1M7EA

Crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 50
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1m7eA00
3PG7A 1UNPA 4MT7A 1V5PA 1QC6A 4DX90 3GYPA 4NSWA 2J0MA 2J59M 3A8PA 3AJ4A 1X86A 4XWXA 2CAYA 4L6EA 1RRPB 3FSSA 4H8SA 5C5BA 1UPQA 5DIFB 3DXDA 1WJMA 2Z0QA 4DX8A 4ZRIA 1EF1A 5DHFB 3FEHA 4HB4B 1FGZA 1V5MA 2DYNA 3PVWA 3X23A 1KZ7A 2GS0A 2LOXA 3DXEA 4IAPA 3U8ZA 1PLSA 2D11A 2N0YA 2DTCA 1V88A 1MK9B 3ULBA 3M1IB 3D8EA 5DI9B 3KY9A 1FHOA 1B55A 4IOYX 2DHKA 3BINA 1KZGA 2AEHA 3SV1A 1M7RA 4YONA 1Z87A 3IVFA 3SYXA 2KCJA 4HDQA 1FHXA 2PZ1A 3CXBB 2ZPYA 4GMXB 2R0DA 5JHGA 2BCJA 2Y8GA 3QIJA 5D3XA 2CY5A 4ZRKA 2HTHB 2YF0A 1DDWA 4A6FA 4CYEA 1U2BA 4KHOA 1AQCA 1FB8A 1W1HA 5J3TA 3V5WA 2COFA 2COCA 3T06A 3SO6A 2RGNB 1I2HA 2YT0A 1ZC4B 1U5FA 3G9WA 1TQZA 1X11A 5J3QA 5EFXA 1WI1A 4HATB 5D3YA 2DX1A 2P0FA 2RNRB 3SNHA 4F7HA 1X05A 2HE7A 1OY2A 4EKUA 2XQNM 3TO1A 1BTKA 1H10A 2D10A 1J19A 1DDVA 4PNKA 1DROA 1Q67A 1W1DA 3BJIA 1PMSA 4A6FB 1U5DA 5JLJB 1XODA 2I1KA 5CLQB 2NMBA 5KQ1A 1OQNA 3TCAA 4HDOA 2YS3A 1P5TA 4HAXB 1LW3A 4PQ0A 2RVBB 4C0AA 2DN6A 5JP4A 2L2IA 2Z0PA 4F7GA 1LB1A 2D4QA 4HAWB 2DX5A 2YS1A 4GZUA 2D9XA 1K5DB 3U7DA 1P6SA 4A6HA 4WJ7A 2IYBA 3ZVRA 1P3RA 2I1JA 2L1CA 1BAKA 1UNRA 1U5EA 2FJLA 1H4RA 3O96A 4TYZA 1XKEA 1WGQA 2CRFA 3N7CA 3NSUA 5LONB 1W1GA 3MDBC 3SUZA 3LJUX 1ISNA 3CIKA 2ELAA 3TFMA 2D2QA 4P7IA 3KRXA 2LYDA 2DHJA 4EJNA 2DLWA 1DDMA 2IFSA 2DKPA 3PZDA 2Q13A 2D9VA 3DXCA 4MK0A 4K17A 2MFQA 2Y8FA 1OMWA 2YSZA 4A5KA 3QWMA 2R09A 3AU4A 2EC1A 1NU2A 2I5FA 2W2XC 1E5WA 4GPTB 2AL6A 5DH9B 3FM8C 2YRYA 2QKMA 2UZSA 4GXBA 1GG3A 3D8FA 4K2PA 1SHCA 3AU5A 1NTYA 5J3YA 1Y19B 1EGXA 3PP2A 4GN1A 4MY6A 5D27A 2VRWB 5C6RA 5D3WA 1DBHA 1XX0A 2K2JA 1U27A 2D9ZA 1MPHA 2ROVA 1EAZA 5CLLB 2COAA 2V76A 5D3VA 2VSZA 2JP2A 1UEFA 1NTVA 1V5UA 2CODA 2LULA 1BTNA 3HW2B 4GMVA 4IFSA 1X1GA 1UNQA 1MAIA 4Y94A 4YL8A 4HHVA 3A98B 2ADZA 3KSYA 4EMOA 1WGUA 2J0KA 1V61A 2DKQA 3RCPA 2NZ8B 1X1FA 3KRWA 2EMTA 5C16A 2DYQA 1TJ6A 2D9YA 4TKNA 4K81A 2GCLA 3D8DA 1MK7B 2EJ8A 1ZM0A 2YVCA 3KZ1A 2LKOA 5HE1A 2K2UA 3TW1A 1N3HA 3ZDTA 1XCGA 4B6HA 4CHMA 5DHAB 2KGXB 4ZRJA 3MPXA 3ODXA 4HAUB 1M7EA 1BWNA 5GOWB 2OQBA 3GYOA 3WA0A 5HE3A 1QQGA 2X18A 1IRSA 2H7DA 1ZSQA 5FI1A 2RUKB 2RSGA 3QBVB 4WSFA 3P7ZA 1U29A 1ZC3B 1GC6A 4HAYB 5KCVA 3P6AA 1WG7A 2MDXA 2P0DA 4F7UP 4BBKA 2G35A 3ODOA 3ML4A 3VOQA 2MKRA 1TXDA 1FGYA 5LOPB 4K2OA 1V89A 2K00A 4HB3B 4Z2MB 1RJ2A 2KUPA 4D0NB 2LG1A 1XR0B 2M14A 2MWNB 2RLOA 3F0WA 2UVMA 2ROZB 5JHHA 4CHJA 4KHBB 2P0HA 2DA0A 2UZRA 3A8QA 5C5BB 2GCJA 2LOZA 2QKLA 2OTXA 1FAOA 1MKEA 1I7AA 2W2XD 3ULCA 2YS5A 3VIAA 1MIZB 3PVLA 2I5CA 2W2WA 3PEGA 5L81A 5C79A 1WVHA 1UPRA 1NI2A 5HE2A 2YT1A 1ZVRA 1FOEA 2Z0OA 1SGHA 4HB2B 1FHWA 3TVVA 4HB0B 4A6KA 2ELBA 2VKIA 1Y5OA 2J0JA 3HQCA 4KVGB 2H7EA 1WJ1A 4NY0A 4HAZB 2D9WA 3PSCA 3ODWA 2M38A 4KAXB 1MIXA 1PFJA 3PVUA 3F5RA 4DXAB 3HK0A 1U5GA 2E2XA 2Y7BA 1EVHA 2P8VA 5FI0A 1KI1B 3WYFB 1XD4A 3OANA 2GJYA 1GC7A 5HE0A 2N23A 3UZTA 5KQ4A 1J0WA 2CY4A 1DYNA 4HAVB 4KHAA 4DBBA 1AWEA 2DHIA 4Z2NA 1K5GB 2DFKA 2EMSA 4WVFB
chains in the Genus database with same CATH superfamily
3PG7A 1UNPA 4MT7A 1V5PA 1QC6A 4DX90 3GYPA 4NSWA 2J0MA 2J59M 3A8PA 3AJ4A 1X86A 4XWXA 2CAYA 3NWAA 4L6EA 1RRPB 3FSSA 4H8SA 5C5BA 1UPQA 2RRFA 5DIFB 3DXDA 1WJMA 2KIEA 2Z0QA 4DX8A 4ZRIA 1EF1A 5DHFB 3FEHA 2YT2A 4HB4B 1FGZA 1V5MA 2DYNA 3PVWA 3X23A 1KZ7A 2GS0A 2LOXA 3DXEA 4IAPA 3U8ZA 1PLSA 2D11A 2N0YA 2DTCA 1V88A 1MK9B 3ULBA 2Z59A 3M1IB 3D8EA 5DI9B 3KY9A 1FHOA 1B55A 4IOYX 2DHKA 1ZYIA 3BINA 2KR0A 1KZGA 2AEHA 3SV1A 1M7RA 4YONA 1Z87A 3IVFA 3SYXA 2KCJA 4HDQA 1FHXA 2PZ1A 3CXBB 2ZPYA 4GMXB 2R0DA 5JHGA 2BCJA 2Y8GA 3DCXA 3QIJA 5D3XA 2CY5A 4ZRKA 2HTHB 2YF0A 4QJ4B 1DDWA 4A6FA 4CYEA 1U2BA 4KHOA 4KHBA 1AQCA 1FB8A 1W1HA 5J3TA 3V5WA 2COFA 2COCA 3T06A 3SO6A 2RGNB 1I2HA 2YT0A 1ZC4B 1U5FA 3G9WA 3OHMB 1TQZA 1X11A 5J3QA 5EFXA 1WI1A 4HATB 5D3YA 2DX1A 2P0FA 2RNRB 3SNHA 4F7HA 1X05A 2HE7A 3HSAA 1OY2A 5M4YB 4EKUA 2XQNM 3TO1A 1BTKA 1H10A 2D10A 1J19A 1DDVA 4PNKA 1DROA 5LG4B 1Q67A 1W1DA 3BJIA 1PMSA 4A6FB 1U5DA 5JLJB 1XODA 2I1KA 5CLQB 2NMBA 5KQ1A 1OQNA 3TCAA 4HDOA 3A58A 2YS3A 1P5TA 4HAXB 1LW3A 4PQ0A 2Z4DA 2RVBB 4C0AA 2DN6A 5JP4A 2L2IA 2Z0PA 4F7GA 5IRSA 1LB1A 2D4QA 4HAWB 2DX5A 3U12A 2YS1A 4GZUA 2D9XA 1K5DB 3U7DA 1P6SA 2Z13A 4GNKB 4A6HA 4WJ7A 2IYBA 3ZVRA 1P3RA 2I1JA 2L1CA 1BAKA 1UNRA 1U5EA 2FJLA 1H4RA 3O96A 4TYZA 1XKEA 1WGQA 2CRFA 2K8EA 3N7CA 3NSUA 5LONB 1W1GA 3MDBC 3SUZA 3LJUX 1ISNA 3CIKA 2ELAA 3TFMA 2D2QA 4P7IA 3KRXA 2LYDA 2DHJA 4EJNA 4DIXA 2DLWA 1DDMA 2IFSA 2DKPA 3PZDA 2Q13A 2D9VA 3DXCA 4MK0A 2K49A 1MI1A 4K17A 2MFQA 2Y8FA 1OMWA 2YSZA 2FJUB 4A5KA 3QWMA 2R09A 3AU4A 2EC1A 1NU2A 2I5FA 2W2XC 1E5WA 4GPTB 2AL6A 5DH9B 3FM8C 2YRYA 2QKMA 2UZSA 4GXBA 1GG3A 3D8FA 4K2PA 1SHCA 3AU5A 3NWDA 1NTYA 5J3YA 1Y19B 1EGXA 3PP2A 4GN1A 4MY6A 5D27A 2VRWB 5C6RA 5D3WA 1DBHA 1XX0A 2K2JA 1U27A 2D9ZA 1MPHA 2GUMA 1EAZA 2ROVA 5CLLB 2COAA 2V76A 4HSIA 5D3VA 2VSZA 2JP2A 1UEFA 1NTVA 4QJ3B 4L1RA 1V5UA 3B77A 2CODA 2LULA 1BTNA 3HW2B 4GMVA 4IFSA 1X1GA 1UNQA 1MAIA 4Y94A 4YL8A 4HHVA 3A98B 2ADZA 3KSYA 4EMOA 2KIGA 1WGUA 2J0KA 1V61A 2DKQA 3RCPA 2NZ8B 1X1FA 3KRWA 2EMTA 5C16A 2DYQA 1TJ6A 2D9YA 4TKNA 4K81A 2GCLA 3D8DA 1MK7B 2Z14A 2EJ8A 1ZM0A 2YVCA 3KZ1A 2LKOA 5HE1A 2K2UA 3TW1A 1N3HA 3ZDTA 1XCGA 4B6HA 4CHMA 3HIEA 5DHAB 2KGXB 4ZRJA 3MPXA 3ODXA 4HAUB 1M7EA 1BWNA 5GOWB 4GOUA 2KUQA 4QXAB 2OQBA 3GYOA 3WA0A 5HE3A 1QQGA 2X18A 1IRSA 2H7DA 1ZSQA 5FI1A 2RUKB 2RSGA 3QBVB 4WSFA 3P7ZA 1U29A 1ZC3B 4QJ5B 1GC6A 5I2SA 4HAYB 5KCVA 3NW8A 3P6AA 1WG7A 2MDXA 2P0DA 4F7UP 4BBKA 2G35A 2ZKMX 3ODOA 3ML4A 3VOQA 2MKRA 1TXDA 1FGYA 5LOPB 4K2OA 2R2YA 4CSQA 5I2MA 1V89A 2K00A 4HB3B 4D6WA 4Z2MB 4OSNA 1RJ2A 2KUPA 4D0NB 2LG1A 1XR0B 2M14A 2MWNB 2RLOA 3F0WA 2UVMA 2ROZB 5JHHA 4CHJA 4KHBB 2P0HA 2DA0A 2UZRA 3A8QA 5C5BB 3FVCA 2GCJA 2LOZA 2NBVA 2QKLA 2OTXA 1FAOA 1MKEA 1I7AA 2W2XD 3ULCA 2YS5A 3VIAA 1MIZB 3PVLA 2I5CA 2W2WA 3PEGA 5L81A 5C79A 1WVHA 1UPRA 1NI2A 5HE2A 2YT1A 1ZVRA 1FOEA 2Z0OA 1SGHA 4HB2B 1FHWA 3NWFA 3TVVA 4HB0B 4A6KA 2ELBA 2VKIA 1Y5OA 2J0JA 3HQCA 4KVGB 2H7EA 1WJ1A 4NY0A 4HAZB 2D9WA 3PSCA 3ODWA 2M38A 4KAXB 1MIXA 1PFJA 3PVUA 4OT1A 3F5RA 4DXAB 3HK0A 1U5GA 2E2XA 2Y7BA 1EVHA 2P8VA 5FI0A 1KI1B 3WYFB 1XD4A 3OANA 1T77A 2GJYA 1GC7A 5HE0A 2N23A 3UZTA 5KQ4A 1J0WA 2CY4A 1DYNA 4HAVB 4KHAA 4DBBA 1AWEA 2DHIA 4Z2NA 1K5GB 2DFKA 2EMSA 4WVFB
chains in the Genus database with same CATH topology
3PG7A 1UNPA 4MT7A 1V5PA 1QC6A 4DX90 3GYPA 4NSWA 2J0MA 2J59M 3A8PA 3AJ4A 1X86A 4XWXA 2CAYA 4L6EA 1RRPB 3FSSA 4H8SA 5C5BA 1UPQA 5DIFB 3DXDA 1WJMA 2Z0QA 4DX8A 4ZRIA 1EF1A 5DHFB 3FEHA 4HB4B 1FGZA 1V5MA 2DYNA 3PVWA 3X23A 1KZ7A 2GS0A 2LOXA 3DXEA 4IAPA 3U8ZA 1PLSA 2D11A 2N0YA 2DTCA 1V88A 1MK9B 3ULBA 3M1IB 3D8EA 5DI9B 3KY9A 1FHOA 1B55A 4IOYX 2DHKA 3BINA 1KZGA 2AEHA 3SV1A 1M7RA 4YONA 1Z87A 3IVFA 3SYXA 2KCJA 4HDQA 1FHXA 2PZ1A 3CXBB 2ZPYA 4GMXB 2R0DA 5JHGA 2BCJA 2Y8GA 3QIJA 5D3XA 2CY5A 4ZRKA 2HTHB 2YF0A 1DDWA 4A6FA 4CYEA 1U2BA 4KHOA 1AQCA 1FB8A 1W1HA 5J3TA 3V5WA 2COFA 2COCA 3T06A 3SO6A 2RGNB 1I2HA 2YT0A 1ZC4B 1U5FA 3G9WA 1TQZA 1X11A 5J3QA 5EFXA 1WI1A 4HATB 5D3YA 2DX1A 2P0FA 2RNRB 3SNHA 4F7HA 1X05A 2HE7A 1OY2A 4EKUA 2XQNM 3TO1A 1BTKA 1H10A 2D10A 1J19A 1DDVA 4PNKA 1DROA 1Q67A 1W1DA 3BJIA 1PMSA 4A6FB 1U5DA 5JLJB 1XODA 2I1KA 5CLQB 2NMBA 5KQ1A 1OQNA 3TCAA 4HDOA 2YS3A 1P5TA 4HAXB 1LW3A 4PQ0A 2RVBB 4C0AA 2DN6A 5JP4A 2L2IA 2Z0PA 4F7GA 1LB1A 2D4QA 4HAWB 2DX5A 2YS1A 4GZUA 2D9XA 1K5DB 3U7DA 1P6SA 4A6HA 4WJ7A 2IYBA 3ZVRA 1P3RA 2I1JA 2L1CA 1BAKA 1UNRA 1U5EA 2FJLA 1H4RA 3O96A 4TYZA 1XKEA 1WGQA 2CRFA 3N7CA 3NSUA 5LONB 1W1GA 3MDBC 3SUZA 3LJUX 1ISNA 3CIKA 2ELAA 3TFMA 2D2QA 4P7IA 3KRXA 2LYDA 2DHJA 4EJNA 2DLWA 1DDMA 2IFSA 2DKPA 3PZDA 2Q13A 2D9VA 3DXCA 4MK0A 4K17A 2MFQA 2Y8FA 1OMWA 2YSZA 4A5KA 3QWMA 2R09A 3AU4A 2EC1A 1NU2A 2I5FA 2W2XC 1E5WA 4GPTB 2AL6A 5DH9B 3FM8C 2YRYA 2QKMA 2UZSA 4GXBA 1GG3A 3D8FA 4K2PA 1SHCA 3AU5A 1NTYA 5J3YA 1Y19B 1EGXA 3PP2A 4GN1A 4MY6A 5D27A 2VRWB 5C6RA 5D3WA 1DBHA 1XX0A 2K2JA 1U27A 2D9ZA 1MPHA 2ROVA 1EAZA 5CLLB 2COAA 2V76A 5D3VA 2VSZA 2JP2A 1UEFA 1NTVA 1V5UA 2CODA 2LULA 1BTNA 3HW2B 4GMVA 4IFSA 1X1GA 1UNQA 1MAIA 4Y94A 4YL8A 4HHVA 3A98B 2ADZA 3KSYA 4EMOA 1WGUA 2J0KA 1V61A 2DKQA 3RCPA 2NZ8B 1X1FA 3KRWA 2EMTA 5C16A 2DYQA 1TJ6A 2D9YA 4TKNA 4K81A 2GCLA 3D8DA 1MK7B 2EJ8A 1ZM0A 2YVCA 3KZ1A 2LKOA 5HE1A 2K2UA 3TW1A 1N3HA 3ZDTA 1XCGA 4B6HA 4CHMA 5DHAB 2KGXB 4ZRJA 3MPXA 3ODXA 4HAUB 1M7EA 1BWNA 5GOWB 2OQBA 3GYOA 3WA0A 5HE3A 1QQGA 2X18A 1IRSA 2H7DA 1ZSQA 5FI1A 2RUKB 2RSGA 3QBVB 4WSFA 3P7ZA 1U29A 1ZC3B 1GC6A 4HAYB 5KCVA 3P6AA 1WG7A 2MDXA 2P0DA 4F7UP 4BBKA 2G35A 3ODOA 3ML4A 3VOQA 2MKRA 1TXDA 1FGYA 5LOPB 4K2OA 1V89A 2K00A 4HB3B 4Z2MB 1RJ2A 2KUPA 4D0NB 2LG1A 1XR0B 2M14A 2MWNB 2RLOA 3F0WA 2UVMA 2ROZB 5JHHA 4CHJA 4KHBB 2P0HA 2DA0A 2UZRA 3A8QA 5C5BB 2GCJA 2LOZA 2QKLA 2OTXA 1FAOA 1MKEA 1I7AA 2W2XD 3ULCA 2YS5A 3VIAA 1MIZB 3PVLA 2I5CA 2W2WA 3PEGA 5L81A 5C79A 1WVHA 1UPRA 1NI2A 5HE2A 2YT1A 1ZVRA 1FOEA 2Z0OA 1SGHA 4HB2B 1FHWA 3TVVA 4HB0B 4A6KA 2ELBA 2VKIA 1Y5OA 2J0JA 3HQCA 4KVGB 2H7EA 1WJ1A 4NY0A 4HAZB 2D9WA 3PSCA 3ODWA 2M38A 4KAXB 1MIXA 1PFJA 3PVUA 3F5RA 4DXAB 3HK0A 1U5GA 2E2XA 2Y7BA 1EVHA 2P8VA 5FI0A 1KI1B 3WYFB 1XD4A 3OANA 2GJYA 1GC7A 5HE0A 2N23A 3UZTA 5KQ4A 1J0WA 2CY4A 1DYNA 4HAVB 4KHAA 4DBBA 1AWEA 2DHIA 4Z2NA 1K5GB 2DFKA 2EMSA 4WVFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG7 A;  1UNP A;  4MT7 A;  1V5P A;  1QC6 A;  4DX9 0;  3GYP A;  4NSW A;  2J0M A;  2J59 M;  3A8P A;  3AJ4 A;  1X86 A;  4XWX A;  2CAY A;  4L6E A;  1RRP B;  3FSS A;  4H8S A;  5C5B A;  1UPQ A;  5DIF B;  3DXD A;  1WJM A;  2Z0Q A;  4DX8 A;  4ZRI A;  1EF1 A;  5DHF B;  3FEH A;  4HB4 B;  1FGZ A;  1V5M A;  2DYN A;  3PVW A;  3X23 A;  1KZ7 A;  2GS0 A;  2LOX A;  3DXE A;  4IAP A;  3U8Z A;  1PLS A;  2D11 A;  2N0Y A;  2DTC A;  1V88 A;  1MK9 B;  3ULB A;  3M1I B;  3D8E A;  5DI9 B;  3KY9 A;  1FHO A;  1B55 A;  4IOY X;  2DHK A;  3BIN A;  1KZG A;  2AEH A;  3SV1 A;  1M7R A;  4YON A;  1Z87 A;  3IVF A;  3SYX A;  2KCJ A;  4HDQ A;  1FHX A;  2PZ1 A;  3CXB B;  2ZPY A;  4GMX B;  2R0D A;  5JHG A;  2BCJ A;  2Y8G A;  3QIJ A;  5D3X A;  2CY5 A;  4ZRK A;  2HTH B;  2YF0 A;  1DDW A;  4A6F A;  4CYE A;  1U2B A;  4KHO A;  1AQC A;  1FB8 A;  1W1H A;  5J3T A;  3V5W A;  2COF A;  2COC A;  3T06 A;  3SO6 A;  2RGN B;  1I2H A;  2YT0 A;  1ZC4 B;  1U5F A;  3G9W A;  1TQZ A;  1X11 A;  5J3Q A;  5EFX A;  1WI1 A;  4HAT B;  5D3Y A;  2DX1 A;  2P0F A;  2RNR B;  3SNH A;  4F7H A;  1X05 A;  2HE7 A;  1OY2 A;  4EKU A;  2XQN M;  3TO1 A;  1BTK A;  1H10 A;  2D10 A;  1J19 A;  1DDV A;  4PNK A;  1DRO A;  1Q67 A;  1W1D A;  3BJI A;  1PMS A;  4A6F B;  1U5D A;  5JLJ B;  1XOD A;  2I1K A;  5CLQ B;  2NMB A;  5KQ1 A;  1OQN A;  3TCA A;  4HDO A;  2YS3 A;  1P5T A;  4HAX B;  1LW3 A;  4PQ0 A;  2RVB B;  4C0A A;  2DN6 A;  5JP4 A;  2L2I A;  2Z0P A;  4F7G A;  1LB1 A;  2D4Q A;  4HAW B;  2DX5 A;  2YS1 A;  4GZU A;  2D9X A;  1K5D B;  3U7D A;  1P6S A;  4A6H A;  4WJ7 A;  2IYB A;  3ZVR A;  1P3R A;  2I1J A;  2L1C A;  1BAK A;  1UNR A;  1U5E A;  2FJL A;  1H4R A;  3O96 A;  4TYZ A;  1XKE A;  1WGQ A;  2CRF A;  3N7C A;  3NSU A;  5LON B;  1W1G A;  3MDB C;  3SUZ A;  3LJU X;  1ISN A;  3CIK A;  2ELA A;  3TFM A;  2D2Q A;  4P7I A;  3KRX A;  2LYD A;  2DHJ A;  4EJN A;  2DLW A;  1DDM A;  2IFS A;  2DKP A;  3PZD A;  2Q13 A;  2D9V A;  3DXC A;  4MK0 A;  4K17 A;  2MFQ A;  2Y8F A;  1OMW A;  2YSZ A;  4A5K A;  3QWM A;  2R09 A;  3AU4 A;  2EC1 A;  1NU2 A;  2I5F A;  2W2X C;  1E5W A;  4GPT B;  2AL6 A;  5DH9 B;  3FM8 C;  2YRY A;  2QKM A;  2UZS A;  4GXB A;  1GG3 A;  3D8F A;  4K2P A;  1SHC A;  3AU5 A;  1NTY A;  5J3Y A;  1Y19 B;  1EGX A;  3PP2 A;  4GN1 A;  4MY6 A;  5D27 A;  2VRW B;  5C6R A;  5D3W A;  1DBH A;  1XX0 A;  2K2J A;  1U27 A;  2D9Z A;  1MPH A;  2ROV A;  1EAZ A;  5CLL B;  2COA A;  2V76 A;  5D3V A;  2VSZ A;  2JP2 A;  1UEF A;  1NTV A;  1V5U A;  2COD A;  2LUL A;  1BTN A;  3HW2 B;  4GMV A;  4IFS A;  1X1G A;  1UNQ A;  1MAI A;  4Y94 A;  4YL8 A;  4HHV A;  3A98 B;  2ADZ A;  3KSY A;  4EMO A;  1WGU A;  2J0K A;  1V61 A;  2DKQ A;  3RCP A;  2NZ8 B;  1X1F A;  3KRW A;  2EMT A;  5C16 A;  2DYQ A;  1TJ6 A;  2D9Y A;  4TKN A;  4K81 A;  2GCL A;  3D8D A;  1MK7 B;  2EJ8 A;  1ZM0 A;  2YVC A;  3KZ1 A;  2LKO A;  5HE1 A;  2K2U A;  3TW1 A;  1N3H A;  3ZDT A;  1XCG A;  4B6H A;  4CHM A;  5DHA B;  2KGX B;  4ZRJ A;  3MPX A;  3ODX A;  4HAU B;  1M7E A;  1BWN A;  5GOW B;  2OQB A;  3GYO A;  3WA0 A;  5HE3 A;  1QQG A;  2X18 A;  1IRS A;  2H7D A;  1ZSQ A;  5FI1 A;  2RUK B;  2RSG A;  3QBV B;  4WSF A;  3P7Z A;  1U29 A;  1ZC3 B;  1GC6 A;  4HAY B;  5KCV A;  3P6A A;  1WG7 A;  2MDX A;  2P0D A;  4F7U P;  4BBK A;  2G35 A;  3ODO A;  3ML4 A;  3VOQ A;  2MKR A;  1TXD A;  1FGY A;  5LOP B;  4K2O A;  1V89 A;  2K00 A;  4HB3 B;  4Z2M B;  1RJ2 A;  2KUP A;  4D0N B;  2LG1 A;  1XR0 B;  2M14 A;  2MWN B;  2RLO A;  3F0W A;  2UVM A;  2ROZ B;  5JHH A;  4CHJ A;  4KHB B;  2P0H A;  2DA0 A;  2UZR A;  3A8Q A;  5C5B B;  2GCJ A;  2LOZ A;  2QKL A;  2OTX A;  1FAO A;  1MKE A;  1I7A A;  2W2X D;  3ULC A;  2YS5 A;  3VIA A;  1MIZ B;  3PVL A;  2I5C A;  2W2W A;  3PEG A;  5L81 A;  5C79 A;  1WVH A;  1UPR A;  1NI2 A;  5HE2 A;  2YT1 A;  1ZVR A;  1FOE A;  2Z0O A;  1SGH A;  4HB2 B;  1FHW A;  3TVV A;  4HB0 B;  4A6K A;  2ELB A;  2VKI A;  1Y5O A;  2J0J A;  3HQC A;  4KVG B;  2H7E A;  1WJ1 A;  4NY0 A;  4HAZ B;  2D9W A;  3PSC A;  3ODW A;  2M38 A;  4KAX B;  1MIX A;  1PFJ A;  3PVU A;  3F5R A;  4DXA B;  3HK0 A;  1U5G A;  2E2X A;  2Y7B A;  1EVH A;  2P8V A;  5FI0 A;  1KI1 B;  3WYF B;  1XD4 A;  3OAN A;  2GJY A;  1GC7 A;  5HE0 A;  2N23 A;  3UZT A;  5KQ4 A;  1J0W A;  2CY4 A;  1DYN A;  4HAV B;  4KHA A;  4DBB A;  1AWE A;  2DHI A;  4Z2N A;  1K5G B;  2DFK A;  2EMS A;  4WVF B; 
#chains in the Genus database with same CATH topology
 3PG7 A;  1UNP A;  4MT7 A;  1V5P A;  1QC6 A;  4DX9 0;  3GYP A;  4NSW A;  2J0M A;  2J59 M;  3A8P A;  3AJ4 A;  1X86 A;  4XWX A;  2CAY A;  3NWA A;  4L6E A;  1RRP B;  3FSS A;  4H8S A;  5C5B A;  1UPQ A;  2RRF A;  5DIF B;  3DXD A;  1WJM A;  2KIE A;  2Z0Q A;  4DX8 A;  4ZRI A;  1EF1 A;  5DHF B;  3FEH A;  2YT2 A;  4HB4 B;  1FGZ A;  1V5M A;  2DYN A;  3PVW A;  3X23 A;  1KZ7 A;  2GS0 A;  2LOX A;  3DXE A;  4IAP A;  3U8Z A;  1PLS A;  2D11 A;  2N0Y A;  2DTC A;  1V88 A;  1MK9 B;  3ULB A;  2Z59 A;  3M1I B;  3D8E A;  5DI9 B;  3KY9 A;  1FHO A;  1B55 A;  4IOY X;  2DHK A;  1ZYI A;  3BIN A;  2KR0 A;  1KZG A;  2AEH A;  3SV1 A;  1M7R A;  4YON A;  1Z87 A;  3IVF A;  3SYX A;  2KCJ A;  4HDQ A;  1FHX A;  2PZ1 A;  3CXB B;  2ZPY A;  4GMX B;  2R0D A;  5JHG A;  2BCJ A;  2Y8G A;  3DCX A;  3QIJ A;  5D3X A;  2CY5 A;  4ZRK A;  2HTH B;  2YF0 A;  4QJ4 B;  1DDW A;  4A6F A;  4CYE A;  1U2B A;  4KHO A;  4KHB A;  1AQC A;  1FB8 A;  1W1H A;  5J3T A;  3V5W A;  2COF A;  2COC A;  3T06 A;  3SO6 A;  2RGN B;  1I2H A;  2YT0 A;  1ZC4 B;  1U5F A;  3G9W A;  3OHM B;  1TQZ A;  1X11 A;  5J3Q A;  5EFX A;  1WI1 A;  4HAT B;  5D3Y A;  2DX1 A;  2P0F A;  2RNR B;  3SNH A;  4F7H A;  1X05 A;  2HE7 A;  3HSA A;  1OY2 A;  5M4Y B;  4EKU A;  2XQN M;  3TO1 A;  1BTK A;  1H10 A;  2D10 A;  1J19 A;  1DDV A;  4PNK A;  1DRO A;  5LG4 B;  1Q67 A;  1W1D A;  3BJI A;  1PMS A;  4A6F B;  1U5D A;  5JLJ B;  1XOD A;  2I1K A;  5CLQ B;  2NMB A;  5KQ1 A;  1OQN A;  3TCA A;  4HDO A;  3A58 A;  2YS3 A;  1P5T A;  4HAX B;  1LW3 A;  4PQ0 A;  2Z4D A;  2RVB B;  4C0A A;  2DN6 A;  5JP4 A;  2L2I A;  2Z0P A;  4F7G A;  5IRS A;  1LB1 A;  2D4Q A;  4HAW B;  2DX5 A;  3U12 A;  2YS1 A;  4GZU A;  2D9X A;  1K5D B;  3U7D A;  1P6S A;  2Z13 A;  4GNK B;  4A6H A;  4WJ7 A;  2IYB A;  3ZVR A;  1P3R A;  2I1J A;  2L1C A;  1BAK A;  1UNR A;  1U5E A;  2FJL A;  1H4R A;  3O96 A;  4TYZ A;  1XKE A;  1WGQ A;  2CRF A;  2K8E A;  3N7C A;  3NSU A;  5LON B;  1W1G A;  3MDB C;  3SUZ A;  3LJU X;  1ISN A;  3CIK A;  2ELA A;  3TFM A;  2D2Q A;  4P7I A;  3KRX A;  2LYD A;  2DHJ A;  4EJN A;  4DIX A;  2DLW A;  1DDM A;  2IFS A;  2DKP A;  3PZD A;  2Q13 A;  2D9V A;  3DXC A;  4MK0 A;  2K49 A;  1MI1 A;  4K17 A;  2MFQ A;  2Y8F A;  1OMW A;  2YSZ A;  2FJU B;  4A5K A;  3QWM A;  2R09 A;  3AU4 A;  2EC1 A;  1NU2 A;  2I5F A;  2W2X C;  1E5W A;  4GPT B;  2AL6 A;  5DH9 B;  3FM8 C;  2YRY A;  2QKM A;  2UZS A;  4GXB A;  1GG3 A;  3D8F A;  4K2P A;  1SHC A;  3AU5 A;  3NWD A;  1NTY A;  5J3Y A;  1Y19 B;  1EGX A;  3PP2 A;  4GN1 A;  4MY6 A;  5D27 A;  2VRW B;  5C6R A;  5D3W A;  1DBH A;  1XX0 A;  2K2J A;  1U27 A;  2D9Z A;  1MPH A;  2GUM A;  1EAZ A;  2ROV A;  5CLL B;  2COA A;  2V76 A;  4HSI A;  5D3V A;  2VSZ A;  2JP2 A;  1UEF A;  1NTV A;  4QJ3 B;  4L1R A;  1V5U A;  3B77 A;  2COD A;  2LUL A;  1BTN A;  3HW2 B;  4GMV A;  4IFS A;  1X1G A;  1UNQ A;  1MAI A;  4Y94 A;  4YL8 A;  4HHV A;  3A98 B;  2ADZ A;  3KSY A;  4EMO A;  2KIG A;  1WGU A;  2J0K A;  1V61 A;  2DKQ A;  3RCP A;  2NZ8 B;  1X1F A;  3KRW A;  2EMT A;  5C16 A;  2DYQ A;  1TJ6 A;  2D9Y A;  4TKN A;  4K81 A;  2GCL A;  3D8D A;  1MK7 B;  2Z14 A;  2EJ8 A;  1ZM0 A;  2YVC A;  3KZ1 A;  2LKO A;  5HE1 A;  2K2U A;  3TW1 A;  1N3H A;  3ZDT A;  1XCG A;  4B6H A;  4CHM A;  3HIE A;  5DHA B;  2KGX B;  4ZRJ A;  3MPX A;  3ODX A;  4HAU B;  1M7E A;  1BWN A;  5GOW B;  4GOU A;  2KUQ A;  4QXA B;  2OQB A;  3GYO A;  3WA0 A;  5HE3 A;  1QQG A;  2X18 A;  1IRS A;  2H7D A;  1ZSQ A;  5FI1 A;  2RUK B;  2RSG A;  3QBV B;  4WSF A;  3P7Z A;  1U29 A;  1ZC3 B;  4QJ5 B;  1GC6 A;  5I2S A;  4HAY B;  5KCV A;  3NW8 A;  3P6A A;  1WG7 A;  2MDX A;  2P0D A;  4F7U P;  4BBK A;  2G35 A;  2ZKM X;  3ODO A;  3ML4 A;  3VOQ A;  2MKR A;  1TXD A;  1FGY A;  5LOP B;  4K2O A;  2R2Y A;  4CSQ A;  5I2M A;  1V89 A;  2K00 A;  4HB3 B;  4D6W A;  4Z2M B;  4OSN A;  1RJ2 A;  2KUP A;  4D0N B;  2LG1 A;  1XR0 B;  2M14 A;  2MWN B;  2RLO A;  3F0W A;  2UVM A;  2ROZ B;  5JHH A;  4CHJ A;  4KHB B;  2P0H A;  2DA0 A;  2UZR A;  3A8Q A;  5C5B B;  3FVC A;  2GCJ A;  2LOZ A;  2NBV A;  2QKL A;  2OTX A;  1FAO A;  1MKE A;  1I7A A;  2W2X D;  3ULC A;  2YS5 A;  3VIA A;  1MIZ B;  3PVL A;  2I5C A;  2W2W A;  3PEG A;  5L81 A;  5C79 A;  1WVH A;  1UPR A;  1NI2 A;  5HE2 A;  2YT1 A;  1ZVR A;  1FOE A;  2Z0O A;  1SGH A;  4HB2 B;  1FHW A;  3NWF A;  3TVV A;  4HB0 B;  4A6K A;  2ELB A;  2VKI A;  1Y5O A;  2J0J A;  3HQC A;  4KVG B;  2H7E A;  1WJ1 A;  4NY0 A;  4HAZ B;  2D9W A;  3PSC A;  3ODW A;  2M38 A;  4KAX B;  1MIX A;  1PFJ A;  3PVU A;  4OT1 A;  3F5R A;  4DXA B;  3HK0 A;  1U5G A;  2E2X A;  2Y7B A;  1EVH A;  2P8V A;  5FI0 A;  1KI1 B;  3WYF B;  1XD4 A;  3OAN A;  1T77 A;  2GJY A;  1GC7 A;  5HE0 A;  2N23 A;  3UZT A;  5KQ4 A;  1J0W A;  2CY4 A;  1DYN A;  4HAV B;  4KHA A;  4DBB A;  1AWE A;  2DHI A;  4Z2N A;  1K5G B;  2DFK A;  2EMS A;  4WVF B; 
#chains in the Genus database with same CATH homology
 3PG7 A;  1UNP A;  4MT7 A;  1V5P A;  1QC6 A;  4DX9 0;  3GYP A;  4NSW A;  2J0M A;  2J59 M;  3A8P A;  3AJ4 A;  1X86 A;  4XWX A;  2CAY A;  4L6E A;  1RRP B;  3FSS A;  4H8S A;  5C5B A;  1UPQ A;  5DIF B;  3DXD A;  1WJM A;  2Z0Q A;  4DX8 A;  4ZRI A;  1EF1 A;  5DHF B;  3FEH A;  4HB4 B;  1FGZ A;  1V5M A;  2DYN A;  3PVW A;  3X23 A;  1KZ7 A;  2GS0 A;  2LOX A;  3DXE A;  4IAP A;  3U8Z A;  1PLS A;  2D11 A;  2N0Y A;  2DTC A;  1V88 A;  1MK9 B;  3ULB A;  3M1I B;  3D8E A;  5DI9 B;  3KY9 A;  1FHO A;  1B55 A;  4IOY X;  2DHK A;  3BIN A;  1KZG A;  2AEH A;  3SV1 A;  1M7R A;  4YON A;  1Z87 A;  3IVF A;  3SYX A;  2KCJ A;  4HDQ A;  1FHX A;  2PZ1 A;  3CXB B;  2ZPY A;  4GMX B;  2R0D A;  5JHG A;  2BCJ A;  2Y8G A;  3QIJ A;  5D3X A;  2CY5 A;  4ZRK A;  2HTH B;  2YF0 A;  1DDW A;  4A6F A;  4CYE A;  1U2B A;  4KHO A;  1AQC A;  1FB8 A;  1W1H A;  5J3T A;  3V5W A;  2COF A;  2COC A;  3T06 A;  3SO6 A;  2RGN B;  1I2H A;  2YT0 A;  1ZC4 B;  1U5F A;  3G9W A;  1TQZ A;  1X11 A;  5J3Q A;  5EFX A;  1WI1 A;  4HAT B;  5D3Y A;  2DX1 A;  2P0F A;  2RNR B;  3SNH A;  4F7H A;  1X05 A;  2HE7 A;  1OY2 A;  4EKU A;  2XQN M;  3TO1 A;  1BTK A;  1H10 A;  2D10 A;  1J19 A;  1DDV A;  4PNK A;  1DRO A;  1Q67 A;  1W1D A;  3BJI A;  1PMS A;  4A6F B;  1U5D A;  5JLJ B;  1XOD A;  2I1K A;  5CLQ B;  2NMB A;  5KQ1 A;  1OQN A;  3TCA A;  4HDO A;  2YS3 A;  1P5T A;  4HAX B;  1LW3 A;  4PQ0 A;  2RVB B;  4C0A A;  2DN6 A;  5JP4 A;  2L2I A;  2Z0P A;  4F7G A;  1LB1 A;  2D4Q A;  4HAW B;  2DX5 A;  2YS1 A;  4GZU A;  2D9X A;  1K5D B;  3U7D A;  1P6S A;  4A6H A;  4WJ7 A;  2IYB A;  3ZVR A;  1P3R A;  2I1J A;  2L1C A;  1BAK A;  1UNR A;  1U5E A;  2FJL A;  1H4R A;  3O96 A;  4TYZ A;  1XKE A;  1WGQ A;  2CRF A;  3N7C A;  3NSU A;  5LON B;  1W1G A;  3MDB C;  3SUZ A;  3LJU X;  1ISN A;  3CIK A;  2ELA A;  3TFM A;  2D2Q A;  4P7I A;  3KRX A;  2LYD A;  2DHJ A;  4EJN A;  2DLW A;  1DDM A;  2IFS A;  2DKP A;  3PZD A;  2Q13 A;  2D9V A;  3DXC A;  4MK0 A;  4K17 A;  2MFQ A;  2Y8F A;  1OMW A;  2YSZ A;  4A5K A;  3QWM A;  2R09 A;  3AU4 A;  2EC1 A;  1NU2 A;  2I5F A;  2W2X C;  1E5W A;  4GPT B;  2AL6 A;  5DH9 B;  3FM8 C;  2YRY A;  2QKM A;  2UZS A;  4GXB A;  1GG3 A;  3D8F A;  4K2P A;  1SHC A;  3AU5 A;  1NTY A;  5J3Y A;  1Y19 B;  1EGX A;  3PP2 A;  4GN1 A;  4MY6 A;  5D27 A;  2VRW B;  5C6R A;  5D3W A;  1DBH A;  1XX0 A;  2K2J A;  1U27 A;  2D9Z A;  1MPH A;  2ROV A;  1EAZ A;  5CLL B;  2COA A;  2V76 A;  5D3V A;  2VSZ A;  2JP2 A;  1UEF A;  1NTV A;  1V5U A;  2COD A;  2LUL A;  1BTN A;  3HW2 B;  4GMV A;  4IFS A;  1X1G A;  1UNQ A;  1MAI A;  4Y94 A;  4YL8 A;  4HHV A;  3A98 B;  2ADZ A;  3KSY A;  4EMO A;  1WGU A;  2J0K A;  1V61 A;  2DKQ A;  3RCP A;  2NZ8 B;  1X1F A;  3KRW A;  2EMT A;  5C16 A;  2DYQ A;  1TJ6 A;  2D9Y A;  4TKN A;  4K81 A;  2GCL A;  3D8D A;  1MK7 B;  2EJ8 A;  1ZM0 A;  2YVC A;  3KZ1 A;  2LKO A;  5HE1 A;  2K2U A;  3TW1 A;  1N3H A;  3ZDT A;  1XCG A;  4B6H A;  4CHM A;  5DHA B;  2KGX B;  4ZRJ A;  3MPX A;  3ODX A;  4HAU B;  1M7E A;  1BWN A;  5GOW B;  2OQB A;  3GYO A;  3WA0 A;  5HE3 A;  1QQG A;  2X18 A;  1IRS A;  2H7D A;  1ZSQ A;  5FI1 A;  2RUK B;  2RSG A;  3QBV B;  4WSF A;  3P7Z A;  1U29 A;  1ZC3 B;  1GC6 A;  4HAY B;  5KCV A;  3P6A A;  1WG7 A;  2MDX A;  2P0D A;  4F7U P;  4BBK A;  2G35 A;  3ODO A;  3ML4 A;  3VOQ A;  2MKR A;  1TXD A;  1FGY A;  5LOP B;  4K2O A;  1V89 A;  2K00 A;  4HB3 B;  4Z2M B;  1RJ2 A;  2KUP A;  4D0N B;  2LG1 A;  1XR0 B;  2M14 A;  2MWN B;  2RLO A;  3F0W A;  2UVM A;  2ROZ B;  5JHH A;  4CHJ A;  4KHB B;  2P0H A;  2DA0 A;  2UZR A;  3A8Q A;  5C5B B;  2GCJ A;  2LOZ A;  2QKL A;  2OTX A;  1FAO A;  1MKE A;  1I7A A;  2W2X D;  3ULC A;  2YS5 A;  3VIA A;  1MIZ B;  3PVL A;  2I5C A;  2W2W A;  3PEG A;  5L81 A;  5C79 A;  1WVH A;  1UPR A;  1NI2 A;  5HE2 A;  2YT1 A;  1ZVR A;  1FOE A;  2Z0O A;  1SGH A;  4HB2 B;  1FHW A;  3TVV A;  4HB0 B;  4A6K A;  2ELB A;  2VKI A;  1Y5O A;  2J0J A;  3HQC A;  4KVG B;  2H7E A;  1WJ1 A;  4NY0 A;  4HAZ B;  2D9W A;  3PSC A;  3ODW A;  2M38 A;  4KAX B;  1MIX A;  1PFJ A;  3PVU A;  3F5R A;  4DXA B;  3HK0 A;  1U5G A;  2E2X A;  2Y7B A;  1EVH A;  2P8V A;  5FI0 A;  1KI1 B;  3WYF B;  1XD4 A;  3OAN A;  2GJY A;  1GC7 A;  5HE0 A;  2N23 A;  3UZT A;  5KQ4 A;  1J0W A;  2CY4 A;  1DYN A;  4HAV B;  4KHA A;  4DBB A;  1AWE A;  2DHI A;  4Z2N A;  1K5G B;  2DFK A;  2EMS A;  4WVF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...