1M7EA

Crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Disabled homolog 2
total genus 50
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1m7eA00
2D11A 2EC1A 4ZRJA 2DHIA 1V5UA 3FSSA 1X86A 3M1IB 1KZGA 1NU2A 2AL6A 1MK9B 1ZC3B 4NSWA 1P5TA 1N3HA 2Q13A 3DXDA 5CLQB 5LONB 2OQBA 1H4RA 1MKEA 4K2OA 2YS1A 4TYZA 2K2JA 1QQGA 4GZUA 3U7DA 1LW3A 3SNHA 2YVCA 4HB0B 2EMSA 1FHWA 2I5FA 2DX1A 1OY2A 1GG3A 1KZ7A 2W2WA 5D3VA 5HE1A 3ZDTA 1AWEA 5DIFB 3VIAA 2D9VA 5J3YA 1H10A 4Z2MB 2RVBB 4A6FB 1QC6A 1MK7B 1ZVRA 2YS3A 2K00A 2RLOA 4CHMA 1U27A 4HB4B 3HW2B 2AEHA 1M7EA 4K2PA 1FAOA 1K5DB 1MAIA 2VSZA 1UNRA 1P6SA 2D9YA 1W1HA 4GMXB 4PNKA 3ZVRA 3PZDA 2W2XC 4HB2B 3QIJA 1X1FA 2GCLA 5C5BB 5HE3A 3ULCA 2Y7BA 5JHGA 1WJ1A 1DBHA 2ZPYA 1XCGA 3AU4A 4WVFB 3V5WA 4KHAA 1J0WA 2P0HA 4C0AA 5J3TA 4HAVB 5FI1A 3KZ1A 3ULBA 4Y94A 5EFXA 5JLJB 2GS0A 2DYNA 1X11A 2PZ1A 4H8SA 1BTNA 2Z0OA 2YT0A 2Y8GA 1I7AA 3A8PA 4KVGB 4L6EA 2DKQA 2LOZA 2HTHB 2J59M 2P0FA 4HAZB 4CYEA 1BAKA 1DDMA 5C5BA 1WGQA 4MY6A 4YONA 1WI1A 2N0YA 1DDVA 1U29A 4A6HA 2Z0QA 2K2UA 2RUKB 3U8ZA 2ROVA 4GXBA 3DXEA 1MIXA 3LJUX 2LULA 3TVVA 2L1CA 3ODOA 3SYXA 4F7HA 2ELBA 4EJNA 1U5EA 4GMVA 4HHVA 1V88A 3A8QA 2MWNB 1SGHA 1UNPA 5C79A 4XWXA 5KQ4A 2R0DA 2COAA 4A6FA 3G9WA 4HB3B 3D8FA 1ISNA 3TCAA 1W1GA 2M14A 2VRWB 4HAXB 5KQ1A 5JHHA 2MDXA 4ZRIA 4CHJA 1TJ6A 4P7IA 2L2IA 5D27A 5CLLB 2IFSA 1X05A 2EMTA 2MFQA 2DN6A 3SV1A 1Y5OA 4A5KA 4KAXB 3ODWA 3TW1A 2M38A 3IVFA 3HQCA 3NSUA 2LKOA 1TXDA 2I1KA 3WYFB 4F7GA 2V76A 1XKEA 2RSGA 4KHBB 2YF0A 3QBVB 4Z2NA 4HAUB 2KGXB 2ELAA 1I2HA 1M7RA 1EVHA 3X23A 4A6KA 2BCJA 2YS5A 4YL8A 2UVMA 4IAPA 1ZC4B 2CY5A 4HDQA 2X18A 2D10A 1GC7A 1U5DA 5DI9B 1ZM0A 1V5PA 5C6RA 3P6AA 4GN1A 3SO6A 3PSCA 4MK0A 3P7ZA 1BWNA 1XD4A 3GYPA 1FHOA 1AQCA 1FHXA 2XQNM 1UPRA 3MDBC 1FGZA 1NI2A 1NTVA 3AU5A 3FM8C 2DHJA 4IFSA 4HDOA 3N7CA 5HE0A 2CAYA 2DTCA 3AJ4A 4HATB 2CY4A 3GYOA 3HK0A 4D0NB 1XR0B 5LOPB 2COCA 3WA0A 3BINA 2LOXA 4K81A 2NZ8B 2Z0PA 1PFJA 5DHFB 2H7DA 3DXCA 1U5GA 3T06A 1B55A 1BTKA 1EGXA 5D3WA 3TO1A 1RJ2A 4DXAB 5FI0A 5JP4A 2ADZA 2DA0A 3OANA 2NMBA 2D9ZA 1TQZA 4WJ7A 2RNRB 3D8DA 2P8VA 1LB1A 1EAZA 5C16A 2KCJA 4BBKA 2I5CA 2VKIA 2DX5A 1FB8A 1KI1B 1XODA 2DHKA 1MIZB 3O96A 1V5MA 2IYBA 2UZSA 1P3RA 2G35A 5DHAB 2HE7A 2ROZB 2GJYA 4DX90 2QKMA 4MT7A 2YSZA 4WSFA 1NTYA 1WVHA 5D3XA 1ZSQA 3SUZA 4DX8A 3FEHA 5GOWB 3ODXA 2D4QA 1SHCA 1J19A 3MPXA 2YT1A 4B6HA 5DH9B 3ML4A 2H7EA 3KY9A 1MPHA 2LG1A 4KHOA 3UZTA 2CODA 4IOYX 2FJLA 1UEFA 4K17A 3CXBB 4F7UP 2DFKA 1WGUA 2GCJA 3A98B 2CRFA 3PG7A 5J3QA 3PP2A 2P0DA 4HAWB 2J0JA 2MKRA 3KRXA 1PLSA 4DBBA 3VOQA 1Z87A 1V61A 1PMSA 1WJMA 3PVUA 2KUPA 1X1GA 1DROA 3TFMA 4HAYB 1U2BA 4EMOA 2D2QA 2JP2A 5L81A 3PEGA 3RCPA 5KCVA 1K5GB 1EF1A 3PVLA 1WG7A 4NY0A 2J0KA 3KSYA 1DYNA 2DLWA 2LYDA 1IRSA 2YRYA 2E2XA 3CIKA 3PVWA 1XX0A 1OQNA 2QKLA 4GPTB 1GC6A 3D8EA 1V89A 2UZRA 2DKPA 2R09A 3F5RA 4TKNA 1DDWA 1Y19B 1UPQA 2RGNB 2DYQA 2Y8FA 2W2XD 5HE2A 2D9XA 3QWMA 2OTXA 2D9WA 2N23A 1RRPB 1OMWA 3F0WA 4PQ0A 2J0MA 5D3YA 2EJ8A 1E5WA 4EKUA 1FOEA 1UNQA 1Q67A 3BJIA 1U5FA 1W1DA 3KRWA 1FGYA 2COFA 2I1JA 4ZRKA
chains in the Genus database with same CATH superfamily
2D11A 2EC1A 4ZRJA 2DHIA 1V5UA 3FSSA 1X86A 3M1IB 3NWAA 1KZGA 1NU2A 2AL6A 1MK9B 1ZC3B 4NSWA 1P5TA 1N3HA 2Q13A 3DXDA 5CLQB 5LONB 2OQBA 1H4RA 1MKEA 4K2OA 2YS1A 4TYZA 2K2JA 1QQGA 4GZUA 3U7DA 1LW3A 3SNHA 2YVCA 4QXAB 4HB0B 2EMSA 1FHWA 2I5FA 2DX1A 1OY2A 1GG3A 1KZ7A 2W2WA 5D3VA 5HE1A 3ZDTA 1AWEA 5DIFB 3VIAA 2GUMA 2D9VA 5J3YA 1H10A 4Z2MB 2K8EA 2RVBB 4A6FB 1QC6A 1MK7B 1ZVRA 5I2MA 2YS3A 2K00A 2RLOA 4CHMA 1U27A 4HB4B 3HW2B 2AEHA 1M7EA 4K2PA 1FAOA 1K5DB 1MAIA 2K49A 2VSZA 1UNRA 1P6SA 2D9YA 2KR0A 1W1HA 5LG4B 4GMXB 4PNKA 3ZVRA 3PZDA 2W2XC 4HB2B 3QIJA 1X1FA 2GCLA 5C5BB 5HE3A 3ULCA 2Y7BA 5JHGA 1WJ1A 1DBHA 2ZPYA 1XCGA 3AU4A 4WVFB 3V5WA 4KHAA 1J0WA 2P0HA 4C0AA 5IRSA 5J3TA 4HAVB 5FI1A 3KZ1A 3ULBA 4Y94A 5EFXA 5JLJB 1MI1A 2GS0A 2DYNA 1X11A 2PZ1A 4KHBA 4H8SA 1BTNA 4QJ4B 2Z0OA 2YT0A 2Y8GA 1I7AA 3A8PA 4CSQA 4KVGB 4L6EA 2DKQA 2LOZA 2HTHB 2J59M 2P0FA 4HAZB 4CYEA 1BAKA 1DDMA 5C5BA 1WGQA 4MY6A 4YONA 2FJUB 1WI1A 2N0YA 1DDVA 1U29A 3HSAA 4A6HA 2Z0QA 4DIXA 2K2UA 2RUKB 3U8ZA 4OSNA 2ROVA 4GXBA 3DXEA 1MIXA 3HIEA 3LJUX 2LULA 3TVVA 2L1CA 3ODOA 3SYXA 4F7HA 2ELBA 4QJ5B 4EJNA 1U5EA 3B77A 4GMVA 4HHVA 1V88A 3A8QA 4GOUA 2MWNB 1SGHA 1UNPA 5C79A 4XWXA 5KQ4A 2R0DA 2COAA 4A6FA 3G9WA 4HB3B 2KIEA 3D8FA 1ISNA 3TCAA 1W1GA 2M14A 2VRWB 4HAXB 5KQ1A 5JHHA 2MDXA 4ZRIA 4CHJA 1TJ6A 4P7IA 2L2IA 5D27A 5CLLB 2IFSA 1X05A 2EMTA 2MFQA 2DN6A 3SV1A 2Z59A 1Y5OA 4A5KA 4KAXB 3ODWA 3TW1A 2M38A 3IVFA 3HQCA 3NSUA 2LKOA 1TXDA 2I1KA 3WYFB 4F7GA 2V76A 1XKEA 2RSGA 4KHBB 2YF0A 3QBVB 4Z2NA 4HAUB 2KGXB 2ELAA 1I2HA 1M7RA 1EVHA 3X23A 4A6KA 2BCJA 2YS5A 4YL8A 2UVMA 4IAPA 1ZC4B 2CY5A 3NWDA 4HDQA 2X18A 2D10A 1GC7A 1U5DA 5DI9B 1ZM0A 1V5PA 2KUQA 5C6RA 3P6AA 4GN1A 3SO6A 3PSCA 4MK0A 3P7ZA 1BWNA 1XD4A 5I2SA 3GYPA 1FHOA 1AQCA 1FHXA 2XQNM 1UPRA 3MDBC 1FGZA 1NI2A 1NTVA 3AU5A 3FM8C 2DHJA 4IFSA 4HDOA 3N7CA 5HE0A 3U12A 2CAYA 2DTCA 3AJ4A 2NBVA 4HATB 2CY4A 3GYOA 3HK0A 1T77A 4D0NB 1XR0B 5LOPB 1ZYIA 2COCA 3WA0A 3BINA 2LOXA 4K81A 2NZ8B 2Z0PA 2KIGA 1PFJA 5DHFB 2H7DA 3DXCA 1U5GA 2Z4DA 3T06A 1B55A 1BTKA 1EGXA 5D3WA 3TO1A 1RJ2A 4DXAB 5FI0A 5JP4A 2ADZA 2DA0A 3OANA 2NMBA 2D9ZA 4D6WA 1TQZA 2Z13A 4WJ7A 2RNRB 2R2YA 3D8DA 2P8VA 1LB1A 1EAZA 5C16A 2KCJA 4BBKA 2I5CA 2VKIA 2DX5A 1FB8A 1KI1B 1XODA 2DHKA 1MIZB 3O96A 1V5MA 2IYBA 2UZSA 1P3RA 2G35A 4GNKB 5DHAB 2HE7A 2ROZB 2GJYA 4DX90 4OT1A 2QKMA 4MT7A 2YSZA 4WSFA 1NTYA 1WVHA 5D3XA 4QJ3B 1ZSQA 3SUZA 4DX8A 3FEHA 5GOWB 3ODXA 2D4QA 1SHCA 1J19A 3MPXA 2YT1A 4B6HA 5DH9B 3ML4A 2H7EA 3KY9A 3FVCA 1MPHA 2LG1A 4KHOA 3UZTA 2CODA 4IOYX 2FJLA 1UEFA 4K17A 3CXBB 2Z14A 2DFKA 4F7UP 1WGUA 2GCJA 3A98B 2CRFA 3OHMB 3PG7A 5J3QA 3PP2A 2P0DA 4HAWB 2J0JA 2MKRA 3KRXA 3NW8A 1PLSA 4DBBA 3VOQA 1Z87A 1V61A 2RRFA 1PMSA 1WJMA 3PVUA 2KUPA 1X1GA 1DROA 3TFMA 4HAYB 1U2BA 4EMOA 2D2QA 2JP2A 5L81A 2YT2A 3PEGA 3RCPA 5KCVA 1K5GB 1EF1A 3PVLA 1WG7A 4NY0A 2J0KA 5M4YB 3KSYA 1DYNA 2DLWA 2LYDA 1IRSA 2YRYA 2E2XA 3DCXA 3CIKA 3PVWA 1XX0A 1OQNA 2QKLA 4GPTB 1GC6A 4HSIA 3A58A 3D8EA 1V89A 2ZKMX 2UZRA 2DKPA 2R09A 4L1RA 3F5RA 4TKNA 1DDWA 1Y19B 1UPQA 2RGNB 2DYQA 2Y8FA 2W2XD 5HE2A 2D9XA 3QWMA 2OTXA 2D9WA 3NWFA 2N23A 1RRPB 1OMWA 3F0WA 4PQ0A 2J0MA 5D3YA 2EJ8A 1E5WA 4EKUA 1FOEA 1UNQA 1Q67A 3BJIA 1U5FA 1W1DA 3KRWA 1FGYA 2COFA 2I1JA 4ZRKA
chains in the Genus database with same CATH topology
2D11A 2EC1A 4ZRJA 2DHIA 1V5UA 3FSSA 1X86A 3M1IB 1KZGA 1NU2A 2AL6A 1MK9B 1ZC3B 4NSWA 1P5TA 1N3HA 2Q13A 3DXDA 5CLQB 5LONB 2OQBA 1H4RA 1MKEA 4K2OA 2YS1A 4TYZA 2K2JA 1QQGA 4GZUA 3U7DA 1LW3A 3SNHA 2YVCA 4HB0B 2EMSA 1FHWA 2I5FA 2DX1A 1OY2A 1GG3A 1KZ7A 2W2WA 5D3VA 5HE1A 3ZDTA 1AWEA 5DIFB 3VIAA 2D9VA 5J3YA 1H10A 4Z2MB 2RVBB 4A6FB 1QC6A 1MK7B 1ZVRA 2YS3A 2K00A 2RLOA 4CHMA 1U27A 4HB4B 3HW2B 2AEHA 1M7EA 4K2PA 1FAOA 1K5DB 1MAIA 2VSZA 1UNRA 1P6SA 2D9YA 1W1HA 4GMXB 4PNKA 3ZVRA 3PZDA 2W2XC 4HB2B 3QIJA 1X1FA 2GCLA 5C5BB 5HE3A 3ULCA 2Y7BA 5JHGA 1WJ1A 1DBHA 2ZPYA 1XCGA 3AU4A 4WVFB 3V5WA 4KHAA 1J0WA 2P0HA 4C0AA 5J3TA 4HAVB 5FI1A 3KZ1A 3ULBA 4Y94A 5EFXA 5JLJB 2GS0A 2DYNA 1X11A 2PZ1A 4H8SA 1BTNA 2Z0OA 2YT0A 2Y8GA 1I7AA 3A8PA 4KVGB 4L6EA 2DKQA 2LOZA 2HTHB 2J59M 2P0FA 4HAZB 4CYEA 1BAKA 1DDMA 5C5BA 1WGQA 4MY6A 4YONA 1WI1A 2N0YA 1DDVA 1U29A 4A6HA 2Z0QA 2K2UA 2RUKB 3U8ZA 2ROVA 4GXBA 3DXEA 1MIXA 3LJUX 2LULA 3TVVA 2L1CA 3ODOA 3SYXA 4F7HA 2ELBA 4EJNA 1U5EA 4GMVA 4HHVA 1V88A 3A8QA 2MWNB 1SGHA 1UNPA 5C79A 4XWXA 5KQ4A 2R0DA 2COAA 4A6FA 3G9WA 4HB3B 3D8FA 1ISNA 3TCAA 1W1GA 2M14A 2VRWB 4HAXB 5KQ1A 5JHHA 2MDXA 4ZRIA 4CHJA 1TJ6A 4P7IA 2L2IA 5D27A 5CLLB 2IFSA 1X05A 2EMTA 2MFQA 2DN6A 3SV1A 1Y5OA 4A5KA 4KAXB 3ODWA 3TW1A 2M38A 3IVFA 3HQCA 3NSUA 2LKOA 1TXDA 2I1KA 3WYFB 4F7GA 2V76A 1XKEA 2RSGA 4KHBB 2YF0A 3QBVB 4Z2NA 4HAUB 2KGXB 2ELAA 1I2HA 1M7RA 1EVHA 3X23A 4A6KA 2BCJA 2YS5A 4YL8A 2UVMA 4IAPA 1ZC4B 2CY5A 4HDQA 2X18A 2D10A 1GC7A 1U5DA 5DI9B 1ZM0A 1V5PA 5C6RA 3P6AA 4GN1A 3SO6A 3PSCA 4MK0A 3P7ZA 1BWNA 1XD4A 3GYPA 1FHOA 1AQCA 1FHXA 2XQNM 1UPRA 3MDBC 1FGZA 1NI2A 1NTVA 3AU5A 3FM8C 2DHJA 4IFSA 4HDOA 3N7CA 5HE0A 2CAYA 2DTCA 3AJ4A 4HATB 2CY4A 3GYOA 3HK0A 4D0NB 1XR0B 5LOPB 2COCA 3WA0A 3BINA 2LOXA 4K81A 2NZ8B 2Z0PA 1PFJA 5DHFB 2H7DA 3DXCA 1U5GA 3T06A 1B55A 1BTKA 1EGXA 5D3WA 3TO1A 1RJ2A 4DXAB 5FI0A 5JP4A 2ADZA 2DA0A 3OANA 2NMBA 2D9ZA 1TQZA 4WJ7A 2RNRB 3D8DA 2P8VA 1LB1A 1EAZA 5C16A 2KCJA 4BBKA 2I5CA 2VKIA 2DX5A 1FB8A 1KI1B 1XODA 2DHKA 1MIZB 3O96A 1V5MA 2IYBA 2UZSA 1P3RA 2G35A 5DHAB 2HE7A 2ROZB 2GJYA 4DX90 2QKMA 4MT7A 2YSZA 4WSFA 1NTYA 1WVHA 5D3XA 1ZSQA 3SUZA 4DX8A 3FEHA 5GOWB 3ODXA 2D4QA 1SHCA 1J19A 3MPXA 2YT1A 4B6HA 5DH9B 3ML4A 2H7EA 3KY9A 1MPHA 2LG1A 4KHOA 3UZTA 2CODA 4IOYX 2FJLA 1UEFA 4K17A 3CXBB 4F7UP 2DFKA 1WGUA 2GCJA 3A98B 2CRFA 3PG7A 5J3QA 3PP2A 2P0DA 4HAWB 2J0JA 2MKRA 3KRXA 1PLSA 4DBBA 3VOQA 1Z87A 1V61A 1PMSA 1WJMA 3PVUA 2KUPA 1X1GA 1DROA 3TFMA 4HAYB 1U2BA 4EMOA 2D2QA 2JP2A 5L81A 3PEGA 3RCPA 5KCVA 1K5GB 1EF1A 3PVLA 1WG7A 4NY0A 2J0KA 3KSYA 1DYNA 2DLWA 2LYDA 1IRSA 2YRYA 2E2XA 3CIKA 3PVWA 1XX0A 1OQNA 2QKLA 4GPTB 1GC6A 3D8EA 1V89A 2UZRA 2DKPA 2R09A 3F5RA 4TKNA 1DDWA 1Y19B 1UPQA 2RGNB 2DYQA 2Y8FA 2W2XD 5HE2A 2D9XA 3QWMA 2OTXA 2D9WA 2N23A 1RRPB 1OMWA 3F0WA 4PQ0A 2J0MA 5D3YA 2EJ8A 1E5WA 4EKUA 1FOEA 1UNQA 1Q67A 3BJIA 1U5FA 1W1DA 3KRWA 1FGYA 2COFA 2I1JA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D11 A;  2EC1 A;  4ZRJ A;  2DHI A;  1V5U A;  3FSS A;  1X86 A;  3M1I B;  1KZG A;  1NU2 A;  2AL6 A;  1MK9 B;  1ZC3 B;  4NSW A;  1P5T A;  1N3H A;  2Q13 A;  3DXD A;  5CLQ B;  5LON B;  2OQB A;  1H4R A;  1MKE A;  4K2O A;  2YS1 A;  4TYZ A;  2K2J A;  1QQG A;  4GZU A;  3U7D A;  1LW3 A;  3SNH A;  2YVC A;  4HB0 B;  2EMS A;  1FHW A;  2I5F A;  2DX1 A;  1OY2 A;  1GG3 A;  1KZ7 A;  2W2W A;  5D3V A;  5HE1 A;  3ZDT A;  1AWE A;  5DIF B;  3VIA A;  2D9V A;  5J3Y A;  1H10 A;  4Z2M B;  2RVB B;  4A6F B;  1QC6 A;  1MK7 B;  1ZVR A;  2YS3 A;  2K00 A;  2RLO A;  4CHM A;  1U27 A;  4HB4 B;  3HW2 B;  2AEH A;  1M7E A;  4K2P A;  1FAO A;  1K5D B;  1MAI A;  2VSZ A;  1UNR A;  1P6S A;  2D9Y A;  1W1H A;  4GMX B;  4PNK A;  3ZVR A;  3PZD A;  2W2X C;  4HB2 B;  3QIJ A;  1X1F A;  2GCL A;  5C5B B;  5HE3 A;  3ULC A;  2Y7B A;  5JHG A;  1WJ1 A;  1DBH A;  2ZPY A;  1XCG A;  3AU4 A;  4WVF B;  3V5W A;  4KHA A;  1J0W A;  2P0H A;  4C0A A;  5J3T A;  4HAV B;  5FI1 A;  3KZ1 A;  3ULB A;  4Y94 A;  5EFX A;  5JLJ B;  2GS0 A;  2DYN A;  1X11 A;  2PZ1 A;  4H8S A;  1BTN A;  2Z0O A;  2YT0 A;  2Y8G A;  1I7A A;  3A8P A;  4KVG B;  4L6E A;  2DKQ A;  2LOZ A;  2HTH B;  2J59 M;  2P0F A;  4HAZ B;  4CYE A;  1BAK A;  1DDM A;  5C5B A;  1WGQ A;  4MY6 A;  4YON A;  1WI1 A;  2N0Y A;  1DDV A;  1U29 A;  4A6H A;  2Z0Q A;  2K2U A;  2RUK B;  3U8Z A;  2ROV A;  4GXB A;  3DXE A;  1MIX A;  3LJU X;  2LUL A;  3TVV A;  2L1C A;  3ODO A;  3SYX A;  4F7H A;  2ELB A;  4EJN A;  1U5E A;  4GMV A;  4HHV A;  1V88 A;  3A8Q A;  2MWN B;  1SGH A;  1UNP A;  5C79 A;  4XWX A;  5KQ4 A;  2R0D A;  2COA A;  4A6F A;  3G9W A;  4HB3 B;  3D8F A;  1ISN A;  3TCA A;  1W1G A;  2M14 A;  2VRW B;  4HAX B;  5KQ1 A;  5JHH A;  2MDX A;  4ZRI A;  4CHJ A;  1TJ6 A;  4P7I A;  2L2I A;  5D27 A;  5CLL B;  2IFS A;  1X05 A;  2EMT A;  2MFQ A;  2DN6 A;  3SV1 A;  1Y5O A;  4A5K A;  4KAX B;  3ODW A;  3TW1 A;  2M38 A;  3IVF A;  3HQC A;  3NSU A;  2LKO A;  1TXD A;  2I1K A;  3WYF B;  4F7G A;  2V76 A;  1XKE A;  2RSG A;  4KHB B;  2YF0 A;  3QBV B;  4Z2N A;  4HAU B;  2KGX B;  2ELA A;  1I2H A;  1M7R A;  1EVH A;  3X23 A;  4A6K A;  2BCJ A;  2YS5 A;  4YL8 A;  2UVM A;  4IAP A;  1ZC4 B;  2CY5 A;  4HDQ A;  2X18 A;  2D10 A;  1GC7 A;  1U5D A;  5DI9 B;  1ZM0 A;  1V5P A;  5C6R A;  3P6A A;  4GN1 A;  3SO6 A;  3PSC A;  4MK0 A;  3P7Z A;  1BWN A;  1XD4 A;  3GYP A;  1FHO A;  1AQC A;  1FHX A;  2XQN M;  1UPR A;  3MDB C;  1FGZ A;  1NI2 A;  1NTV A;  3AU5 A;  3FM8 C;  2DHJ A;  4IFS A;  4HDO A;  3N7C A;  5HE0 A;  2CAY A;  2DTC A;  3AJ4 A;  4HAT B;  2CY4 A;  3GYO A;  3HK0 A;  4D0N B;  1XR0 B;  5LOP B;  2COC A;  3WA0 A;  3BIN A;  2LOX A;  4K81 A;  2NZ8 B;  2Z0P A;  1PFJ A;  5DHF B;  2H7D A;  3DXC A;  1U5G A;  3T06 A;  1B55 A;  1BTK A;  1EGX A;  5D3W A;  3TO1 A;  1RJ2 A;  4DXA B;  5FI0 A;  5JP4 A;  2ADZ A;  2DA0 A;  3OAN A;  2NMB A;  2D9Z A;  1TQZ A;  4WJ7 A;  2RNR B;  3D8D A;  2P8V A;  1LB1 A;  1EAZ A;  5C16 A;  2KCJ A;  4BBK A;  2I5C A;  2VKI A;  2DX5 A;  1FB8 A;  1KI1 B;  1XOD A;  2DHK A;  1MIZ B;  3O96 A;  1V5M A;  2IYB A;  2UZS A;  1P3R A;  2G35 A;  5DHA B;  2HE7 A;  2ROZ B;  2GJY A;  4DX9 0;  2QKM A;  4MT7 A;  2YSZ A;  4WSF A;  1NTY A;  1WVH A;  5D3X A;  1ZSQ A;  3SUZ A;  4DX8 A;  3FEH A;  5GOW B;  3ODX A;  2D4Q A;  1SHC A;  1J19 A;  3MPX A;  2YT1 A;  4B6H A;  5DH9 B;  3ML4 A;  2H7E A;  3KY9 A;  1MPH A;  2LG1 A;  4KHO A;  3UZT A;  2COD A;  4IOY X;  2FJL A;  1UEF A;  4K17 A;  3CXB B;  4F7U P;  2DFK A;  1WGU A;  2GCJ A;  3A98 B;  2CRF A;  3PG7 A;  5J3Q A;  3PP2 A;  2P0D A;  4HAW B;  2J0J A;  2MKR A;  3KRX A;  1PLS A;  4DBB A;  3VOQ A;  1Z87 A;  1V61 A;  1PMS A;  1WJM A;  3PVU A;  2KUP A;  1X1G A;  1DRO A;  3TFM A;  4HAY B;  1U2B A;  4EMO A;  2D2Q A;  2JP2 A;  5L81 A;  3PEG A;  3RCP A;  5KCV A;  1K5G B;  1EF1 A;  3PVL A;  1WG7 A;  4NY0 A;  2J0K A;  3KSY A;  1DYN A;  2DLW A;  2LYD A;  1IRS A;  2YRY A;  2E2X A;  3CIK A;  3PVW A;  1XX0 A;  1OQN A;  2QKL A;  4GPT B;  1GC6 A;  3D8E A;  1V89 A;  2UZR A;  2DKP A;  2R09 A;  3F5R A;  4TKN A;  1DDW A;  1Y19 B;  1UPQ A;  2RGN B;  2DYQ A;  2Y8F A;  2W2X D;  5HE2 A;  2D9X A;  3QWM A;  2OTX A;  2D9W A;  2N23 A;  1RRP B;  1OMW A;  3F0W A;  4PQ0 A;  2J0M A;  5D3Y A;  2EJ8 A;  1E5W A;  4EKU A;  1FOE A;  1UNQ A;  1Q67 A;  3BJI A;  1U5F A;  1W1D A;  3KRW A;  1FGY A;  2COF A;  2I1J A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 2D11 A;  2EC1 A;  4ZRJ A;  2DHI A;  1V5U A;  3FSS A;  1X86 A;  3M1I B;  3NWA A;  1KZG A;  1NU2 A;  2AL6 A;  1MK9 B;  1ZC3 B;  4NSW A;  1P5T A;  1N3H A;  2Q13 A;  3DXD A;  5CLQ B;  5LON B;  2OQB A;  1H4R A;  1MKE A;  4K2O A;  2YS1 A;  4TYZ A;  2K2J A;  1QQG A;  4GZU A;  3U7D A;  1LW3 A;  3SNH A;  2YVC A;  4QXA B;  4HB0 B;  2EMS A;  1FHW A;  2I5F A;  2DX1 A;  1OY2 A;  1GG3 A;  1KZ7 A;  2W2W A;  5D3V A;  5HE1 A;  3ZDT A;  1AWE A;  5DIF B;  3VIA A;  2GUM A;  2D9V A;  5J3Y A;  1H10 A;  4Z2M B;  2K8E A;  2RVB B;  4A6F B;  1QC6 A;  1MK7 B;  1ZVR A;  5I2M A;  2YS3 A;  2K00 A;  2RLO A;  4CHM A;  1U27 A;  4HB4 B;  3HW2 B;  2AEH A;  1M7E A;  4K2P A;  1FAO A;  1K5D B;  1MAI A;  2K49 A;  2VSZ A;  1UNR A;  1P6S A;  2D9Y A;  2KR0 A;  1W1H A;  5LG4 B;  4GMX B;  4PNK A;  3ZVR A;  3PZD A;  2W2X C;  4HB2 B;  3QIJ A;  1X1F A;  2GCL A;  5C5B B;  5HE3 A;  3ULC A;  2Y7B A;  5JHG A;  1WJ1 A;  1DBH A;  2ZPY A;  1XCG A;  3AU4 A;  4WVF B;  3V5W A;  4KHA A;  1J0W A;  2P0H A;  4C0A A;  5IRS A;  5J3T A;  4HAV B;  5FI1 A;  3KZ1 A;  3ULB A;  4Y94 A;  5EFX A;  5JLJ B;  1MI1 A;  2GS0 A;  2DYN A;  1X11 A;  2PZ1 A;  4KHB A;  4H8S A;  1BTN A;  4QJ4 B;  2Z0O A;  2YT0 A;  2Y8G A;  1I7A A;  3A8P A;  4CSQ A;  4KVG B;  4L6E A;  2DKQ A;  2LOZ A;  2HTH B;  2J59 M;  2P0F A;  4HAZ B;  4CYE A;  1BAK A;  1DDM A;  5C5B A;  1WGQ A;  4MY6 A;  4YON A;  2FJU B;  1WI1 A;  2N0Y A;  1DDV A;  1U29 A;  3HSA A;  4A6H A;  2Z0Q A;  4DIX A;  2K2U A;  2RUK B;  3U8Z A;  4OSN A;  2ROV A;  4GXB A;  3DXE A;  1MIX A;  3HIE A;  3LJU X;  2LUL A;  3TVV A;  2L1C A;  3ODO A;  3SYX A;  4F7H A;  2ELB A;  4QJ5 B;  4EJN A;  1U5E A;  3B77 A;  4GMV A;  4HHV A;  1V88 A;  3A8Q A;  4GOU A;  2MWN B;  1SGH A;  1UNP A;  5C79 A;  4XWX A;  5KQ4 A;  2R0D A;  2COA A;  4A6F A;  3G9W A;  4HB3 B;  2KIE A;  3D8F A;  1ISN A;  3TCA A;  1W1G A;  2M14 A;  2VRW B;  4HAX B;  5KQ1 A;  5JHH A;  2MDX A;  4ZRI A;  4CHJ A;  1TJ6 A;  4P7I A;  2L2I A;  5D27 A;  5CLL B;  2IFS A;  1X05 A;  2EMT A;  2MFQ A;  2DN6 A;  3SV1 A;  2Z59 A;  1Y5O A;  4A5K A;  4KAX B;  3ODW A;  3TW1 A;  2M38 A;  3IVF A;  3HQC A;  3NSU A;  2LKO A;  1TXD A;  2I1K A;  3WYF B;  4F7G A;  2V76 A;  1XKE A;  2RSG A;  4KHB B;  2YF0 A;  3QBV B;  4Z2N A;  4HAU B;  2KGX B;  2ELA A;  1I2H A;  1M7R A;  1EVH A;  3X23 A;  4A6K A;  2BCJ A;  2YS5 A;  4YL8 A;  2UVM A;  4IAP A;  1ZC4 B;  2CY5 A;  3NWD A;  4HDQ A;  2X18 A;  2D10 A;  1GC7 A;  1U5D A;  5DI9 B;  1ZM0 A;  1V5P A;  2KUQ A;  5C6R A;  3P6A A;  4GN1 A;  3SO6 A;  3PSC A;  4MK0 A;  3P7Z A;  1BWN A;  1XD4 A;  5I2S A;  3GYP A;  1FHO A;  1AQC A;  1FHX A;  2XQN M;  1UPR A;  3MDB C;  1FGZ A;  1NI2 A;  1NTV A;  3AU5 A;  3FM8 C;  2DHJ A;  4IFS A;  4HDO A;  3N7C A;  5HE0 A;  3U12 A;  2CAY A;  2DTC A;  3AJ4 A;  2NBV A;  4HAT B;  2CY4 A;  3GYO A;  3HK0 A;  1T77 A;  4D0N B;  1XR0 B;  5LOP B;  1ZYI A;  2COC A;  3WA0 A;  3BIN A;  2LOX A;  4K81 A;  2NZ8 B;  2Z0P A;  2KIG A;  1PFJ A;  5DHF B;  2H7D A;  3DXC A;  1U5G A;  2Z4D A;  3T06 A;  1B55 A;  1BTK A;  1EGX A;  5D3W A;  3TO1 A;  1RJ2 A;  4DXA B;  5FI0 A;  5JP4 A;  2ADZ A;  2DA0 A;  3OAN A;  2NMB A;  2D9Z A;  4D6W A;  1TQZ A;  2Z13 A;  4WJ7 A;  2RNR B;  2R2Y A;  3D8D A;  2P8V A;  1LB1 A;  1EAZ A;  5C16 A;  2KCJ A;  4BBK A;  2I5C A;  2VKI A;  2DX5 A;  1FB8 A;  1KI1 B;  1XOD A;  2DHK A;  1MIZ B;  3O96 A;  1V5M A;  2IYB A;  2UZS A;  1P3R A;  2G35 A;  4GNK B;  5DHA B;  2HE7 A;  2ROZ B;  2GJY A;  4DX9 0;  4OT1 A;  2QKM A;  4MT7 A;  2YSZ A;  4WSF A;  1NTY A;  1WVH A;  5D3X A;  4QJ3 B;  1ZSQ A;  3SUZ A;  4DX8 A;  3FEH A;  5GOW B;  3ODX A;  2D4Q A;  1SHC A;  1J19 A;  3MPX A;  2YT1 A;  4B6H A;  5DH9 B;  3ML4 A;  2H7E A;  3KY9 A;  3FVC A;  1MPH A;  2LG1 A;  4KHO A;  3UZT A;  2COD A;  4IOY X;  2FJL A;  1UEF A;  4K17 A;  3CXB B;  2Z14 A;  2DFK A;  4F7U P;  1WGU A;  2GCJ A;  3A98 B;  2CRF A;  3OHM B;  3PG7 A;  5J3Q A;  3PP2 A;  2P0D A;  4HAW B;  2J0J A;  2MKR A;  3KRX A;  3NW8 A;  1PLS A;  4DBB A;  3VOQ A;  1Z87 A;  1V61 A;  2RRF A;  1PMS A;  1WJM A;  3PVU A;  2KUP A;  1X1G A;  1DRO A;  3TFM A;  4HAY B;  1U2B A;  4EMO A;  2D2Q A;  2JP2 A;  5L81 A;  2YT2 A;  3PEG A;  3RCP A;  5KCV A;  1K5G B;  1EF1 A;  3PVL A;  1WG7 A;  4NY0 A;  2J0K A;  5M4Y B;  3KSY A;  1DYN A;  2DLW A;  2LYD A;  1IRS A;  2YRY A;  2E2X A;  3DCX A;  3CIK A;  3PVW A;  1XX0 A;  1OQN A;  2QKL A;  4GPT B;  1GC6 A;  4HSI A;  3A58 A;  3D8E A;  1V89 A;  2ZKM X;  2UZR A;  2DKP A;  2R09 A;  4L1R A;  3F5R A;  4TKN A;  1DDW A;  1Y19 B;  1UPQ A;  2RGN B;  2DYQ A;  2Y8F A;  2W2X D;  5HE2 A;  2D9X A;  3QWM A;  2OTX A;  2D9W A;  3NWF A;  2N23 A;  1RRP B;  1OMW A;  3F0W A;  4PQ0 A;  2J0M A;  5D3Y A;  2EJ8 A;  1E5W A;  4EKU A;  1FOE A;  1UNQ A;  1Q67 A;  3BJI A;  1U5F A;  1W1D A;  3KRW A;  1FGY A;  2COF A;  2I1J A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 2D11 A;  2EC1 A;  4ZRJ A;  2DHI A;  1V5U A;  3FSS A;  1X86 A;  3M1I B;  1KZG A;  1NU2 A;  2AL6 A;  1MK9 B;  1ZC3 B;  4NSW A;  1P5T A;  1N3H A;  2Q13 A;  3DXD A;  5CLQ B;  5LON B;  2OQB A;  1H4R A;  1MKE A;  4K2O A;  2YS1 A;  4TYZ A;  2K2J A;  1QQG A;  4GZU A;  3U7D A;  1LW3 A;  3SNH A;  2YVC A;  4HB0 B;  2EMS A;  1FHW A;  2I5F A;  2DX1 A;  1OY2 A;  1GG3 A;  1KZ7 A;  2W2W A;  5D3V A;  5HE1 A;  3ZDT A;  1AWE A;  5DIF B;  3VIA A;  2D9V A;  5J3Y A;  1H10 A;  4Z2M B;  2RVB B;  4A6F B;  1QC6 A;  1MK7 B;  1ZVR A;  2YS3 A;  2K00 A;  2RLO A;  4CHM A;  1U27 A;  4HB4 B;  3HW2 B;  2AEH A;  1M7E A;  4K2P A;  1FAO A;  1K5D B;  1MAI A;  2VSZ A;  1UNR A;  1P6S A;  2D9Y A;  1W1H A;  4GMX B;  4PNK A;  3ZVR A;  3PZD A;  2W2X C;  4HB2 B;  3QIJ A;  1X1F A;  2GCL A;  5C5B B;  5HE3 A;  3ULC A;  2Y7B A;  5JHG A;  1WJ1 A;  1DBH A;  2ZPY A;  1XCG A;  3AU4 A;  4WVF B;  3V5W A;  4KHA A;  1J0W A;  2P0H A;  4C0A A;  5J3T A;  4HAV B;  5FI1 A;  3KZ1 A;  3ULB A;  4Y94 A;  5EFX A;  5JLJ B;  2GS0 A;  2DYN A;  1X11 A;  2PZ1 A;  4H8S A;  1BTN A;  2Z0O A;  2YT0 A;  2Y8G A;  1I7A A;  3A8P A;  4KVG B;  4L6E A;  2DKQ A;  2LOZ A;  2HTH B;  2J59 M;  2P0F A;  4HAZ B;  4CYE A;  1BAK A;  1DDM A;  5C5B A;  1WGQ A;  4MY6 A;  4YON A;  1WI1 A;  2N0Y A;  1DDV A;  1U29 A;  4A6H A;  2Z0Q A;  2K2U A;  2RUK B;  3U8Z A;  2ROV A;  4GXB A;  3DXE A;  1MIX A;  3LJU X;  2LUL A;  3TVV A;  2L1C A;  3ODO A;  3SYX A;  4F7H A;  2ELB A;  4EJN A;  1U5E A;  4GMV A;  4HHV A;  1V88 A;  3A8Q A;  2MWN B;  1SGH A;  1UNP A;  5C79 A;  4XWX A;  5KQ4 A;  2R0D A;  2COA A;  4A6F A;  3G9W A;  4HB3 B;  3D8F A;  1ISN A;  3TCA A;  1W1G A;  2M14 A;  2VRW B;  4HAX B;  5KQ1 A;  5JHH A;  2MDX A;  4ZRI A;  4CHJ A;  1TJ6 A;  4P7I A;  2L2I A;  5D27 A;  5CLL B;  2IFS A;  1X05 A;  2EMT A;  2MFQ A;  2DN6 A;  3SV1 A;  1Y5O A;  4A5K A;  4KAX B;  3ODW A;  3TW1 A;  2M38 A;  3IVF A;  3HQC A;  3NSU A;  2LKO A;  1TXD A;  2I1K A;  3WYF B;  4F7G A;  2V76 A;  1XKE A;  2RSG A;  4KHB B;  2YF0 A;  3QBV B;  4Z2N A;  4HAU B;  2KGX B;  2ELA A;  1I2H A;  1M7R A;  1EVH A;  3X23 A;  4A6K A;  2BCJ A;  2YS5 A;  4YL8 A;  2UVM A;  4IAP A;  1ZC4 B;  2CY5 A;  4HDQ A;  2X18 A;  2D10 A;  1GC7 A;  1U5D A;  5DI9 B;  1ZM0 A;  1V5P A;  5C6R A;  3P6A A;  4GN1 A;  3SO6 A;  3PSC A;  4MK0 A;  3P7Z A;  1BWN A;  1XD4 A;  3GYP A;  1FHO A;  1AQC A;  1FHX A;  2XQN M;  1UPR A;  3MDB C;  1FGZ A;  1NI2 A;  1NTV A;  3AU5 A;  3FM8 C;  2DHJ A;  4IFS A;  4HDO A;  3N7C A;  5HE0 A;  2CAY A;  2DTC A;  3AJ4 A;  4HAT B;  2CY4 A;  3GYO A;  3HK0 A;  4D0N B;  1XR0 B;  5LOP B;  2COC A;  3WA0 A;  3BIN A;  2LOX A;  4K81 A;  2NZ8 B;  2Z0P A;  1PFJ A;  5DHF B;  2H7D A;  3DXC A;  1U5G A;  3T06 A;  1B55 A;  1BTK A;  1EGX A;  5D3W A;  3TO1 A;  1RJ2 A;  4DXA B;  5FI0 A;  5JP4 A;  2ADZ A;  2DA0 A;  3OAN A;  2NMB A;  2D9Z A;  1TQZ A;  4WJ7 A;  2RNR B;  3D8D A;  2P8V A;  1LB1 A;  1EAZ A;  5C16 A;  2KCJ A;  4BBK A;  2I5C A;  2VKI A;  2DX5 A;  1FB8 A;  1KI1 B;  1XOD A;  2DHK A;  1MIZ B;  3O96 A;  1V5M A;  2IYB A;  2UZS A;  1P3R A;  2G35 A;  5DHA B;  2HE7 A;  2ROZ B;  2GJY A;  4DX9 0;  2QKM A;  4MT7 A;  2YSZ A;  4WSF A;  1NTY A;  1WVH A;  5D3X A;  1ZSQ A;  3SUZ A;  4DX8 A;  3FEH A;  5GOW B;  3ODX A;  2D4Q A;  1SHC A;  1J19 A;  3MPX A;  2YT1 A;  4B6H A;  5DH9 B;  3ML4 A;  2H7E A;  3KY9 A;  1MPH A;  2LG1 A;  4KHO A;  3UZT A;  2COD A;  4IOY X;  2FJL A;  1UEF A;  4K17 A;  3CXB B;  4F7U P;  2DFK A;  1WGU A;  2GCJ A;  3A98 B;  2CRF A;  3PG7 A;  5J3Q A;  3PP2 A;  2P0D A;  4HAW B;  2J0J A;  2MKR A;  3KRX A;  1PLS A;  4DBB A;  3VOQ A;  1Z87 A;  1V61 A;  1PMS A;  1WJM A;  3PVU A;  2KUP A;  1X1G A;  1DRO A;  3TFM A;  4HAY B;  1U2B A;  4EMO A;  2D2Q A;  2JP2 A;  5L81 A;  3PEG A;  3RCP A;  5KCV A;  1K5G B;  1EF1 A;  3PVL A;  1WG7 A;  4NY0 A;  2J0K A;  3KSY A;  1DYN A;  2DLW A;  2LYD A;  1IRS A;  2YRY A;  2E2X A;  3CIK A;  3PVW A;  1XX0 A;  1OQN A;  2QKL A;  4GPT B;  1GC6 A;  3D8E A;  1V89 A;  2UZR A;  2DKP A;  2R09 A;  3F5R A;  4TKN A;  1DDW A;  1Y19 B;  1UPQ A;  2RGN B;  2DYQ A;  2Y8F A;  2W2X D;  5HE2 A;  2D9X A;  3QWM A;  2OTX A;  2D9W A;  2N23 A;  1RRP B;  1OMW A;  3F0W A;  4PQ0 A;  2J0M A;  5D3Y A;  2EJ8 A;  1E5W A;  4EKU A;  1FOE A;  1UNQ A;  1Q67 A;  3BJI A;  1U5F A;  1W1D A;  3KRW A;  1FGY A;  2COF A;  2I1J A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...