1M7EA

Crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 50
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1m7eA00
2YSZA 1XD4A 1UNPA 2CRFA 5HE1A 1M7EA 2D9ZA 3VIAA 2FJLA 2P0HA 2DYNA 3KSYA 4Y94A 2Y8GA 4B6HA 1GC7A 2RVBB 5C5BB 4DBBA 2UZSA 2D9WA 2UZRA 2DA0A 5C16A 3TVVA 4F7HA 2J0KA 2Q13A 3SNHA 1ZSQA 3U7DA 1DDVA 1FGYA 3A8QA 2EMTA 2VRWB 2RNRB 5DI9B 3DXEA 1UPRA 1U5GA 2LULA 2BCJA 3KY9A 5DHFB 1AWEA 2ADZA 5JHHA 3RCPA 1MKEA 4Z2MB 4F7UP 4HB2B 5JLJB 1KZGA 4MK0A 2DHKA 1WJMA 1V89A 5J3YA 2VKIA 1Q67A 5D3YA 2I1KA 2ELAA 1OMWA 2L1CA 1KI1B 2OQBA 4HAVB 4GZUA 3DXDA 1TQZA 3PVUA 1DDWA 3IVFA 1FAOA 5FI1A 2P0FA 2GJYA 2DX1A 2UVMA 3O96A 2RGNB 2DKPA 5JHGA 1WG7A 2E2XA 4YONA 1B55A 2YVCA 2DX5A 2YT1A 3ODWA 3DXCA 2IFSA 1NTVA 1J19A 3PVLA 2H7DA 1EVHA 2RUKB 1XX0A 2D9YA 4PNKA 2YS5A 3HW2B 3ML4A 2D9VA 1BWNA 2COAA 1MIXA 4D0NB 2W2WA 1DROA 2D2QA 3VOQA 1W1HA 2D4QA 1EGXA 3KRXA 5DIFB 1TXDA 1RJ2A 1MIZB 2K2JA 4EJNA 3HK0A 1LB1A 1QQGA 2I5CA 4HB3B 2YRYA 1X05A 2W2XC 5J3TA 3ULCA 4WJ7A 3PG7A 1UPQA 2MWNB 4TKNA 4KAXB 4NY0A 5DHAB 3PZDA 2GS0A 1X1FA 3QWMA 4HDOA 4L6EA 1WVHA 1M7RA 4H8SA 2DTCA 4GN1A 2G35A 1NI2A 4A6FA 4GMVA 2GCLA 3ZVRA 5L81A 3SYXA 2D11A 5C6RA 3V5WA 4HAYB 2J0JA 3A8PA 2ROZB 5HE2A 2YS3A 1FHWA 4WSFA 1Z87A 2EC1A 3SUZA 4TYZA 5KQ1A 4CHJA 4HAZB 2DYQA 3D8DA 5FI0A 1W1DA 4MY6A 3UZTA 1WGQA 2AEHA 3TCAA 3PSCA 2HTHB 1DDMA 2DLWA 2MKRA 2HE7A 1N3HA 1XCGA 1ZVRA 2CODA 5D3XA 3BJIA 2KGXB 1Y19B 3ULBA 1KZ7A 4DXAB 1P3RA 4GPTB 1IRSA 2CY5A 3D8EA 3NSUA 5HE0A 5C79A 2EJ8A 4EMOA 1I7AA 1U5FA 2J59M 3G9WA 1MK7B 2OTXA 3ZDTA 1GG3A 2IYBA 2P0DA 2DKQA 2Y8FA 2K00A 4PQ0A 3WA0A 1FGZA 2Z0QA 1V5MA 4HATB 1MPHA 4YL8A 3T06A 1AQCA 2V76A 5D3WA 3GYOA 3P6AA 1P5TA 1SGHA 4IOYX 4IAPA 1X11A 2PZ1A 3BINA 2K2UA 2VSZA 2ELBA 1FOEA 4A6FB 3F5RA 4ZRIA 1BAKA 1WGUA 2N0YA 4XWXA 1UNRA 4F7GA 3ODXA 2JP2A 4K17A 1ZC4B 3PP2A 2YF0A 2LOXA 3AU4A 4K2PA 2XQNM 3AU5A 2YS1A 4EKUA 1PFJA 5KCVA 1NU2A 2NZ8B 3A98B 1EAZA 1U5EA 3PEGA 4ZRKA 3CXBB 3M1IB 1OQNA 1UEFA 3OANA 4HHVA 1K5GB 1V61A 1WJ1A 2RSGA 5KQ4A 2GCJA 2Z0OA 2LYDA 4CYEA 4K81A 2D9XA 4BBKA 3U8ZA 1V5PA 1W1GA 1ZC3B 2I1JA 2LG1A 3TFMA 2KUPA 4GXBA 1TJ6A 4HB0B 3GYPA 4KHOA 2D10A 1RRPB 2DHJA 4Z2NA 4WVFB 2M14A 1PMSA 1ISNA 3N7CA 1PLSA 1XR0B 5GOWB 1ZM0A 5D27A 2W2XD 2CY4A 2DHIA 1K5DB 3D8FA 4CHMA 3MDBC 3WYFB 1J0WA 1WI1A 2MDXA 4HAXB 4P7IA 3KRWA 4HAWB 2COFA 3F0WA 1FHOA 1XODA 5EFXA 1V5UA 1LW3A 3MPXA 2ROVA 4KHBB 1EF1A 2H7EA 1X86A 3KZ1A 1E5WA 4K2OA 4A6KA 1U27A 2I5FA 4MT7A 2LOZA 1QC6A 5CLLB 3TO1A 2ZPYA 4KVGB 3QBVB 3HQCA 3FSSA 1UNQA 4GMXB 3X23A 1GC6A 1U5DA 2RLOA 4A5KA 1H4RA 2P8VA 5C5BA 5LONB 5LOPB 3TW1A 2X18A 4KHAA 1DYNA 2KCJA 1FHXA 2L2IA 1BTKA 1V88A 2QKMA 2R09A 4NSWA 4DX8A 2DFKA 3CIKA 5JP4A 2J0MA 2QKLA 1MAIA 1XKEA 1Y5OA 1DBHA 5CLQB 1X1GA 1FB8A 5J3QA 3PVWA 1BTNA 4C0AA 1SHCA 4HDQA 3SO6A 2MFQA 2Z0PA 5HE3A 4DX90 1NTYA 2AL6A 2M38A 1I2HA 4A6HA 3FM8C 2Y7BA 5D3VA 5DH9B 4ZRJA 1OY2A 2YT0A 3QIJA 4IFSA 1U2BA 1P6SA 2COCA 3LJUX 2NMBA 3AJ4A 2CAYA 4HB4B 2EMSA 3SV1A 1U29A 3P7ZA 2LKOA 1MK9B 2DN6A 2R0DA 1H10A 3FEHA 3ODOA 2N23A 4HAUB
chains in the Genus database with same CATH superfamily
2YSZA 1XD4A 3HSAA 1UNPA 2CRFA 5HE1A 1M7EA 2D9ZA 3VIAA 2K8EA 2FJLA 2P0HA 2DYNA 3KSYA 4Y94A 2Y8GA 4B6HA 1GC7A 2RVBB 5C5BB 4DBBA 2UZSA 2D9WA 2UZRA 2DA0A 5C16A 3TVVA 4F7HA 2J0KA 2Q13A 3SNHA 1ZSQA 3U7DA 1DDVA 1FGYA 1T77A 3A8QA 2EMTA 2VRWB 2RNRB 5DI9B 3DXEA 1UPRA 1U5GA 2LULA 2BCJA 3KY9A 5DHFB 1AWEA 2ADZA 3A58A 5I2MA 5JHHA 3RCPA 1MKEA 4Z2MB 4F7UP 4HB2B 5JLJB 1KZGA 4MK0A 2DHKA 1WJMA 1V89A 5J3YA 2VKIA 1Q67A 5D3YA 2I1KA 3NW8A 2ELAA 1OMWA 2L1CA 1KI1B 2OQBA 4HAVB 4GZUA 3DXDA 1TQZA 3PVUA 1DDWA 3IVFA 1FAOA 5FI1A 2P0FA 2GJYA 2DX1A 2UVMA 3O96A 2RGNB 2YT2A 2DKPA 2Z59A 5JHGA 1WG7A 2GUMA 2E2XA 4YONA 1B55A 2YVCA 2DX5A 2YT1A 3ODWA 3DXCA 2IFSA 1NTVA 1J19A 3PVLA 2H7DA 1EVHA 2RUKB 1XX0A 2D9YA 4PNKA 2YS5A 5LG4B 3HW2B 3ML4A 2D9VA 1BWNA 2COAA 1MIXA 4D0NB 2W2WA 1DROA 2D2QA 3VOQA 1W1HA 2D4QA 1EGXA 3KRXA 5DIFB 1TXDA 1RJ2A 1MIZB 2K2JA 4EJNA 3HK0A 1LB1A 1QQGA 2I5CA 4HB3B 2YRYA 1X05A 2W2XC 5J3TA 3ULCA 4WJ7A 3PG7A 1UPQA 2MWNB 4TKNA 4KAXB 4NY0A 5DHAB 3PZDA 2GS0A 1X1FA 3QWMA 4QJ3B 4HDOA 4QJ4B 4L6EA 1WVHA 1M7RA 4H8SA 2DTCA 2R2YA 2K49A 4GN1A 2G35A 1NI2A 4A6FA 4GMVA 4QJ5B 2GCLA 1ZYIA 3ZVRA 5I2SA 5L81A 3SYXA 2D11A 5C6RA 3V5WA 3HIEA 4HAYB 2J0JA 3A8PA 2ROZB 5HE2A 2YS3A 1FHWA 4WSFA 1Z87A 2EC1A 3SUZA 4TYZA 5KQ1A 4CHJA 4HAZB 2DYQA 3D8DA 4L1RA 2KIGA 1W1DA 5FI0A 4MY6A 3UZTA 1WGQA 2AEHA 3TCAA 3PSCA 2HTHB 1DDMA 2DLWA 2MKRA 2HE7A 4GOUA 1N3HA 1XCGA 1ZVRA 3U12A 2CODA 5D3XA 3BJIA 2KGXB 1Y19B 3ULBA 2KR0A 4DIXA 1KZ7A 4DXAB 1P3RA 4GPTB 1IRSA 2CY5A 3D8EA 3NSUA 5HE0A 2NBVA 5C79A 2EJ8A 4EMOA 1I7AA 1U5FA 2J59M 3G9WA 1MK7B 2OTXA 3ZDTA 1GG3A 2IYBA 2P0DA 2DKQA 2Y8FA 2K00A 4PQ0A 3WA0A 1FGZA 2Z0QA 1V5MA 3B77A 4HATB 1MPHA 4YL8A 3T06A 1AQCA 2V76A 5IRSA 5D3WA 3GYOA 3P6AA 1P5TA 1SGHA 4IOYX 4IAPA 1X11A 2PZ1A 3BINA 2K2UA 2VSZA 2ELBA 1FOEA 4A6FB 3F5RA 4ZRIA 1BAKA 1WGUA 2N0YA 4KHBA 4XWXA 1UNRA 4F7GA 3NWDA 3ODXA 2JP2A 4K17A 3DCXA 1ZC4B 3PP2A 2YF0A 2LOXA 3AU4A 4K2PA 2XQNM 3AU5A 2YS1A 4EKUA 1PFJA 5KCVA 1NU2A 4OT1A 2NZ8B 3A98B 1EAZA 1U5EA 2Z4DA 3PEGA 4ZRKA 3CXBB 3M1IB 2FJUB 1OQNA 1UEFA 3OANA 4HHVA 1K5GB 1V61A 1WJ1A 2RSGA 5KQ4A 2GCJA 2Z0OA 2LYDA 4CYEA 4K81A 2D9XA 4BBKA 3U8ZA 1V5PA 1W1GA 1ZC3B 2I1JA 2LG1A 3TFMA 4GNKB 2KUPA 4GXBA 3OHMB 1TJ6A 4HB0B 3GYPA 2KUQA 4KHOA 2D10A 1RRPB 2DHJA 4Z2NA 4WVFB 2M14A 1PMSA 1ISNA 3N7CA 1PLSA 1XR0B 5GOWB 1ZM0A 5D27A 4HSIA 2W2XD 2CY4A 2DHIA 1K5DB 3D8FA 4CHMA 3MDBC 3WYFB 1J0WA 1WI1A 2MDXA 4HAXB 4P7IA 3KRWA 4HAWB 2COFA 3F0WA 1FHOA 1XODA 5EFXA 1V5UA 1MI1A 1LW3A 3MPXA 2ROVA 4KHBB 1EF1A 2H7EA 1X86A 2ZKMX 3KZ1A 1E5WA 5M4YB 4K2OA 4A6KA 1U27A 2I5FA 4MT7A 2LOZA 1QC6A 5CLLB 3TO1A 2ZPYA 4OSNA 4KVGB 3QBVB 3HQCA 3FSSA 1UNQA 4GMXB 3X23A 1GC6A 1U5DA 2RLOA 4A5KA 1H4RA 2P8VA 5C5BA 5LONB 5LOPB 3TW1A 2X18A 4KHAA 1DYNA 2KCJA 1FHXA 2L2IA 3NWFA 1BTKA 1V88A 2QKMA 2R09A 4NSWA 4DX8A 2DFKA 3CIKA 5JP4A 2J0MA 2QKLA 1MAIA 1XKEA 1Y5OA 1DBHA 5CLQB 1X1GA 1FB8A 5J3QA 3PVWA 1BTNA 2Z13A 4C0AA 1SHCA 4HDQA 4D6WA 2Z14A 2MFQA 3SO6A 2Z0PA 3NWAA 5HE3A 4DX90 1NTYA 2AL6A 2RRFA 2KIEA 2M38A 1I2HA 4A6HA 3FM8C 2Y7BA 4CSQA 5D3VA 5DH9B 4ZRJA 1OY2A 2YT0A 3QIJA 4IFSA 1U2BA 1P6SA 2COCA 3LJUX 2NMBA 3AJ4A 2CAYA 4HB4B 2EMSA 3SV1A 1U29A 4QXAB 2LKOA 3P7ZA 3FVCA 1MK9B 2DN6A 2R0DA 1H10A 3FEHA 3ODOA 2N23A 4HAUB
chains in the Genus database with same CATH topology
2YSZA 1XD4A 1UNPA 2CRFA 5HE1A 1M7EA 2D9ZA 3VIAA 2FJLA 2P0HA 2DYNA 3KSYA 4Y94A 2Y8GA 4B6HA 1GC7A 2RVBB 5C5BB 4DBBA 2UZSA 2D9WA 2UZRA 2DA0A 5C16A 3TVVA 4F7HA 2J0KA 2Q13A 3SNHA 1ZSQA 3U7DA 1DDVA 1FGYA 3A8QA 2EMTA 2VRWB 2RNRB 5DI9B 3DXEA 1UPRA 1U5GA 2LULA 2BCJA 3KY9A 5DHFB 1AWEA 2ADZA 5JHHA 3RCPA 1MKEA 4Z2MB 4F7UP 4HB2B 5JLJB 1KZGA 4MK0A 2DHKA 1WJMA 1V89A 5J3YA 2VKIA 1Q67A 5D3YA 2I1KA 2ELAA 1OMWA 2L1CA 1KI1B 2OQBA 4HAVB 4GZUA 3DXDA 1TQZA 3PVUA 1DDWA 3IVFA 1FAOA 5FI1A 2P0FA 2GJYA 2DX1A 2UVMA 3O96A 2RGNB 2DKPA 5JHGA 1WG7A 2E2XA 4YONA 1B55A 2YVCA 2DX5A 2YT1A 3ODWA 3DXCA 2IFSA 1NTVA 1J19A 3PVLA 2H7DA 1EVHA 2RUKB 1XX0A 2D9YA 4PNKA 2YS5A 3HW2B 3ML4A 2D9VA 1BWNA 2COAA 1MIXA 4D0NB 2W2WA 1DROA 2D2QA 3VOQA 1W1HA 2D4QA 1EGXA 3KRXA 5DIFB 1TXDA 1RJ2A 1MIZB 2K2JA 4EJNA 3HK0A 1LB1A 1QQGA 2I5CA 4HB3B 2YRYA 1X05A 2W2XC 5J3TA 3ULCA 4WJ7A 3PG7A 1UPQA 2MWNB 4TKNA 4KAXB 4NY0A 5DHAB 3PZDA 2GS0A 1X1FA 3QWMA 4HDOA 4L6EA 1WVHA 1M7RA 4H8SA 2DTCA 4GN1A 2G35A 1NI2A 4A6FA 4GMVA 2GCLA 3ZVRA 5L81A 3SYXA 2D11A 5C6RA 3V5WA 4HAYB 2J0JA 3A8PA 2ROZB 5HE2A 2YS3A 1FHWA 4WSFA 1Z87A 2EC1A 3SUZA 4TYZA 5KQ1A 4CHJA 4HAZB 2DYQA 3D8DA 5FI0A 1W1DA 4MY6A 3UZTA 1WGQA 2AEHA 3TCAA 3PSCA 2HTHB 1DDMA 2DLWA 2MKRA 2HE7A 1N3HA 1XCGA 1ZVRA 2CODA 5D3XA 3BJIA 2KGXB 1Y19B 3ULBA 1KZ7A 4DXAB 1P3RA 4GPTB 1IRSA 2CY5A 3D8EA 3NSUA 5HE0A 5C79A 2EJ8A 4EMOA 1I7AA 1U5FA 2J59M 3G9WA 1MK7B 2OTXA 3ZDTA 1GG3A 2IYBA 2P0DA 2DKQA 2Y8FA 2K00A 4PQ0A 3WA0A 1FGZA 2Z0QA 1V5MA 4HATB 1MPHA 4YL8A 3T06A 1AQCA 2V76A 5D3WA 3GYOA 3P6AA 1P5TA 1SGHA 4IOYX 4IAPA 1X11A 2PZ1A 3BINA 2K2UA 2VSZA 2ELBA 1FOEA 4A6FB 3F5RA 4ZRIA 1BAKA 1WGUA 2N0YA 4XWXA 1UNRA 4F7GA 3ODXA 2JP2A 4K17A 1ZC4B 3PP2A 2YF0A 2LOXA 3AU4A 4K2PA 2XQNM 3AU5A 2YS1A 4EKUA 1PFJA 5KCVA 1NU2A 2NZ8B 3A98B 1EAZA 1U5EA 3PEGA 4ZRKA 3CXBB 3M1IB 1OQNA 1UEFA 3OANA 4HHVA 1K5GB 1V61A 1WJ1A 2RSGA 5KQ4A 2GCJA 2Z0OA 2LYDA 4CYEA 4K81A 2D9XA 4BBKA 3U8ZA 1V5PA 1W1GA 1ZC3B 2I1JA 2LG1A 3TFMA 2KUPA 4GXBA 1TJ6A 4HB0B 3GYPA 4KHOA 2D10A 1RRPB 2DHJA 4Z2NA 4WVFB 2M14A 1PMSA 1ISNA 3N7CA 1PLSA 1XR0B 5GOWB 1ZM0A 5D27A 2W2XD 2CY4A 2DHIA 1K5DB 3D8FA 4CHMA 3MDBC 3WYFB 1J0WA 1WI1A 2MDXA 4HAXB 4P7IA 3KRWA 4HAWB 2COFA 3F0WA 1FHOA 1XODA 5EFXA 1V5UA 1LW3A 3MPXA 2ROVA 4KHBB 1EF1A 2H7EA 1X86A 3KZ1A 1E5WA 4K2OA 4A6KA 1U27A 2I5FA 4MT7A 2LOZA 1QC6A 5CLLB 3TO1A 2ZPYA 4KVGB 3QBVB 3HQCA 3FSSA 1UNQA 4GMXB 3X23A 1GC6A 1U5DA 2RLOA 4A5KA 1H4RA 2P8VA 5C5BA 5LONB 5LOPB 3TW1A 2X18A 4KHAA 1DYNA 2KCJA 1FHXA 2L2IA 1BTKA 1V88A 2QKMA 2R09A 4NSWA 4DX8A 2DFKA 3CIKA 5JP4A 2J0MA 2QKLA 1MAIA 1XKEA 1Y5OA 1DBHA 5CLQB 1X1GA 1FB8A 5J3QA 3PVWA 1BTNA 4C0AA 1SHCA 4HDQA 3SO6A 2MFQA 2Z0PA 5HE3A 4DX90 1NTYA 2AL6A 2M38A 1I2HA 4A6HA 3FM8C 2Y7BA 5D3VA 5DH9B 4ZRJA 1OY2A 2YT0A 3QIJA 4IFSA 1U2BA 1P6SA 2COCA 3LJUX 2NMBA 3AJ4A 2CAYA 4HB4B 2EMSA 3SV1A 1U29A 3P7ZA 2LKOA 1MK9B 2DN6A 2R0DA 1H10A 3FEHA 3ODOA 2N23A 4HAUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSZ A;  1XD4 A;  1UNP A;  2CRF A;  5HE1 A;  1M7E A;  2D9Z A;  3VIA A;  2FJL A;  2P0H A;  2DYN A;  3KSY A;  4Y94 A;  2Y8G A;  4B6H A;  1GC7 A;  2RVB B;  5C5B B;  4DBB A;  2UZS A;  2D9W A;  2UZR A;  2DA0 A;  5C16 A;  3TVV A;  4F7H A;  2J0K A;  2Q13 A;  3SNH A;  1ZSQ A;  3U7D A;  1DDV A;  1FGY A;  3A8Q A;  2EMT A;  2VRW B;  2RNR B;  5DI9 B;  3DXE A;  1UPR A;  1U5G A;  2LUL A;  2BCJ A;  3KY9 A;  5DHF B;  1AWE A;  2ADZ A;  5JHH A;  3RCP A;  1MKE A;  4Z2M B;  4F7U P;  4HB2 B;  5JLJ B;  1KZG A;  4MK0 A;  2DHK A;  1WJM A;  1V89 A;  5J3Y A;  2VKI A;  1Q67 A;  5D3Y A;  2I1K A;  2ELA A;  1OMW A;  2L1C A;  1KI1 B;  2OQB A;  4HAV B;  4GZU A;  3DXD A;  1TQZ A;  3PVU A;  1DDW A;  3IVF A;  1FAO A;  5FI1 A;  2P0F A;  2GJY A;  2DX1 A;  2UVM A;  3O96 A;  2RGN B;  2DKP A;  5JHG A;  1WG7 A;  2E2X A;  4YON A;  1B55 A;  2YVC A;  2DX5 A;  2YT1 A;  3ODW A;  3DXC A;  2IFS A;  1NTV A;  1J19 A;  3PVL A;  2H7D A;  1EVH A;  2RUK B;  1XX0 A;  2D9Y A;  4PNK A;  2YS5 A;  3HW2 B;  3ML4 A;  2D9V A;  1BWN A;  2COA A;  1MIX A;  4D0N B;  2W2W A;  1DRO A;  2D2Q A;  3VOQ A;  1W1H A;  2D4Q A;  1EGX A;  3KRX A;  5DIF B;  1TXD A;  1RJ2 A;  1MIZ B;  2K2J A;  4EJN A;  3HK0 A;  1LB1 A;  1QQG A;  2I5C A;  4HB3 B;  2YRY A;  1X05 A;  2W2X C;  5J3T A;  3ULC A;  4WJ7 A;  3PG7 A;  1UPQ A;  2MWN B;  4TKN A;  4KAX B;  4NY0 A;  5DHA B;  3PZD A;  2GS0 A;  1X1F A;  3QWM A;  4HDO A;  4L6E A;  1WVH A;  1M7R A;  4H8S A;  2DTC A;  4GN1 A;  2G35 A;  1NI2 A;  4A6F A;  4GMV A;  2GCL A;  3ZVR A;  5L81 A;  3SYX A;  2D11 A;  5C6R A;  3V5W A;  4HAY B;  2J0J A;  3A8P A;  2ROZ B;  5HE2 A;  2YS3 A;  1FHW A;  4WSF A;  1Z87 A;  2EC1 A;  3SUZ A;  4TYZ A;  5KQ1 A;  4CHJ A;  4HAZ B;  2DYQ A;  3D8D A;  5FI0 A;  1W1D A;  4MY6 A;  3UZT A;  1WGQ A;  2AEH A;  3TCA A;  3PSC A;  2HTH B;  1DDM A;  2DLW A;  2MKR A;  2HE7 A;  1N3H A;  1XCG A;  1ZVR A;  2COD A;  5D3X A;  3BJI A;  2KGX B;  1Y19 B;  3ULB A;  1KZ7 A;  4DXA B;  1P3R A;  4GPT B;  1IRS A;  2CY5 A;  3D8E A;  3NSU A;  5HE0 A;  5C79 A;  2EJ8 A;  4EMO A;  1I7A A;  1U5F A;  2J59 M;  3G9W A;  1MK7 B;  2OTX A;  3ZDT A;  1GG3 A;  2IYB A;  2P0D A;  2DKQ A;  2Y8F A;  2K00 A;  4PQ0 A;  3WA0 A;  1FGZ A;  2Z0Q A;  1V5M A;  4HAT B;  1MPH A;  4YL8 A;  3T06 A;  1AQC A;  2V76 A;  5D3W A;  3GYO A;  3P6A A;  1P5T A;  1SGH A;  4IOY X;  4IAP A;  1X11 A;  2PZ1 A;  3BIN A;  2K2U A;  2VSZ A;  2ELB A;  1FOE A;  4A6F B;  3F5R A;  4ZRI A;  1BAK A;  1WGU A;  2N0Y A;  4XWX A;  1UNR A;  4F7G A;  3ODX A;  2JP2 A;  4K17 A;  1ZC4 B;  3PP2 A;  2YF0 A;  2LOX A;  3AU4 A;  4K2P A;  2XQN M;  3AU5 A;  2YS1 A;  4EKU A;  1PFJ A;  5KCV A;  1NU2 A;  2NZ8 B;  3A98 B;  1EAZ A;  1U5E A;  3PEG A;  4ZRK A;  3CXB B;  3M1I B;  1OQN A;  1UEF A;  3OAN A;  4HHV A;  1K5G B;  1V61 A;  1WJ1 A;  2RSG A;  5KQ4 A;  2GCJ A;  2Z0O A;  2LYD A;  4CYE A;  4K81 A;  2D9X A;  4BBK A;  3U8Z A;  1V5P A;  1W1G A;  1ZC3 B;  2I1J A;  2LG1 A;  3TFM A;  2KUP A;  4GXB A;  1TJ6 A;  4HB0 B;  3GYP A;  4KHO A;  2D10 A;  1RRP B;  2DHJ A;  4Z2N A;  4WVF B;  2M14 A;  1PMS A;  1ISN A;  3N7C A;  1PLS A;  1XR0 B;  5GOW B;  1ZM0 A;  5D27 A;  2W2X D;  2CY4 A;  2DHI A;  1K5D B;  3D8F A;  4CHM A;  3MDB C;  3WYF B;  1J0W A;  1WI1 A;  2MDX A;  4HAX B;  4P7I A;  3KRW A;  4HAW B;  2COF A;  3F0W A;  1FHO A;  1XOD A;  5EFX A;  1V5U A;  1LW3 A;  3MPX A;  2ROV A;  4KHB B;  1EF1 A;  2H7E A;  1X86 A;  3KZ1 A;  1E5W A;  4K2O A;  4A6K A;  1U27 A;  2I5F A;  4MT7 A;  2LOZ A;  1QC6 A;  5CLL B;  3TO1 A;  2ZPY A;  4KVG B;  3QBV B;  3HQC A;  3FSS A;  1UNQ A;  4GMX B;  3X23 A;  1GC6 A;  1U5D A;  2RLO A;  4A5K A;  1H4R A;  2P8V A;  5C5B A;  5LON B;  5LOP B;  3TW1 A;  2X18 A;  4KHA A;  1DYN A;  2KCJ A;  1FHX A;  2L2I A;  1BTK A;  1V88 A;  2QKM A;  2R09 A;  4NSW A;  4DX8 A;  2DFK A;  3CIK A;  5JP4 A;  2J0M A;  2QKL A;  1MAI A;  1XKE A;  1Y5O A;  1DBH A;  5CLQ B;  1X1G A;  1FB8 A;  5J3Q A;  3PVW A;  1BTN A;  4C0A A;  1SHC A;  4HDQ A;  3SO6 A;  2MFQ A;  2Z0P A;  5HE3 A;  4DX9 0;  1NTY A;  2AL6 A;  2M38 A;  1I2H A;  4A6H A;  3FM8 C;  2Y7B A;  5D3V A;  5DH9 B;  4ZRJ A;  1OY2 A;  2YT0 A;  3QIJ A;  4IFS A;  1U2B A;  1P6S A;  2COC A;  3LJU X;  2NMB A;  3AJ4 A;  2CAY A;  4HB4 B;  2EMS A;  3SV1 A;  1U29 A;  3P7Z A;  2LKO A;  1MK9 B;  2DN6 A;  2R0D A;  1H10 A;  3FEH A;  3ODO A;  2N23 A;  4HAU B; 
#chains in the Genus database with same CATH topology
 2YSZ A;  1XD4 A;  3HSA A;  1UNP A;  2CRF A;  5HE1 A;  1M7E A;  2D9Z A;  3VIA A;  2K8E A;  2FJL A;  2P0H A;  2DYN A;  3KSY A;  4Y94 A;  2Y8G A;  4B6H A;  1GC7 A;  2RVB B;  5C5B B;  4DBB A;  2UZS A;  2D9W A;  2UZR A;  2DA0 A;  5C16 A;  3TVV A;  4F7H A;  2J0K A;  2Q13 A;  3SNH A;  1ZSQ A;  3U7D A;  1DDV A;  1FGY A;  1T77 A;  3A8Q A;  2EMT A;  2VRW B;  2RNR B;  5DI9 B;  3DXE A;  1UPR A;  1U5G A;  2LUL A;  2BCJ A;  3KY9 A;  5DHF B;  1AWE A;  2ADZ A;  3A58 A;  5I2M A;  5JHH A;  3RCP A;  1MKE A;  4Z2M B;  4F7U P;  4HB2 B;  5JLJ B;  1KZG A;  4MK0 A;  2DHK A;  1WJM A;  1V89 A;  5J3Y A;  2VKI A;  1Q67 A;  5D3Y A;  2I1K A;  3NW8 A;  2ELA A;  1OMW A;  2L1C A;  1KI1 B;  2OQB A;  4HAV B;  4GZU A;  3DXD A;  1TQZ A;  3PVU A;  1DDW A;  3IVF A;  1FAO A;  5FI1 A;  2P0F A;  2GJY A;  2DX1 A;  2UVM A;  3O96 A;  2RGN B;  2YT2 A;  2DKP A;  2Z59 A;  5JHG A;  1WG7 A;  2GUM A;  2E2X A;  4YON A;  1B55 A;  2YVC A;  2DX5 A;  2YT1 A;  3ODW A;  3DXC A;  2IFS A;  1NTV A;  1J19 A;  3PVL A;  2H7D A;  1EVH A;  2RUK B;  1XX0 A;  2D9Y A;  4PNK A;  2YS5 A;  5LG4 B;  3HW2 B;  3ML4 A;  2D9V A;  1BWN A;  2COA A;  1MIX A;  4D0N B;  2W2W A;  1DRO A;  2D2Q A;  3VOQ A;  1W1H A;  2D4Q A;  1EGX A;  3KRX A;  5DIF B;  1TXD A;  1RJ2 A;  1MIZ B;  2K2J A;  4EJN A;  3HK0 A;  1LB1 A;  1QQG A;  2I5C A;  4HB3 B;  2YRY A;  1X05 A;  2W2X C;  5J3T A;  3ULC A;  4WJ7 A;  3PG7 A;  1UPQ A;  2MWN B;  4TKN A;  4KAX B;  4NY0 A;  5DHA B;  3PZD A;  2GS0 A;  1X1F A;  3QWM A;  4QJ3 B;  4HDO A;  4QJ4 B;  4L6E A;  1WVH A;  1M7R A;  4H8S A;  2DTC A;  2R2Y A;  2K49 A;  4GN1 A;  2G35 A;  1NI2 A;  4A6F A;  4GMV A;  4QJ5 B;  2GCL A;  1ZYI A;  3ZVR A;  5I2S A;  5L81 A;  3SYX A;  2D11 A;  5C6R A;  3V5W A;  3HIE A;  4HAY B;  2J0J A;  3A8P A;  2ROZ B;  5HE2 A;  2YS3 A;  1FHW A;  4WSF A;  1Z87 A;  2EC1 A;  3SUZ A;  4TYZ A;  5KQ1 A;  4CHJ A;  4HAZ B;  2DYQ A;  3D8D A;  4L1R A;  2KIG A;  1W1D A;  5FI0 A;  4MY6 A;  3UZT A;  1WGQ A;  2AEH A;  3TCA A;  3PSC A;  2HTH B;  1DDM A;  2DLW A;  2MKR A;  2HE7 A;  4GOU A;  1N3H A;  1XCG A;  1ZVR A;  3U12 A;  2COD A;  5D3X A;  3BJI A;  2KGX B;  1Y19 B;  3ULB A;  2KR0 A;  4DIX A;  1KZ7 A;  4DXA B;  1P3R A;  4GPT B;  1IRS A;  2CY5 A;  3D8E A;  3NSU A;  5HE0 A;  2NBV A;  5C79 A;  2EJ8 A;  4EMO A;  1I7A A;  1U5F A;  2J59 M;  3G9W A;  1MK7 B;  2OTX A;  3ZDT A;  1GG3 A;  2IYB A;  2P0D A;  2DKQ A;  2Y8F A;  2K00 A;  4PQ0 A;  3WA0 A;  1FGZ A;  2Z0Q A;  1V5M A;  3B77 A;  4HAT B;  1MPH A;  4YL8 A;  3T06 A;  1AQC A;  2V76 A;  5IRS A;  5D3W A;  3GYO A;  3P6A A;  1P5T A;  1SGH A;  4IOY X;  4IAP A;  1X11 A;  2PZ1 A;  3BIN A;  2K2U A;  2VSZ A;  2ELB A;  1FOE A;  4A6F B;  3F5R A;  4ZRI A;  1BAK A;  1WGU A;  2N0Y A;  4KHB A;  4XWX A;  1UNR A;  4F7G A;  3NWD A;  3ODX A;  2JP2 A;  4K17 A;  3DCX A;  1ZC4 B;  3PP2 A;  2YF0 A;  2LOX A;  3AU4 A;  4K2P A;  2XQN M;  3AU5 A;  2YS1 A;  4EKU A;  1PFJ A;  5KCV A;  1NU2 A;  4OT1 A;  2NZ8 B;  3A98 B;  1EAZ A;  1U5E A;  2Z4D A;  3PEG A;  4ZRK A;  3CXB B;  3M1I B;  2FJU B;  1OQN A;  1UEF A;  3OAN A;  4HHV A;  1K5G B;  1V61 A;  1WJ1 A;  2RSG A;  5KQ4 A;  2GCJ A;  2Z0O A;  2LYD A;  4CYE A;  4K81 A;  2D9X A;  4BBK A;  3U8Z A;  1V5P A;  1W1G A;  1ZC3 B;  2I1J A;  2LG1 A;  3TFM A;  4GNK B;  2KUP A;  4GXB A;  3OHM B;  1TJ6 A;  4HB0 B;  3GYP A;  2KUQ A;  4KHO A;  2D10 A;  1RRP B;  2DHJ A;  4Z2N A;  4WVF B;  2M14 A;  1PMS A;  1ISN A;  3N7C A;  1PLS A;  1XR0 B;  5GOW B;  1ZM0 A;  5D27 A;  4HSI A;  2W2X D;  2CY4 A;  2DHI A;  1K5D B;  3D8F A;  4CHM A;  3MDB C;  3WYF B;  1J0W A;  1WI1 A;  2MDX A;  4HAX B;  4P7I A;  3KRW A;  4HAW B;  2COF A;  3F0W A;  1FHO A;  1XOD A;  5EFX A;  1V5U A;  1MI1 A;  1LW3 A;  3MPX A;  2ROV A;  4KHB B;  1EF1 A;  2H7E A;  1X86 A;  2ZKM X;  3KZ1 A;  1E5W A;  5M4Y B;  4K2O A;  4A6K A;  1U27 A;  2I5F A;  4MT7 A;  2LOZ A;  1QC6 A;  5CLL B;  3TO1 A;  2ZPY A;  4OSN A;  4KVG B;  3QBV B;  3HQC A;  3FSS A;  1UNQ A;  4GMX B;  3X23 A;  1GC6 A;  1U5D A;  2RLO A;  4A5K A;  1H4R A;  2P8V A;  5C5B A;  5LON B;  5LOP B;  3TW1 A;  2X18 A;  4KHA A;  1DYN A;  2KCJ A;  1FHX A;  2L2I A;  3NWF A;  1BTK A;  1V88 A;  2QKM A;  2R09 A;  4NSW A;  4DX8 A;  2DFK A;  3CIK A;  5JP4 A;  2J0M A;  2QKL A;  1MAI A;  1XKE A;  1Y5O A;  1DBH A;  5CLQ B;  1X1G A;  1FB8 A;  5J3Q A;  3PVW A;  1BTN A;  2Z13 A;  4C0A A;  1SHC A;  4HDQ A;  4D6W A;  2Z14 A;  2MFQ A;  3SO6 A;  2Z0P A;  3NWA A;  5HE3 A;  4DX9 0;  1NTY A;  2AL6 A;  2RRF A;  2KIE A;  2M38 A;  1I2H A;  4A6H A;  3FM8 C;  2Y7B A;  4CSQ A;  5D3V A;  5DH9 B;  4ZRJ A;  1OY2 A;  2YT0 A;  3QIJ A;  4IFS A;  1U2B A;  1P6S A;  2COC A;  3LJU X;  2NMB A;  3AJ4 A;  2CAY A;  4HB4 B;  2EMS A;  3SV1 A;  1U29 A;  4QXA B;  2LKO A;  3P7Z A;  3FVC A;  1MK9 B;  2DN6 A;  2R0D A;  1H10 A;  3FEH A;  3ODO A;  2N23 A;  4HAU B; 
#chains in the Genus database with same CATH homology
 2YSZ A;  1XD4 A;  1UNP A;  2CRF A;  5HE1 A;  1M7E A;  2D9Z A;  3VIA A;  2FJL A;  2P0H A;  2DYN A;  3KSY A;  4Y94 A;  2Y8G A;  4B6H A;  1GC7 A;  2RVB B;  5C5B B;  4DBB A;  2UZS A;  2D9W A;  2UZR A;  2DA0 A;  5C16 A;  3TVV A;  4F7H A;  2J0K A;  2Q13 A;  3SNH A;  1ZSQ A;  3U7D A;  1DDV A;  1FGY A;  3A8Q A;  2EMT A;  2VRW B;  2RNR B;  5DI9 B;  3DXE A;  1UPR A;  1U5G A;  2LUL A;  2BCJ A;  3KY9 A;  5DHF B;  1AWE A;  2ADZ A;  5JHH A;  3RCP A;  1MKE A;  4Z2M B;  4F7U P;  4HB2 B;  5JLJ B;  1KZG A;  4MK0 A;  2DHK A;  1WJM A;  1V89 A;  5J3Y A;  2VKI A;  1Q67 A;  5D3Y A;  2I1K A;  2ELA A;  1OMW A;  2L1C A;  1KI1 B;  2OQB A;  4HAV B;  4GZU A;  3DXD A;  1TQZ A;  3PVU A;  1DDW A;  3IVF A;  1FAO A;  5FI1 A;  2P0F A;  2GJY A;  2DX1 A;  2UVM A;  3O96 A;  2RGN B;  2DKP A;  5JHG A;  1WG7 A;  2E2X A;  4YON A;  1B55 A;  2YVC A;  2DX5 A;  2YT1 A;  3ODW A;  3DXC A;  2IFS A;  1NTV A;  1J19 A;  3PVL A;  2H7D A;  1EVH A;  2RUK B;  1XX0 A;  2D9Y A;  4PNK A;  2YS5 A;  3HW2 B;  3ML4 A;  2D9V A;  1BWN A;  2COA A;  1MIX A;  4D0N B;  2W2W A;  1DRO A;  2D2Q A;  3VOQ A;  1W1H A;  2D4Q A;  1EGX A;  3KRX A;  5DIF B;  1TXD A;  1RJ2 A;  1MIZ B;  2K2J A;  4EJN A;  3HK0 A;  1LB1 A;  1QQG A;  2I5C A;  4HB3 B;  2YRY A;  1X05 A;  2W2X C;  5J3T A;  3ULC A;  4WJ7 A;  3PG7 A;  1UPQ A;  2MWN B;  4TKN A;  4KAX B;  4NY0 A;  5DHA B;  3PZD A;  2GS0 A;  1X1F A;  3QWM A;  4HDO A;  4L6E A;  1WVH A;  1M7R A;  4H8S A;  2DTC A;  4GN1 A;  2G35 A;  1NI2 A;  4A6F A;  4GMV A;  2GCL A;  3ZVR A;  5L81 A;  3SYX A;  2D11 A;  5C6R A;  3V5W A;  4HAY B;  2J0J A;  3A8P A;  2ROZ B;  5HE2 A;  2YS3 A;  1FHW A;  4WSF A;  1Z87 A;  2EC1 A;  3SUZ A;  4TYZ A;  5KQ1 A;  4CHJ A;  4HAZ B;  2DYQ A;  3D8D A;  5FI0 A;  1W1D A;  4MY6 A;  3UZT A;  1WGQ A;  2AEH A;  3TCA A;  3PSC A;  2HTH B;  1DDM A;  2DLW A;  2MKR A;  2HE7 A;  1N3H A;  1XCG A;  1ZVR A;  2COD A;  5D3X A;  3BJI A;  2KGX B;  1Y19 B;  3ULB A;  1KZ7 A;  4DXA B;  1P3R A;  4GPT B;  1IRS A;  2CY5 A;  3D8E A;  3NSU A;  5HE0 A;  5C79 A;  2EJ8 A;  4EMO A;  1I7A A;  1U5F A;  2J59 M;  3G9W A;  1MK7 B;  2OTX A;  3ZDT A;  1GG3 A;  2IYB A;  2P0D A;  2DKQ A;  2Y8F A;  2K00 A;  4PQ0 A;  3WA0 A;  1FGZ A;  2Z0Q A;  1V5M A;  4HAT B;  1MPH A;  4YL8 A;  3T06 A;  1AQC A;  2V76 A;  5D3W A;  3GYO A;  3P6A A;  1P5T A;  1SGH A;  4IOY X;  4IAP A;  1X11 A;  2PZ1 A;  3BIN A;  2K2U A;  2VSZ A;  2ELB A;  1FOE A;  4A6F B;  3F5R A;  4ZRI A;  1BAK A;  1WGU A;  2N0Y A;  4XWX A;  1UNR A;  4F7G A;  3ODX A;  2JP2 A;  4K17 A;  1ZC4 B;  3PP2 A;  2YF0 A;  2LOX A;  3AU4 A;  4K2P A;  2XQN M;  3AU5 A;  2YS1 A;  4EKU A;  1PFJ A;  5KCV A;  1NU2 A;  2NZ8 B;  3A98 B;  1EAZ A;  1U5E A;  3PEG A;  4ZRK A;  3CXB B;  3M1I B;  1OQN A;  1UEF A;  3OAN A;  4HHV A;  1K5G B;  1V61 A;  1WJ1 A;  2RSG A;  5KQ4 A;  2GCJ A;  2Z0O A;  2LYD A;  4CYE A;  4K81 A;  2D9X A;  4BBK A;  3U8Z A;  1V5P A;  1W1G A;  1ZC3 B;  2I1J A;  2LG1 A;  3TFM A;  2KUP A;  4GXB A;  1TJ6 A;  4HB0 B;  3GYP A;  4KHO A;  2D10 A;  1RRP B;  2DHJ A;  4Z2N A;  4WVF B;  2M14 A;  1PMS A;  1ISN A;  3N7C A;  1PLS A;  1XR0 B;  5GOW B;  1ZM0 A;  5D27 A;  2W2X D;  2CY4 A;  2DHI A;  1K5D B;  3D8F A;  4CHM A;  3MDB C;  3WYF B;  1J0W A;  1WI1 A;  2MDX A;  4HAX B;  4P7I A;  3KRW A;  4HAW B;  2COF A;  3F0W A;  1FHO A;  1XOD A;  5EFX A;  1V5U A;  1LW3 A;  3MPX A;  2ROV A;  4KHB B;  1EF1 A;  2H7E A;  1X86 A;  3KZ1 A;  1E5W A;  4K2O A;  4A6K A;  1U27 A;  2I5F A;  4MT7 A;  2LOZ A;  1QC6 A;  5CLL B;  3TO1 A;  2ZPY A;  4KVG B;  3QBV B;  3HQC A;  3FSS A;  1UNQ A;  4GMX B;  3X23 A;  1GC6 A;  1U5D A;  2RLO A;  4A5K A;  1H4R A;  2P8V A;  5C5B A;  5LON B;  5LOP B;  3TW1 A;  2X18 A;  4KHA A;  1DYN A;  2KCJ A;  1FHX A;  2L2I A;  1BTK A;  1V88 A;  2QKM A;  2R09 A;  4NSW A;  4DX8 A;  2DFK A;  3CIK A;  5JP4 A;  2J0M A;  2QKL A;  1MAI A;  1XKE A;  1Y5O A;  1DBH A;  5CLQ B;  1X1G A;  1FB8 A;  5J3Q A;  3PVW A;  1BTN A;  4C0A A;  1SHC A;  4HDQ A;  3SO6 A;  2MFQ A;  2Z0P A;  5HE3 A;  4DX9 0;  1NTY A;  2AL6 A;  2M38 A;  1I2H A;  4A6H A;  3FM8 C;  2Y7B A;  5D3V A;  5DH9 B;  4ZRJ A;  1OY2 A;  2YT0 A;  3QIJ A;  4IFS A;  1U2B A;  1P6S A;  2COC A;  3LJU X;  2NMB A;  3AJ4 A;  2CAY A;  4HB4 B;  2EMS A;  3SV1 A;  1U29 A;  3P7Z A;  2LKO A;  1MK9 B;  2DN6 A;  2R0D A;  1H10 A;  3FEH A;  3ODO A;  2N23 A;  4HAU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...