1U5D A;  4HAT B;  5FI0 A;  4KHA A;  2GCJ A;  2ELA A;  2DN6 A;  2QKM A;  3HK0 A;  2YT1 A;  2I5C A;  1GG3 A;  1BAK A;  2ELB A;  2DKP A;  2J0K A;  3AU4 A;  1WJM A;  1DRO A;  2LUL A;  2ROZ B;  1WGU A;  3ULB A;  3ODX A;  1AWE A;  4IOY X;  5D3Y A;  4H8S A;  4K17 A;  3SO6 A;  4WSF A;  3HQC A;  4A6K A;  2YF0 A;  1I7A A;  3FEH A;  3LJU X;  1TQZ A;  5KQ1 A;  2DTC A;  3MPX A;  4Z2N A;  2LOX A;  1J0W A;  5KCV A;  1QC6 A;  3O96 A;  1X05 A;  1EGX A;  1XD4 A;  1M7E A;  1KZG A;  5JLJ B;  3PVL A;  3PVU A;  3A98 B;  2YS3 A;  5HE0 A;  3PP2 A;  2PZ1 A;  2GCL A;  4Y94 A;  1XKE A;  1UPR A;  1DDW A;  1XR0 B;  3PSC A;  4NSW A;  5EFX A;  4EMO A;  1FHO A;  1UEF A;  3PZD A;  2DA0 A;  2EJ8 A;  2Z0O A;  4HHV A;  4TKN A;  3ML4 A;  5LON B;  1OY2 A;  3D8F A;  3ODO A;  4HB2 B;  5KQ4 A;  5FI1 A;  4CHJ A;  5CLQ B;  2DHI A;  1U2B A;  2RGN B;  3A8P A;  1SHC A;  1WI1 A;  5DI9 B;  2CY5 A;  2K00 A;  1UPQ A;  3U8Z A;  2AEH A;  1MIX A;  3F5R A;  3D8E A;  2EMT A;  2CRF A;  1Z87 A;  1AQC A;  5CLL B;  3KZ1 A;  4KAX B;  4B6H A;  1Y5O A;  4EKU A;  1UNR A;  2AL6 A;  1WG7 A;  2ADZ A;  2J59 M;  3D8D A;  2R09 A;  3F0W A;  5C5B B;  2W2X C;  1ISN A;  2X18 A;  3ULC A;  3DXE A;  2Y8F A;  2COF A;  5L81 A;  1DBH A;  3RCP A;  2LG1 A;  2MDX A;  1P5T A;  1FGY A;  4TYZ A;  1W1H A;  3GYP A;  4GN1 A;  2D9X A;  4GZU A;  4A6F B;  3TW1 A;  4KHB B;  4K81 A;  4HAX B;  3P6A A;  3PG7 A;  1V5M A;  3N7C A;  1DYN A;  2DFK A;  2DKQ A;  2RVB B;  3KY9 A;  1W1D A;  3VOQ A;  3NSU A;  2COD A;  1XOD A;  1KZ7 A;  2OQB A;  1GC7 A;  2BCJ A;  2KGX B;  1V88 A;  5C6R A;  3KRX A;  2LYD A;  1DDV A;  1P3R A;  2N0Y A;  4Z2M B;  4HB3 B;  4DX8 A;  1BTK A;  4GXB A;  4HAZ B;  2Y8G A;  2KCJ A;  2MFQ A;  3QBV B;  5D3V A;  3SUZ A;  4MY6 A;  2D9Y A;  2EC1 A;  2J0J A;  1X1G A;  5C5B A;  1NU2 A;  2CAY A;  2COA A;  1H4R A;  4HB0 B;  2RUK B;  4GPT B;  1NTV A;  3TFM A;  4ZRJ A;  1MAI A;  5J3Y A;  3T06 A;  4WVF B;  3AU5 A;  1Q67 A;  5DIF B;  4A6F A;  2D9Z A;  2YRY A;  4PNK A;  1V61 A;  2G35 A;  2RSG A;  4A5K A;  3QIJ A;  5LOP B;  1ZVR A;  4GMX B;  2XQN M;  2W2W A;  1M7R A;  4YON A;  2YS1 A;  1EF1 A;  2OTX A;  2N23 A;  4KHO A;  3ZVR A;  5GOW B;  1Y19 B;  2ROV A;  3HW2 B;  1UNP A;  2YVC A;  1ZC4 B;  2I1J A;  1FOE A;  4DXA B;  2Z0Q A;  2EMS A;  3VIA A;  4CHM A;  4HDO A;  2K2U A;  5C79 A;  1LW3 A;  2UVM A;  1X11 A;  2V76 A;  5D3X A;  1BTN A;  2P0D A;  4F7U P;  3ZDT A;  3BIN A;  4F7G A;  1P6S A;  1FB8 A;  4ZRI A;  4C0A A;  1V5P A;  2DYQ A;  1U27 A;  4HDQ A;  5C16 A;  1UNQ A;  2D9W A;  3SNH A;  4A6H A;  2J0M A;  2E2X A;  1SGH A;  4D0N B;  2L1C A;  2VRW B;  3KSY A;  3U7D A; 
#chains in the Genus database with same CATH topology
 1WVH A;  2M38 A;  1FHW A;  1DDM A;  4GOU A;  3M1I B;  1FHX A;  3DCX A;  4DIX A;  2RNR B;  4HAV B;  1QQG A;  2Q13 A;  2LKO A;  3FVC A;  1IRS A;  2D9V A;  3MDB C;  2NMB A;  1ZYI A;  2DHJ A;  1LB1 A;  2D11 A;  1U29 A;  5JHG A;  2Z13 A;  1W1G A;  1ZC3 B;  4MT7 A;  2H7D A;  1RRP B;  4CYE A;  4QJ3 B;  2RRF A;  4KVG B;  2P0F A;  3GYO A;  1TXD A;  1ZM0 A;  4MK0 A;  3CIK A;  2FJU B;  2Y7B A;  2I5F A;  3OAN A;  2CY4 A;  2UZR A;  1OQN A;  2D2Q A;  1FGZ A;  4F7H A;  1U5G A;  1PLS A;  4WJ7 A;  2IFS A;  1B55 A;  1MIZ B;  2LOZ A;  3P7Z A;  3A8Q A;  1OMW A;  3G9W A;  3IVF A;  1NI2 A;  3DXD A;  2YS5 A;  3CXB B;  3WA0 A;  5LG4 B;  1XCG A;  1MK7 B;  1XX0 A;  1GC6 A;  2QKL A;  1K5G B;  1H10 A;  2DYN A;  3TCA A;  5HE3 A;  2P0H A;  1I2H A;  2VKI A;  4GMV A;  1FAO A;  2IYB A;  5JHH A;  1ZSQ A;  2H7E A;  1J19 A;  3TVV A;  1TJ6 A;  2NZ8 B;  5J3Q A;  1E5W A;  2P8V A;  1V89 A;  4K2P A;  4GNK B;  3SYX A;  2DLW A;  4ZRK A;  2HE7 A;  2YT0 A;  2L2I A;  1V5U A;  3UZT A;  2COC A;  1EVH A;  2FJL A;  3FM8 C;  1WJ1 A;  2ZPY A;  4DBB A;  4HAU B;  3DXC A;  4L1R A;  3V5W A;  2I1K A;  2MKR A;  5DHF B;  5D3W A;  4DX9 0;  4HB4 B;  1EAZ A;  2KUP A;  3FSS A;  2R0D A;  3PEG A;  1MKE A;  3TO1 A;  4IAP A;  4YL8 A;  2R2Y A;  5HE2 A;  5HE1 A;  2M14 A;  1N3H A;  2Z0P A;  1U5F A;  1WGQ A;  4D6W A;  1KI1 B;  5I2S A;  1PFJ A;  1X86 A;  2Z59 A;  3WYF B;  5JP4 A;  2K49 A;  1U5E A;  1MPH A;  1PMS A;  3AJ4 A;  4L6E A;  5J3T A;  4P7I A;  4K2O A;  2D10 A;  1K5D B;  4HAY B;  4XWX A;  4HAW B;  2MWN B;  4BBK A;  2DX1 A;  2VSZ A;  2K2J A;  2D4Q A;  1RJ2 A;  1BWN A;  2GS0 A;  2GJY A;  3SV1 A;  2W2X D;  3X23 A;  5DH9 B;  2JP2 A;  3PVW A;  2DHK A;  5D27 A;  4NY0 A;  2RLO A;  4EJN A;  2HTH B;  2YSZ A;  3QWM A;  1MK9 B;  3NWD A;  5DHA B;  1X1F A;  4PQ0 A;  2UZS A;  3KRW A;  2DX5 A;  3BJI A;  3ODW A;  1NTY A;  4IFS A;  1U5D A;  2YT2 A;  4HAT B;  5FI0 A;  4KHA A;  2GCJ A;  2ELA A;  2DN6 A;  4OT1 A;  2QKM A;  3HK0 A;  1MI1 A;  2YT1 A;  2I5C A;  1GG3 A;  1BAK A;  2ELB A;  2DKP A;  2J0K A;  3AU4 A;  1WJM A;  1DRO A;  2LUL A;  2ROZ B;  1WGU A;  3ULB A;  5I2M A;  3ODX A;  1AWE A;  4IOY X;  5D3Y A;  4H8S A;  4K17 A;  3SO6 A;  4WSF A;  3HQC A;  4A6K A;  2YF0 A;  1I7A A;  3FEH A;  3LJU X;  1TQZ A;  5KQ1 A;  2DTC A;  3MPX A;  4Z2N A;  2LOX A;  1J0W A;  5KCV A;  1QC6 A;  3O96 A;  1X05 A;  4KHB A;  1EGX A;  1XD4 A;  5IRS A;  1M7E A;  1KZG A;  5JLJ B;  3PVL A;  3OHM B;  3PVU A;  3A98 B;  2YS3 A;  5HE0 A;  3PP2 A;  2PZ1 A;  2GCL A;  4Y94 A;  1XKE A;  1UPR A;  1DDW A;  1XR0 B;  3B77 A;  3PSC A;  4NSW A;  5EFX A;  4EMO A;  1FHO A;  1UEF A;  3PZD A;  2DA0 A;  2EJ8 A;  2Z0O A;  4HHV A;  4TKN A;  3ML4 A;  5LON B;  1OY2 A;  3D8F A;  3ODO A;  4HB2 B;  5KQ4 A;  5FI1 A;  4CHJ A;  5CLQ B;  2DHI A;  1U2B A;  2RGN B;  3A8P A;  1SHC A;  1WI1 A;  5DI9 B;  2CY5 A;  2KIG A;  2K00 A;  1UPQ A;  3U8Z A;  2AEH A;  1MIX A;  2Z14 A;  2KR0 A;  3F5R A;  3D8E A;  2EMT A;  2CRF A;  1Z87 A;  1AQC A;  5CLL B;  3KZ1 A;  4KAX B;  4B6H A;  1Y5O A;  4EKU A;  1UNR A;  2AL6 A;  1WG7 A;  2ADZ A;  2J59 M;  3D8D A;  2R09 A;  3F0W A;  4QXA B;  5C5B B;  2W2X C;  1ISN A;  3A58 A;  2X18 A;  3ULC A;  3DXE A;  3U12 A;  2Y8F A;  2Z4D A;  2COF A;  5L81 A;  1DBH A;  3RCP A;  3HSA A;  2LG1 A;  1T77 A;  1P5T A;  2MDX A;  1FGY A;  4TYZ A;  1W1H A;  3GYP A;  4GN1 A;  2D9X A;  4GZU A;  4A6F B;  3TW1 A;  4KHB B;  4K81 A;  4HAX B;  4QJ4 B;  2NBV A;  3P6A A;  3PG7 A;  1V5M A;  3N7C A;  1DYN A;  2DFK A;  2DKQ A;  2RVB B;  3KY9 A;  1W1D A;  3VOQ A;  3NSU A;  2COD A;  1XOD A;  1KZ7 A;  2OQB A;  1GC7 A;  2BCJ A;  3NW8 A;  2KGX B;  1V88 A;  5C6R A;  3KRX A;  2LYD A;  1DDV A;  1P3R A;  2N0Y A;  4Z2M B;  4HB3 B;  4DX8 A;  1BTK A;  4GXB A;  4HAZ B;  2Y8G A;  2KCJ A;  2MFQ A;  3QBV B;  3HIE A;  5D3V A;  3SUZ A;  4MY6 A;  2D9Y A;  2EC1 A;  2J0J A;  1X1G A;  5C5B A;  1NU2 A;  2CAY A;  2COA A;  1H4R A;  4HB0 B;  2KUQ A;  2RUK B;  4GPT B;  1NTV A;  3TFM A;  2ZKM X;  2KIE A;  4ZRJ A;  3NWA A;  1MAI A;  5J3Y A;  3T06 A;  4WVF B;  3AU5 A;  1Q67 A;  5DIF B;  4A6F A;  4QJ5 B;  2D9Z A;  2YRY A;  4PNK A;  5M4Y B;  1V61 A;  2G35 A;  2RSG A;  4A5K A;  3QIJ A;  5LOP B;  1ZVR A;  4GMX B;  2XQN M;  2W2W A;  1M7R A;  4YON A;  2YS1 A;  1EF1 A;  2OTX A;  2N23 A;  4KHO A;  3NWF A;  3ZVR A;  5GOW B;  1Y19 B;  2ROV A;  3HW2 B;  4OSN A;  1UNP A;  2YVC A;  1ZC4 B;  4HSI A;  2I1J A;  1FOE A;  4DXA B;  2Z0Q A;  2EMS A;  3VIA A;  4CHM A;  4HDO A;  4CSQ A;  2K2U A;  5C79 A;  1LW3 A;  2UVM A;  1X11 A;  2V76 A;  5D3X A;  1BTN A;  2P0D A;  4F7U P;  3ZDT A;  3BIN A;  4F7G A;  1P6S A;  1FB8 A;  4ZRI A;  4C0A A;  1V5P A;  2DYQ A;  1U27 A;  4HDQ A;  5C16 A;  1UNQ A;  2D9W A;  3SNH A;  4A6H A;  2J0M A;  2E2X A;  1SGH A;  2GUM A;  2K8E A;  4D0N B;  2L1C A;  2VRW B;  3KSY A;  3U7D A; 
#chains in the Genus database with same CATH homology
 1WVH A;  2M38 A;  1FHW A;  1DDM A;  3M1I B;  1FHX A;  2RNR B;  4HAV B;  1QQG A;  2Q13 A;  2LKO A;  1IRS A;  2D9V A;  3MDB C;  2NMB A;  2DHJ A;  1LB1 A;  2D11 A;  1U29 A;  5JHG A;  1W1G A;  1ZC3 B;  4MT7 A;  2H7D A;  1RRP B;  4CYE A;  4KVG B;  2P0F A;  3GYO A;  1TXD A;  1ZM0 A;  4MK0 A;  3CIK A;  2Y7B A;  2I5F A;  3OAN A;  2CY4 A;  2UZR A;  1OQN A;  2D2Q A;  1FGZ A;  4F7H A;  1U5G A;  1PLS A;  4WJ7 A;  2IFS A;  1B55 A;  1MIZ B;  2LOZ A;  3P7Z A;  3A8Q A;  1OMW A;  3G9W A;  3IVF A;  1NI2 A;  3DXD A;  2YS5 A;  3CXB B;  3WA0 A;  1XCG A;  1MK7 B;  1XX0 A;  1GC6 A;  2QKL A;  1K5G B;  1H10 A;  2DYN A;  3TCA A;  5HE3 A;  2P0H A;  1I2H A;  2VKI A;  4GMV A;  1FAO A;  2IYB A;  5JHH A;  1ZSQ A;  2H7E A;  1J19 A;  3TVV A;  1TJ6 A;  2NZ8 B;  5J3Q A;  1E5W A;  2P8V A;  1V89 A;  4K2P A;  3SYX A;  2DLW A;  4ZRK A;  2HE7 A;  2YT0 A;  2L2I A;  1V5U A;  3UZT A;  2COC A;  1EVH A;  2FJL A;  3FM8 C;  1WJ1 A;  2ZPY A;  4DBB A;  4HAU B;  3DXC A;  3V5W A;  2I1K A;  2MKR A;  5DHF B;  5D3W A;  4DX9 0;  4HB4 B;  1EAZ A;  2KUP A;  3FSS A;  2R0D A;  3PEG A;  1MKE A;  3TO1 A;  4IAP A;  4YL8 A;  5HE2 A;  5HE1 A;  2M14 A;  1N3H A;  2Z0P A;  1U5F A;  1WGQ A;  1KI1 B;  1PFJ A;  1X86 A;  3WYF B;  5JP4 A;  1U5E A;  1MPH A;  1PMS A;  3AJ4 A;  4L6E A;  5J3T A;  4P7I A;  4K2O A;  2D10 A;  1K5D B;  4HAY B;  4XWX A;  4HAW B;  2MWN B;  4BBK A;  2DX1 A;  2VSZ A;  2K2J A;  2D4Q A;  1RJ2 A;  1BWN A;  2GS0 A;  2GJY A;  3SV1 A;  2W2X D;  3X23 A;  5DH9 B;  2JP2 A;  3PVW A;  2DHK A;  5D27 A;  4NY0 A;  2RLO A;  4EJN A;  2HTH B;  2YSZ A;  3QWM A;  1MK9 B;  5DHA B;  1X1F A;  4PQ0 A;  2UZS A;  3KRW A;  2DX5 A;  3BJI A;  3ODW A;  1NTY A;  4IFS A;  1U5D A;  4HAT B;  5FI0 A;  4KHA A;  2GCJ A;  2ELA A;  2DN6 A;  2QKM A;  3HK0 A;  2YT1 A;  2I5C A;  1GG3 A;  1BAK A;  2ELB A;  2DKP A;  2J0K A;  3AU4 A;  1WJM A;  1DRO A;  2LUL A;  2ROZ B;  1WGU A;  3ULB A;  3ODX A;  1AWE A;  4IOY X;  5D3Y A;  4H8S A;  4K17 A;  3SO6 A;  4WSF A;  3HQC A;  4A6K A;  2YF0 A;  1I7A A;  3FEH A;  3LJU X;  1TQZ A;  5KQ1 A;  2DTC A;  3MPX A;  4Z2N A;  2LOX A;  1J0W A;  5KCV A;  1QC6 A;  3O96 A;  1X05 A;  1EGX A;  1XD4 A;  1M7E A;  1KZG A;  5JLJ B;  3PVL A;  3PVU A;  3A98 B;  2YS3 A;  5HE0 A;  3PP2 A;  2PZ1 A;  2GCL A;  4Y94 A;  1XKE A;  1UPR A;  1DDW A;  1XR0 B;  3PSC A;  4NSW A;  5EFX A;  4EMO A;  1FHO A;  1UEF A;  3PZD A;  2DA0 A;  2EJ8 A;  2Z0O A;  4HHV A;  4TKN A;  3ML4 A;  5LON B;  1OY2 A;  3D8F A;  3ODO A;  4HB2 B;  5KQ4 A;  5FI1 A;  4CHJ A;  5CLQ B;  2DHI A;  1U2B A;  2RGN B;  3A8P A;  1SHC A;  1WI1 A;  5DI9 B;  2CY5 A;  2K00 A;  1UPQ A;  3U8Z A;  2AEH A;  1MIX A;  3F5R A;  3D8E A;  2EMT A;  2CRF A;  1Z87 A;  1AQC A;  5CLL B;  3KZ1 A;  4KAX B;  4B6H A;  1Y5O A;  4EKU A;  1UNR A;  2AL6 A;  1WG7 A;  2ADZ A;  2J59 M;  3D8D A;  2R09 A;  3F0W A;  5C5B B;  2W2X C;  1ISN A;  2X18 A;  3ULC A;  3DXE A;  2Y8F A;  2COF A;  5L81 A;  1DBH A;  3RCP A;  2LG1 A;  2MDX A;  1P5T A;  1FGY A;  4TYZ A;  1W1H A;  3GYP A;  4GN1 A;  2D9X A;  4GZU A;  4A6F B;  3TW1 A;  4KHB B;  4K81 A;  4HAX B;  3P6A A;  3PG7 A;  1V5M A;  3N7C A;  1DYN A;  2DFK A;  2DKQ A;  2RVB B;  3KY9 A;  1W1D A;  3VOQ A;  3NSU A;  2COD A;  1XOD A;  1KZ7 A;  2OQB A;  1GC7 A;  2BCJ A;  2KGX B;  1V88 A;  5C6R A;  3KRX A;  2LYD A;  1DDV A;  1P3R A;  2N0Y A;  4Z2M B;  4HB3 B;  4DX8 A;  1BTK A;  4GXB A;  4HAZ B;  2Y8G A;  2KCJ A;  2MFQ A;  3QBV B;  5D3V A;  3SUZ A;  4MY6 A;  2D9Y A;  2EC1 A;  2J0J A;  1X1G A;  5C5B A;  1NU2 A;  2CAY A;  2COA A;  1H4R A;  4HB0 B;  2RUK B;  4GPT B;  1NTV A;  3TFM A;  4ZRJ A;  1MAI A;  5J3Y A;  3T06 A;  4WVF B;  3AU5 A;  1Q67 A;  5DIF B;  4A6F A;  2D9Z A;  2YRY A;  4PNK A;  1V61 A;  2G35 A;  2RSG A;  4A5K A;  3QIJ A;  5LOP B;  1ZVR A;  4GMX B;  2XQN M;  2W2W A;  1M7R A;  4YON A;  2YS1 A;  1EF1 A;  2OTX A;  2N23 A;  4KHO A;  3ZVR A;  5GOW B;  1Y19 B;  2ROV A;  3HW2 B;  1UNP A;  2YVC A;  1ZC4 B;  2I1J A;  1FOE A;  4DXA B;  2Z0Q A;  2EMS A;  3VIA A;  4CHM A;  4HDO A;  2K2U A;  5C79 A;  1LW3 A;  2UVM A;  1X11 A;  2V76 A;  5D3X A;  1BTN A;  2P0D A;  4F7U P;  3ZDT A;  3BIN A;  4F7G A;  1P6S A;  1FB8 A;  4ZRI A;  4C0A A;  1V5P A;  2DYQ A;  1U27 A;  4HDQ A;  5C16 A;  1UNQ A;  2D9W A;  3SNH A;  4A6H A;  2J0M A;  2E2X A;  1SGH A;  4D0N B;  2L1C A;  2VRW B;  3KSY A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...