4HB2B

Crystal structure of crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
129
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
total genus 34
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb2B00
2PZ1A 1ZM0A 2AL6A 4F7GA 3QBVB 3TW1A 5KQ4A 1WVHA 4A6FB 1DROA 4KAXB 1NTVA 1EAZA 3NSUA 1XODA 1GC7A 2EC1A 4F7UP 2DN6A 4GMXB 4HB3B 2RUKB 5HE2A 1XKEA 1ZC4B 4GN1A 1MKEA 3MPXA 4ZRKA 1XR0B 1MIXA 1ZSQA 3ULCA 4A6HA 2D2QA 4HAVB 1AQCA 2MKRA 3PG7A 1MK9B 1U5GA 4WJ7A 5HE1A 2DKPA 1IRSA 2D9XA 4EJNA 3A8PA 1V61A 2OQBA 2R0DA 3ML4A 2XQNM 2R09A 3SO6A 1UEFA 1KZ7A 2COAA 1SHCA 4GXBA 1Y5OA 1N3HA 3U7DA 1UPRA 1PLSA 2YS1A 2NZ8B 2GJYA 2P8VA 4HAWB 2DHKA 3TFMA 2G35A 5DIFB 1V89A 1U2BA 2LULA 1FHWA 1M7EA 2D4QA 1BAKA 2D11A 3CXBB 3PSCA 1V88A 3TCAA 2UVMA 2Y7BA 4HDOA 4F7HA 3MDBC 3KRWA 2K2UA 2HE7A 2QKLA 1DYNA 3F0WA 4DX90 3PVUA 4NSWA 3VOQA 1QC6A 3P6AA 1AWEA 1H4RA 1J19A 4MK0A 2K00A 1H10A 1PFJA 4EKUA 2YRYA 2RVBB 2J0JA 1FHXA 3CIKA 2YF0A 5J3TA 2YVCA 5KCVA 1J0WA 1XD4A 4KHOA 2CAYA 1I7AA 3HQCA 5JLJB 2Y8FA 1WI1A 2VRWB 4IOYX 5LONB 2ELBA 1FGYA 4HAUB 4IFSA 1W1DA 1XX0A 2KGXB 1NI2A 2DKQA 1MIZB 4A6KA 2RGNB 5FI1A 2DLWA 5C5BA 2YT1A 5JHGA 4HB2B 4H8SA 3SYXA 2BCJA 4BBKA 1LW3A 2RNRB 1KZGA 2I1KA 4HAZB 1P3RA 2I1JA 1NTYA 5GOWB 3M1IB 2DFKA 4IAPA 3PP2A 2UZSA 4GMVA 1TJ6A 2UZRA 2OTXA 2D9WA 1GG3A 2D9VA 3V5WA 1EVHA 1OQNA 3FEHA 3AJ4A 4K2OA 3FSSA 3SUZA 1BTKA 2D9YA 3RCPA 3DXCA 2MFQA 4HHVA 4GPTB 3ZDTA 2DX1A 1V5MA 2I5CA 4DX8A 1DDMA 2DYNA 3PVWA 2CODA 3LJUX 2GS0A 2ROZB 3SV1A 3ULBA 2IYBA 3DXEA 5HE3A 5LOPB 2W2XC 5EFXA 2ADZA 3UZTA 3IVFA 4L6EA 1LB1A 1P6SA 1WJMA 2LOZA 3TVVA 2N0YA 3N7CA 2L1CA 4Z2NA 1TQZA 1ZVRA 1BWNA 5C5BB 2YSZA 3ODXA 1WGQA 1OY2A 2J0MA 2W2XD 3KSYA 5D27A 2DTCA 4EMOA 4TKNA 2D9ZA 2LYDA 2M14A 1UPQA 1U5EA 2EMTA 2ROVA 4ZRIA 2EJ8A 1FAOA 2DA0A 1QQGA 1U5DA 1Q67A 1U5FA 3G9WA 4MT7A 4KVGB 1K5DB 4K81A 4D0NB 5JHHA 1TXDA 1E5WA 4KHBB 2COFA 5D3XA 3F5RA 1V5UA 3WA0A 3SNHA 2E2XA 3A98B 2D10A 5DHAB 5C6RA 4HDQA 1OMWA 1FHOA 3VIAA 3TO1A 5D3WA 4KHAA 2ELAA 4ZRJA 1WG7A 1K5GB 3GYPA 2W2WA 1U27A 3BINA 2YT0A 3D8DA 3BJIA 1X1FA 3OANA 1UNRA 5D3YA 1EGXA 2H7DA 3D8EA 4NY0A 2MDXA 1FOEA 3HK0A 1DBHA 3FM8C 2N23A 2J59M 2HTHB 2CY4A 5CLQB 2DHJA 1DDVA 2IFSA 2H7EA 4HB0B 2Z0QA 3KRXA 2ZPYA 1B55A 2VKIA 2X18A 3D8FA 2DX5A 4GZUA 1MPHA 3KZ1A 2NMBA 2GCJA 4HATB 4DBBA 3A8QA 4C0AA 4Y94A 1I2HA 1X05A 5KQ1A 1XCGA 4B6HA 1Y19B 1UNPA 3QIJA 3ODWA 1GC6A 5C79A 1BTNA 2P0FA 1WGUA 2DYQA 5HE0A 5JP4A 1W1HA 1NU2A 4HAXB 4WSFA 3WYFB 3U8ZA 2K2JA 3PZDA 1X1GA 1V5PA 4XWXA 2GCLA 1MAIA 2YS3A 2LG1A 4A6FA 3AU5A 5DI9B 2FJLA 1W1GA 1X11A 4WVFB 1DDWA 1M7RA 2M38A 4A5KA 3GYOA 4K2PA 2LKOA 2I5FA 5DH9B 1ISNA 2JP2A 5J3QA 4K17A 2EMSA 2Y8GA 2LOXA 2V76A 3T06A 1RJ2A 2DHIA 3ZVRA 2VSZA 3HW2B 2KUPA 4HB4B 2J0KA 2MWNB 3QWMA 2P0HA 4CHJA 3AU4A 4PNKA 1ZC3B 1EF1A 4YL8A 4P7IA 4PQ0A 4YONA 3DXDA 2Z0OA 5J3YA 4CYEA 3P7ZA 3KY9A 2P0DA 5CLLB 3O96A 5DHFB 4CHMA 4HAYB 2RSGA 3X23A 4Z2MB 5FI0A 3PEGA 5D3VA 5L81A 2Z0PA 1KI1B 1FGZA 1U29A 2COCA 2CY5A 1P5TA 1PMSA 1UNQA 2AEHA 2L2IA 1WJ1A 2Q13A 1Z87A 2KCJA 3ODOA 1RRPB 1MK7B 1X86A 2RLOA 3PVLA 2CRFA 5C16A 2YS5A 4DXAB 1SGHA 4MY6A 4TYZA 2QKMA 1FB8A
chains in the Genus database with same CATH superfamily
2PZ1A 1ZM0A 2AL6A 4F7GA 3QBVB 3TW1A 5KQ4A 1WVHA 4A6FB 1DROA 4KAXB 1NTVA 1EAZA 3NSUA 1XODA 1GC7A 2EC1A 4F7UP 2DN6A 4GMXB 4HB3B 2RUKB 5HE2A 1XKEA 1ZC4B 4GN1A 1MKEA 3MPXA 4ZRKA 1XR0B 1MIXA 1ZSQA 3ULCA 4A6HA 2D2QA 4HAVB 1AQCA 2MKRA 3PG7A 1MK9B 1U5GA 4WJ7A 5HE1A 2DKPA 1IRSA 2D9XA 4EJNA 3A8PA 1V61A 2OQBA 2R0DA 3ML4A 2XQNM 2R09A 3SO6A 1UEFA 1KZ7A 2COAA 4L1RA 1SHCA 4GXBA 1Y5OA 1N3HA 3U7DA 1UPRA 1PLSA 2YS1A 2NZ8B 2ZKMX 2GJYA 2P8VA 4HAWB 2DHKA 3TFMA 2G35A 5DIFB 1V89A 1U2BA 2LULA 4OT1A 1FHWA 1M7EA 2D4QA 1BAKA 2D11A 3CXBB 3PSCA 1V88A 3TCAA 2NBVA 2UVMA 2Y7BA 4HDOA 4F7HA 3MDBC 3KRWA 2Z14A 3B77A 2K2UA 2HE7A 1MI1A 2QKLA 1DYNA 3F0WA 4DX90 3PVUA 4OSNA 4HSIA 4NSWA 3VOQA 1QC6A 3P6AA 2KIGA 1AWEA 1H4RA 1J19A 4KHBA 4MK0A 2K00A 3DCXA 1H10A 1PFJA 4EKUA 2YRYA 2RVBB 2J0JA 1FHXA 4GOUA 3CIKA 2YF0A 5J3TA 2YVCA 5KCVA 1J0WA 1XD4A 4KHOA 2CAYA 1I7AA 3HQCA 5JLJB 2Y8FA 1WI1A 2VRWB 4IOYX 5LONB 2ELBA 1FGYA 4HAUB 4IFSA 1W1DA 1XX0A 2KGXB 1NI2A 2DKQA 1MIZB 4A6KA 2RGNB 5FI1A 2DLWA 5C5BA 2YT1A 5JHGA 4HB2B 4H8SA 3SYXA 2BCJA 4BBKA 1LW3A 2RNRB 5M4YB 1KZGA 2I1KA 4HAZB 4D6WA 1P3RA 2I1JA 1NTYA 5GOWB 3M1IB 2DFKA 4IAPA 3PP2A 2UZSA 4GMVA 1TJ6A 2UZRA 2OTXA 2D9WA 1GG3A 2D9VA 3V5WA 1EVHA 1OQNA 3FEHA 2Z4DA 3AJ4A 4K2OA 3FSSA 3SUZA 1BTKA 4GNKB 2D9YA 3RCPA 3DXCA 2MFQA 4HHVA 4GPTB 3ZDTA 2DX1A 2KIEA 1V5MA 2I5CA 4DX8A 1DDMA 2DYNA 3PVWA 2CODA 3LJUX 2GS0A 2ROZB 3SV1A 3ULBA 2IYBA 3DXEA 5HE3A 5LOPB 2W2XC 5EFXA 2ADZA 4DIXA 3UZTA 3HIEA 3IVFA 4L6EA 1LB1A 1P6SA 1WJMA 2LOZA 3TVVA 2YT2A 4QJ4B 2N0YA 3N7CA 2L1CA 4Z2NA 1TQZA 3FVCA 1ZVRA 1BWNA 5C5BB 2YSZA 3ODXA 1WGQA 1OY2A 2J0MA 2W2XD 3KSYA 5D27A 2DTCA 4EMOA 4TKNA 2D9ZA 2LYDA 2M14A 1UPQA 1U5EA 2EMTA 2KR0A 2ROVA 4ZRIA 2EJ8A 1FAOA 2DA0A 1QQGA 1U5DA 1Q67A 1U5FA 3G9WA 4MT7A 4KVGB 1K5DB 4K81A 4D0NB 5JHHA 1TXDA 1E5WA 4KHBB 4QJ5B 3NWFA 2COFA 5D3XA 3F5RA 1V5UA 3WA0A 3SNHA 2E2XA 3A98B 4QXAB 2D10A 5DHAB 5C6RA 4HDQA 1OMWA 1FHOA 3VIAA 3TO1A 5D3WA 4KHAA 2ELAA 4ZRJA 3NWDA 1WG7A 3OHMB 1K5GB 3GYPA 2W2WA 1U27A 3BINA 2YT0A 3D8DA 3BJIA 1X1FA 3OANA 1UNRA 5D3YA 1EGXA 2H7DA 3D8EA 4NY0A 2MDXA 1FOEA 3HK0A 1DBHA 3FM8C 2N23A 2J59M 2HTHB 3NWAA 2CY4A 5CLQB 2DHJA 1DDVA 2IFSA 2H7EA 4HB0B 2Z0QA 3KRXA 2ZPYA 4QJ3B 1B55A 2VKIA 2X18A 2K49A 3D8FA 2DX5A 4GZUA 1MPHA 3KZ1A 2NMBA 2GCJA 4HATB 4DBBA 3A8QA 2R2YA 4C0AA 4Y94A 1I2HA 1X05A 5KQ1A 1XCGA 4B6HA 1Y19B 1UNPA 3QIJA 3ODWA 1GC6A 5C79A 1BTNA 2P0FA 1WGUA 2DYQA 5HE0A 5JP4A 1W1HA 1NU2A 4HAXB 1ZYIA 4WSFA 3WYFB 3U8ZA 2K2JA 2GUMA 3PZDA 1X1GA 3NW8A 1V5PA 4XWXA 2GCLA 1MAIA 2YS3A 2LG1A 4A6FA 2KUQA 3AU5A 3HSAA 5DI9B 2FJLA 1W1GA 2K8EA 1X11A 4WVFB 1DDWA 1M7RA 2M38A 4A5KA 3GYOA 4K2PA 2LKOA 2I5FA 5DH9B 1ISNA 2JP2A 5J3QA 4K17A 2EMSA 2Y8GA 2LOXA 2V76A 3T06A 4CSQA 1RJ2A 2DHIA 3ZVRA 2VSZA 3HW2B 2KUPA 4HB4B 2J0KA 2MWNB 3QWMA 5LG4B 2P0HA 4CHJA 3AU4A 4PNKA 1ZC3B 1EF1A 4YL8A 4P7IA 4PQ0A 4YONA 2Z13A 3A58A 3DXDA 2Z0OA 5J3YA 1T77A 5I2SA 4CYEA 3P7ZA 3KY9A 2FJUB 2P0DA 5CLLB 3O96A 5DHFB 4CHMA 4HAYB 2RSGA 3X23A 4Z2MB 5FI0A 2RRFA 3PEGA 5IRSA 5D3VA 5L81A 2Z0PA 5I2MA 1KI1B 1FGZA 1U29A 2COCA 3U12A 2CY5A 1P5TA 1PMSA 1UNQA 2AEHA 2L2IA 1WJ1A 2Q13A 1Z87A 2KCJA 3ODOA 1RRPB 1MK7B 1X86A 2RLOA 3PVLA 2CRFA 5C16A 2YS5A 4DXAB 1SGHA 4MY6A 4TYZA 2QKMA 2Z59A 1FB8A
chains in the Genus database with same CATH topology
2PZ1A 1ZM0A 2AL6A 4F7GA 3QBVB 3TW1A 5KQ4A 1WVHA 4A6FB 1DROA 4KAXB 1NTVA 1EAZA 3NSUA 1XODA 1GC7A 2EC1A 4F7UP 2DN6A 4GMXB 4HB3B 2RUKB 5HE2A 1XKEA 1ZC4B 4GN1A 1MKEA 3MPXA 4ZRKA 1XR0B 1MIXA 1ZSQA 3ULCA 4A6HA 2D2QA 4HAVB 1AQCA 2MKRA 3PG7A 1MK9B 1U5GA 4WJ7A 5HE1A 2DKPA 1IRSA 2D9XA 4EJNA 3A8PA 1V61A 2OQBA 2R0DA 3ML4A 2XQNM 2R09A 3SO6A 1UEFA 1KZ7A 2COAA 1SHCA 4GXBA 1Y5OA 1N3HA 3U7DA 1UPRA 1PLSA 2YS1A 2NZ8B 2GJYA 2P8VA 4HAWB 2DHKA 3TFMA 2G35A 5DIFB 1V89A 1U2BA 2LULA 1FHWA 1M7EA 2D4QA 1BAKA 2D11A 3CXBB 3PSCA 1V88A 3TCAA 2UVMA 2Y7BA 4HDOA 4F7HA 3MDBC 3KRWA 2K2UA 2HE7A 2QKLA 1DYNA 3F0WA 4DX90 3PVUA 4NSWA 3VOQA 1QC6A 3P6AA 1AWEA 1H4RA 1J19A 4MK0A 2K00A 1H10A 1PFJA 4EKUA 2YRYA 2RVBB 2J0JA 1FHXA 3CIKA 2YF0A 5J3TA 2YVCA 5KCVA 1J0WA 1XD4A 4KHOA 2CAYA 1I7AA 3HQCA 5JLJB 2Y8FA 1WI1A 2VRWB 4IOYX 5LONB 2ELBA 1FGYA 4HAUB 4IFSA 1W1DA 1XX0A 2KGXB 1NI2A 2DKQA 1MIZB 4A6KA 2RGNB 5FI1A 2DLWA 5C5BA 2YT1A 5JHGA 4HB2B 4H8SA 3SYXA 2BCJA 4BBKA 1LW3A 2RNRB 1KZGA 2I1KA 4HAZB 1P3RA 2I1JA 1NTYA 5GOWB 3M1IB 2DFKA 4IAPA 3PP2A 2UZSA 4GMVA 1TJ6A 2UZRA 2OTXA 2D9WA 1GG3A 2D9VA 3V5WA 1EVHA 1OQNA 3FEHA 3AJ4A 4K2OA 3FSSA 3SUZA 1BTKA 2D9YA 3RCPA 3DXCA 2MFQA 4HHVA 4GPTB 3ZDTA 2DX1A 1V5MA 2I5CA 4DX8A 1DDMA 2DYNA 3PVWA 2CODA 3LJUX 2GS0A 2ROZB 3SV1A 3ULBA 2IYBA 3DXEA 5HE3A 5LOPB 2W2XC 5EFXA 2ADZA 3UZTA 3IVFA 4L6EA 1LB1A 1P6SA 1WJMA 2LOZA 3TVVA 2N0YA 3N7CA 2L1CA 4Z2NA 1TQZA 1ZVRA 1BWNA 5C5BB 2YSZA 3ODXA 1WGQA 1OY2A 2J0MA 2W2XD 3KSYA 5D27A 2DTCA 4EMOA 4TKNA 2D9ZA 2LYDA 2M14A 1UPQA 1U5EA 2EMTA 2ROVA 4ZRIA 2EJ8A 1FAOA 2DA0A 1QQGA 1U5DA 1Q67A 1U5FA 3G9WA 4MT7A 4KVGB 1K5DB 4K81A 4D0NB 5JHHA 1TXDA 1E5WA 4KHBB 2COFA 5D3XA 3F5RA 1V5UA 3WA0A 3SNHA 2E2XA 3A98B 2D10A 5DHAB 5C6RA 4HDQA 1OMWA 1FHOA 3VIAA 3TO1A 5D3WA 4KHAA 2ELAA 4ZRJA 1WG7A 1K5GB 3GYPA 2W2WA 1U27A 3BINA 2YT0A 3D8DA 3BJIA 1X1FA 3OANA 1UNRA 5D3YA 1EGXA 2H7DA 3D8EA 4NY0A 2MDXA 1FOEA 3HK0A 1DBHA 3FM8C 2N23A 2J59M 2HTHB 2CY4A 5CLQB 2DHJA 1DDVA 2IFSA 2H7EA 4HB0B 2Z0QA 3KRXA 2ZPYA 1B55A 2VKIA 2X18A 3D8FA 2DX5A 4GZUA 1MPHA 3KZ1A 2NMBA 2GCJA 4HATB 4DBBA 3A8QA 4C0AA 4Y94A 1I2HA 1X05A 5KQ1A 1XCGA 4B6HA 1Y19B 1UNPA 3QIJA 3ODWA 1GC6A 5C79A 1BTNA 2P0FA 1WGUA 2DYQA 5HE0A 5JP4A 1W1HA 1NU2A 4HAXB 4WSFA 3WYFB 3U8ZA 2K2JA 3PZDA 1X1GA 1V5PA 4XWXA 2GCLA 1MAIA 2YS3A 2LG1A 4A6FA 3AU5A 5DI9B 2FJLA 1W1GA 1X11A 4WVFB 1DDWA 1M7RA 2M38A 4A5KA 3GYOA 4K2PA 2LKOA 2I5FA 5DH9B 1ISNA 2JP2A 5J3QA 4K17A 2EMSA 2Y8GA 2LOXA 2V76A 3T06A 1RJ2A 2DHIA 3ZVRA 2VSZA 3HW2B 2KUPA 4HB4B 2J0KA 2MWNB 3QWMA 2P0HA 4CHJA 3AU4A 4PNKA 1ZC3B 1EF1A 4YL8A 4P7IA 4PQ0A 4YONA 3DXDA 2Z0OA 5J3YA 4CYEA 3P7ZA 3KY9A 2P0DA 5CLLB 3O96A 5DHFB 4CHMA 4HAYB 2RSGA 3X23A 4Z2MB 5FI0A 3PEGA 5D3VA 5L81A 2Z0PA 1KI1B 1FGZA 1U29A 2COCA 2CY5A 1P5TA 1PMSA 1UNQA 2AEHA 2L2IA 1WJ1A 2Q13A 1Z87A 2KCJA 3ODOA 1RRPB 1MK7B 1X86A 2RLOA 3PVLA 2CRFA 5C16A 2YS5A 4DXAB 1SGHA 4MY6A 4TYZA 2QKMA 1FB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  1ZM0 A;  2AL6 A;  4F7G A;  3QBV B;  3TW1 A;  5KQ4 A;  1WVH A;  4A6F B;  1DRO A;  4KAX B;  1NTV A;  1EAZ A;  3NSU A;  1XOD A;  1GC7 A;  2EC1 A;  4F7U P;  2DN6 A;  4GMX B;  4HB3 B;  2RUK B;  5HE2 A;  1XKE A;  1ZC4 B;  4GN1 A;  1MKE A;  3MPX A;  4ZRK A;  1XR0 B;  1MIX A;  1ZSQ A;  3ULC A;  4A6H A;  2D2Q A;  4HAV B;  1AQC A;  2MKR A;  3PG7 A;  1MK9 B;  1U5G A;  4WJ7 A;  5HE1 A;  2DKP A;  1IRS A;  2D9X A;  4EJN A;  3A8P A;  1V61 A;  2OQB A;  2R0D A;  3ML4 A;  2XQN M;  2R09 A;  3SO6 A;  1UEF A;  1KZ7 A;  2COA A;  1SHC A;  4GXB A;  1Y5O A;  1N3H A;  3U7D A;  1UPR A;  1PLS A;  2YS1 A;  2NZ8 B;  2GJY A;  2P8V A;  4HAW B;  2DHK A;  3TFM A;  2G35 A;  5DIF B;  1V89 A;  1U2B A;  2LUL A;  1FHW A;  1M7E A;  2D4Q A;  1BAK A;  2D11 A;  3CXB B;  3PSC A;  1V88 A;  3TCA A;  2UVM A;  2Y7B A;  4HDO A;  4F7H A;  3MDB C;  3KRW A;  2K2U A;  2HE7 A;  2QKL A;  1DYN A;  3F0W A;  4DX9 0;  3PVU A;  4NSW A;  3VOQ A;  1QC6 A;  3P6A A;  1AWE A;  1H4R A;  1J19 A;  4MK0 A;  2K00 A;  1H10 A;  1PFJ A;  4EKU A;  2YRY A;  2RVB B;  2J0J A;  1FHX A;  3CIK A;  2YF0 A;  5J3T A;  2YVC A;  5KCV A;  1J0W A;  1XD4 A;  4KHO A;  2CAY A;  1I7A A;  3HQC A;  5JLJ B;  2Y8F A;  1WI1 A;  2VRW B;  4IOY X;  5LON B;  2ELB A;  1FGY A;  4HAU B;  4IFS A;  1W1D A;  1XX0 A;  2KGX B;  1NI2 A;  2DKQ A;  1MIZ B;  4A6K A;  2RGN B;  5FI1 A;  2DLW A;  5C5B A;  2YT1 A;  5JHG A;  4HB2 B;  4H8S A;  3SYX A;  2BCJ A;  4BBK A;  1LW3 A;  2RNR B;  1KZG A;  2I1K A;  4HAZ B;  1P3R A;  2I1J A;  1NTY A;  5GOW B;  3M1I B;  2DFK A;  4IAP A;  3PP2 A;  2UZS A;  4GMV A;  1TJ6 A;  2UZR A;  2OTX A;  2D9W A;  1GG3 A;  2D9V A;  3V5W A;  1EVH A;  1OQN A;  3FEH A;  3AJ4 A;  4K2O A;  3FSS A;  3SUZ A;  1BTK A;  2D9Y A;  3RCP A;  3DXC A;  2MFQ A;  4HHV A;  4GPT B;  3ZDT A;  2DX1 A;  1V5M A;  2I5C A;  4DX8 A;  1DDM A;  2DYN A;  3PVW A;  2COD A;  3LJU X;  2GS0 A;  2ROZ B;  3SV1 A;  3ULB A;  2IYB A;  3DXE A;  5HE3 A;  5LOP B;  2W2X C;  5EFX A;  2ADZ A;  3UZT A;  3IVF A;  4L6E A;  1LB1 A;  1P6S A;  1WJM A;  2LOZ A;  3TVV A;  2N0Y A;  3N7C A;  2L1C A;  4Z2N A;  1TQZ A;  1ZVR A;  1BWN A;  5C5B B;  2YSZ A;  3ODX A;  1WGQ A;  1OY2 A;  2J0M A;  2W2X D;  3KSY A;  5D27 A;  2DTC A;  4EMO A;  4TKN A;  2D9Z A;  2LYD A;  2M14 A;  1UPQ A;  1U5E A;  2EMT A;  2ROV A;  4ZRI A;  2EJ8 A;  1FAO A;  2DA0 A;  1QQG A;  1U5D A;  1Q67 A;  1U5F A;  3G9W A;  4MT7 A;  4KVG B;  1K5D B;  4K81 A;  4D0N B;  5JHH A;  1TXD A;  1E5W A;  4KHB B;  2COF A;  5D3X A;  3F5R A;  1V5U A;  3WA0 A;  3SNH A;  2E2X A;  3A98 B;  2D10 A;  5DHA B;  5C6R A;  4HDQ A;  1OMW A;  1FHO A;  3VIA A;  3TO1 A;  5D3W A;  4KHA A;  2ELA A;  4ZRJ A;  1WG7 A;  1K5G B;  3GYP A;  2W2W A;  1U27 A;  3BIN A;  2YT0 A;  3D8D A;  3BJI A;  1X1F A;  3OAN A;  1UNR A;  5D3Y A;  1EGX A;  2H7D A;  3D8E A;  4NY0 A;  2MDX A;  1FOE A;  3HK0 A;  1DBH A;  3FM8 C;  2N23 A;  2J59 M;  2HTH B;  2CY4 A;  5CLQ B;  2DHJ A;  1DDV A;  2IFS A;  2H7E A;  4HB0 B;  2Z0Q A;  3KRX A;  2ZPY A;  1B55 A;  2VKI A;  2X18 A;  3D8F A;  2DX5 A;  4GZU A;  1MPH A;  3KZ1 A;  2NMB A;  2GCJ A;  4HAT B;  4DBB A;  3A8Q A;  4C0A A;  4Y94 A;  1I2H A;  1X05 A;  5KQ1 A;  1XCG A;  4B6H A;  1Y19 B;  1UNP A;  3QIJ A;  3ODW A;  1GC6 A;  5C79 A;  1BTN A;  2P0F A;  1WGU A;  2DYQ A;  5HE0 A;  5JP4 A;  1W1H A;  1NU2 A;  4HAX B;  4WSF A;  3WYF B;  3U8Z A;  2K2J A;  3PZD A;  1X1G A;  1V5P A;  4XWX A;  2GCL A;  1MAI A;  2YS3 A;  2LG1 A;  4A6F A;  3AU5 A;  5DI9 B;  2FJL A;  1W1G A;  1X11 A;  4WVF B;  1DDW A;  1M7R A;  2M38 A;  4A5K A;  3GYO A;  4K2P A;  2LKO A;  2I5F A;  5DH9 B;  1ISN A;  2JP2 A;  5J3Q A;  4K17 A;  2EMS A;  2Y8G A;  2LOX A;  2V76 A;  3T06 A;  1RJ2 A;  2DHI A;  3ZVR A;  2VSZ A;  3HW2 B;  2KUP A;  4HB4 B;  2J0K A;  2MWN B;  3QWM A;  2P0H A;  4CHJ A;  3AU4 A;  4PNK A;  1ZC3 B;  1EF1 A;  4YL8 A;  4P7I A;  4PQ0 A;  4YON A;  3DXD A;  2Z0O A;  5J3Y A;  4CYE A;  3P7Z A;  3KY9 A;  2P0D A;  5CLL B;  3O96 A;  5DHF B;  4CHM A;  4HAY B;  2RSG A;  3X23 A;  4Z2M B;  5FI0 A;  3PEG A;  5D3V A;  5L81 A;  2Z0P A;  1KI1 B;  1FGZ A;  1U29 A;  2COC A;  2CY5 A;  1P5T A;  1PMS A;  1UNQ A;  2AEH A;  2L2I A;  1WJ1 A;  2Q13 A;  1Z87 A;  2KCJ A;  3ODO A;  1RRP B;  1MK7 B;  1X86 A;  2RLO A;  3PVL A;  2CRF A;  5C16 A;  2YS5 A;  4DXA B;  1SGH A;  4MY6 A;  4TYZ A;  2QKM A;  1FB8 A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  1ZM0 A;  2AL6 A;  4F7G A;  3QBV B;  3TW1 A;  5KQ4 A;  1WVH A;  4A6F B;  1DRO A;  4KAX B;  1NTV A;  1EAZ A;  3NSU A;  1XOD A;  1GC7 A;  2EC1 A;  4F7U P;  2DN6 A;  4GMX B;  4HB3 B;  2RUK B;  5HE2 A;  1XKE A;  1ZC4 B;  4GN1 A;  1MKE A;  3MPX A;  4ZRK A;  1XR0 B;  1MIX A;  1ZSQ A;  3ULC A;  4A6H A;  2D2Q A;  4HAV B;  1AQC A;  2MKR A;  3PG7 A;  1MK9 B;  1U5G A;  4WJ7 A;  5HE1 A;  2DKP A;  1IRS A;  2D9X A;  4EJN A;  3A8P A;  1V61 A;  2OQB A;  2R0D A;  3ML4 A;  2XQN M;  2R09 A;  3SO6 A;  1UEF A;  1KZ7 A;  2COA A;  4L1R A;  1SHC A;  4GXB A;  1Y5O A;  1N3H A;  3U7D A;  1UPR A;  1PLS A;  2YS1 A;  2NZ8 B;  2ZKM X;  2GJY A;  2P8V A;  4HAW B;  2DHK A;  3TFM A;  2G35 A;  5DIF B;  1V89 A;  1U2B A;  2LUL A;  4OT1 A;  1FHW A;  1M7E A;  2D4Q A;  1BAK A;  2D11 A;  3CXB B;  3PSC A;  1V88 A;  3TCA A;  2NBV A;  2UVM A;  2Y7B A;  4HDO A;  4F7H A;  3MDB C;  3KRW A;  2Z14 A;  3B77 A;  2K2U A;  2HE7 A;  1MI1 A;  2QKL A;  1DYN A;  3F0W A;  4DX9 0;  3PVU A;  4OSN A;  4HSI A;  4NSW A;  3VOQ A;  1QC6 A;  3P6A A;  2KIG A;  1AWE A;  1H4R A;  1J19 A;  4KHB A;  4MK0 A;  2K00 A;  3DCX A;  1H10 A;  1PFJ A;  4EKU A;  2YRY A;  2RVB B;  2J0J A;  1FHX A;  4GOU A;  3CIK A;  2YF0 A;  5J3T A;  2YVC A;  5KCV A;  1J0W A;  1XD4 A;  4KHO A;  2CAY A;  1I7A A;  3HQC A;  5JLJ B;  2Y8F A;  1WI1 A;  2VRW B;  4IOY X;  5LON B;  2ELB A;  1FGY A;  4HAU B;  4IFS A;  1W1D A;  1XX0 A;  2KGX B;  1NI2 A;  2DKQ A;  1MIZ B;  4A6K A;  2RGN B;  5FI1 A;  2DLW A;  5C5B A;  2YT1 A;  5JHG A;  4HB2 B;  4H8S A;  3SYX A;  2BCJ A;  4BBK A;  1LW3 A;  2RNR B;  5M4Y B;  1KZG A;  2I1K A;  4HAZ B;  4D6W A;  1P3R A;  2I1J A;  1NTY A;  5GOW B;  3M1I B;  2DFK A;  4IAP A;  3PP2 A;  2UZS A;  4GMV A;  1TJ6 A;  2UZR A;  2OTX A;  2D9W A;  1GG3 A;  2D9V A;  3V5W A;  1EVH A;  1OQN A;  3FEH A;  2Z4D A;  3AJ4 A;  4K2O A;  3FSS A;  3SUZ A;  1BTK A;  4GNK B;  2D9Y A;  3RCP A;  3DXC A;  2MFQ A;  4HHV A;  4GPT B;  3ZDT A;  2DX1 A;  2KIE A;  1V5M A;  2I5C A;  4DX8 A;  1DDM A;  2DYN A;  3PVW A;  2COD A;  3LJU X;  2GS0 A;  2ROZ B;  3SV1 A;  3ULB A;  2IYB A;  3DXE A;  5HE3 A;  5LOP B;  2W2X C;  5EFX A;  2ADZ A;  4DIX A;  3UZT A;  3HIE A;  3IVF A;  4L6E A;  1LB1 A;  1P6S A;  1WJM A;  2LOZ A;  3TVV A;  2YT2 A;  4QJ4 B;  2N0Y A;  3N7C A;  2L1C A;  4Z2N A;  1TQZ A;  3FVC A;  1ZVR A;  1BWN A;  5C5B B;  2YSZ A;  3ODX A;  1WGQ A;  1OY2 A;  2J0M A;  2W2X D;  3KSY A;  5D27 A;  2DTC A;  4EMO A;  4TKN A;  2D9Z A;  2LYD A;  2M14 A;  1UPQ A;  1U5E A;  2EMT A;  2KR0 A;  2ROV A;  4ZRI A;  2EJ8 A;  1FAO A;  2DA0 A;  1QQG A;  1U5D A;  1Q67 A;  1U5F A;  3G9W A;  4MT7 A;  4KVG B;  1K5D B;  4K81 A;  4D0N B;  5JHH A;  1TXD A;  1E5W A;  4KHB B;  4QJ5 B;  3NWF A;  2COF A;  5D3X A;  3F5R A;  1V5U A;  3WA0 A;  3SNH A;  2E2X A;  3A98 B;  4QXA B;  2D10 A;  5DHA B;  5C6R A;  4HDQ A;  1OMW A;  1FHO A;  3VIA A;  3TO1 A;  5D3W A;  4KHA A;  2ELA A;  4ZRJ A;  3NWD A;  1WG7 A;  3OHM B;  1K5G B;  3GYP A;  2W2W A;  1U27 A;  3BIN A;  2YT0 A;  3D8D A;  3BJI A;  1X1F A;  3OAN A;  1UNR A;  5D3Y A;  1EGX A;  2H7D A;  3D8E A;  4NY0 A;  2MDX A;  1FOE A;  3HK0 A;  1DBH A;  3FM8 C;  2N23 A;  2J59 M;  2HTH B;  3NWA A;  2CY4 A;  5CLQ B;  2DHJ A;  1DDV A;  2IFS A;  2H7E A;  4HB0 B;  2Z0Q A;  3KRX A;  2ZPY A;  4QJ3 B;  1B55 A;  2VKI A;  2X18 A;  2K49 A;  3D8F A;  2DX5 A;  4GZU A;  1MPH A;  3KZ1 A;  2NMB A;  2GCJ A;  4HAT B;  4DBB A;  3A8Q A;  2R2Y A;  4C0A A;  4Y94 A;  1I2H A;  1X05 A;  5KQ1 A;  1XCG A;  4B6H A;  1Y19 B;  1UNP A;  3QIJ A;  3ODW A;  1GC6 A;  5C79 A;  1BTN A;  2P0F A;  1WGU A;  2DYQ A;  5HE0 A;  5JP4 A;  1W1H A;  1NU2 A;  4HAX B;  1ZYI A;  4WSF A;  3WYF B;  3U8Z A;  2K2J A;  2GUM A;  3PZD A;  1X1G A;  3NW8 A;  1V5P A;  4XWX A;  2GCL A;  1MAI A;  2YS3 A;  2LG1 A;  4A6F A;  2KUQ A;  3AU5 A;  3HSA A;  5DI9 B;  2FJL A;  1W1G A;  2K8E A;  1X11 A;  4WVF B;  1DDW A;  1M7R A;  2M38 A;  4A5K A;  3GYO A;  4K2P A;  2LKO A;  2I5F A;  5DH9 B;  1ISN A;  2JP2 A;  5J3Q A;  4K17 A;  2EMS A;  2Y8G A;  2LOX A;  2V76 A;  3T06 A;  4CSQ A;  1RJ2 A;  2DHI A;  3ZVR A;  2VSZ A;  3HW2 B;  2KUP A;  4HB4 B;  2J0K A;  2MWN B;  3QWM A;  5LG4 B;  2P0H A;  4CHJ A;  3AU4 A;  4PNK A;  1ZC3 B;  1EF1 A;  4YL8 A;  4P7I A;  4PQ0 A;  4YON A;  2Z13 A;  3A58 A;  3DXD A;  2Z0O A;  5J3Y A;  1T77 A;  5I2S A;  4CYE A;  3P7Z A;  3KY9 A;  2FJU B;  2P0D A;  5CLL B;  3O96 A;  5DHF B;  4CHM A;  4HAY B;  2RSG A;  3X23 A;  4Z2M B;  5FI0 A;  2RRF A;  3PEG A;  5IRS A;  5D3V A;  5L81 A;  2Z0P A;  5I2M A;  1KI1 B;  1FGZ A;  1U29 A;  2COC A;  3U12 A;  2CY5 A;  1P5T A;  1PMS A;  1UNQ A;  2AEH A;  2L2I A;  1WJ1 A;  2Q13 A;  1Z87 A;  2KCJ A;  3ODO A;  1RRP B;  1MK7 B;  1X86 A;  2RLO A;  3PVL A;  2CRF A;  5C16 A;  2YS5 A;  4DXA B;  1SGH A;  4MY6 A;  4TYZ A;  2QKM A;  2Z59 A;  1FB8 A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  1ZM0 A;  2AL6 A;  4F7G A;  3QBV B;  3TW1 A;  5KQ4 A;  1WVH A;  4A6F B;  1DRO A;  4KAX B;  1NTV A;  1EAZ A;  3NSU A;  1XOD A;  1GC7 A;  2EC1 A;  4F7U P;  2DN6 A;  4GMX B;  4HB3 B;  2RUK B;  5HE2 A;  1XKE A;  1ZC4 B;  4GN1 A;  1MKE A;  3MPX A;  4ZRK A;  1XR0 B;  1MIX A;  1ZSQ A;  3ULC A;  4A6H A;  2D2Q A;  4HAV B;  1AQC A;  2MKR A;  3PG7 A;  1MK9 B;  1U5G A;  4WJ7 A;  5HE1 A;  2DKP A;  1IRS A;  2D9X A;  4EJN A;  3A8P A;  1V61 A;  2OQB A;  2R0D A;  3ML4 A;  2XQN M;  2R09 A;  3SO6 A;  1UEF A;  1KZ7 A;  2COA A;  1SHC A;  4GXB A;  1Y5O A;  1N3H A;  3U7D A;  1UPR A;  1PLS A;  2YS1 A;  2NZ8 B;  2GJY A;  2P8V A;  4HAW B;  2DHK A;  3TFM A;  2G35 A;  5DIF B;  1V89 A;  1U2B A;  2LUL A;  1FHW A;  1M7E A;  2D4Q A;  1BAK A;  2D11 A;  3CXB B;  3PSC A;  1V88 A;  3TCA A;  2UVM A;  2Y7B A;  4HDO A;  4F7H A;  3MDB C;  3KRW A;  2K2U A;  2HE7 A;  2QKL A;  1DYN A;  3F0W A;  4DX9 0;  3PVU A;  4NSW A;  3VOQ A;  1QC6 A;  3P6A A;  1AWE A;  1H4R A;  1J19 A;  4MK0 A;  2K00 A;  1H10 A;  1PFJ A;  4EKU A;  2YRY A;  2RVB B;  2J0J A;  1FHX A;  3CIK A;  2YF0 A;  5J3T A;  2YVC A;  5KCV A;  1J0W A;  1XD4 A;  4KHO A;  2CAY A;  1I7A A;  3HQC A;  5JLJ B;  2Y8F A;  1WI1 A;  2VRW B;  4IOY X;  5LON B;  2ELB A;  1FGY A;  4HAU B;  4IFS A;  1W1D A;  1XX0 A;  2KGX B;  1NI2 A;  2DKQ A;  1MIZ B;  4A6K A;  2RGN B;  5FI1 A;  2DLW A;  5C5B A;  2YT1 A;  5JHG A;  4HB2 B;  4H8S A;  3SYX A;  2BCJ A;  4BBK A;  1LW3 A;  2RNR B;  1KZG A;  2I1K A;  4HAZ B;  1P3R A;  2I1J A;  1NTY A;  5GOW B;  3M1I B;  2DFK A;  4IAP A;  3PP2 A;  2UZS A;  4GMV A;  1TJ6 A;  2UZR A;  2OTX A;  2D9W A;  1GG3 A;  2D9V A;  3V5W A;  1EVH A;  1OQN A;  3FEH A;  3AJ4 A;  4K2O A;  3FSS A;  3SUZ A;  1BTK A;  2D9Y A;  3RCP A;  3DXC A;  2MFQ A;  4HHV A;  4GPT B;  3ZDT A;  2DX1 A;  1V5M A;  2I5C A;  4DX8 A;  1DDM A;  2DYN A;  3PVW A;  2COD A;  3LJU X;  2GS0 A;  2ROZ B;  3SV1 A;  3ULB A;  2IYB A;  3DXE A;  5HE3 A;  5LOP B;  2W2X C;  5EFX A;  2ADZ A;  3UZT A;  3IVF A;  4L6E A;  1LB1 A;  1P6S A;  1WJM A;  2LOZ A;  3TVV A;  2N0Y A;  3N7C A;  2L1C A;  4Z2N A;  1TQZ A;  1ZVR A;  1BWN A;  5C5B B;  2YSZ A;  3ODX A;  1WGQ A;  1OY2 A;  2J0M A;  2W2X D;  3KSY A;  5D27 A;  2DTC A;  4EMO A;  4TKN A;  2D9Z A;  2LYD A;  2M14 A;  1UPQ A;  1U5E A;  2EMT A;  2ROV A;  4ZRI A;  2EJ8 A;  1FAO A;  2DA0 A;  1QQG A;  1U5D A;  1Q67 A;  1U5F A;  3G9W A;  4MT7 A;  4KVG B;  1K5D B;  4K81 A;  4D0N B;  5JHH A;  1TXD A;  1E5W A;  4KHB B;  2COF A;  5D3X A;  3F5R A;  1V5U A;  3WA0 A;  3SNH A;  2E2X A;  3A98 B;  2D10 A;  5DHA B;  5C6R A;  4HDQ A;  1OMW A;  1FHO A;  3VIA A;  3TO1 A;  5D3W A;  4KHA A;  2ELA A;  4ZRJ A;  1WG7 A;  1K5G B;  3GYP A;  2W2W A;  1U27 A;  3BIN A;  2YT0 A;  3D8D A;  3BJI A;  1X1F A;  3OAN A;  1UNR A;  5D3Y A;  1EGX A;  2H7D A;  3D8E A;  4NY0 A;  2MDX A;  1FOE A;  3HK0 A;  1DBH A;  3FM8 C;  2N23 A;  2J59 M;  2HTH B;  2CY4 A;  5CLQ B;  2DHJ A;  1DDV A;  2IFS A;  2H7E A;  4HB0 B;  2Z0Q A;  3KRX A;  2ZPY A;  1B55 A;  2VKI A;  2X18 A;  3D8F A;  2DX5 A;  4GZU A;  1MPH A;  3KZ1 A;  2NMB A;  2GCJ A;  4HAT B;  4DBB A;  3A8Q A;  4C0A A;  4Y94 A;  1I2H A;  1X05 A;  5KQ1 A;  1XCG A;  4B6H A;  1Y19 B;  1UNP A;  3QIJ A;  3ODW A;  1GC6 A;  5C79 A;  1BTN A;  2P0F A;  1WGU A;  2DYQ A;  5HE0 A;  5JP4 A;  1W1H A;  1NU2 A;  4HAX B;  4WSF A;  3WYF B;  3U8Z A;  2K2J A;  3PZD A;  1X1G A;  1V5P A;  4XWX A;  2GCL A;  1MAI A;  2YS3 A;  2LG1 A;  4A6F A;  3AU5 A;  5DI9 B;  2FJL A;  1W1G A;  1X11 A;  4WVF B;  1DDW A;  1M7R A;  2M38 A;  4A5K A;  3GYO A;  4K2P A;  2LKO A;  2I5F A;  5DH9 B;  1ISN A;  2JP2 A;  5J3Q A;  4K17 A;  2EMS A;  2Y8G A;  2LOX A;  2V76 A;  3T06 A;  1RJ2 A;  2DHI A;  3ZVR A;  2VSZ A;  3HW2 B;  2KUP A;  4HB4 B;  2J0K A;  2MWN B;  3QWM A;  2P0H A;  4CHJ A;  3AU4 A;  4PNK A;  1ZC3 B;  1EF1 A;  4YL8 A;  4P7I A;  4PQ0 A;  4YON A;  3DXD A;  2Z0O A;  5J3Y A;  4CYE A;  3P7Z A;  3KY9 A;  2P0D A;  5CLL B;  3O96 A;  5DHF B;  4CHM A;  4HAY B;  2RSG A;  3X23 A;  4Z2M B;  5FI0 A;  3PEG A;  5D3V A;  5L81 A;  2Z0P A;  1KI1 B;  1FGZ A;  1U29 A;  2COC A;  2CY5 A;  1P5T A;  1PMS A;  1UNQ A;  2AEH A;  2L2I A;  1WJ1 A;  2Q13 A;  1Z87 A;  2KCJ A;  3ODO A;  1RRP B;  1MK7 B;  1X86 A;  2RLO A;  3PVL A;  2CRF A;  5C16 A;  2YS5 A;  4DXA B;  1SGH A;  4MY6 A;  4TYZ A;  2QKM A;  1FB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...