2RVBB

Solution structure of the complex between xpc acidic domain and tfiih p62 ph domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/transcription
molecule keywords DNA repair protein complementing XP-C cells
publication title Structural Insight into the Mechanism of TFIIH Recognition by the Acidic String of the Nucleotide Excision Repair Factor XPC.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rvbB00
3GYPA 4KVGB 4H8SA 1KZ7A 1ZM0A 5HE0A 2GCLA 4D0NB 3KRWA 1MIXA 1UNQA 3M1IB 2J0KA 2YT0A 2DFKA 1FOEA 2DHIA 2Y8GA 1XD4A 2EJ8A 2OQBA 1GC7A 1TXDA 3PVLA 1BWNA 1UEFA 2L2IA 4HDOA 3ZDTA 3D8FA 2EMTA 2V76A 2RGNB 4F7HA 2RUKB 3DXEA 3KY9A 1ISNA 3P7ZA 4GPTB 4EJNA 1PMSA 2K2UA 2DX5A 3V5WA 2H7EA 5D3YA 2K00A 1GC6A 1TJ6A 2LOXA 5JHGA 5JLJB 1MK9B 2YF0A 1NI2A 3ULCA 4NY0A 3SYXA 4CYEA 3O96A 2DTCA 3TO1A 3PG7A 2W2XC 1MAIA 5D3VA 1EVHA 4MK0A 4Y94A 5KQ4A 4HB0B 3FSSA 2CY5A 2DLWA 1KZGA 4TKNA 1UPRA 2JP2A 2DYQA 2LG1A 3DXCA 5C5BB 2PZ1A 4WJ7A 4GXBA 1M7RA 2P0FA 1DDWA 2CY4A 4Z2MB 2YT1A 2NZ8B 3OANA 4HB2B 1V89A 2DA0A 2KUPA 3SV1A 4BBKA 2COCA 1MIZB 3VIAA 1P6SA 4DBBA 1EGXA 3TCAA 4KHAA 5CLLB 2P8VA 2DKQA 3TW1A 5HE1A 2DHJA 3LJUX 3QBVB 4IOYX 1Y5OA 3FM8C 2E2XA 1DDMA 1UPQA 5GOWB 5D27A 5DHAB 2ELAA 3X23A 1Y19B 2BCJA 1XCGA 3MPXA 2Y8FA 2N23A 3A8QA 2LULA 2P0HA 2NMBA 2EC1A 4HAYB 5C79A 3WA0A 4MY6A 2D9ZA 1X1FA 2COFA 1K5DB 1IRSA 3D8DA 2I1JA 5DIFB 4CHJA 1FGZA 1V61A 4F7GA 5LONB 5JHHA 1WJ1A 5DI9B 2GS0A 2CAYA 3F5RA 3QIJA 3ZVRA 2RSGA 2Z0OA 2I5FA 4A6KA 2LKOA 4HATB 2J59M 1UNRA 2X18A 1QC6A 4EMOA 3KSYA 2I5CA 1N3HA 1PLSA 4GN1A 3AJ4A 1FHXA 3A98B 5J3YA 4YONA 3FEHA 2P0DA 2OTXA 5J3QA 1BTNA 5DH9B 3BJIA 2D2QA 3G9WA 2Y7BA 4WSFA 3D8EA 2J0JA 5J3TA 2ROZB 1AQCA 1X1GA 1FGYA 2QKMA 3PVUA 4A5KA 1H4RA 2YVCA 4ZRJA 4HB4B 4L6EA 4KHBB 1X11A 3ODOA 3SO6A 1ZC4B 4NSWA 1QQGA 5D3WA 2N0YA 1FHWA 2D10A 4IFSA 2MWNB 3HW2B 4HDQA 3MDBC 1J19A 1E5WA 2UZRA 1X05A 3ODXA 5FI1A 4ZRKA 2Z0PA 3NSUA 1P5TA 2MFQA 5LOPB 3TVVA 4DXAB 2KGXB 5FI0A 2DN6A 4DX8A 3TFMA 1WGQA 2GCJA 1UNPA 2DHKA 3ULBA 2I1KA 1W1DA 2M14A 2M38A 1K5GB 5HE3A 3U7DA 2R0DA 2D9XA 2R09A 2MKRA 1DYNA 1U5DA 1TQZA 1BAKA 5DHFB 4EKUA 1WGUA 2IFSA 1RJ2A 3HQCA 3BINA 2D11A 1U27A 3PP2A 2ROVA 3DXDA 4GZUA 1XX0A 5L81A 3QWMA 1EF1A 1ZC3B 1J0WA 2K2JA 2G35A 3SNHA 3KRXA 2LOZA 1MKEA 2FJLA 4PNKA 3PSCA 3KZ1A 1U2BA 2EMSA 4K81A 1DROA 1Z87A 2J0MA 1V5PA 3T06A 2L1CA 1U29A 4A6FA 1NTYA 1WJMA 1WG7A 4HHVA 4WVFB 1NTVA 2UZSA 3ML4A 2D9YA 4A6HA 2H7DA 2RNRB 3P6AA 4KAXB 1DBHA 3AU5A 1AWEA 4TYZA 2DKPA 4HAXB 4P7IA 2CODA 3F0WA 1EAZA 4DX90 4K2OA 2W2WA 4XWXA 4K2PA 3IVFA 2VKIA 2HE7A 4GMVA 5KQ1A 2W2XD 4K17A 2RLOA 4KHOA 4IAPA 2D9WA 1LW3A 2YSZA 1I2HA 2Z0QA 3SUZA 1WI1A 2YS5A 2ADZA 1V5MA 4HAZB 4F7UP 4Z2NA 3N7CA 2DYNA 1KI1B 1ZVRA 4GMXB 4HAUB 1OY2A 2MDXA 2IYBA 3AU4A 1OMWA 2VSZA 2AEHA 1WVHA 3HK0A 2GJYA 2D9VA 2YS1A 1FHOA 1U5FA 1W1HA 4CHMA 2UVMA 3UZTA 3CIKA 5C16A 2YS3A 2YRYA 3PEGA 3U8ZA 2XQNM 4HAVB 5D3XA 4PQ0A 2LYDA 3PVWA 1FB8A 1U5GA 2RVBB 1Q67A 2Q13A 4MT7A 4ZRIA 1V88A 5KCVA 1XR0B 1U5EA 2D4QA 1I7AA 5JP4A 5EFXA 1RRPB 2COAA 3VOQA 3WYFB 5HE2A 5C5BA 2VRWB 1H10A 1NU2A 4HB3B 5C6RA 1V5UA 1SGHA 1LB1A 3A8PA 1FAOA 2ZPYA 1P3RA 3CXBB 1M7EA 2QKLA 1W1GA 1BTKA 1OQNA 1XODA 1PFJA 1MK7B 4YL8A 1ZSQA 1SHCA 2HTHB 2ELBA 3GYOA 1B55A 3RCPA 3PZDA 1MPHA 1X86A 2AL6A 4HAWB 2KCJA 1GG3A 5CLQB 1XKEA 4A6FB 4C0AA 4B6HA 3ODWA 1DDVA 2CRFA 2DX1A
chains in the Genus database with same CATH superfamily
3GYPA 4KVGB 5IRSA 4H8SA 1KZ7A 1ZM0A 5HE0A 2GCLA 3FVCA 4D0NB 3KRWA 4OSNA 1MIXA 1UNQA 3M1IB 2J0KA 2YT0A 2DFKA 3NWAA 1FOEA 2DHIA 2Y8GA 3NW8A 2Z4DA 1XD4A 2EJ8A 2OQBA 1GC7A 1TXDA 5LG4B 3PVLA 1BWNA 1UEFA 2L2IA 4HDOA 3ZDTA 3D8FA 2EMTA 2YT2A 3A58A 2V76A 4D6WA 2RGNB 4F7HA 2RUKB 3DXEA 2FJUB 1ISNA 3KY9A 3P7ZA 4GPTB 4EJNA 1PMSA 2K2UA 2DX5A 3V5WA 2H7EA 5D3YA 2K00A 2GUMA 1GC6A 1TJ6A 2LOXA 5JHGA 5JLJB 1MK9B 2YF0A 1NI2A 4QJ4B 3ULCA 4NY0A 3SYXA 4CYEA 3O96A 2DTCA 3TO1A 3PG7A 2W2XC 1MAIA 4L1RA 5D3VA 2RRFA 4KHBA 1EVHA 4MK0A 4Y94A 5KQ4A 4HB0B 3FSSA 2CY5A 2DLWA 1KZGA 3NWDA 4TKNA 1UPRA 2JP2A 2DYQA 2LG1A 3DXCA 3NWFA 2PZ1A 4WJ7A 5C5BB 4GXBA 1M7RA 2P0FA 1DDWA 2CY4A 4Z2MB 2YT1A 2NZ8B 3OANA 4HB2B 1V89A 2DA0A 4HSIA 2KUPA 3SV1A 4BBKA 2COCA 1MIZB 3VIAA 1P6SA 4DBBA 1EGXA 3TCAA 4KHAA 5CLLB 2P8VA 2NBVA 3HSAA 4QJ5B 2DKQA 3TW1A 5HE1A 2DHJA 3LJUX 3QBVB 4IOYX 1Y5OA 3FM8C 2E2XA 1DDMA 1UPQA 5GOWB 5D27A 1T77A 5DHAB 2ELAA 3X23A 1Y19B 2BCJA 1XCGA 2ZKMX 3MPXA 2Y8FA 2N23A 3A8QA 2LULA 5I2MA 2P0HA 2NMBA 3B77A 2EC1A 4HAYB 5C79A 3WA0A 4MY6A 2D9ZA 1X1FA 2COFA 1K5DB 1IRSA 3D8DA 2I1JA 5DIFB 4CHJA 1FGZA 1V61A 4F7GA 5LONB 4QXAB 5JHHA 1WJ1A 5DI9B 2GS0A 2CAYA 3F5RA 3QIJA 3ZVRA 2RSGA 2Z0OA 2I5FA 4A6KA 2LKOA 4HATB 2J59M 1UNRA 2X18A 1QC6A 4EMOA 3KSYA 2I5CA 1N3HA 1PLSA 3DCXA 4GN1A 3AJ4A 1FHXA 3A98B 5J3YA 4YONA 3FEHA 2P0DA 2OTXA 5J3QA 1BTNA 5DH9B 3BJIA 2D2QA 3G9WA 2Y7BA 4WSFA 3D8EA 2J0JA 5J3TA 2ROZB 1AQCA 1X1GA 1FGYA 2QKMA 3PVUA 4GOUA 1H4RA 4A5KA 2YVCA 4ZRJA 4HB4B 4L6EA 4GNKB 4KHBB 1X11A 3ODOA 3SO6A 1ZC4B 4NSWA 1QQGA 5D3WA 2N0YA 1FHWA 2D10A 4IFSA 2MWNB 3HW2B 4HDQA 3MDBC 1J19A 1E5WA 2UZRA 1X05A 3ODXA 4QJ3B 2R2YA 5FI1A 4ZRKA 2Z0PA 3NSUA 1P5TA 2MFQA 5LOPB 3TVVA 4DXAB 2KGXB 5FI0A 2DN6A 4DX8A 3TFMA 4DIXA 3HIEA 2KUQA 1WGQA 2GCJA 1UNPA 2DHKA 3ULBA 2I1KA 1W1DA 2K8EA 2M14A 2M38A 1K5GB 5HE3A 3U7DA 2R0DA 2D9XA 2R09A 2MKRA 1DYNA 1U5DA 1TQZA 1BAKA 1MI1A 5DHFB 4EKUA 1WGUA 2IFSA 1RJ2A 3HQCA 3BINA 2D11A 1U27A 3PP2A 2ROVA 3DXDA 4GZUA 1XX0A 5L81A 3QWMA 1EF1A 1ZC3B 1J0WA 2K2JA 2G35A 3SNHA 5M4YB 3KRXA 2LOZA 1MKEA 2FJLA 4PNKA 3PSCA 3KZ1A 1U2BA 2EMSA 4K81A 1DROA 1Z87A 2J0MA 1V5PA 3T06A 2L1CA 1U29A 4A6FA 1NTYA 3OHMB 1WJMA 1WG7A 4HHVA 4WVFB 1NTVA 2UZSA 3ML4A 2D9YA 4A6HA 2H7DA 2RNRB 3P6AA 4KAXB 1DBHA 3AU5A 1AWEA 4TYZA 2DKPA 4HAXB 4P7IA 2CODA 3F0WA 1EAZA 4DX90 4K2OA 2W2WA 4XWXA 4K2PA 3IVFA 2VKIA 2HE7A 4GMVA 5KQ1A 2W2XD 4K17A 2RLOA 4KHOA 4IAPA 2D9WA 1LW3A 2YSZA 1I2HA 2Z0QA 3SUZA 1WI1A 2YS5A 2ADZA 1V5MA 4HAZB 4F7UP 4Z2NA 3N7CA 2DYNA 1KI1B 1ZVRA 4GMXB 4HAUB 1OY2A 2Z13A 2MDXA 2IYBA 4OT1A 3AU4A 5I2SA 1OMWA 2VSZA 2AEHA 1WVHA 3HK0A 2GJYA 2D9VA 2YS1A 1FHOA 1U5FA 1W1HA 4CHMA 2UVMA 3UZTA 3CIKA 5C16A 2YS3A 2YRYA 3PEGA 2KR0A 3U8ZA 2XQNM 4HAVB 5D3XA 4PQ0A 1ZYIA 2LYDA 3PVWA 1FB8A 1U5GA 2RVBB 1Q67A 2Z14A 2Q13A 4MT7A 4ZRIA 1V88A 5KCVA 1XR0B 1U5EA 2D4QA 2Z59A 1I7AA 5JP4A 5EFXA 1RRPB 2COAA 3VOQA 3WYFB 5HE2A 5C5BA 2VRWB 1H10A 1NU2A 4HB3B 5C6RA 1V5UA 1SGHA 1LB1A 2KIGA 2KIEA 3A8PA 1FAOA 2ZPYA 1P3RA 3CXBB 1M7EA 2QKLA 1W1GA 1BTKA 1OQNA 1XODA 1PFJA 1MK7B 4YL8A 1ZSQA 1SHCA 2HTHB 2ELBA 3GYOA 3U12A 1B55A 3RCPA 3PZDA 1MPHA 1X86A 2AL6A 4HAWB 2KCJA 1GG3A 5CLQB 1XKEA 4CSQA 4A6FB 4C0AA 4B6HA 3ODWA 1DDVA 2CRFA 2DX1A 2K49A
chains in the Genus database with same CATH topology
3GYPA 4KVGB 4H8SA 1KZ7A 1ZM0A 5HE0A 2GCLA 4D0NB 3KRWA 1MIXA 1UNQA 3M1IB 2J0KA 2YT0A 2DFKA 1FOEA 2DHIA 2Y8GA 1XD4A 2EJ8A 2OQBA 1GC7A 1TXDA 3PVLA 1BWNA 1UEFA 2L2IA 4HDOA 3ZDTA 3D8FA 2EMTA 2V76A 2RGNB 4F7HA 2RUKB 3DXEA 3KY9A 1ISNA 3P7ZA 4GPTB 4EJNA 1PMSA 2K2UA 2DX5A 3V5WA 2H7EA 5D3YA 2K00A 1GC6A 1TJ6A 2LOXA 5JHGA 5JLJB 1MK9B 2YF0A 1NI2A 3ULCA 4NY0A 3SYXA 4CYEA 3O96A 2DTCA 3TO1A 3PG7A 2W2XC 1MAIA 5D3VA 1EVHA 4MK0A 4Y94A 5KQ4A 4HB0B 3FSSA 2CY5A 2DLWA 1KZGA 4TKNA 1UPRA 2JP2A 2DYQA 2LG1A 3DXCA 5C5BB 2PZ1A 4WJ7A 4GXBA 1M7RA 2P0FA 1DDWA 2CY4A 4Z2MB 2YT1A 2NZ8B 3OANA 4HB2B 1V89A 2DA0A 2KUPA 3SV1A 4BBKA 2COCA 1MIZB 3VIAA 1P6SA 4DBBA 1EGXA 3TCAA 4KHAA 5CLLB 2P8VA 2DKQA 3TW1A 5HE1A 2DHJA 3LJUX 3QBVB 4IOYX 1Y5OA 3FM8C 2E2XA 1DDMA 1UPQA 5GOWB 5D27A 5DHAB 2ELAA 3X23A 1Y19B 2BCJA 1XCGA 3MPXA 2Y8FA 2N23A 3A8QA 2LULA 2P0HA 2NMBA 2EC1A 4HAYB 5C79A 3WA0A 4MY6A 2D9ZA 1X1FA 2COFA 1K5DB 1IRSA 3D8DA 2I1JA 5DIFB 4CHJA 1FGZA 1V61A 4F7GA 5LONB 5JHHA 1WJ1A 5DI9B 2GS0A 2CAYA 3F5RA 3QIJA 3ZVRA 2RSGA 2Z0OA 2I5FA 4A6KA 2LKOA 4HATB 2J59M 1UNRA 2X18A 1QC6A 4EMOA 3KSYA 2I5CA 1N3HA 1PLSA 4GN1A 3AJ4A 1FHXA 3A98B 5J3YA 4YONA 3FEHA 2P0DA 2OTXA 5J3QA 1BTNA 5DH9B 3BJIA 2D2QA 3G9WA 2Y7BA 4WSFA 3D8EA 2J0JA 5J3TA 2ROZB 1AQCA 1X1GA 1FGYA 2QKMA 3PVUA 4A5KA 1H4RA 2YVCA 4ZRJA 4HB4B 4L6EA 4KHBB 1X11A 3ODOA 3SO6A 1ZC4B 4NSWA 1QQGA 5D3WA 2N0YA 1FHWA 2D10A 4IFSA 2MWNB 3HW2B 4HDQA 3MDBC 1J19A 1E5WA 2UZRA 1X05A 3ODXA 5FI1A 4ZRKA 2Z0PA 3NSUA 1P5TA 2MFQA 5LOPB 3TVVA 4DXAB 2KGXB 5FI0A 2DN6A 4DX8A 3TFMA 1WGQA 2GCJA 1UNPA 2DHKA 3ULBA 2I1KA 1W1DA 2M14A 2M38A 1K5GB 5HE3A 3U7DA 2R0DA 2D9XA 2R09A 2MKRA 1DYNA 1U5DA 1TQZA 1BAKA 5DHFB 4EKUA 1WGUA 2IFSA 1RJ2A 3HQCA 3BINA 2D11A 1U27A 3PP2A 2ROVA 3DXDA 4GZUA 1XX0A 5L81A 3QWMA 1EF1A 1ZC3B 1J0WA 2K2JA 2G35A 3SNHA 3KRXA 2LOZA 1MKEA 2FJLA 4PNKA 3PSCA 3KZ1A 1U2BA 2EMSA 4K81A 1DROA 1Z87A 2J0MA 1V5PA 3T06A 2L1CA 1U29A 4A6FA 1NTYA 1WJMA 1WG7A 4HHVA 4WVFB 1NTVA 2UZSA 3ML4A 2D9YA 4A6HA 2H7DA 2RNRB 3P6AA 4KAXB 1DBHA 3AU5A 1AWEA 4TYZA 2DKPA 4HAXB 4P7IA 2CODA 3F0WA 1EAZA 4DX90 4K2OA 2W2WA 4XWXA 4K2PA 3IVFA 2VKIA 2HE7A 4GMVA 5KQ1A 2W2XD 4K17A 2RLOA 4KHOA 4IAPA 2D9WA 1LW3A 2YSZA 1I2HA 2Z0QA 3SUZA 1WI1A 2YS5A 2ADZA 1V5MA 4HAZB 4F7UP 4Z2NA 3N7CA 2DYNA 1KI1B 1ZVRA 4GMXB 4HAUB 1OY2A 2MDXA 2IYBA 3AU4A 1OMWA 2VSZA 2AEHA 1WVHA 3HK0A 2GJYA 2D9VA 2YS1A 1FHOA 1U5FA 1W1HA 4CHMA 2UVMA 3UZTA 3CIKA 5C16A 2YS3A 2YRYA 3PEGA 3U8ZA 2XQNM 4HAVB 5D3XA 4PQ0A 2LYDA 3PVWA 1FB8A 1U5GA 2RVBB 1Q67A 2Q13A 4MT7A 4ZRIA 1V88A 5KCVA 1XR0B 1U5EA 2D4QA 1I7AA 5JP4A 5EFXA 1RRPB 2COAA 3VOQA 3WYFB 5HE2A 5C5BA 2VRWB 1H10A 1NU2A 4HB3B 5C6RA 1V5UA 1SGHA 1LB1A 3A8PA 1FAOA 2ZPYA 1P3RA 3CXBB 1M7EA 2QKLA 1W1GA 1BTKA 1OQNA 1XODA 1PFJA 1MK7B 4YL8A 1ZSQA 1SHCA 2HTHB 2ELBA 3GYOA 1B55A 3RCPA 3PZDA 1MPHA 1X86A 2AL6A 4HAWB 2KCJA 1GG3A 5CLQB 1XKEA 4A6FB 4C0AA 4B6HA 3ODWA 1DDVA 2CRFA 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYP A;  4KVG B;  4H8S A;  1KZ7 A;  1ZM0 A;  5HE0 A;  2GCL A;  4D0N B;  3KRW A;  1MIX A;  1UNQ A;  3M1I B;  2J0K A;  2YT0 A;  2DFK A;  1FOE A;  2DHI A;  2Y8G A;  1XD4 A;  2EJ8 A;  2OQB A;  1GC7 A;  1TXD A;  3PVL A;  1BWN A;  1UEF A;  2L2I A;  4HDO A;  3ZDT A;  3D8F A;  2EMT A;  2V76 A;  2RGN B;  4F7H A;  2RUK B;  3DXE A;  3KY9 A;  1ISN A;  3P7Z A;  4GPT B;  4EJN A;  1PMS A;  2K2U A;  2DX5 A;  3V5W A;  2H7E A;  5D3Y A;  2K00 A;  1GC6 A;  1TJ6 A;  2LOX A;  5JHG A;  5JLJ B;  1MK9 B;  2YF0 A;  1NI2 A;  3ULC A;  4NY0 A;  3SYX A;  4CYE A;  3O96 A;  2DTC A;  3TO1 A;  3PG7 A;  2W2X C;  1MAI A;  5D3V A;  1EVH A;  4MK0 A;  4Y94 A;  5KQ4 A;  4HB0 B;  3FSS A;  2CY5 A;  2DLW A;  1KZG A;  4TKN A;  1UPR A;  2JP2 A;  2DYQ A;  2LG1 A;  3DXC A;  5C5B B;  2PZ1 A;  4WJ7 A;  4GXB A;  1M7R A;  2P0F A;  1DDW A;  2CY4 A;  4Z2M B;  2YT1 A;  2NZ8 B;  3OAN A;  4HB2 B;  1V89 A;  2DA0 A;  2KUP A;  3SV1 A;  4BBK A;  2COC A;  1MIZ B;  3VIA A;  1P6S A;  4DBB A;  1EGX A;  3TCA A;  4KHA A;  5CLL B;  2P8V A;  2DKQ A;  3TW1 A;  5HE1 A;  2DHJ A;  3LJU X;  3QBV B;  4IOY X;  1Y5O A;  3FM8 C;  2E2X A;  1DDM A;  1UPQ A;  5GOW B;  5D27 A;  5DHA B;  2ELA A;  3X23 A;  1Y19 B;  2BCJ A;  1XCG A;  3MPX A;  2Y8F A;  2N23 A;  3A8Q A;  2LUL A;  2P0H A;  2NMB A;  2EC1 A;  4HAY B;  5C79 A;  3WA0 A;  4MY6 A;  2D9Z A;  1X1F A;  2COF A;  1K5D B;  1IRS A;  3D8D A;  2I1J A;  5DIF B;  4CHJ A;  1FGZ A;  1V61 A;  4F7G A;  5LON B;  5JHH A;  1WJ1 A;  5DI9 B;  2GS0 A;  2CAY A;  3F5R A;  3QIJ A;  3ZVR A;  2RSG A;  2Z0O A;  2I5F A;  4A6K A;  2LKO A;  4HAT B;  2J59 M;  1UNR A;  2X18 A;  1QC6 A;  4EMO A;  3KSY A;  2I5C A;  1N3H A;  1PLS A;  4GN1 A;  3AJ4 A;  1FHX A;  3A98 B;  5J3Y A;  4YON A;  3FEH A;  2P0D A;  2OTX A;  5J3Q A;  1BTN A;  5DH9 B;  3BJI A;  2D2Q A;  3G9W A;  2Y7B A;  4WSF A;  3D8E A;  2J0J A;  5J3T A;  2ROZ B;  1AQC A;  1X1G A;  1FGY A;  2QKM A;  3PVU A;  4A5K A;  1H4R A;  2YVC A;  4ZRJ A;  4HB4 B;  4L6E A;  4KHB B;  1X11 A;  3ODO A;  3SO6 A;  1ZC4 B;  4NSW A;  1QQG A;  5D3W A;  2N0Y A;  1FHW A;  2D10 A;  4IFS A;  2MWN B;  3HW2 B;  4HDQ A;  3MDB C;  1J19 A;  1E5W A;  2UZR A;  1X05 A;  3ODX A;  5FI1 A;  4ZRK A;  2Z0P A;  3NSU A;  1P5T A;  2MFQ A;  5LOP B;  3TVV A;  4DXA B;  2KGX B;  5FI0 A;  2DN6 A;  4DX8 A;  3TFM A;  1WGQ A;  2GCJ A;  1UNP A;  2DHK A;  3ULB A;  2I1K A;  1W1D A;  2M14 A;  2M38 A;  1K5G B;  5HE3 A;  3U7D A;  2R0D A;  2D9X A;  2R09 A;  2MKR A;  1DYN A;  1U5D A;  1TQZ A;  1BAK A;  5DHF B;  4EKU A;  1WGU A;  2IFS A;  1RJ2 A;  3HQC A;  3BIN A;  2D11 A;  1U27 A;  3PP2 A;  2ROV A;  3DXD A;  4GZU A;  1XX0 A;  5L81 A;  3QWM A;  1EF1 A;  1ZC3 B;  1J0W A;  2K2J A;  2G35 A;  3SNH A;  3KRX A;  2LOZ A;  1MKE A;  2FJL A;  4PNK A;  3PSC A;  3KZ1 A;  1U2B A;  2EMS A;  4K81 A;  1DRO A;  1Z87 A;  2J0M A;  1V5P A;  3T06 A;  2L1C A;  1U29 A;  4A6F A;  1NTY A;  1WJM A;  1WG7 A;  4HHV A;  4WVF B;  1NTV A;  2UZS A;  3ML4 A;  2D9Y A;  4A6H A;  2H7D A;  2RNR B;  3P6A A;  4KAX B;  1DBH A;  3AU5 A;  1AWE A;  4TYZ A;  2DKP A;  4HAX B;  4P7I A;  2COD A;  3F0W A;  1EAZ A;  4DX9 0;  4K2O A;  2W2W A;  4XWX A;  4K2P A;  3IVF A;  2VKI A;  2HE7 A;  4GMV A;  5KQ1 A;  2W2X D;  4K17 A;  2RLO A;  4KHO A;  4IAP A;  2D9W A;  1LW3 A;  2YSZ A;  1I2H A;  2Z0Q A;  3SUZ A;  1WI1 A;  2YS5 A;  2ADZ A;  1V5M A;  4HAZ B;  4F7U P;  4Z2N A;  3N7C A;  2DYN A;  1KI1 B;  1ZVR A;  4GMX B;  4HAU B;  1OY2 A;  2MDX A;  2IYB A;  3AU4 A;  1OMW A;  2VSZ A;  2AEH A;  1WVH A;  3HK0 A;  2GJY A;  2D9V A;  2YS1 A;  1FHO A;  1U5F A;  1W1H A;  4CHM A;  2UVM A;  3UZT A;  3CIK A;  5C16 A;  2YS3 A;  2YRY A;  3PEG A;  3U8Z A;  2XQN M;  4HAV B;  5D3X A;  4PQ0 A;  2LYD A;  3PVW A;  1FB8 A;  1U5G A;  2RVB B;  1Q67 A;  2Q13 A;  4MT7 A;  4ZRI A;  1V88 A;  5KCV A;  1XR0 B;  1U5E A;  2D4Q A;  1I7A A;  5JP4 A;  5EFX A;  1RRP B;  2COA A;  3VOQ A;  3WYF B;  5HE2 A;  5C5B A;  2VRW B;  1H10 A;  1NU2 A;  4HB3 B;  5C6R A;  1V5U A;  1SGH A;  1LB1 A;  3A8P A;  1FAO A;  2ZPY A;  1P3R A;  3CXB B;  1M7E A;  2QKL A;  1W1G A;  1BTK A;  1OQN A;  1XOD A;  1PFJ A;  1MK7 B;  4YL8 A;  1ZSQ A;  1SHC A;  2HTH B;  2ELB A;  3GYO A;  1B55 A;  3RCP A;  3PZD A;  1MPH A;  1X86 A;  2AL6 A;  4HAW B;  2KCJ A;  1GG3 A;  5CLQ B;  1XKE A;  4A6F B;  4C0A A;  4B6H A;  3ODW A;  1DDV A;  2CRF A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 3GYP A;  4KVG B;  5IRS A;  4H8S A;  1KZ7 A;  1ZM0 A;  5HE0 A;  2GCL A;  3FVC A;  4D0N B;  3KRW A;  4OSN A;  1MIX A;  1UNQ A;  3M1I B;  2J0K A;  2YT0 A;  2DFK A;  3NWA A;  1FOE A;  2DHI A;  2Y8G A;  3NW8 A;  2Z4D A;  1XD4 A;  2EJ8 A;  2OQB A;  1GC7 A;  1TXD A;  5LG4 B;  3PVL A;  1BWN A;  1UEF A;  2L2I A;  4HDO A;  3ZDT A;  3D8F A;  2EMT A;  2YT2 A;  3A58 A;  2V76 A;  4D6W A;  2RGN B;  4F7H A;  2RUK B;  3DXE A;  2FJU B;  1ISN A;  3KY9 A;  3P7Z A;  4GPT B;  4EJN A;  1PMS A;  2K2U A;  2DX5 A;  3V5W A;  2H7E A;  5D3Y A;  2K00 A;  2GUM A;  1GC6 A;  1TJ6 A;  2LOX A;  5JHG A;  5JLJ B;  1MK9 B;  2YF0 A;  1NI2 A;  4QJ4 B;  3ULC A;  4NY0 A;  3SYX A;  4CYE A;  3O96 A;  2DTC A;  3TO1 A;  3PG7 A;  2W2X C;  1MAI A;  4L1R A;  5D3V A;  2RRF A;  4KHB A;  1EVH A;  4MK0 A;  4Y94 A;  5KQ4 A;  4HB0 B;  3FSS A;  2CY5 A;  2DLW A;  1KZG A;  3NWD A;  4TKN A;  1UPR A;  2JP2 A;  2DYQ A;  2LG1 A;  3DXC A;  3NWF A;  2PZ1 A;  4WJ7 A;  5C5B B;  4GXB A;  1M7R A;  2P0F A;  1DDW A;  2CY4 A;  4Z2M B;  2YT1 A;  2NZ8 B;  3OAN A;  4HB2 B;  1V89 A;  2DA0 A;  4HSI A;  2KUP A;  3SV1 A;  4BBK A;  2COC A;  1MIZ B;  3VIA A;  1P6S A;  4DBB A;  1EGX A;  3TCA A;  4KHA A;  5CLL B;  2P8V A;  2NBV A;  3HSA A;  4QJ5 B;  2DKQ A;  3TW1 A;  5HE1 A;  2DHJ A;  3LJU X;  3QBV B;  4IOY X;  1Y5O A;  3FM8 C;  2E2X A;  1DDM A;  1UPQ A;  5GOW B;  5D27 A;  1T77 A;  5DHA B;  2ELA A;  3X23 A;  1Y19 B;  2BCJ A;  1XCG A;  2ZKM X;  3MPX A;  2Y8F A;  2N23 A;  3A8Q A;  2LUL A;  5I2M A;  2P0H A;  2NMB A;  3B77 A;  2EC1 A;  4HAY B;  5C79 A;  3WA0 A;  4MY6 A;  2D9Z A;  1X1F A;  2COF A;  1K5D B;  1IRS A;  3D8D A;  2I1J A;  5DIF B;  4CHJ A;  1FGZ A;  1V61 A;  4F7G A;  5LON B;  4QXA B;  5JHH A;  1WJ1 A;  5DI9 B;  2GS0 A;  2CAY A;  3F5R A;  3QIJ A;  3ZVR A;  2RSG A;  2Z0O A;  2I5F A;  4A6K A;  2LKO A;  4HAT B;  2J59 M;  1UNR A;  2X18 A;  1QC6 A;  4EMO A;  3KSY A;  2I5C A;  1N3H A;  1PLS A;  3DCX A;  4GN1 A;  3AJ4 A;  1FHX A;  3A98 B;  5J3Y A;  4YON A;  3FEH A;  2P0D A;  2OTX A;  5J3Q A;  1BTN A;  5DH9 B;  3BJI A;  2D2Q A;  3G9W A;  2Y7B A;  4WSF A;  3D8E A;  2J0J A;  5J3T A;  2ROZ B;  1AQC A;  1X1G A;  1FGY A;  2QKM A;  3PVU A;  4GOU A;  1H4R A;  4A5K A;  2YVC A;  4ZRJ A;  4HB4 B;  4L6E A;  4GNK B;  4KHB B;  1X11 A;  3ODO A;  3SO6 A;  1ZC4 B;  4NSW A;  1QQG A;  5D3W A;  2N0Y A;  1FHW A;  2D10 A;  4IFS A;  2MWN B;  3HW2 B;  4HDQ A;  3MDB C;  1J19 A;  1E5W A;  2UZR A;  1X05 A;  3ODX A;  4QJ3 B;  2R2Y A;  5FI1 A;  4ZRK A;  2Z0P A;  3NSU A;  1P5T A;  2MFQ A;  5LOP B;  3TVV A;  4DXA B;  2KGX B;  5FI0 A;  2DN6 A;  4DX8 A;  3TFM A;  4DIX A;  3HIE A;  2KUQ A;  1WGQ A;  2GCJ A;  1UNP A;  2DHK A;  3ULB A;  2I1K A;  1W1D A;  2K8E A;  2M14 A;  2M38 A;  1K5G B;  5HE3 A;  3U7D A;  2R0D A;  2D9X A;  2R09 A;  2MKR A;  1DYN A;  1U5D A;  1TQZ A;  1BAK A;  1MI1 A;  5DHF B;  4EKU A;  1WGU A;  2IFS A;  1RJ2 A;  3HQC A;  3BIN A;  2D11 A;  1U27 A;  3PP2 A;  2ROV A;  3DXD A;  4GZU A;  1XX0 A;  5L81 A;  3QWM A;  1EF1 A;  1ZC3 B;  1J0W A;  2K2J A;  2G35 A;  3SNH A;  5M4Y B;  3KRX A;  2LOZ A;  1MKE A;  2FJL A;  4PNK A;  3PSC A;  3KZ1 A;  1U2B A;  2EMS A;  4K81 A;  1DRO A;  1Z87 A;  2J0M A;  1V5P A;  3T06 A;  2L1C A;  1U29 A;  4A6F A;  1NTY A;  3OHM B;  1WJM A;  1WG7 A;  4HHV A;  4WVF B;  1NTV A;  2UZS A;  3ML4 A;  2D9Y A;  4A6H A;  2H7D A;  2RNR B;  3P6A A;  4KAX B;  1DBH A;  3AU5 A;  1AWE A;  4TYZ A;  2DKP A;  4HAX B;  4P7I A;  2COD A;  3F0W A;  1EAZ A;  4DX9 0;  4K2O A;  2W2W A;  4XWX A;  4K2P A;  3IVF A;  2VKI A;  2HE7 A;  4GMV A;  5KQ1 A;  2W2X D;  4K17 A;  2RLO A;  4KHO A;  4IAP A;  2D9W A;  1LW3 A;  2YSZ A;  1I2H A;  2Z0Q A;  3SUZ A;  1WI1 A;  2YS5 A;  2ADZ A;  1V5M A;  4HAZ B;  4F7U P;  4Z2N A;  3N7C A;  2DYN A;  1KI1 B;  1ZVR A;  4GMX B;  4HAU B;  1OY2 A;  2Z13 A;  2MDX A;  2IYB A;  4OT1 A;  3AU4 A;  5I2S A;  1OMW A;  2VSZ A;  2AEH A;  1WVH A;  3HK0 A;  2GJY A;  2D9V A;  2YS1 A;  1FHO A;  1U5F A;  1W1H A;  4CHM A;  2UVM A;  3UZT A;  3CIK A;  5C16 A;  2YS3 A;  2YRY A;  3PEG A;  2KR0 A;  3U8Z A;  2XQN M;  4HAV B;  5D3X A;  4PQ0 A;  1ZYI A;  2LYD A;  3PVW A;  1FB8 A;  1U5G A;  2RVB B;  1Q67 A;  2Z14 A;  2Q13 A;  4MT7 A;  4ZRI A;  1V88 A;  5KCV A;  1XR0 B;  1U5E A;  2D4Q A;  2Z59 A;  1I7A A;  5JP4 A;  5EFX A;  1RRP B;  2COA A;  3VOQ A;  3WYF B;  5HE2 A;  5C5B A;  2VRW B;  1H10 A;  1NU2 A;  4HB3 B;  5C6R A;  1V5U A;  1SGH A;  1LB1 A;  2KIG A;  2KIE A;  3A8P A;  1FAO A;  2ZPY A;  1P3R A;  3CXB B;  1M7E A;  2QKL A;  1W1G A;  1BTK A;  1OQN A;  1XOD A;  1PFJ A;  1MK7 B;  4YL8 A;  1ZSQ A;  1SHC A;  2HTH B;  2ELB A;  3GYO A;  3U12 A;  1B55 A;  3RCP A;  3PZD A;  1MPH A;  1X86 A;  2AL6 A;  4HAW B;  2KCJ A;  1GG3 A;  5CLQ B;  1XKE A;  4CSQ A;  4A6F B;  4C0A A;  4B6H A;  3ODW A;  1DDV A;  2CRF A;  2DX1 A;  2K49 A; 
#chains in the Genus database with same CATH homology
 3GYP A;  4KVG B;  4H8S A;  1KZ7 A;  1ZM0 A;  5HE0 A;  2GCL A;  4D0N B;  3KRW A;  1MIX A;  1UNQ A;  3M1I B;  2J0K A;  2YT0 A;  2DFK A;  1FOE A;  2DHI A;  2Y8G A;  1XD4 A;  2EJ8 A;  2OQB A;  1GC7 A;  1TXD A;  3PVL A;  1BWN A;  1UEF A;  2L2I A;  4HDO A;  3ZDT A;  3D8F A;  2EMT A;  2V76 A;  2RGN B;  4F7H A;  2RUK B;  3DXE A;  3KY9 A;  1ISN A;  3P7Z A;  4GPT B;  4EJN A;  1PMS A;  2K2U A;  2DX5 A;  3V5W A;  2H7E A;  5D3Y A;  2K00 A;  1GC6 A;  1TJ6 A;  2LOX A;  5JHG A;  5JLJ B;  1MK9 B;  2YF0 A;  1NI2 A;  3ULC A;  4NY0 A;  3SYX A;  4CYE A;  3O96 A;  2DTC A;  3TO1 A;  3PG7 A;  2W2X C;  1MAI A;  5D3V A;  1EVH A;  4MK0 A;  4Y94 A;  5KQ4 A;  4HB0 B;  3FSS A;  2CY5 A;  2DLW A;  1KZG A;  4TKN A;  1UPR A;  2JP2 A;  2DYQ A;  2LG1 A;  3DXC A;  5C5B B;  2PZ1 A;  4WJ7 A;  4GXB A;  1M7R A;  2P0F A;  1DDW A;  2CY4 A;  4Z2M B;  2YT1 A;  2NZ8 B;  3OAN A;  4HB2 B;  1V89 A;  2DA0 A;  2KUP A;  3SV1 A;  4BBK A;  2COC A;  1MIZ B;  3VIA A;  1P6S A;  4DBB A;  1EGX A;  3TCA A;  4KHA A;  5CLL B;  2P8V A;  2DKQ A;  3TW1 A;  5HE1 A;  2DHJ A;  3LJU X;  3QBV B;  4IOY X;  1Y5O A;  3FM8 C;  2E2X A;  1DDM A;  1UPQ A;  5GOW B;  5D27 A;  5DHA B;  2ELA A;  3X23 A;  1Y19 B;  2BCJ A;  1XCG A;  3MPX A;  2Y8F A;  2N23 A;  3A8Q A;  2LUL A;  2P0H A;  2NMB A;  2EC1 A;  4HAY B;  5C79 A;  3WA0 A;  4MY6 A;  2D9Z A;  1X1F A;  2COF A;  1K5D B;  1IRS A;  3D8D A;  2I1J A;  5DIF B;  4CHJ A;  1FGZ A;  1V61 A;  4F7G A;  5LON B;  5JHH A;  1WJ1 A;  5DI9 B;  2GS0 A;  2CAY A;  3F5R A;  3QIJ A;  3ZVR A;  2RSG A;  2Z0O A;  2I5F A;  4A6K A;  2LKO A;  4HAT B;  2J59 M;  1UNR A;  2X18 A;  1QC6 A;  4EMO A;  3KSY A;  2I5C A;  1N3H A;  1PLS A;  4GN1 A;  3AJ4 A;  1FHX A;  3A98 B;  5J3Y A;  4YON A;  3FEH A;  2P0D A;  2OTX A;  5J3Q A;  1BTN A;  5DH9 B;  3BJI A;  2D2Q A;  3G9W A;  2Y7B A;  4WSF A;  3D8E A;  2J0J A;  5J3T A;  2ROZ B;  1AQC A;  1X1G A;  1FGY A;  2QKM A;  3PVU A;  4A5K A;  1H4R A;  2YVC A;  4ZRJ A;  4HB4 B;  4L6E A;  4KHB B;  1X11 A;  3ODO A;  3SO6 A;  1ZC4 B;  4NSW A;  1QQG A;  5D3W A;  2N0Y A;  1FHW A;  2D10 A;  4IFS A;  2MWN B;  3HW2 B;  4HDQ A;  3MDB C;  1J19 A;  1E5W A;  2UZR A;  1X05 A;  3ODX A;  5FI1 A;  4ZRK A;  2Z0P A;  3NSU A;  1P5T A;  2MFQ A;  5LOP B;  3TVV A;  4DXA B;  2KGX B;  5FI0 A;  2DN6 A;  4DX8 A;  3TFM A;  1WGQ A;  2GCJ A;  1UNP A;  2DHK A;  3ULB A;  2I1K A;  1W1D A;  2M14 A;  2M38 A;  1K5G B;  5HE3 A;  3U7D A;  2R0D A;  2D9X A;  2R09 A;  2MKR A;  1DYN A;  1U5D A;  1TQZ A;  1BAK A;  5DHF B;  4EKU A;  1WGU A;  2IFS A;  1RJ2 A;  3HQC A;  3BIN A;  2D11 A;  1U27 A;  3PP2 A;  2ROV A;  3DXD A;  4GZU A;  1XX0 A;  5L81 A;  3QWM A;  1EF1 A;  1ZC3 B;  1J0W A;  2K2J A;  2G35 A;  3SNH A;  3KRX A;  2LOZ A;  1MKE A;  2FJL A;  4PNK A;  3PSC A;  3KZ1 A;  1U2B A;  2EMS A;  4K81 A;  1DRO A;  1Z87 A;  2J0M A;  1V5P A;  3T06 A;  2L1C A;  1U29 A;  4A6F A;  1NTY A;  1WJM A;  1WG7 A;  4HHV A;  4WVF B;  1NTV A;  2UZS A;  3ML4 A;  2D9Y A;  4A6H A;  2H7D A;  2RNR B;  3P6A A;  4KAX B;  1DBH A;  3AU5 A;  1AWE A;  4TYZ A;  2DKP A;  4HAX B;  4P7I A;  2COD A;  3F0W A;  1EAZ A;  4DX9 0;  4K2O A;  2W2W A;  4XWX A;  4K2P A;  3IVF A;  2VKI A;  2HE7 A;  4GMV A;  5KQ1 A;  2W2X D;  4K17 A;  2RLO A;  4KHO A;  4IAP A;  2D9W A;  1LW3 A;  2YSZ A;  1I2H A;  2Z0Q A;  3SUZ A;  1WI1 A;  2YS5 A;  2ADZ A;  1V5M A;  4HAZ B;  4F7U P;  4Z2N A;  3N7C A;  2DYN A;  1KI1 B;  1ZVR A;  4GMX B;  4HAU B;  1OY2 A;  2MDX A;  2IYB A;  3AU4 A;  1OMW A;  2VSZ A;  2AEH A;  1WVH A;  3HK0 A;  2GJY A;  2D9V A;  2YS1 A;  1FHO A;  1U5F A;  1W1H A;  4CHM A;  2UVM A;  3UZT A;  3CIK A;  5C16 A;  2YS3 A;  2YRY A;  3PEG A;  3U8Z A;  2XQN M;  4HAV B;  5D3X A;  4PQ0 A;  2LYD A;  3PVW A;  1FB8 A;  1U5G A;  2RVB B;  1Q67 A;  2Q13 A;  4MT7 A;  4ZRI A;  1V88 A;  5KCV A;  1XR0 B;  1U5E A;  2D4Q A;  1I7A A;  5JP4 A;  5EFX A;  1RRP B;  2COA A;  3VOQ A;  3WYF B;  5HE2 A;  5C5B A;  2VRW B;  1H10 A;  1NU2 A;  4HB3 B;  5C6R A;  1V5U A;  1SGH A;  1LB1 A;  3A8P A;  1FAO A;  2ZPY A;  1P3R A;  3CXB B;  1M7E A;  2QKL A;  1W1G A;  1BTK A;  1OQN A;  1XOD A;  1PFJ A;  1MK7 B;  4YL8 A;  1ZSQ A;  1SHC A;  2HTH B;  2ELB A;  3GYO A;  1B55 A;  3RCP A;  3PZD A;  1MPH A;  1X86 A;  2AL6 A;  4HAW B;  2KCJ A;  1GG3 A;  5CLQ B;  1XKE A;  4A6F B;  4C0A A;  4B6H A;  3ODW A;  1DDV A;  2CRF A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...