4HB2B

Crystal structure of crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
129
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb2B00
2UZSA 1W1HA 1OMWA 1MIZB 3F5RA 1U5DA 1ISNA 1X1FA 4IAPA 3LJUX 2MFQA 4A6HA 2D2QA 1EGXA 2QKMA 2Z0OA 2DHIA 4WJ7A 1EVHA 3FSSA 4GZUA 2COCA 1Q67A 2CAYA 1X11A 2COAA 4K2PA 3TVVA 2EC1A 2EMSA 2R0DA 4HAUB 4NSWA 2P0HA 3OANA 3A8QA 1ZC4B 3WYFB 2YT1A 5KQ4A 3UZTA 1AWEA 1WVHA 3D8EA 3AU4A 3TFMA 4GN1A 1X86A 2J0KA 4KVGB 2W2WA 3SUZA 2LOZA 1DDMA 3QBVB 2DX5A 4DBBA 3X23A 4EMOA 5KQ1A 2LULA 2K00A 1FHWA 3FM8C 4EJNA 5J3QA 3TO1A 1AQCA 2I5CA 3SYXA 4XWXA 4HAVB 5J3YA 2RGNB 2DA0A 1KZ7A 2MKRA 1N3HA 1WJ1A 3TCAA 1TXDA 3GYOA 4GMXB 2W2XD 1X05A 1SHCA 2X18A 2V76A 3KRXA 2Z0PA 4K2OA 5C16A 1EAZA 1V61A 5JHHA 1ZVRA 1EF1A 4HHVA 4K81A 1OQNA 4HATB 1WG7A 2P0DA 3ZVRA 4KHBB 1FGYA 2HE7A 3AU5A 1J0WA 2RNRB 1Y5OA 1XD4A 2D11A 1V89A 2LKOA 4PNKA 2Y8GA 4L6EA 4EKUA 1LW3A 2GCJA 1DROA 4HAWB 1U29A 2KCJA 1DYNA 1WGQA 5C5BB 1NI2A 2I1KA 1MAIA 2PZ1A 4GPTB 2L2IA 3PZDA 1WI1A 2BCJA 1UNQA 2XQNM 4CHJA 2Y8FA 5D3WA 3RCPA 4PQ0A 1TJ6A 2RSGA 1BTKA 2D9YA 3D8DA 3TW1A 3WA0A 4GXBA 1J19A 4HAZB 2YSZA 2DYQA 5DI9B 1FHOA 2GS0A 3DXEA 4IFSA 5HE0A 4HB3B 2N0YA 5C6RA 1XKEA 2CODA 3DXDA 1UEFA 1U5GA 5DHAB 2UVMA 4HDOA 1ZM0A 5FI1A 3PG7A 4YL8A 2EJ8A 4HB2B 2OTXA 2J0JA 5D3YA 1FOEA 1UNPA 1M7EA 1H4RA 5EFXA 1MKEA 1K5GB 2DKQA 3ULCA 3PSCA 1K5DB 5HE1A 5HE2A 2COFA 5FI0A 2UZRA 3ZDTA 1E5WA 3MPXA 5DIFB 3VIAA 1QC6A 1ZSQA 2CY4A 2E2XA 1KI1B 5C5BA 2MDXA 2H7DA 4ZRJA 1MPHA 1QQGA 1GC7A 2CRFA 2DYNA 4WSFA 1UNRA 2D10A 3VOQA 2Z0QA 4KHAA 1IRSA 2JP2A 3FEHA 4IOYX 4D0NB 3F0WA 1V88A 3ML4A 1I7AA 1DBHA 4CYEA 1Z87A 1FB8A 2DX1A 4A6FA 4TKNA 2QKLA 2M14A 3MDBC 3A8PA 5JLJB 2ADZA 1RJ2A 2VRWB 3KSYA 5D3VA 1B55A 3SV1A 4CHMA 1U2BA 1KZGA 3QIJA 2CY5A 4HAYB 3DXCA 1I2HA 2HTHB 2DHJA 2KUPA 2P0FA 4DX90 3QWMA 4MK0A 1MK7B 2R09A 3NSUA 2YS1A 3PEGA 2K2UA 2RUKB 2I5FA 1U27A 1LB1A 4WVFB 1P6SA 3SO6A 2NZ8B 2ELBA 2DLWA 3CXBB 3KZ1A 2D9XA 2YT0A 5KCVA 2I1JA 4ZRIA 2G35A 2YS5A 5GOWB 3HW2B 3P7ZA 2DHKA 4F7HA 3ULBA 5LONB 4F7UP 1U5FA 4HB0B 1PLSA 3KY9A 3PVUA 4K17A 4DX8A 2YRYA 4A6FB 5J3TA 1WGUA 1PMSA 1NU2A 1BAKA 1M7RA 1DDWA 2L1CA 2M38A 1XR0B 1DDVA 1NTVA 2RLOA 4MT7A 4ZRKA 4F7GA 1W1GA 3D8FA 3PP2A 3A98B 2VKIA 1P5TA 2D9WA 2EMTA 2MWNB 3GYPA 2YS3A 4YONA 1SGHA 2D4QA 2YF0A 1UPQA 4HB4B 1W1DA 2DTCA 3ODWA 2GCLA 1U5EA 4C0AA 2KGXB 5JHGA 2AL6A 2LG1A 5DH9B 1FGZA 4HAXB 5CLLB 5LOPB 3KRWA 1V5PA 4TYZA 5DHFB 3U7DA 1ZC3B 1V5MA 3U8ZA 2K2JA 2J59M 1H10A 2W2XC 3G9WA 2GJYA 1GC6A 2FJLA 2Y7BA 1BWNA 2VSZA 1BTNA 2LYDA 2N23A 2ROVA 2ELAA 1RRPB 1FHXA 2IFSA 1MIXA 3HK0A 2H7EA 3V5WA 4BBKA 3AJ4A 2LOXA 2AEHA 5D3XA 2D9VA 2J0MA 3O96A 4KHOA 2DFKA 2NMBA 1X1GA 1FAOA 4DXAB 2OQBA 5CLQB 2D9ZA 3SNHA 4A5KA 2P8VA 3CIKA 1UPRA 1V5UA 3HQCA 1OY2A 2DKPA 4Y94A 2RVBB 5JP4A 2YVCA 1XCGA 3P6AA 4Z2NA 4HDQA 2DN6A 4Z2MB 1WJMA 1TQZA 3ODXA 4GMVA 3M1IB 1Y19B 4B6HA 2ROZB 5C79A 4P7IA 5L81A 3IVFA 3PVLA 3T06A 3BINA 5D27A 4KAXB 3PVWA 3ODOA 1XODA 1GG3A 2IYBA 3BJIA 1MK9B 1NTYA 4MY6A 1PFJA 2Q13A 5HE3A 4A6KA 4NY0A 3N7CA 4H8SA 2ZPYA 1XX0A 1P3RA
chains in the Genus database with same CATH superfamily
2UZSA 1W1HA 1OMWA 1MIZB 3F5RA 1U5DA 1ISNA 1X1FA 4IAPA 3LJUX 2MFQA 4A6HA 4HSIA 2D2QA 1EGXA 2QKMA 2Z0OA 3DCXA 2DHIA 4WJ7A 1EVHA 3FSSA 4GZUA 2COCA 4QJ3B 1Q67A 2CAYA 1X11A 2COAA 4K2PA 3TVVA 2EC1A 2EMSA 2R0DA 4HAUB 4NSWA 2P0HA 3OANA 3A8QA 4GOUA 1ZC4B 2KR0A 2YT1A 3WYFB 5KQ4A 3UZTA 4QJ5B 1AWEA 1WVHA 3D8EA 3AU4A 5I2MA 3TFMA 4GN1A 1X86A 2J0KA 2KIGA 4OSNA 4KVGB 2W2WA 3SUZA 2LOZA 1DDMA 3QBVB 1T77A 2DX5A 4DBBA 3X23A 4EMOA 5KQ1A 2LULA 2K00A 1FHWA 3FM8C 4EJNA 5M4YB 5J3QA 3TO1A 2K8EA 1AQCA 2GUMA 2I5CA 3SYXA 4XWXA 4HAVB 5J3YA 2RGNB 4OT1A 2DA0A 1KZ7A 2MKRA 1N3HA 4L1RA 1WJ1A 3TCAA 1TXDA 3GYOA 4GMXB 2W2XD 1X05A 1SHCA 2X18A 2V76A 3KRXA 2Z0PA 4K2OA 5C16A 1EAZA 1V61A 5JHHA 1ZVRA 1EF1A 4HHVA 4K81A 1OQNA 4HATB 1WG7A 2P0DA 3ZVRA 4KHBB 1FGYA 2HE7A 3AU5A 1J0WA 2RNRB 1Y5OA 1XD4A 3NWFA 2D11A 1V89A 2LKOA 4PNKA 2Y8GA 4L6EA 4EKUA 1LW3A 2GCJA 1DROA 4HAWB 1U29A 2KCJA 1DYNA 1WGQA 2KIEA 5C5BB 1NI2A 2I1KA 1MAIA 3FVCA 2PZ1A 4GPTB 2L2IA 3PZDA 1WI1A 2KUQA 2BCJA 1UNQA 2XQNM 4CHJA 2Y8FA 5D3WA 3RCPA 4PQ0A 1TJ6A 2RSGA 1BTKA 2D9YA 3D8DA 4GNKB 3TW1A 3WA0A 4GXBA 1J19A 4HAZB 2YSZA 2DYQA 5DI9B 1FHOA 2GS0A 3DXEA 4IFSA 5HE0A 4HB3B 2N0YA 5C6RA 1XKEA 2CODA 3DXDA 1UEFA 1U5GA 5DHAB 2UVMA 4HDOA 1ZM0A 5FI1A 3PG7A 4YL8A 2Z4DA 2EJ8A 4HB2B 2OTXA 2J0JA 5D3YA 2RRFA 1FOEA 5IRSA 4KHBA 1UNPA 1M7EA 1H4RA 1MI1A 5EFXA 1MKEA 1K5GB 2DKQA 3ULCA 3PSCA 1K5DB 5HE1A 5HE2A 2COFA 2ZKMX 5FI0A 2UZRA 3ZDTA 1E5WA 3MPXA 5DIFB 3VIAA 1QC6A 1ZSQA 2CY4A 2E2XA 2Z59A 1KI1B 2FJUB 5C5BA 2MDXA 2H7DA 4ZRJA 1MPHA 1QQGA 1GC7A 2CRFA 2DYNA 4WSFA 1UNRA 2D10A 3VOQA 2Z0QA 4KHAA 1IRSA 2JP2A 3FEHA 4IOYX 4D0NB 3F0WA 1V88A 3ML4A 4D6WA 1I7AA 1DBHA 4CYEA 1Z87A 1FB8A 2DX1A 3B77A 4A6FA 4TKNA 2QKLA 5LG4B 2M14A 3MDBC 3A8PA 5JLJB 2ADZA 1RJ2A 2VRWB 3KSYA 5D3VA 1B55A 3SV1A 4CHMA 1U2BA 3NW8A 1KZGA 3QIJA 2CY5A 4HAYB 3DXCA 1I2HA 2HTHB 1ZYIA 2DHJA 2KUPA 2P0FA 4DX90 3QWMA 4MK0A 1MK7B 2R09A 3NSUA 2YS1A 3PEGA 2K2UA 2RUKB 2I5FA 1U27A 1LB1A 4WVFB 1P6SA 3SO6A 2NZ8B 2ELBA 2DLWA 3CXBB 3KZ1A 2D9XA 2YT0A 5KCVA 2I1JA 4ZRIA 2G35A 2YS5A 5GOWB 3HW2B 3P7ZA 4CSQA 2DHKA 4F7HA 3NWDA 3ULBA 5LONB 4F7UP 1U5FA 4HB0B 1PLSA 3KY9A 3PVUA 4K17A 4DX8A 2YRYA 4A6FB 5J3TA 1WGUA 1PMSA 1NU2A 1BAKA 1M7RA 1DDWA 2L1CA 2M38A 1XR0B 1DDVA 1NTVA 4QXAB 2RLOA 4MT7A 4ZRKA 4F7GA 1W1GA 3D8FA 3PP2A 3A98B 2VKIA 1P5TA 2YT2A 2D9WA 2EMTA 2MWNB 3GYPA 2YS3A 4YONA 1SGHA 2D4QA 2YF0A 1UPQA 4HB4B 1W1DA 2DTCA 3ODWA 2GCLA 1U5EA 4C0AA 2KGXB 5JHGA 2AL6A 2LG1A 5DH9B 1FGZA 4HAXB 5CLLB 5LOPB 3KRWA 1V5PA 4TYZA 5DHFB 3U7DA 1ZC3B 1V5MA 3U8ZA 2K2JA 2J59M 1H10A 2Z13A 2W2XC 3G9WA 2GJYA 1GC6A 2FJLA 2Y7BA 1BWNA 2VSZA 1BTNA 2LYDA 2N23A 2ROVA 2ELAA 1RRPB 1FHXA 2IFSA 1MIXA 3HK0A 2H7EA 3V5WA 4BBKA 3AJ4A 2LOXA 2AEHA 5D3XA 2D9VA 2Z14A 2J0MA 3O96A 4KHOA 2DFKA 2NMBA 1X1GA 1FAOA 4DXAB 2OQBA 5CLQB 2D9ZA 3SNHA 4A5KA 2P8VA 3CIKA 1UPRA 1V5UA 5I2SA 3HQCA 1OY2A 2DKPA 4Y94A 3A58A 2RVBB 5JP4A 2YVCA 3HIEA 1XCGA 3P6AA 4Z2NA 4HDQA 2DN6A 4Z2MB 1WJMA 1TQZA 2K49A 3ODXA 3NWAA 4GMVA 3M1IB 1Y19B 4B6HA 4DIXA 2ROZB 5C79A 4P7IA 5L81A 3IVFA 3PVLA 3T06A 2NBVA 3BINA 3U12A 2R2YA 5D27A 3HSAA 4KAXB 3PVWA 3ODOA 1XODA 1GG3A 2IYBA 3BJIA 1MK9B 1NTYA 4QJ4B 4MY6A 1PFJA 2Q13A 3OHMB 5HE3A 4A6KA 4NY0A 3N7CA 4H8SA 2ZPYA 1XX0A 1P3RA
chains in the Genus database with same CATH topology
2UZSA 1W1HA 1OMWA 1MIZB 3F5RA 1U5DA 1ISNA 1X1FA 4IAPA 3LJUX 2MFQA 4A6HA 2D2QA 1EGXA 2QKMA 2Z0OA 2DHIA 4WJ7A 1EVHA 3FSSA 4GZUA 2COCA 1Q67A 2CAYA 1X11A 2COAA 4K2PA 3TVVA 2EC1A 2EMSA 2R0DA 4HAUB 4NSWA 2P0HA 3OANA 3A8QA 1ZC4B 3WYFB 2YT1A 5KQ4A 3UZTA 1AWEA 1WVHA 3D8EA 3AU4A 3TFMA 4GN1A 1X86A 2J0KA 4KVGB 2W2WA 3SUZA 2LOZA 1DDMA 3QBVB 2DX5A 4DBBA 3X23A 4EMOA 5KQ1A 2LULA 2K00A 1FHWA 3FM8C 4EJNA 5J3QA 3TO1A 1AQCA 2I5CA 3SYXA 4XWXA 4HAVB 5J3YA 2RGNB 2DA0A 1KZ7A 2MKRA 1N3HA 1WJ1A 3TCAA 1TXDA 3GYOA 4GMXB 2W2XD 1X05A 1SHCA 2X18A 2V76A 3KRXA 2Z0PA 4K2OA 5C16A 1EAZA 1V61A 5JHHA 1ZVRA 1EF1A 4HHVA 4K81A 1OQNA 4HATB 1WG7A 2P0DA 3ZVRA 4KHBB 1FGYA 2HE7A 3AU5A 1J0WA 2RNRB 1Y5OA 1XD4A 2D11A 1V89A 2LKOA 4PNKA 2Y8GA 4L6EA 4EKUA 1LW3A 2GCJA 1DROA 4HAWB 1U29A 2KCJA 1DYNA 1WGQA 5C5BB 1NI2A 2I1KA 1MAIA 2PZ1A 4GPTB 2L2IA 3PZDA 1WI1A 2BCJA 1UNQA 2XQNM 4CHJA 2Y8FA 5D3WA 3RCPA 4PQ0A 1TJ6A 2RSGA 1BTKA 2D9YA 3D8DA 3TW1A 3WA0A 4GXBA 1J19A 4HAZB 2YSZA 2DYQA 5DI9B 1FHOA 2GS0A 3DXEA 4IFSA 5HE0A 4HB3B 2N0YA 5C6RA 1XKEA 2CODA 3DXDA 1UEFA 1U5GA 5DHAB 2UVMA 4HDOA 1ZM0A 5FI1A 3PG7A 4YL8A 2EJ8A 4HB2B 2OTXA 2J0JA 5D3YA 1FOEA 1UNPA 1M7EA 1H4RA 5EFXA 1MKEA 1K5GB 2DKQA 3ULCA 3PSCA 1K5DB 5HE1A 5HE2A 2COFA 5FI0A 2UZRA 3ZDTA 1E5WA 3MPXA 5DIFB 3VIAA 1QC6A 1ZSQA 2CY4A 2E2XA 1KI1B 5C5BA 2MDXA 2H7DA 4ZRJA 1MPHA 1QQGA 1GC7A 2CRFA 2DYNA 4WSFA 1UNRA 2D10A 3VOQA 2Z0QA 4KHAA 1IRSA 2JP2A 3FEHA 4IOYX 4D0NB 3F0WA 1V88A 3ML4A 1I7AA 1DBHA 4CYEA 1Z87A 1FB8A 2DX1A 4A6FA 4TKNA 2QKLA 2M14A 3MDBC 3A8PA 5JLJB 2ADZA 1RJ2A 2VRWB 3KSYA 5D3VA 1B55A 3SV1A 4CHMA 1U2BA 1KZGA 3QIJA 2CY5A 4HAYB 3DXCA 1I2HA 2HTHB 2DHJA 2KUPA 2P0FA 4DX90 3QWMA 4MK0A 1MK7B 2R09A 3NSUA 2YS1A 3PEGA 2K2UA 2RUKB 2I5FA 1U27A 1LB1A 4WVFB 1P6SA 3SO6A 2NZ8B 2ELBA 2DLWA 3CXBB 3KZ1A 2D9XA 2YT0A 5KCVA 2I1JA 4ZRIA 2G35A 2YS5A 5GOWB 3HW2B 3P7ZA 2DHKA 4F7HA 3ULBA 5LONB 4F7UP 1U5FA 4HB0B 1PLSA 3KY9A 3PVUA 4K17A 4DX8A 2YRYA 4A6FB 5J3TA 1WGUA 1PMSA 1NU2A 1BAKA 1M7RA 1DDWA 2L1CA 2M38A 1XR0B 1DDVA 1NTVA 2RLOA 4MT7A 4ZRKA 4F7GA 1W1GA 3D8FA 3PP2A 3A98B 2VKIA 1P5TA 2D9WA 2EMTA 2MWNB 3GYPA 2YS3A 4YONA 1SGHA 2D4QA 2YF0A 1UPQA 4HB4B 1W1DA 2DTCA 3ODWA 2GCLA 1U5EA 4C0AA 2KGXB 5JHGA 2AL6A 2LG1A 5DH9B 1FGZA 4HAXB 5CLLB 5LOPB 3KRWA 1V5PA 4TYZA 5DHFB 3U7DA 1ZC3B 1V5MA 3U8ZA 2K2JA 2J59M 1H10A 2W2XC 3G9WA 2GJYA 1GC6A 2FJLA 2Y7BA 1BWNA 2VSZA 1BTNA 2LYDA 2N23A 2ROVA 2ELAA 1RRPB 1FHXA 2IFSA 1MIXA 3HK0A 2H7EA 3V5WA 4BBKA 3AJ4A 2LOXA 2AEHA 5D3XA 2D9VA 2J0MA 3O96A 4KHOA 2DFKA 2NMBA 1X1GA 1FAOA 4DXAB 2OQBA 5CLQB 2D9ZA 3SNHA 4A5KA 2P8VA 3CIKA 1UPRA 1V5UA 3HQCA 1OY2A 2DKPA 4Y94A 2RVBB 5JP4A 2YVCA 1XCGA 3P6AA 4Z2NA 4HDQA 2DN6A 4Z2MB 1WJMA 1TQZA 3ODXA 4GMVA 3M1IB 1Y19B 4B6HA 2ROZB 5C79A 4P7IA 5L81A 3IVFA 3PVLA 3T06A 3BINA 5D27A 4KAXB 3PVWA 3ODOA 1XODA 1GG3A 2IYBA 3BJIA 1MK9B 1NTYA 4MY6A 1PFJA 2Q13A 5HE3A 4A6KA 4NY0A 3N7CA 4H8SA 2ZPYA 1XX0A 1P3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZS A;  1W1H A;  1OMW A;  1MIZ B;  3F5R A;  1U5D A;  1ISN A;  1X1F A;  4IAP A;  3LJU X;  2MFQ A;  4A6H A;  2D2Q A;  1EGX A;  2QKM A;  2Z0O A;  2DHI A;  4WJ7 A;  1EVH A;  3FSS A;  4GZU A;  2COC A;  1Q67 A;  2CAY A;  1X11 A;  2COA A;  4K2P A;  3TVV A;  2EC1 A;  2EMS A;  2R0D A;  4HAU B;  4NSW A;  2P0H A;  3OAN A;  3A8Q A;  1ZC4 B;  3WYF B;  2YT1 A;  5KQ4 A;  3UZT A;  1AWE A;  1WVH A;  3D8E A;  3AU4 A;  3TFM A;  4GN1 A;  1X86 A;  2J0K A;  4KVG B;  2W2W A;  3SUZ A;  2LOZ A;  1DDM A;  3QBV B;  2DX5 A;  4DBB A;  3X23 A;  4EMO A;  5KQ1 A;  2LUL A;  2K00 A;  1FHW A;  3FM8 C;  4EJN A;  5J3Q A;  3TO1 A;  1AQC A;  2I5C A;  3SYX A;  4XWX A;  4HAV B;  5J3Y A;  2RGN B;  2DA0 A;  1KZ7 A;  2MKR A;  1N3H A;  1WJ1 A;  3TCA A;  1TXD A;  3GYO A;  4GMX B;  2W2X D;  1X05 A;  1SHC A;  2X18 A;  2V76 A;  3KRX A;  2Z0P A;  4K2O A;  5C16 A;  1EAZ A;  1V61 A;  5JHH A;  1ZVR A;  1EF1 A;  4HHV A;  4K81 A;  1OQN A;  4HAT B;  1WG7 A;  2P0D A;  3ZVR A;  4KHB B;  1FGY A;  2HE7 A;  3AU5 A;  1J0W A;  2RNR B;  1Y5O A;  1XD4 A;  2D11 A;  1V89 A;  2LKO A;  4PNK A;  2Y8G A;  4L6E A;  4EKU A;  1LW3 A;  2GCJ A;  1DRO A;  4HAW B;  1U29 A;  2KCJ A;  1DYN A;  1WGQ A;  5C5B B;  1NI2 A;  2I1K A;  1MAI A;  2PZ1 A;  4GPT B;  2L2I A;  3PZD A;  1WI1 A;  2BCJ A;  1UNQ A;  2XQN M;  4CHJ A;  2Y8F A;  5D3W A;  3RCP A;  4PQ0 A;  1TJ6 A;  2RSG A;  1BTK A;  2D9Y A;  3D8D A;  3TW1 A;  3WA0 A;  4GXB A;  1J19 A;  4HAZ B;  2YSZ A;  2DYQ A;  5DI9 B;  1FHO A;  2GS0 A;  3DXE A;  4IFS A;  5HE0 A;  4HB3 B;  2N0Y A;  5C6R A;  1XKE A;  2COD A;  3DXD A;  1UEF A;  1U5G A;  5DHA B;  2UVM A;  4HDO A;  1ZM0 A;  5FI1 A;  3PG7 A;  4YL8 A;  2EJ8 A;  4HB2 B;  2OTX A;  2J0J A;  5D3Y A;  1FOE A;  1UNP A;  1M7E A;  1H4R A;  5EFX A;  1MKE A;  1K5G B;  2DKQ A;  3ULC A;  3PSC A;  1K5D B;  5HE1 A;  5HE2 A;  2COF A;  5FI0 A;  2UZR A;  3ZDT A;  1E5W A;  3MPX A;  5DIF B;  3VIA A;  1QC6 A;  1ZSQ A;  2CY4 A;  2E2X A;  1KI1 B;  5C5B A;  2MDX A;  2H7D A;  4ZRJ A;  1MPH A;  1QQG A;  1GC7 A;  2CRF A;  2DYN A;  4WSF A;  1UNR A;  2D10 A;  3VOQ A;  2Z0Q A;  4KHA A;  1IRS A;  2JP2 A;  3FEH A;  4IOY X;  4D0N B;  3F0W A;  1V88 A;  3ML4 A;  1I7A A;  1DBH A;  4CYE A;  1Z87 A;  1FB8 A;  2DX1 A;  4A6F A;  4TKN A;  2QKL A;  2M14 A;  3MDB C;  3A8P A;  5JLJ B;  2ADZ A;  1RJ2 A;  2VRW B;  3KSY A;  5D3V A;  1B55 A;  3SV1 A;  4CHM A;  1U2B A;  1KZG A;  3QIJ A;  2CY5 A;  4HAY B;  3DXC A;  1I2H A;  2HTH B;  2DHJ A;  2KUP A;  2P0F A;  4DX9 0;  3QWM A;  4MK0 A;  1MK7 B;  2R09 A;  3NSU A;  2YS1 A;  3PEG A;  2K2U A;  2RUK B;  2I5F A;  1U27 A;  1LB1 A;  4WVF B;  1P6S A;  3SO6 A;  2NZ8 B;  2ELB A;  2DLW A;  3CXB B;  3KZ1 A;  2D9X A;  2YT0 A;  5KCV A;  2I1J A;  4ZRI A;  2G35 A;  2YS5 A;  5GOW B;  3HW2 B;  3P7Z A;  2DHK A;  4F7H A;  3ULB A;  5LON B;  4F7U P;  1U5F A;  4HB0 B;  1PLS A;  3KY9 A;  3PVU A;  4K17 A;  4DX8 A;  2YRY A;  4A6F B;  5J3T A;  1WGU A;  1PMS A;  1NU2 A;  1BAK A;  1M7R A;  1DDW A;  2L1C A;  2M38 A;  1XR0 B;  1DDV A;  1NTV A;  2RLO A;  4MT7 A;  4ZRK A;  4F7G A;  1W1G A;  3D8F A;  3PP2 A;  3A98 B;  2VKI A;  1P5T A;  2D9W A;  2EMT A;  2MWN B;  3GYP A;  2YS3 A;  4YON A;  1SGH A;  2D4Q A;  2YF0 A;  1UPQ A;  4HB4 B;  1W1D A;  2DTC A;  3ODW A;  2GCL A;  1U5E A;  4C0A A;  2KGX B;  5JHG A;  2AL6 A;  2LG1 A;  5DH9 B;  1FGZ A;  4HAX B;  5CLL B;  5LOP B;  3KRW A;  1V5P A;  4TYZ A;  5DHF B;  3U7D A;  1ZC3 B;  1V5M A;  3U8Z A;  2K2J A;  2J59 M;  1H10 A;  2W2X C;  3G9W A;  2GJY A;  1GC6 A;  2FJL A;  2Y7B A;  1BWN A;  2VSZ A;  1BTN A;  2LYD A;  2N23 A;  2ROV A;  2ELA A;  1RRP B;  1FHX A;  2IFS A;  1MIX A;  3HK0 A;  2H7E A;  3V5W A;  4BBK A;  3AJ4 A;  2LOX A;  2AEH A;  5D3X A;  2D9V A;  2J0M A;  3O96 A;  4KHO A;  2DFK A;  2NMB A;  1X1G A;  1FAO A;  4DXA B;  2OQB A;  5CLQ B;  2D9Z A;  3SNH A;  4A5K A;  2P8V A;  3CIK A;  1UPR A;  1V5U A;  3HQC A;  1OY2 A;  2DKP A;  4Y94 A;  2RVB B;  5JP4 A;  2YVC A;  1XCG A;  3P6A A;  4Z2N A;  4HDQ A;  2DN6 A;  4Z2M B;  1WJM A;  1TQZ A;  3ODX A;  4GMV A;  3M1I B;  1Y19 B;  4B6H A;  2ROZ B;  5C79 A;  4P7I A;  5L81 A;  3IVF A;  3PVL A;  3T06 A;  3BIN A;  5D27 A;  4KAX B;  3PVW A;  3ODO A;  1XOD A;  1GG3 A;  2IYB A;  3BJI A;  1MK9 B;  1NTY A;  4MY6 A;  1PFJ A;  2Q13 A;  5HE3 A;  4A6K A;  4NY0 A;  3N7C A;  4H8S A;  2ZPY A;  1XX0 A;  1P3R A; 
#chains in the Genus database with same CATH topology
 2UZS A;  1W1H A;  1OMW A;  1MIZ B;  3F5R A;  1U5D A;  1ISN A;  1X1F A;  4IAP A;  3LJU X;  2MFQ A;  4A6H A;  4HSI A;  2D2Q A;  1EGX A;  2QKM A;  2Z0O A;  3DCX A;  2DHI A;  4WJ7 A;  1EVH A;  3FSS A;  4GZU A;  2COC A;  4QJ3 B;  1Q67 A;  2CAY A;  1X11 A;  2COA A;  4K2P A;  3TVV A;  2EC1 A;  2EMS A;  2R0D A;  4HAU B;  4NSW A;  2P0H A;  3OAN A;  3A8Q A;  4GOU A;  1ZC4 B;  2KR0 A;  2YT1 A;  3WYF B;  5KQ4 A;  3UZT A;  4QJ5 B;  1AWE A;  1WVH A;  3D8E A;  3AU4 A;  5I2M A;  3TFM A;  4GN1 A;  1X86 A;  2J0K A;  2KIG A;  4OSN A;  4KVG B;  2W2W A;  3SUZ A;  2LOZ A;  1DDM A;  3QBV B;  1T77 A;  2DX5 A;  4DBB A;  3X23 A;  4EMO A;  5KQ1 A;  2LUL A;  2K00 A;  1FHW A;  3FM8 C;  4EJN A;  5M4Y B;  5J3Q A;  3TO1 A;  2K8E A;  1AQC A;  2GUM A;  2I5C A;  3SYX A;  4XWX A;  4HAV B;  5J3Y A;  2RGN B;  4OT1 A;  2DA0 A;  1KZ7 A;  2MKR A;  1N3H A;  4L1R A;  1WJ1 A;  3TCA A;  1TXD A;  3GYO A;  4GMX B;  2W2X D;  1X05 A;  1SHC A;  2X18 A;  2V76 A;  3KRX A;  2Z0P A;  4K2O A;  5C16 A;  1EAZ A;  1V61 A;  5JHH A;  1ZVR A;  1EF1 A;  4HHV A;  4K81 A;  1OQN A;  4HAT B;  1WG7 A;  2P0D A;  3ZVR A;  4KHB B;  1FGY A;  2HE7 A;  3AU5 A;  1J0W A;  2RNR B;  1Y5O A;  1XD4 A;  3NWF A;  2D11 A;  1V89 A;  2LKO A;  4PNK A;  2Y8G A;  4L6E A;  4EKU A;  1LW3 A;  2GCJ A;  1DRO A;  4HAW B;  1U29 A;  2KCJ A;  1DYN A;  1WGQ A;  2KIE A;  5C5B B;  1NI2 A;  2I1K A;  1MAI A;  3FVC A;  2PZ1 A;  4GPT B;  2L2I A;  3PZD A;  1WI1 A;  2KUQ A;  2BCJ A;  1UNQ A;  2XQN M;  4CHJ A;  2Y8F A;  5D3W A;  3RCP A;  4PQ0 A;  1TJ6 A;  2RSG A;  1BTK A;  2D9Y A;  3D8D A;  4GNK B;  3TW1 A;  3WA0 A;  4GXB A;  1J19 A;  4HAZ B;  2YSZ A;  2DYQ A;  5DI9 B;  1FHO A;  2GS0 A;  3DXE A;  4IFS A;  5HE0 A;  4HB3 B;  2N0Y A;  5C6R A;  1XKE A;  2COD A;  3DXD A;  1UEF A;  1U5G A;  5DHA B;  2UVM A;  4HDO A;  1ZM0 A;  5FI1 A;  3PG7 A;  4YL8 A;  2Z4D A;  2EJ8 A;  4HB2 B;  2OTX A;  2J0J A;  5D3Y A;  2RRF A;  1FOE A;  5IRS A;  4KHB A;  1UNP A;  1M7E A;  1H4R A;  1MI1 A;  5EFX A;  1MKE A;  1K5G B;  2DKQ A;  3ULC A;  3PSC A;  1K5D B;  5HE1 A;  5HE2 A;  2COF A;  2ZKM X;  5FI0 A;  2UZR A;  3ZDT A;  1E5W A;  3MPX A;  5DIF B;  3VIA A;  1QC6 A;  1ZSQ A;  2CY4 A;  2E2X A;  2Z59 A;  1KI1 B;  2FJU B;  5C5B A;  2MDX A;  2H7D A;  4ZRJ A;  1MPH A;  1QQG A;  1GC7 A;  2CRF A;  2DYN A;  4WSF A;  1UNR A;  2D10 A;  3VOQ A;  2Z0Q A;  4KHA A;  1IRS A;  2JP2 A;  3FEH A;  4IOY X;  4D0N B;  3F0W A;  1V88 A;  3ML4 A;  4D6W A;  1I7A A;  1DBH A;  4CYE A;  1Z87 A;  1FB8 A;  2DX1 A;  3B77 A;  4A6F A;  4TKN A;  2QKL A;  5LG4 B;  2M14 A;  3MDB C;  3A8P A;  5JLJ B;  2ADZ A;  1RJ2 A;  2VRW B;  3KSY A;  5D3V A;  1B55 A;  3SV1 A;  4CHM A;  1U2B A;  3NW8 A;  1KZG A;  3QIJ A;  2CY5 A;  4HAY B;  3DXC A;  1I2H A;  2HTH B;  1ZYI A;  2DHJ A;  2KUP A;  2P0F A;  4DX9 0;  3QWM A;  4MK0 A;  1MK7 B;  2R09 A;  3NSU A;  2YS1 A;  3PEG A;  2K2U A;  2RUK B;  2I5F A;  1U27 A;  1LB1 A;  4WVF B;  1P6S A;  3SO6 A;  2NZ8 B;  2ELB A;  2DLW A;  3CXB B;  3KZ1 A;  2D9X A;  2YT0 A;  5KCV A;  2I1J A;  4ZRI A;  2G35 A;  2YS5 A;  5GOW B;  3HW2 B;  3P7Z A;  4CSQ A;  2DHK A;  4F7H A;  3NWD A;  3ULB A;  5LON B;  4F7U P;  1U5F A;  4HB0 B;  1PLS A;  3KY9 A;  3PVU A;  4K17 A;  4DX8 A;  2YRY A;  4A6F B;  5J3T A;  1WGU A;  1PMS A;  1NU2 A;  1BAK A;  1M7R A;  1DDW A;  2L1C A;  2M38 A;  1XR0 B;  1DDV A;  1NTV A;  4QXA B;  2RLO A;  4MT7 A;  4ZRK A;  4F7G A;  1W1G A;  3D8F A;  3PP2 A;  3A98 B;  2VKI A;  1P5T A;  2YT2 A;  2D9W A;  2EMT A;  2MWN B;  3GYP A;  2YS3 A;  4YON A;  1SGH A;  2D4Q A;  2YF0 A;  1UPQ A;  4HB4 B;  1W1D A;  2DTC A;  3ODW A;  2GCL A;  1U5E A;  4C0A A;  2KGX B;  5JHG A;  2AL6 A;  2LG1 A;  5DH9 B;  1FGZ A;  4HAX B;  5CLL B;  5LOP B;  3KRW A;  1V5P A;  4TYZ A;  5DHF B;  3U7D A;  1ZC3 B;  1V5M A;  3U8Z A;  2K2J A;  2J59 M;  1H10 A;  2Z13 A;  2W2X C;  3G9W A;  2GJY A;  1GC6 A;  2FJL A;  2Y7B A;  1BWN A;  2VSZ A;  1BTN A;  2LYD A;  2N23 A;  2ROV A;  2ELA A;  1RRP B;  1FHX A;  2IFS A;  1MIX A;  3HK0 A;  2H7E A;  3V5W A;  4BBK A;  3AJ4 A;  2LOX A;  2AEH A;  5D3X A;  2D9V A;  2Z14 A;  2J0M A;  3O96 A;  4KHO A;  2DFK A;  2NMB A;  1X1G A;  1FAO A;  4DXA B;  2OQB A;  5CLQ B;  2D9Z A;  3SNH A;  4A5K A;  2P8V A;  3CIK A;  1UPR A;  1V5U A;  5I2S A;  3HQC A;  1OY2 A;  2DKP A;  4Y94 A;  3A58 A;  2RVB B;  5JP4 A;  2YVC A;  3HIE A;  1XCG A;  3P6A A;  4Z2N A;  4HDQ A;  2DN6 A;  4Z2M B;  1WJM A;  1TQZ A;  2K49 A;  3ODX A;  3NWA A;  4GMV A;  3M1I B;  1Y19 B;  4B6H A;  4DIX A;  2ROZ B;  5C79 A;  4P7I A;  5L81 A;  3IVF A;  3PVL A;  3T06 A;  2NBV A;  3BIN A;  3U12 A;  2R2Y A;  5D27 A;  3HSA A;  4KAX B;  3PVW A;  3ODO A;  1XOD A;  1GG3 A;  2IYB A;  3BJI A;  1MK9 B;  1NTY A;  4QJ4 B;  4MY6 A;  1PFJ A;  2Q13 A;  3OHM B;  5HE3 A;  4A6K A;  4NY0 A;  3N7C A;  4H8S A;  2ZPY A;  1XX0 A;  1P3R A; 
#chains in the Genus database with same CATH homology
 2UZS A;  1W1H A;  1OMW A;  1MIZ B;  3F5R A;  1U5D A;  1ISN A;  1X1F A;  4IAP A;  3LJU X;  2MFQ A;  4A6H A;  2D2Q A;  1EGX A;  2QKM A;  2Z0O A;  2DHI A;  4WJ7 A;  1EVH A;  3FSS A;  4GZU A;  2COC A;  1Q67 A;  2CAY A;  1X11 A;  2COA A;  4K2P A;  3TVV A;  2EC1 A;  2EMS A;  2R0D A;  4HAU B;  4NSW A;  2P0H A;  3OAN A;  3A8Q A;  1ZC4 B;  3WYF B;  2YT1 A;  5KQ4 A;  3UZT A;  1AWE A;  1WVH A;  3D8E A;  3AU4 A;  3TFM A;  4GN1 A;  1X86 A;  2J0K A;  4KVG B;  2W2W A;  3SUZ A;  2LOZ A;  1DDM A;  3QBV B;  2DX5 A;  4DBB A;  3X23 A;  4EMO A;  5KQ1 A;  2LUL A;  2K00 A;  1FHW A;  3FM8 C;  4EJN A;  5J3Q A;  3TO1 A;  1AQC A;  2I5C A;  3SYX A;  4XWX A;  4HAV B;  5J3Y A;  2RGN B;  2DA0 A;  1KZ7 A;  2MKR A;  1N3H A;  1WJ1 A;  3TCA A;  1TXD A;  3GYO A;  4GMX B;  2W2X D;  1X05 A;  1SHC A;  2X18 A;  2V76 A;  3KRX A;  2Z0P A;  4K2O A;  5C16 A;  1EAZ A;  1V61 A;  5JHH A;  1ZVR A;  1EF1 A;  4HHV A;  4K81 A;  1OQN A;  4HAT B;  1WG7 A;  2P0D A;  3ZVR A;  4KHB B;  1FGY A;  2HE7 A;  3AU5 A;  1J0W A;  2RNR B;  1Y5O A;  1XD4 A;  2D11 A;  1V89 A;  2LKO A;  4PNK A;  2Y8G A;  4L6E A;  4EKU A;  1LW3 A;  2GCJ A;  1DRO A;  4HAW B;  1U29 A;  2KCJ A;  1DYN A;  1WGQ A;  5C5B B;  1NI2 A;  2I1K A;  1MAI A;  2PZ1 A;  4GPT B;  2L2I A;  3PZD A;  1WI1 A;  2BCJ A;  1UNQ A;  2XQN M;  4CHJ A;  2Y8F A;  5D3W A;  3RCP A;  4PQ0 A;  1TJ6 A;  2RSG A;  1BTK A;  2D9Y A;  3D8D A;  3TW1 A;  3WA0 A;  4GXB A;  1J19 A;  4HAZ B;  2YSZ A;  2DYQ A;  5DI9 B;  1FHO A;  2GS0 A;  3DXE A;  4IFS A;  5HE0 A;  4HB3 B;  2N0Y A;  5C6R A;  1XKE A;  2COD A;  3DXD A;  1UEF A;  1U5G A;  5DHA B;  2UVM A;  4HDO A;  1ZM0 A;  5FI1 A;  3PG7 A;  4YL8 A;  2EJ8 A;  4HB2 B;  2OTX A;  2J0J A;  5D3Y A;  1FOE A;  1UNP A;  1M7E A;  1H4R A;  5EFX A;  1MKE A;  1K5G B;  2DKQ A;  3ULC A;  3PSC A;  1K5D B;  5HE1 A;  5HE2 A;  2COF A;  5FI0 A;  2UZR A;  3ZDT A;  1E5W A;  3MPX A;  5DIF B;  3VIA A;  1QC6 A;  1ZSQ A;  2CY4 A;  2E2X A;  1KI1 B;  5C5B A;  2MDX A;  2H7D A;  4ZRJ A;  1MPH A;  1QQG A;  1GC7 A;  2CRF A;  2DYN A;  4WSF A;  1UNR A;  2D10 A;  3VOQ A;  2Z0Q A;  4KHA A;  1IRS A;  2JP2 A;  3FEH A;  4IOY X;  4D0N B;  3F0W A;  1V88 A;  3ML4 A;  1I7A A;  1DBH A;  4CYE A;  1Z87 A;  1FB8 A;  2DX1 A;  4A6F A;  4TKN A;  2QKL A;  2M14 A;  3MDB C;  3A8P A;  5JLJ B;  2ADZ A;  1RJ2 A;  2VRW B;  3KSY A;  5D3V A;  1B55 A;  3SV1 A;  4CHM A;  1U2B A;  1KZG A;  3QIJ A;  2CY5 A;  4HAY B;  3DXC A;  1I2H A;  2HTH B;  2DHJ A;  2KUP A;  2P0F A;  4DX9 0;  3QWM A;  4MK0 A;  1MK7 B;  2R09 A;  3NSU A;  2YS1 A;  3PEG A;  2K2U A;  2RUK B;  2I5F A;  1U27 A;  1LB1 A;  4WVF B;  1P6S A;  3SO6 A;  2NZ8 B;  2ELB A;  2DLW A;  3CXB B;  3KZ1 A;  2D9X A;  2YT0 A;  5KCV A;  2I1J A;  4ZRI A;  2G35 A;  2YS5 A;  5GOW B;  3HW2 B;  3P7Z A;  2DHK A;  4F7H A;  3ULB A;  5LON B;  4F7U P;  1U5F A;  4HB0 B;  1PLS A;  3KY9 A;  3PVU A;  4K17 A;  4DX8 A;  2YRY A;  4A6F B;  5J3T A;  1WGU A;  1PMS A;  1NU2 A;  1BAK A;  1M7R A;  1DDW A;  2L1C A;  2M38 A;  1XR0 B;  1DDV A;  1NTV A;  2RLO A;  4MT7 A;  4ZRK A;  4F7G A;  1W1G A;  3D8F A;  3PP2 A;  3A98 B;  2VKI A;  1P5T A;  2D9W A;  2EMT A;  2MWN B;  3GYP A;  2YS3 A;  4YON A;  1SGH A;  2D4Q A;  2YF0 A;  1UPQ A;  4HB4 B;  1W1D A;  2DTC A;  3ODW A;  2GCL A;  1U5E A;  4C0A A;  2KGX B;  5JHG A;  2AL6 A;  2LG1 A;  5DH9 B;  1FGZ A;  4HAX B;  5CLL B;  5LOP B;  3KRW A;  1V5P A;  4TYZ A;  5DHF B;  3U7D A;  1ZC3 B;  1V5M A;  3U8Z A;  2K2J A;  2J59 M;  1H10 A;  2W2X C;  3G9W A;  2GJY A;  1GC6 A;  2FJL A;  2Y7B A;  1BWN A;  2VSZ A;  1BTN A;  2LYD A;  2N23 A;  2ROV A;  2ELA A;  1RRP B;  1FHX A;  2IFS A;  1MIX A;  3HK0 A;  2H7E A;  3V5W A;  4BBK A;  3AJ4 A;  2LOX A;  2AEH A;  5D3X A;  2D9V A;  2J0M A;  3O96 A;  4KHO A;  2DFK A;  2NMB A;  1X1G A;  1FAO A;  4DXA B;  2OQB A;  5CLQ B;  2D9Z A;  3SNH A;  4A5K A;  2P8V A;  3CIK A;  1UPR A;  1V5U A;  3HQC A;  1OY2 A;  2DKP A;  4Y94 A;  2RVB B;  5JP4 A;  2YVC A;  1XCG A;  3P6A A;  4Z2N A;  4HDQ A;  2DN6 A;  4Z2M B;  1WJM A;  1TQZ A;  3ODX A;  4GMV A;  3M1I B;  1Y19 B;  4B6H A;  2ROZ B;  5C79 A;  4P7I A;  5L81 A;  3IVF A;  3PVL A;  3T06 A;  3BIN A;  5D27 A;  4KAX B;  3PVW A;  3ODO A;  1XOD A;  1GG3 A;  2IYB A;  3BJI A;  1MK9 B;  1NTY A;  4MY6 A;  1PFJ A;  2Q13 A;  5HE3 A;  4A6K A;  4NY0 A;  3N7C A;  4H8S A;  2ZPY A;  1XX0 A;  1P3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...