4HB2B

Crystal structure of crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
129
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb2B00
1X86A 5C16A 2Y8GA 4ZRJA 2IFSA 5LONB 3FEHA 3PVUA 3U7DA 1MK9B 1I2HA 1W1HA 4K81A 1H10A 1MAIA 4GN1A 3RCPA 2J0JA 1WGUA 2M38A 2D9YA 3X23A 1U5FA 5D3VA 2YRYA 5J3QA 1Y19B 4DX8A 4CHMA 4HAZB 3SO6A 1AQCA 1X1GA 2RVBB 4EJNA 2ELAA 3DXEA 2YS1A 4IAPA 2NZ8B 1OQNA 3A8QA 1U2BA 3CXBB 3PEGA 1BWNA 4MT7A 3A98B 1GG3A 2YT1A 2CAYA 3ODOA 5C6RA 1U29A 2R09A 2R0DA 4IOYX 3G9WA 3O96A 2LG1A 3SNHA 4A6FA 5DHAB 2Z0OA 2RNRB 1DBHA 3AJ4A 2EC1A 2H7DA 3D8DA 5HE1A 1I7AA 2ADZA 5GOWB 1X1FA 2E2XA 5KQ1A 1P3RA 1NTVA 2DLWA 4KVGB 2LOZA 2P0DA 3KZ1A 2D10A 5FI1A 1PLSA 1U5DA 2LOXA 5CLLB 2G35A 2N0YA 3ZVRA 3A8PA 1E5WA 2DHJA 5C5BA 2YF0A 3V5WA 2MWNB 2VSZA 4K2OA 3DXDA 2Z0PA 2DYQA 4H8SA 2COFA 2I1JA 2OQBA 2L1CA 2P0FA 1UNRA 4HB3B 4KAXB 2DFKA 4DXAB 2EJ8A 3AU4A 1DDWA 5C5BB 2D9XA 2UVMA 5DHFB 2V76A 5D3WA 3TW1A 3N7CA 3VOQA 5DI9B 1MK7B 1J19A 4D0NB 1KI1B 1X11A 2QKMA 2GS0A 3M1IB 5EFXA 1DROA 1ISNA 1DDMA 1FHWA 2LYDA 1LB1A 4YL8A 1FHXA 2Y8FA 1V89A 4GMXB 4L6EA 2RSGA 1WI1A 2CODA 2K2JA 2P8VA 3T06A 4KHAA 5DIFB 2W2XD 1PFJA 2H7EA 4HAXB 2DX5A 3ODXA 1NTYA 1ZM0A 1FGYA 4F7HA 4GXBA 5CLQB 2DA0A 4B6HA 4KHBB 3TVVA 1DYNA 2YVCA 1Q67A 5JLJB 4A6HA 2YT0A 1XKEA 4GMVA 4HAUB 3KY9A 4P7IA 4HHVA 5KQ4A 3WA0A 3ULBA 2ROZB 3QWMA 3QBVB 1MIZB 5D27A 3BINA 3HW2B 2GJYA 3OANA 4YONA 2COCA 3FSSA 1OY2A 2CY5A 4WJ7A 1UNQA 1MIXA 1EF1A 1ZC3B 3ML4A 1FB8A 2VRWB 4F7GA 5C79A 1V61A 1KZGA 1UEFA 4WSFA 2Z0QA 2J59M 1Y5OA 4MK0A 1V5MA 2I5CA 3CIKA 3PVWA 3SV1A 1AWEA 1UNPA 1M7RA 4K2PA 4IFSA 1IRSA 4A6FB 2EMSA 3HK0A 2MKRA 1EVHA 1N3HA 2D9ZA 2DYNA 1BTNA 2Y7BA 1MPHA 2IYBA 3ODWA 2AL6A 4MY6A 4PQ0A 4NY0A 1K5DB 5D3YA 1V5UA 1XR0B 3SUZA 1NU2A 2CY4A 3DXCA 2FJLA 5HE0A 3FM8C 4Z2NA 4Z2MB 4DBBA 1Z87A 1U5EA 2N23A 3PG7A 1ZSQA 2DKQA 5LOPB 1B55A 5L81A 1XX0A 3ZDTA 3ULCA 1FGZA 4HAYB 4A5KA 4CHJA 1XODA 1KZ7A 1WVHA 2RGNB 2YS3A 1WJMA 1TJ6A 1EAZA 5JHGA 2D9VA 1XD4A 4TYZA 1M7EA 2MFQA 1W1DA 3GYPA 2ZPYA 1J0WA 2D9WA 2DN6A 3UZTA 5JP4A 2NMBA 3MDBC 4HDOA 1RJ2A 1NI2A 1UPQA 3PP2A 4HB0B 1RRPB 2KUPA 3P6AA 1V88A 4BBKA 1WGQA 4GPTB 2QKLA 2P0HA 5D3XA 3QIJA 1TQZA 4NSWA 4EKUA 1SHCA 1WJ1A 5FI0A 5KCVA 3D8FA 1PMSA 4Y94A 1GC7A 2UZSA 1XCGA 2J0MA 1ZC4B 4GZUA 2K00A 1BAKA 1GC6A 1SGHA 3IVFA 3PSCA 3TFMA 3D8EA 2AEHA 3TO1A 4WVFB 4HB4B 5DH9B 2UZRA 1U5GA 2D11A 1TXDA 1ZVRA 1FAOA 2PZ1A 2KCJA 2W2WA 3KRWA 1MKEA 3U8ZA 1EGXA 2OTXA 4KHOA 1U27A 4HB2B 3TCAA 4HAWB 1H4RA 3F0WA 4HAVB 3BJIA 2MDXA 4ZRIA 2KGXB 2L2IA 2ROVA 3GYOA 3HQCA 3PVLA 2BCJA 2GCJA 3AU5A 3KSYA 3SYXA 1UPRA 2RLOA 2VKIA 1X05A 4C0AA 2DKPA 4XWXA 2ELBA 4K17A 4HDQA 5J3TA 1W1GA 4HATB 1DDVA 2HTHB 4F7UP 2DX1A 4PNKA 4EMOA 2HE7A 2YSZA 3PZDA 2I5FA 1FHOA 2EMTA 1OMWA 1P5TA 5HE2A 2K2UA 2I1KA 1FOEA 5HE3A 2COAA 2Q13A 2DHIA 2X18A 1P6SA 2D2QA 2XQNM 3MPXA 1WG7A 2D4QA 4CYEA 1QC6A 3KRXA 3NSUA 3P7ZA 3LJUX 2LKOA 2RUKB 4ZRKA 3F5RA 2J0KA 5J3YA 2JP2A 5JHHA 1K5GB 4DX90 2DHKA 1BTKA 4TKNA 2DTCA 2LULA 3WYFB 2W2XC 3VIAA 2CRFA 4A6KA 1LW3A 2M14A 1QQGA 2GCLA 1V5PA 2YS5A
chains in the Genus database with same CATH superfamily
1X86A 5C16A 2Y8GA 4ZRJA 2IFSA 5LONB 3FEHA 3DCXA 3PVUA 3U7DA 1MK9B 1I2HA 1W1HA 2Z14A 4K81A 1H10A 1MAIA 4GN1A 3RCPA 2J0JA 1WGUA 2M38A 2D9YA 3X23A 1U5FA 5D3VA 2YRYA 5J3QA 1Y19B 4DX8A 4CHMA 4HAZB 3SO6A 1AQCA 1X1GA 2RVBB 4EJNA 2ELAA 3DXEA 2YS1A 4IAPA 2NZ8B 1OQNA 3A8QA 1U2BA 3CXBB 3PEGA 1BWNA 4MT7A 3A98B 1GG3A 2YT1A 2CAYA 3ODOA 5C6RA 1U29A 2R09A 2KIGA 2R0DA 4IOYX 3G9WA 3O96A 2LG1A 3SNHA 4A6FA 3NW8A 5DHAB 2Z0OA 4CSQA 3B77A 2RNRB 1DBHA 3AJ4A 2EC1A 2H7DA 3D8DA 5HE1A 1I7AA 2ADZA 5GOWB 1X1FA 2ZKMX 2E2XA 5KQ1A 1P3RA 1NTVA 2DLWA 4KVGB 2LOZA 2P0DA 3KZ1A 2D10A 5FI1A 1PLSA 2NBVA 1U5DA 2LOXA 5CLLB 2G35A 4GNKB 2N0YA 3ZVRA 2FJUB 3A8PA 1E5WA 2DHJA 5C5BA 2YF0A 3V5WA 2MWNB 2VSZA 4K2OA 4QJ5B 3DXDA 2Z0PA 2DYQA 4H8SA 2COFA 2I1JA 2OQBA 2L1CA 2KUQA 3OHMB 2P0FA 1UNRA 2GUMA 4HB3B 4KAXB 2DFKA 4DXAB 2EJ8A 3AU4A 2KR0A 1DDWA 5C5BB 2D9XA 2UVMA 4QJ3B 5I2MA 5DHFB 2V76A 5D3WA 3TW1A 4HSIA 3N7CA 3VOQA 5DI9B 1MK7B 1J19A 4KHBA 4D0NB 1KI1B 1X11A 2QKMA 2GS0A 3M1IB 5EFXA 1DROA 1ISNA 1DDMA 1FHWA 2LYDA 1LB1A 4YL8A 1FHXA 2Y8FA 1V89A 4GMXB 4L6EA 2RSGA 4L1RA 1WI1A 2CODA 2K2JA 2P8VA 3T06A 4KHAA 5DIFB 2W2XD 1PFJA 2H7EA 4DIXA 4HAXB 2DX5A 3ODXA 1NTYA 1ZM0A 1FGYA 4F7HA 4GXBA 5CLQB 2DA0A 4B6HA 4KHBB 3TVVA 1DYNA 2RRFA 2YVCA 1Q67A 5JLJB 4A6HA 2YT0A 1XKEA 4GMVA 4HAUB 3KY9A 4P7IA 4HHVA 5KQ4A 3WA0A 5M4YB 3ULBA 2ROZB 3QWMA 3QBVB 1MIZB 4OSNA 4OT1A 5D27A 3BINA 3HW2B 2GJYA 3OANA 4YONA 2COCA 3FSSA 1OY2A 2CY5A 4WJ7A 1UNQA 1MIXA 1EF1A 1ZC3B 3ML4A 1FB8A 2VRWB 4F7GA 5C79A 1V61A 1KZGA 1UEFA 4WSFA 2KIEA 2Z0QA 2J59M 1Y5OA 4MK0A 4D6WA 1V5MA 2I5CA 3CIKA 3PVWA 3SV1A 1AWEA 1UNPA 1M7RA 4K2PA 1T77A 4IFSA 1IRSA 1ZYIA 4A6FB 2EMSA 3HK0A 2MKRA 3U12A 1EVHA 1N3HA 2D9ZA 2DYNA 1BTNA 2Y7BA 1MPHA 2IYBA 3ODWA 2AL6A 4MY6A 4PQ0A 4NY0A 1K5DB 5D3YA 2Z13A 1V5UA 1XR0B 3SUZA 1NU2A 2CY4A 3DXCA 2FJLA 5HE0A 3FM8C 4Z2NA 4Z2MB 4DBBA 1Z87A 1U5EA 2N23A 3PG7A 1ZSQA 2DKQA 5LOPB 1B55A 5L81A 1XX0A 3ZDTA 3ULCA 1FGZA 4HAYB 4A5KA 4CHJA 1XODA 1KZ7A 1WVHA 2RGNB 2YS3A 1WJMA 1TJ6A 1EAZA 3NWDA 5JHGA 2D9VA 1XD4A 4TYZA 1M7EA 5IRSA 2MFQA 1W1DA 3GYPA 2ZPYA 1J0WA 2D9WA 2DN6A 3UZTA 5I2SA 5JP4A 2NMBA 3MDBC 4HDOA 1RJ2A 1NI2A 1UPQA 3PP2A 4HB0B 1RRPB 2KUPA 3P6AA 1V88A 4BBKA 1WGQA 4GPTB 2QKLA 2P0HA 2R2YA 5D3XA 3QIJA 1TQZA 4NSWA 4EKUA 1SHCA 1WJ1A 5FI0A 5KCVA 3D8FA 1PMSA 4Y94A 3HIEA 1GC7A 4QJ4B 2UZSA 1XCGA 4GOUA 3A58A 2J0MA 1ZC4B 4GZUA 2K00A 1BAKA 1GC6A 1SGHA 3IVFA 3PSCA 3TFMA 3D8EA 2AEHA 3TO1A 4WVFB 4HB4B 5DH9B 2UZRA 1U5GA 5LG4B 2D11A 1TXDA 1ZVRA 1FAOA 2K49A 2PZ1A 2KCJA 2W2WA 3KRWA 1MKEA 1MI1A 3U8ZA 1EGXA 2OTXA 4KHOA 1U27A 4HB2B 3TCAA 4HAWB 1H4RA 3NWAA 3F0WA 4HAVB 3BJIA 2MDXA 4ZRIA 2KGXB 3HSAA 2L2IA 2ROVA 3GYOA 3HQCA 3PVLA 2BCJA 2GCJA 3AU5A 3KSYA 3SYXA 1UPRA 2RLOA 2VKIA 1X05A 4C0AA 2DKPA 4XWXA 2ELBA 4K17A 4HDQA 5J3TA 1W1GA 4HATB 1DDVA 2HTHB 4F7UP 2DX1A 4PNKA 4EMOA 2K8EA 2HE7A 2YSZA 3PZDA 2I5FA 1FHOA 2EMTA 1OMWA 2Z4DA 1P5TA 5HE2A 2K2UA 2Z59A 2I1KA 1FOEA 5HE3A 2COAA 2Q13A 2DHIA 2X18A 1P6SA 2D2QA 2XQNM 3MPXA 1WG7A 2D4QA 4CYEA 1QC6A 3KRXA 3NSUA 3P7ZA 3LJUX 2LKOA 2RUKB 4ZRKA 3F5RA 2J0KA 5J3YA 2JP2A 5JHHA 1K5GB 4DX90 2YT2A 2DHKA 1BTKA 4TKNA 4QXAB 2DTCA 2LULA 3WYFB 2W2XC 3VIAA 2CRFA 4A6KA 1LW3A 2M14A 1QQGA 3NWFA 2GCLA 3FVCA 1V5PA 2YS5A
chains in the Genus database with same CATH topology
1X86A 5C16A 2Y8GA 4ZRJA 2IFSA 5LONB 3FEHA 3PVUA 3U7DA 1MK9B 1I2HA 1W1HA 4K81A 1H10A 1MAIA 4GN1A 3RCPA 2J0JA 1WGUA 2M38A 2D9YA 3X23A 1U5FA 5D3VA 2YRYA 5J3QA 1Y19B 4DX8A 4CHMA 4HAZB 3SO6A 1AQCA 1X1GA 2RVBB 4EJNA 2ELAA 3DXEA 2YS1A 4IAPA 2NZ8B 1OQNA 3A8QA 1U2BA 3CXBB 3PEGA 1BWNA 4MT7A 3A98B 1GG3A 2YT1A 2CAYA 3ODOA 5C6RA 1U29A 2R09A 2R0DA 4IOYX 3G9WA 3O96A 2LG1A 3SNHA 4A6FA 5DHAB 2Z0OA 2RNRB 1DBHA 3AJ4A 2EC1A 2H7DA 3D8DA 5HE1A 1I7AA 2ADZA 5GOWB 1X1FA 2E2XA 5KQ1A 1P3RA 1NTVA 2DLWA 4KVGB 2LOZA 2P0DA 3KZ1A 2D10A 5FI1A 1PLSA 1U5DA 2LOXA 5CLLB 2G35A 2N0YA 3ZVRA 3A8PA 1E5WA 2DHJA 5C5BA 2YF0A 3V5WA 2MWNB 2VSZA 4K2OA 3DXDA 2Z0PA 2DYQA 4H8SA 2COFA 2I1JA 2OQBA 2L1CA 2P0FA 1UNRA 4HB3B 4KAXB 2DFKA 4DXAB 2EJ8A 3AU4A 1DDWA 5C5BB 2D9XA 2UVMA 5DHFB 2V76A 5D3WA 3TW1A 3N7CA 3VOQA 5DI9B 1MK7B 1J19A 4D0NB 1KI1B 1X11A 2QKMA 2GS0A 3M1IB 5EFXA 1DROA 1ISNA 1DDMA 1FHWA 2LYDA 1LB1A 4YL8A 1FHXA 2Y8FA 1V89A 4GMXB 4L6EA 2RSGA 1WI1A 2CODA 2K2JA 2P8VA 3T06A 4KHAA 5DIFB 2W2XD 1PFJA 2H7EA 4HAXB 2DX5A 3ODXA 1NTYA 1ZM0A 1FGYA 4F7HA 4GXBA 5CLQB 2DA0A 4B6HA 4KHBB 3TVVA 1DYNA 2YVCA 1Q67A 5JLJB 4A6HA 2YT0A 1XKEA 4GMVA 4HAUB 3KY9A 4P7IA 4HHVA 5KQ4A 3WA0A 3ULBA 2ROZB 3QWMA 3QBVB 1MIZB 5D27A 3BINA 3HW2B 2GJYA 3OANA 4YONA 2COCA 3FSSA 1OY2A 2CY5A 4WJ7A 1UNQA 1MIXA 1EF1A 1ZC3B 3ML4A 1FB8A 2VRWB 4F7GA 5C79A 1V61A 1KZGA 1UEFA 4WSFA 2Z0QA 2J59M 1Y5OA 4MK0A 1V5MA 2I5CA 3CIKA 3PVWA 3SV1A 1AWEA 1UNPA 1M7RA 4K2PA 4IFSA 1IRSA 4A6FB 2EMSA 3HK0A 2MKRA 1EVHA 1N3HA 2D9ZA 2DYNA 1BTNA 2Y7BA 1MPHA 2IYBA 3ODWA 2AL6A 4MY6A 4PQ0A 4NY0A 1K5DB 5D3YA 1V5UA 1XR0B 3SUZA 1NU2A 2CY4A 3DXCA 2FJLA 5HE0A 3FM8C 4Z2NA 4Z2MB 4DBBA 1Z87A 1U5EA 2N23A 3PG7A 1ZSQA 2DKQA 5LOPB 1B55A 5L81A 1XX0A 3ZDTA 3ULCA 1FGZA 4HAYB 4A5KA 4CHJA 1XODA 1KZ7A 1WVHA 2RGNB 2YS3A 1WJMA 1TJ6A 1EAZA 5JHGA 2D9VA 1XD4A 4TYZA 1M7EA 2MFQA 1W1DA 3GYPA 2ZPYA 1J0WA 2D9WA 2DN6A 3UZTA 5JP4A 2NMBA 3MDBC 4HDOA 1RJ2A 1NI2A 1UPQA 3PP2A 4HB0B 1RRPB 2KUPA 3P6AA 1V88A 4BBKA 1WGQA 4GPTB 2QKLA 2P0HA 5D3XA 3QIJA 1TQZA 4NSWA 4EKUA 1SHCA 1WJ1A 5FI0A 5KCVA 3D8FA 1PMSA 4Y94A 1GC7A 2UZSA 1XCGA 2J0MA 1ZC4B 4GZUA 2K00A 1BAKA 1GC6A 1SGHA 3IVFA 3PSCA 3TFMA 3D8EA 2AEHA 3TO1A 4WVFB 4HB4B 5DH9B 2UZRA 1U5GA 2D11A 1TXDA 1ZVRA 1FAOA 2PZ1A 2KCJA 2W2WA 3KRWA 1MKEA 3U8ZA 1EGXA 2OTXA 4KHOA 1U27A 4HB2B 3TCAA 4HAWB 1H4RA 3F0WA 4HAVB 3BJIA 2MDXA 4ZRIA 2KGXB 2L2IA 2ROVA 3GYOA 3HQCA 3PVLA 2BCJA 2GCJA 3AU5A 3KSYA 3SYXA 1UPRA 2RLOA 2VKIA 1X05A 4C0AA 2DKPA 4XWXA 2ELBA 4K17A 4HDQA 5J3TA 1W1GA 4HATB 1DDVA 2HTHB 4F7UP 2DX1A 4PNKA 4EMOA 2HE7A 2YSZA 3PZDA 2I5FA 1FHOA 2EMTA 1OMWA 1P5TA 5HE2A 2K2UA 2I1KA 1FOEA 5HE3A 2COAA 2Q13A 2DHIA 2X18A 1P6SA 2D2QA 2XQNM 3MPXA 1WG7A 2D4QA 4CYEA 1QC6A 3KRXA 3NSUA 3P7ZA 3LJUX 2LKOA 2RUKB 4ZRKA 3F5RA 2J0KA 5J3YA 2JP2A 5JHHA 1K5GB 4DX90 2DHKA 1BTKA 4TKNA 2DTCA 2LULA 3WYFB 2W2XC 3VIAA 2CRFA 4A6KA 1LW3A 2M14A 1QQGA 2GCLA 1V5PA 2YS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  5C16 A;  2Y8G A;  4ZRJ A;  2IFS A;  5LON B;  3FEH A;  3PVU A;  3U7D A;  1MK9 B;  1I2H A;  1W1H A;  4K81 A;  1H10 A;  1MAI A;  4GN1 A;  3RCP A;  2J0J A;  1WGU A;  2M38 A;  2D9Y A;  3X23 A;  1U5F A;  5D3V A;  2YRY A;  5J3Q A;  1Y19 B;  4DX8 A;  4CHM A;  4HAZ B;  3SO6 A;  1AQC A;  1X1G A;  2RVB B;  4EJN A;  2ELA A;  3DXE A;  2YS1 A;  4IAP A;  2NZ8 B;  1OQN A;  3A8Q A;  1U2B A;  3CXB B;  3PEG A;  1BWN A;  4MT7 A;  3A98 B;  1GG3 A;  2YT1 A;  2CAY A;  3ODO A;  5C6R A;  1U29 A;  2R09 A;  2R0D A;  4IOY X;  3G9W A;  3O96 A;  2LG1 A;  3SNH A;  4A6F A;  5DHA B;  2Z0O A;  2RNR B;  1DBH A;  3AJ4 A;  2EC1 A;  2H7D A;  3D8D A;  5HE1 A;  1I7A A;  2ADZ A;  5GOW B;  1X1F A;  2E2X A;  5KQ1 A;  1P3R A;  1NTV A;  2DLW A;  4KVG B;  2LOZ A;  2P0D A;  3KZ1 A;  2D10 A;  5FI1 A;  1PLS A;  1U5D A;  2LOX A;  5CLL B;  2G35 A;  2N0Y A;  3ZVR A;  3A8P A;  1E5W A;  2DHJ A;  5C5B A;  2YF0 A;  3V5W A;  2MWN B;  2VSZ A;  4K2O A;  3DXD A;  2Z0P A;  2DYQ A;  4H8S A;  2COF A;  2I1J A;  2OQB A;  2L1C A;  2P0F A;  1UNR A;  4HB3 B;  4KAX B;  2DFK A;  4DXA B;  2EJ8 A;  3AU4 A;  1DDW A;  5C5B B;  2D9X A;  2UVM A;  5DHF B;  2V76 A;  5D3W A;  3TW1 A;  3N7C A;  3VOQ A;  5DI9 B;  1MK7 B;  1J19 A;  4D0N B;  1KI1 B;  1X11 A;  2QKM A;  2GS0 A;  3M1I B;  5EFX A;  1DRO A;  1ISN A;  1DDM A;  1FHW A;  2LYD A;  1LB1 A;  4YL8 A;  1FHX A;  2Y8F A;  1V89 A;  4GMX B;  4L6E A;  2RSG A;  1WI1 A;  2COD A;  2K2J A;  2P8V A;  3T06 A;  4KHA A;  5DIF B;  2W2X D;  1PFJ A;  2H7E A;  4HAX B;  2DX5 A;  3ODX A;  1NTY A;  1ZM0 A;  1FGY A;  4F7H A;  4GXB A;  5CLQ B;  2DA0 A;  4B6H A;  4KHB B;  3TVV A;  1DYN A;  2YVC A;  1Q67 A;  5JLJ B;  4A6H A;  2YT0 A;  1XKE A;  4GMV A;  4HAU B;  3KY9 A;  4P7I A;  4HHV A;  5KQ4 A;  3WA0 A;  3ULB A;  2ROZ B;  3QWM A;  3QBV B;  1MIZ B;  5D27 A;  3BIN A;  3HW2 B;  2GJY A;  3OAN A;  4YON A;  2COC A;  3FSS A;  1OY2 A;  2CY5 A;  4WJ7 A;  1UNQ A;  1MIX A;  1EF1 A;  1ZC3 B;  3ML4 A;  1FB8 A;  2VRW B;  4F7G A;  5C79 A;  1V61 A;  1KZG A;  1UEF A;  4WSF A;  2Z0Q A;  2J59 M;  1Y5O A;  4MK0 A;  1V5M A;  2I5C A;  3CIK A;  3PVW A;  3SV1 A;  1AWE A;  1UNP A;  1M7R A;  4K2P A;  4IFS A;  1IRS A;  4A6F B;  2EMS A;  3HK0 A;  2MKR A;  1EVH A;  1N3H A;  2D9Z A;  2DYN A;  1BTN A;  2Y7B A;  1MPH A;  2IYB A;  3ODW A;  2AL6 A;  4MY6 A;  4PQ0 A;  4NY0 A;  1K5D B;  5D3Y A;  1V5U A;  1XR0 B;  3SUZ A;  1NU2 A;  2CY4 A;  3DXC A;  2FJL A;  5HE0 A;  3FM8 C;  4Z2N A;  4Z2M B;  4DBB A;  1Z87 A;  1U5E A;  2N23 A;  3PG7 A;  1ZSQ A;  2DKQ A;  5LOP B;  1B55 A;  5L81 A;  1XX0 A;  3ZDT A;  3ULC A;  1FGZ A;  4HAY B;  4A5K A;  4CHJ A;  1XOD A;  1KZ7 A;  1WVH A;  2RGN B;  2YS3 A;  1WJM A;  1TJ6 A;  1EAZ A;  5JHG A;  2D9V A;  1XD4 A;  4TYZ A;  1M7E A;  2MFQ A;  1W1D A;  3GYP A;  2ZPY A;  1J0W A;  2D9W A;  2DN6 A;  3UZT A;  5JP4 A;  2NMB A;  3MDB C;  4HDO A;  1RJ2 A;  1NI2 A;  1UPQ A;  3PP2 A;  4HB0 B;  1RRP B;  2KUP A;  3P6A A;  1V88 A;  4BBK A;  1WGQ A;  4GPT B;  2QKL A;  2P0H A;  5D3X A;  3QIJ A;  1TQZ A;  4NSW A;  4EKU A;  1SHC A;  1WJ1 A;  5FI0 A;  5KCV A;  3D8F A;  1PMS A;  4Y94 A;  1GC7 A;  2UZS A;  1XCG A;  2J0M A;  1ZC4 B;  4GZU A;  2K00 A;  1BAK A;  1GC6 A;  1SGH A;  3IVF A;  3PSC A;  3TFM A;  3D8E A;  2AEH A;  3TO1 A;  4WVF B;  4HB4 B;  5DH9 B;  2UZR A;  1U5G A;  2D11 A;  1TXD A;  1ZVR A;  1FAO A;  2PZ1 A;  2KCJ A;  2W2W A;  3KRW A;  1MKE A;  3U8Z A;  1EGX A;  2OTX A;  4KHO A;  1U27 A;  4HB2 B;  3TCA A;  4HAW B;  1H4R A;  3F0W A;  4HAV B;  3BJI A;  2MDX A;  4ZRI A;  2KGX B;  2L2I A;  2ROV A;  3GYO A;  3HQC A;  3PVL A;  2BCJ A;  2GCJ A;  3AU5 A;  3KSY A;  3SYX A;  1UPR A;  2RLO A;  2VKI A;  1X05 A;  4C0A A;  2DKP A;  4XWX A;  2ELB A;  4K17 A;  4HDQ A;  5J3T A;  1W1G A;  4HAT B;  1DDV A;  2HTH B;  4F7U P;  2DX1 A;  4PNK A;  4EMO A;  2HE7 A;  2YSZ A;  3PZD A;  2I5F A;  1FHO A;  2EMT A;  1OMW A;  1P5T A;  5HE2 A;  2K2U A;  2I1K A;  1FOE A;  5HE3 A;  2COA A;  2Q13 A;  2DHI A;  2X18 A;  1P6S A;  2D2Q A;  2XQN M;  3MPX A;  1WG7 A;  2D4Q A;  4CYE A;  1QC6 A;  3KRX A;  3NSU A;  3P7Z A;  3LJU X;  2LKO A;  2RUK B;  4ZRK A;  3F5R A;  2J0K A;  5J3Y A;  2JP2 A;  5JHH A;  1K5G B;  4DX9 0;  2DHK A;  1BTK A;  4TKN A;  2DTC A;  2LUL A;  3WYF B;  2W2X C;  3VIA A;  2CRF A;  4A6K A;  1LW3 A;  2M14 A;  1QQG A;  2GCL A;  1V5P A;  2YS5 A; 
#chains in the Genus database with same CATH topology
 1X86 A;  5C16 A;  2Y8G A;  4ZRJ A;  2IFS A;  5LON B;  3FEH A;  3DCX A;  3PVU A;  3U7D A;  1MK9 B;  1I2H A;  1W1H A;  2Z14 A;  4K81 A;  1H10 A;  1MAI A;  4GN1 A;  3RCP A;  2J0J A;  1WGU A;  2M38 A;  2D9Y A;  3X23 A;  1U5F A;  5D3V A;  2YRY A;  5J3Q A;  1Y19 B;  4DX8 A;  4CHM A;  4HAZ B;  3SO6 A;  1AQC A;  1X1G A;  2RVB B;  4EJN A;  2ELA A;  3DXE A;  2YS1 A;  4IAP A;  2NZ8 B;  1OQN A;  3A8Q A;  1U2B A;  3CXB B;  3PEG A;  1BWN A;  4MT7 A;  3A98 B;  1GG3 A;  2YT1 A;  2CAY A;  3ODO A;  5C6R A;  1U29 A;  2R09 A;  2KIG A;  2R0D A;  4IOY X;  3G9W A;  3O96 A;  2LG1 A;  3SNH A;  4A6F A;  3NW8 A;  5DHA B;  2Z0O A;  4CSQ A;  3B77 A;  2RNR B;  1DBH A;  3AJ4 A;  2EC1 A;  2H7D A;  3D8D A;  5HE1 A;  1I7A A;  2ADZ A;  5GOW B;  1X1F A;  2ZKM X;  2E2X A;  5KQ1 A;  1P3R A;  1NTV A;  2DLW A;  4KVG B;  2LOZ A;  2P0D A;  3KZ1 A;  2D10 A;  5FI1 A;  1PLS A;  2NBV A;  1U5D A;  2LOX A;  5CLL B;  2G35 A;  4GNK B;  2N0Y A;  3ZVR A;  2FJU B;  3A8P A;  1E5W A;  2DHJ A;  5C5B A;  2YF0 A;  3V5W A;  2MWN B;  2VSZ A;  4K2O A;  4QJ5 B;  3DXD A;  2Z0P A;  2DYQ A;  4H8S A;  2COF A;  2I1J A;  2OQB A;  2L1C A;  2KUQ A;  3OHM B;  2P0F A;  1UNR A;  2GUM A;  4HB3 B;  4KAX B;  2DFK A;  4DXA B;  2EJ8 A;  3AU4 A;  2KR0 A;  1DDW A;  5C5B B;  2D9X A;  2UVM A;  4QJ3 B;  5I2M A;  5DHF B;  2V76 A;  5D3W A;  3TW1 A;  4HSI A;  3N7C A;  3VOQ A;  5DI9 B;  1MK7 B;  1J19 A;  4KHB A;  4D0N B;  1KI1 B;  1X11 A;  2QKM A;  2GS0 A;  3M1I B;  5EFX A;  1DRO A;  1ISN A;  1DDM A;  1FHW A;  2LYD A;  1LB1 A;  4YL8 A;  1FHX A;  2Y8F A;  1V89 A;  4GMX B;  4L6E A;  2RSG A;  4L1R A;  1WI1 A;  2COD A;  2K2J A;  2P8V A;  3T06 A;  4KHA A;  5DIF B;  2W2X D;  1PFJ A;  2H7E A;  4DIX A;  4HAX B;  2DX5 A;  3ODX A;  1NTY A;  1ZM0 A;  1FGY A;  4F7H A;  4GXB A;  5CLQ B;  2DA0 A;  4B6H A;  4KHB B;  3TVV A;  1DYN A;  2RRF A;  2YVC A;  1Q67 A;  5JLJ B;  4A6H A;  2YT0 A;  1XKE A;  4GMV A;  4HAU B;  3KY9 A;  4P7I A;  4HHV A;  5KQ4 A;  3WA0 A;  5M4Y B;  3ULB A;  2ROZ B;  3QWM A;  3QBV B;  1MIZ B;  4OSN A;  4OT1 A;  5D27 A;  3BIN A;  3HW2 B;  2GJY A;  3OAN A;  4YON A;  2COC A;  3FSS A;  1OY2 A;  2CY5 A;  4WJ7 A;  1UNQ A;  1MIX A;  1EF1 A;  1ZC3 B;  3ML4 A;  1FB8 A;  2VRW B;  4F7G A;  5C79 A;  1V61 A;  1KZG A;  1UEF A;  4WSF A;  2KIE A;  2Z0Q A;  2J59 M;  1Y5O A;  4MK0 A;  4D6W A;  1V5M A;  2I5C A;  3CIK A;  3PVW A;  3SV1 A;  1AWE A;  1UNP A;  1M7R A;  4K2P A;  1T77 A;  4IFS A;  1IRS A;  1ZYI A;  4A6F B;  2EMS A;  3HK0 A;  2MKR A;  3U12 A;  1EVH A;  1N3H A;  2D9Z A;  2DYN A;  1BTN A;  2Y7B A;  1MPH A;  2IYB A;  3ODW A;  2AL6 A;  4MY6 A;  4PQ0 A;  4NY0 A;  1K5D B;  5D3Y A;  2Z13 A;  1V5U A;  1XR0 B;  3SUZ A;  1NU2 A;  2CY4 A;  3DXC A;  2FJL A;  5HE0 A;  3FM8 C;  4Z2N A;  4Z2M B;  4DBB A;  1Z87 A;  1U5E A;  2N23 A;  3PG7 A;  1ZSQ A;  2DKQ A;  5LOP B;  1B55 A;  5L81 A;  1XX0 A;  3ZDT A;  3ULC A;  1FGZ A;  4HAY B;  4A5K A;  4CHJ A;  1XOD A;  1KZ7 A;  1WVH A;  2RGN B;  2YS3 A;  1WJM A;  1TJ6 A;  1EAZ A;  3NWD A;  5JHG A;  2D9V A;  1XD4 A;  4TYZ A;  1M7E A;  5IRS A;  2MFQ A;  1W1D A;  3GYP A;  2ZPY A;  1J0W A;  2D9W A;  2DN6 A;  3UZT A;  5I2S A;  5JP4 A;  2NMB A;  3MDB C;  4HDO A;  1RJ2 A;  1NI2 A;  1UPQ A;  3PP2 A;  4HB0 B;  1RRP B;  2KUP A;  3P6A A;  1V88 A;  4BBK A;  1WGQ A;  4GPT B;  2QKL A;  2P0H A;  2R2Y A;  5D3X A;  3QIJ A;  1TQZ A;  4NSW A;  4EKU A;  1SHC A;  1WJ1 A;  5FI0 A;  5KCV A;  3D8F A;  1PMS A;  4Y94 A;  3HIE A;  1GC7 A;  4QJ4 B;  2UZS A;  1XCG A;  4GOU A;  3A58 A;  2J0M A;  1ZC4 B;  4GZU A;  2K00 A;  1BAK A;  1GC6 A;  1SGH A;  3IVF A;  3PSC A;  3TFM A;  3D8E A;  2AEH A;  3TO1 A;  4WVF B;  4HB4 B;  5DH9 B;  2UZR A;  1U5G A;  5LG4 B;  2D11 A;  1TXD A;  1ZVR A;  1FAO A;  2K49 A;  2PZ1 A;  2KCJ A;  2W2W A;  3KRW A;  1MKE A;  1MI1 A;  3U8Z A;  1EGX A;  2OTX A;  4KHO A;  1U27 A;  4HB2 B;  3TCA A;  4HAW B;  1H4R A;  3NWA A;  3F0W A;  4HAV B;  3BJI A;  2MDX A;  4ZRI A;  2KGX B;  3HSA A;  2L2I A;  2ROV A;  3GYO A;  3HQC A;  3PVL A;  2BCJ A;  2GCJ A;  3AU5 A;  3KSY A;  3SYX A;  1UPR A;  2RLO A;  2VKI A;  1X05 A;  4C0A A;  2DKP A;  4XWX A;  2ELB A;  4K17 A;  4HDQ A;  5J3T A;  1W1G A;  4HAT B;  1DDV A;  2HTH B;  4F7U P;  2DX1 A;  4PNK A;  4EMO A;  2K8E A;  2HE7 A;  2YSZ A;  3PZD A;  2I5F A;  1FHO A;  2EMT A;  1OMW A;  2Z4D A;  1P5T A;  5HE2 A;  2K2U A;  2Z59 A;  2I1K A;  1FOE A;  5HE3 A;  2COA A;  2Q13 A;  2DHI A;  2X18 A;  1P6S A;  2D2Q A;  2XQN M;  3MPX A;  1WG7 A;  2D4Q A;  4CYE A;  1QC6 A;  3KRX A;  3NSU A;  3P7Z A;  3LJU X;  2LKO A;  2RUK B;  4ZRK A;  3F5R A;  2J0K A;  5J3Y A;  2JP2 A;  5JHH A;  1K5G B;  4DX9 0;  2YT2 A;  2DHK A;  1BTK A;  4TKN A;  4QXA B;  2DTC A;  2LUL A;  3WYF B;  2W2X C;  3VIA A;  2CRF A;  4A6K A;  1LW3 A;  2M14 A;  1QQG A;  3NWF A;  2GCL A;  3FVC A;  1V5P A;  2YS5 A; 
#chains in the Genus database with same CATH homology
 1X86 A;  5C16 A;  2Y8G A;  4ZRJ A;  2IFS A;  5LON B;  3FEH A;  3PVU A;  3U7D A;  1MK9 B;  1I2H A;  1W1H A;  4K81 A;  1H10 A;  1MAI A;  4GN1 A;  3RCP A;  2J0J A;  1WGU A;  2M38 A;  2D9Y A;  3X23 A;  1U5F A;  5D3V A;  2YRY A;  5J3Q A;  1Y19 B;  4DX8 A;  4CHM A;  4HAZ B;  3SO6 A;  1AQC A;  1X1G A;  2RVB B;  4EJN A;  2ELA A;  3DXE A;  2YS1 A;  4IAP A;  2NZ8 B;  1OQN A;  3A8Q A;  1U2B A;  3CXB B;  3PEG A;  1BWN A;  4MT7 A;  3A98 B;  1GG3 A;  2YT1 A;  2CAY A;  3ODO A;  5C6R A;  1U29 A;  2R09 A;  2R0D A;  4IOY X;  3G9W A;  3O96 A;  2LG1 A;  3SNH A;  4A6F A;  5DHA B;  2Z0O A;  2RNR B;  1DBH A;  3AJ4 A;  2EC1 A;  2H7D A;  3D8D A;  5HE1 A;  1I7A A;  2ADZ A;  5GOW B;  1X1F A;  2E2X A;  5KQ1 A;  1P3R A;  1NTV A;  2DLW A;  4KVG B;  2LOZ A;  2P0D A;  3KZ1 A;  2D10 A;  5FI1 A;  1PLS A;  1U5D A;  2LOX A;  5CLL B;  2G35 A;  2N0Y A;  3ZVR A;  3A8P A;  1E5W A;  2DHJ A;  5C5B A;  2YF0 A;  3V5W A;  2MWN B;  2VSZ A;  4K2O A;  3DXD A;  2Z0P A;  2DYQ A;  4H8S A;  2COF A;  2I1J A;  2OQB A;  2L1C A;  2P0F A;  1UNR A;  4HB3 B;  4KAX B;  2DFK A;  4DXA B;  2EJ8 A;  3AU4 A;  1DDW A;  5C5B B;  2D9X A;  2UVM A;  5DHF B;  2V76 A;  5D3W A;  3TW1 A;  3N7C A;  3VOQ A;  5DI9 B;  1MK7 B;  1J19 A;  4D0N B;  1KI1 B;  1X11 A;  2QKM A;  2GS0 A;  3M1I B;  5EFX A;  1DRO A;  1ISN A;  1DDM A;  1FHW A;  2LYD A;  1LB1 A;  4YL8 A;  1FHX A;  2Y8F A;  1V89 A;  4GMX B;  4L6E A;  2RSG A;  1WI1 A;  2COD A;  2K2J A;  2P8V A;  3T06 A;  4KHA A;  5DIF B;  2W2X D;  1PFJ A;  2H7E A;  4HAX B;  2DX5 A;  3ODX A;  1NTY A;  1ZM0 A;  1FGY A;  4F7H A;  4GXB A;  5CLQ B;  2DA0 A;  4B6H A;  4KHB B;  3TVV A;  1DYN A;  2YVC A;  1Q67 A;  5JLJ B;  4A6H A;  2YT0 A;  1XKE A;  4GMV A;  4HAU B;  3KY9 A;  4P7I A;  4HHV A;  5KQ4 A;  3WA0 A;  3ULB A;  2ROZ B;  3QWM A;  3QBV B;  1MIZ B;  5D27 A;  3BIN A;  3HW2 B;  2GJY A;  3OAN A;  4YON A;  2COC A;  3FSS A;  1OY2 A;  2CY5 A;  4WJ7 A;  1UNQ A;  1MIX A;  1EF1 A;  1ZC3 B;  3ML4 A;  1FB8 A;  2VRW B;  4F7G A;  5C79 A;  1V61 A;  1KZG A;  1UEF A;  4WSF A;  2Z0Q A;  2J59 M;  1Y5O A;  4MK0 A;  1V5M A;  2I5C A;  3CIK A;  3PVW A;  3SV1 A;  1AWE A;  1UNP A;  1M7R A;  4K2P A;  4IFS A;  1IRS A;  4A6F B;  2EMS A;  3HK0 A;  2MKR A;  1EVH A;  1N3H A;  2D9Z A;  2DYN A;  1BTN A;  2Y7B A;  1MPH A;  2IYB A;  3ODW A;  2AL6 A;  4MY6 A;  4PQ0 A;  4NY0 A;  1K5D B;  5D3Y A;  1V5U A;  1XR0 B;  3SUZ A;  1NU2 A;  2CY4 A;  3DXC A;  2FJL A;  5HE0 A;  3FM8 C;  4Z2N A;  4Z2M B;  4DBB A;  1Z87 A;  1U5E A;  2N23 A;  3PG7 A;  1ZSQ A;  2DKQ A;  5LOP B;  1B55 A;  5L81 A;  1XX0 A;  3ZDT A;  3ULC A;  1FGZ A;  4HAY B;  4A5K A;  4CHJ A;  1XOD A;  1KZ7 A;  1WVH A;  2RGN B;  2YS3 A;  1WJM A;  1TJ6 A;  1EAZ A;  5JHG A;  2D9V A;  1XD4 A;  4TYZ A;  1M7E A;  2MFQ A;  1W1D A;  3GYP A;  2ZPY A;  1J0W A;  2D9W A;  2DN6 A;  3UZT A;  5JP4 A;  2NMB A;  3MDB C;  4HDO A;  1RJ2 A;  1NI2 A;  1UPQ A;  3PP2 A;  4HB0 B;  1RRP B;  2KUP A;  3P6A A;  1V88 A;  4BBK A;  1WGQ A;  4GPT B;  2QKL A;  2P0H A;  5D3X A;  3QIJ A;  1TQZ A;  4NSW A;  4EKU A;  1SHC A;  1WJ1 A;  5FI0 A;  5KCV A;  3D8F A;  1PMS A;  4Y94 A;  1GC7 A;  2UZS A;  1XCG A;  2J0M A;  1ZC4 B;  4GZU A;  2K00 A;  1BAK A;  1GC6 A;  1SGH A;  3IVF A;  3PSC A;  3TFM A;  3D8E A;  2AEH A;  3TO1 A;  4WVF B;  4HB4 B;  5DH9 B;  2UZR A;  1U5G A;  2D11 A;  1TXD A;  1ZVR A;  1FAO A;  2PZ1 A;  2KCJ A;  2W2W A;  3KRW A;  1MKE A;  3U8Z A;  1EGX A;  2OTX A;  4KHO A;  1U27 A;  4HB2 B;  3TCA A;  4HAW B;  1H4R A;  3F0W A;  4HAV B;  3BJI A;  2MDX A;  4ZRI A;  2KGX B;  2L2I A;  2ROV A;  3GYO A;  3HQC A;  3PVL A;  2BCJ A;  2GCJ A;  3AU5 A;  3KSY A;  3SYX A;  1UPR A;  2RLO A;  2VKI A;  1X05 A;  4C0A A;  2DKP A;  4XWX A;  2ELB A;  4K17 A;  4HDQ A;  5J3T A;  1W1G A;  4HAT B;  1DDV A;  2HTH B;  4F7U P;  2DX1 A;  4PNK A;  4EMO A;  2HE7 A;  2YSZ A;  3PZD A;  2I5F A;  1FHO A;  2EMT A;  1OMW A;  1P5T A;  5HE2 A;  2K2U A;  2I1K A;  1FOE A;  5HE3 A;  2COA A;  2Q13 A;  2DHI A;  2X18 A;  1P6S A;  2D2Q A;  2XQN M;  3MPX A;  1WG7 A;  2D4Q A;  4CYE A;  1QC6 A;  3KRX A;  3NSU A;  3P7Z A;  3LJU X;  2LKO A;  2RUK B;  4ZRK A;  3F5R A;  2J0K A;  5J3Y A;  2JP2 A;  5JHH A;  1K5G B;  4DX9 0;  2DHK A;  1BTK A;  4TKN A;  2DTC A;  2LUL A;  3WYF B;  2W2X C;  3VIA A;  2CRF A;  4A6K A;  1LW3 A;  2M14 A;  1QQG A;  2GCL A;  1V5P A;  2YS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...