1M7EA

Crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1m7eA00
1DROA 5FI1A 5JLJB 1KI1B 2IFSA 2FJLA 5JHGA 1WGUA 2G35A 3M1IB 2EC1A 2N0YA 2J0JA 3U7DA 1WJ1A 1ZSQA 2D9XA 1TQZA 2VKIA 2K00A 1BTNA 2I5FA 1UNPA 4HB2B 3PVLA 5C6RA 4EKUA 1PMSA 3WYFB 3SYXA 1EF1A 2NMBA 5HE3A 1GC7A 5D27A 1BWNA 2M14A 4HAVB 2P0FA 4TKNA 5LOPB 3DXEA 1M7RA 2Y7BA 4A6FB 3ZVRA 2COAA 3FM8C 1FHOA 3MDBC 2D9WA 3PSCA 1UPRA 2L1CA 2UZRA 2D2QA 3MPXA 2M38A 1V5MA 3ZDTA 1WGQA 3PVUA 2Z0PA 3TFMA 2HE7A 4DX8A 4DBBA 1V5PA 3F0WA 3HW2B 5KQ4A 1W1DA 2J0KA 4GPTB 4EJNA 3OANA 3PG7A 2P0HA 1BTKA 3GYPA 1M7EA 1TJ6A 4WJ7A 4DX90 2D9ZA 2PZ1A 1XX0A 2QKMA 4A6FA 3O96A 1UNRA 1FHXA 1U5DA 2N23A 3ULBA 1SHCA 4B6HA 4GN1A 3AJ4A 2D11A 1MPHA 3F5RA 3UZTA 1MKEA 5D3XA 1NU2A 3BINA 1U27A 3HQCA 3N7CA 2D9VA 5HE0A 1N3HA 4HATB 1U5FA 4MT7A 3D8DA 4MY6A 2YS1A 4DXAB 2EMSA 2CRFA 2V76A 1ZC4B 3TVVA 2RGNB 2HTHB 4F7GA 2COCA 2ROVA 3X23A 2YS5A 2GJYA 4KHBB 2BCJA 2Y8FA 5KQ1A 1ZC3B 1SGHA 3SO6A 2QKLA 4HAYB 2E2XA 2UZSA 1DDMA 3ODOA 1V88A 4F7UP 1P3RA 1DDVA 2I1JA 1EGXA 2JP2A 1RRPB 3NSUA 2LOXA 4HAUB 1QC6A 2D9YA 1ZM0A 2VRWB 1PLSA 1WVHA 5EFXA 1Q67A 2ROZB 2H7DA 3ULCA 2Z0OA 2K2UA 2GCLA 4F7HA 3D8FA 5DIFB 3A8QA 1FGYA 2RNRB 4ZRJA 2P0DA 3AU5A 1FB8A 4YL8A 3KRXA 1X05A 5D3YA 2K2JA 2R09A 4YONA 2GS0A 3ODXA 1MIZB 4GXBA 1Z87A 2R0DA 2P8VA 1OY2A 2DKQA 5JHHA 2J0MA 3KY9A 1I7AA 4MK0A 5DH9B 3FEHA 1X1GA 1AWEA 2CY4A 3PVWA 4HHVA 3KSYA 1PFJA 3VOQA 1H4RA 3G9WA 1LB1A 2DHIA 2COFA 1NTVA 4K81A 1P5TA 4Z2MB 2ADZA 1X86A 1V5UA 2LOZA 1I2HA 2YT0A 3KZ1A 4IAPA 5FI0A 2Z0QA 5C79A 2KCJA 2YT1A 1UPQA 4EMOA 2AL6A 4NSWA 1E5WA 2EJ8A 4IOYX 4HDQA 5D3WA 2X18A 1J0WA 5CLQB 1TXDA 1K5DB 1K5GB 4XWXA 4HB0B 4CYEA 3BJIA 1OMWA 2Q13A 4K2OA 2YVCA 2W2XC 3T06A 1V89A 2YRYA 3LJUX 3QIJA 1X1FA 3V5WA 4K17A 1WJMA 1U29A 3A8PA 4HB3B 1FGZA 2DYNA 1MK7B 1ZVRA 5GOWB 3SNHA 2ELBA 1DDWA 4PQ0A 4A6HA 1GC6A 2I5CA 2RSGA 2DN6A 4L6EA 5DI9B 1IRSA 1J19A 2OQBA 1Y19B 2OTXA 1B55A 5HE1A 2KUPA 1OQNA 4P7IA 2DKPA 1MAIA 1UNQA 5D3VA 3ODWA 2LKOA 3HK0A 2VSZA 5LONB 5J3YA 4H8SA 1EAZA 3U8ZA 2LYDA 1W1HA 1XCGA 2DTCA 2MDXA 2AEHA 3DXCA 2LULA 2MFQA 2YSZA 2MKRA 3A98B 2MWNB 1DYNA 1NI2A 1H10A 3PP2A 4GZUA 5KCVA 2YS3A 4A5KA 4IFSA 1XKEA 5HE2A 2DHJA 2ZPYA 4ZRKA 5DHAB 2Y8GA 2NZ8B 3QWMA 3P7ZA 1NTYA 3AU4A 4Y94A 5J3QA 1Y5OA 3KRWA 2DYQA 1EVHA 2J59M 5JP4A 4PNKA 1AQCA 4HAZB 1XR0B 2W2XD 3GYOA 1XODA 3TO1A 4Z2NA 1RJ2A 1XD4A 4D0NB 1V61A 3P6AA 1WG7A 3SV1A 2RUKB 4HAXB 5C16A 3TW1A 4KAXB 2RLOA 4ZRIA 2DX5A 5L81A 2W2WA 4A6KA 3SUZA 2YF0A 4HDOA 3CIKA 3QBVB 2DX1A 5C5BB 1FOEA 2CAYA 1DBHA 4TYZA 4CHJA 2DHKA 3VIAA 4KHOA 1MK9B 2DFKA 1FHWA 2RVBB 3PZDA 2DA0A 3D8EA 4K2PA 1KZ7A 2GCJA 2D4QA 4GMVA 4HAWB 2KGXB 1U2BA 5J3TA 3ML4A 2L2IA 4KVGB 4C0AA 4WVFB 2LG1A 5C5BA 3TCAA 2H7EA 1W1GA 2UVMA 3RCPA 3PEGA 1U5EA 2CODA 3FSSA 5CLLB 4GMXB 3CXBB 3IVFA 1QQGA 3DXDA 2CY5A 1BAKA 1LW3A 1UEFA 1P6SA 2XQNM 2D10A 4BBKA 4HB4B 1WI1A 2EMTA 3WA0A 1X11A 1KZGA 4KHAA 1MIXA 1ISNA 2DLWA 5DHFB 2IYBA 1GG3A 1FAOA 2I1KA 4WSFA 4CHMA 4NY0A 2ELAA 1U5GA
chains in the Genus database with same CATH superfamily
1DROA 5FI1A 5JLJB 1KI1B 3U12A 2IFSA 2FJLA 5JHGA 1WGUA 2G35A 3M1IB 2EC1A 3NWAA 2N0YA 2J0JA 3U7DA 1WJ1A 1ZSQA 2D9XA 1TQZA 2VKIA 2K00A 1BTNA 2I5FA 3NWFA 1UNPA 4HB2B 3PVLA 5C6RA 4EKUA 1PMSA 5M4YB 3WYFB 3SYXA 1EF1A 2NMBA 2RRFA 5HE3A 1GC7A 5D27A 1BWNA 2M14A 4HAVB 2P0FA 4TKNA 5LOPB 3DXEA 1M7RA 2Y7BA 5IRSA 5I2MA 4A6FB 3ZVRA 4GNKB 2COAA 3FM8C 1FHOA 3MDBC 2D9WA 3PSCA 1UPRA 2L1CA 2UZRA 2D2QA 3MPXA 2M38A 1V5MA 3ZDTA 3OHMB 1WGQA 3PVUA 2Z0PA 3TFMA 2HE7A 4DX8A 4DBBA 1V5PA 2NBVA 3F0WA 3HW2B 5KQ4A 1W1DA 2J0KA 4GPTB 4EJNA 3OANA 3PG7A 2P0HA 1BTKA 3GYPA 1M7EA 1TJ6A 4WJ7A 4DX90 2D9ZA 2PZ1A 1XX0A 2QKMA 4A6FA 3O96A 1UNRA 1FHXA 1U5DA 2N23A 3ULBA 1SHCA 4B6HA 4GN1A 3AJ4A 2D11A 1MPHA 3F5RA 3UZTA 1MKEA 5D3XA 1NU2A 3BINA 1U27A 3HQCA 3N7CA 2D9VA 5HE0A 1N3HA 4HATB 1U5FA 4MT7A 3D8DA 2FJUB 4MY6A 4QXAB 2YS1A 4DXAB 2KUQA 2EMSA 2CRFA 2V76A 1ZC4B 3TVVA 2RGNB 2YT2A 2HTHB 4F7GA 2COCA 3A58A 2ROVA 2GUMA 2YS5A 3X23A 2GJYA 1MI1A 4KHBB 2BCJA 2Y8FA 5KQ1A 1ZC3B 1SGHA 3SO6A 2QKLA 4HAYB 2E2XA 2UZSA 1DDMA 3ODOA 1V88A 4F7UP 1P3RA 1DDVA 2I1JA 1EGXA 2JP2A 1RRPB 3NSUA 2LOXA 4HAUB 1QC6A 2D9YA 1ZM0A 2VRWB 1PLSA 1WVHA 4QJ4B 5EFXA 1Q67A 2ROZB 2H7DA 3ULCA 2Z0OA 2K2UA 2GCLA 4F7HA 3D8FA 5DIFB 3A8QA 4KHBA 1FGYA 2KIEA 2RNRB 2KIGA 4ZRJA 5LG4B 2P0DA 3AU5A 1FB8A 4YL8A 3KRXA 1X05A 5D3YA 2K2JA 2R09A 2Z59A 4YONA 2GS0A 3ODXA 1MIZB 4GXBA 1Z87A 2R0DA 2P8VA 1OY2A 2DKQA 3DCXA 4D6WA 5JHHA 2J0MA 3KY9A 1I7AA 4MK0A 5DH9B 3FEHA 1X1GA 1AWEA 2CY4A 3PVWA 4HHVA 3KSYA 1PFJA 3VOQA 1H4RA 3G9WA 1LB1A 2DHIA 2COFA 1NTVA 4K81A 1P5TA 4Z2MB 2ADZA 1X86A 1V5UA 2LOZA 1I2HA 2YT0A 3KZ1A 4IAPA 5FI0A 2Z0QA 5C79A 2KCJA 2YT1A 1UPQA 4EMOA 2AL6A 4NSWA 1E5WA 2EJ8A 4IOYX 4HDQA 5D3WA 2X18A 1J0WA 5CLQB 1TXDA 1K5DB 1K5GB 4XWXA 4HB0B 4CYEA 3BJIA 1OMWA 2Q13A 4K2OA 2YVCA 2W2XC 3NWDA 3T06A 1V89A 2YRYA 3LJUX 3QIJA 4HSIA 1X1FA 3V5WA 4K17A 1WJMA 1U29A 3A8PA 3HSAA 4HB3B 1FGZA 2DYNA 1MK7B 1ZVRA 5GOWB 3SNHA 2ELBA 1DDWA 4PQ0A 4A6HA 1GC6A 2I5CA 2RSGA 2DN6A 4L6EA 5DI9B 1IRSA 1J19A 2OQBA 1Y19B 2OTXA 1B55A 3B77A 2Z13A 5HE1A 2KUPA 1OQNA 4L1RA 4P7IA 4DIXA 2DKPA 1MAIA 1UNQA 5D3VA 3ODWA 2LKOA 3HK0A 5I2SA 2VSZA 5LONB 5J3YA 4H8SA 4QJ5B 1EAZA 3U8ZA 2LYDA 1W1HA 1XCGA 2DTCA 2MDXA 2AEHA 3DXCA 2LULA 2MFQA 1ZYIA 2YSZA 2MKRA 3A98B 3HIEA 2MWNB 1DYNA 1NI2A 1H10A 3PP2A 4GZUA 4OT1A 5KCVA 2YS3A 4A5KA 4CSQA 4OSNA 4IFSA 1XKEA 5HE2A 2DHJA 2ZPYA 4ZRKA 5DHAB 2Y8GA 2NZ8B 3QWMA 4GOUA 3P7ZA 2K49A 1NTYA 3AU4A 4Y94A 5J3QA 3FVCA 1Y5OA 3KRWA 2DYQA 1EVHA 2J59M 5JP4A 4PNKA 1AQCA 4HAZB 1XR0B 2W2XD 2K8EA 3GYOA 3NW8A 1XODA 3TO1A 4Z2NA 1RJ2A 1XD4A 1T77A 4D0NB 1V61A 3P6AA 1WG7A 3SV1A 2RUKB 4HAXB 5C16A 3TW1A 4KAXB 2RLOA 4ZRIA 2DX5A 5L81A 2W2WA 4A6KA 3SUZA 2YF0A 4HDOA 3CIKA 3QBVB 2DX1A 5C5BB 1FOEA 2CAYA 1DBHA 4TYZA 4CHJA 2DHKA 3VIAA 4KHOA 1MK9B 2DFKA 1FHWA 2RVBB 3PZDA 2DA0A 3D8EA 4K2PA 1KZ7A 2GCJA 2D4QA 4GMVA 4HAWB 2KGXB 1U2BA 2ZKMX 5J3TA 3ML4A 2L2IA 4KVGB 2Z14A 4C0AA 2R2YA 4WVFB 2LG1A 5C5BA 3TCAA 2H7EA 1W1GA 2UVMA 3RCPA 3PEGA 1U5EA 2CODA 3FSSA 5CLLB 4GMXB 3CXBB 4QJ3B 2Z4DA 1QQGA 3DXDA 2CY5A 3IVFA 1BAKA 1LW3A 1UEFA 1P6SA 2KR0A 2XQNM 2D10A 4BBKA 4HB4B 1WI1A 2EMTA 3WA0A 1X11A 1KZGA 4KHAA 1MIXA 1ISNA 2DLWA 5DHFB 2IYBA 1GG3A 1FAOA 2I1KA 4WSFA 4CHMA 4NY0A 2ELAA 1U5GA
chains in the Genus database with same CATH topology
1DROA 5FI1A 5JLJB 1KI1B 2IFSA 2FJLA 5JHGA 1WGUA 2G35A 3M1IB 2EC1A 2N0YA 2J0JA 3U7DA 1WJ1A 1ZSQA 2D9XA 1TQZA 2VKIA 2K00A 1BTNA 2I5FA 1UNPA 4HB2B 3PVLA 5C6RA 4EKUA 1PMSA 3WYFB 3SYXA 1EF1A 2NMBA 5HE3A 1GC7A 5D27A 1BWNA 2M14A 4HAVB 2P0FA 4TKNA 5LOPB 3DXEA 1M7RA 2Y7BA 4A6FB 3ZVRA 2COAA 3FM8C 1FHOA 3MDBC 2D9WA 3PSCA 1UPRA 2L1CA 2UZRA 2D2QA 3MPXA 2M38A 1V5MA 3ZDTA 1WGQA 3PVUA 2Z0PA 3TFMA 2HE7A 4DX8A 4DBBA 1V5PA 3F0WA 3HW2B 5KQ4A 1W1DA 2J0KA 4GPTB 4EJNA 3OANA 3PG7A 2P0HA 1BTKA 3GYPA 1M7EA 1TJ6A 4WJ7A 4DX90 2D9ZA 2PZ1A 1XX0A 2QKMA 4A6FA 3O96A 1UNRA 1FHXA 1U5DA 2N23A 3ULBA 1SHCA 4B6HA 4GN1A 3AJ4A 2D11A 1MPHA 3F5RA 3UZTA 1MKEA 5D3XA 1NU2A 3BINA 1U27A 3HQCA 3N7CA 2D9VA 5HE0A 1N3HA 4HATB 1U5FA 4MT7A 3D8DA 4MY6A 2YS1A 4DXAB 2EMSA 2CRFA 2V76A 1ZC4B 3TVVA 2RGNB 2HTHB 4F7GA 2COCA 2ROVA 3X23A 2YS5A 2GJYA 4KHBB 2BCJA 2Y8FA 5KQ1A 1ZC3B 1SGHA 3SO6A 2QKLA 4HAYB 2E2XA 2UZSA 1DDMA 3ODOA 1V88A 4F7UP 1P3RA 1DDVA 2I1JA 1EGXA 2JP2A 1RRPB 3NSUA 2LOXA 4HAUB 1QC6A 2D9YA 1ZM0A 2VRWB 1PLSA 1WVHA 5EFXA 1Q67A 2ROZB 2H7DA 3ULCA 2Z0OA 2K2UA 2GCLA 4F7HA 3D8FA 5DIFB 3A8QA 1FGYA 2RNRB 4ZRJA 2P0DA 3AU5A 1FB8A 4YL8A 3KRXA 1X05A 5D3YA 2K2JA 2R09A 4YONA 2GS0A 3ODXA 1MIZB 4GXBA 1Z87A 2R0DA 2P8VA 1OY2A 2DKQA 5JHHA 2J0MA 3KY9A 1I7AA 4MK0A 5DH9B 3FEHA 1X1GA 1AWEA 2CY4A 3PVWA 4HHVA 3KSYA 1PFJA 3VOQA 1H4RA 3G9WA 1LB1A 2DHIA 2COFA 1NTVA 4K81A 1P5TA 4Z2MB 2ADZA 1X86A 1V5UA 2LOZA 1I2HA 2YT0A 3KZ1A 4IAPA 5FI0A 2Z0QA 5C79A 2KCJA 2YT1A 1UPQA 4EMOA 2AL6A 4NSWA 1E5WA 2EJ8A 4IOYX 4HDQA 5D3WA 2X18A 1J0WA 5CLQB 1TXDA 1K5DB 1K5GB 4XWXA 4HB0B 4CYEA 3BJIA 1OMWA 2Q13A 4K2OA 2YVCA 2W2XC 3T06A 1V89A 2YRYA 3LJUX 3QIJA 1X1FA 3V5WA 4K17A 1WJMA 1U29A 3A8PA 4HB3B 1FGZA 2DYNA 1MK7B 1ZVRA 5GOWB 3SNHA 2ELBA 1DDWA 4PQ0A 4A6HA 1GC6A 2I5CA 2RSGA 2DN6A 4L6EA 5DI9B 1IRSA 1J19A 2OQBA 1Y19B 2OTXA 1B55A 5HE1A 2KUPA 1OQNA 4P7IA 2DKPA 1MAIA 1UNQA 5D3VA 3ODWA 2LKOA 3HK0A 2VSZA 5LONB 5J3YA 4H8SA 1EAZA 3U8ZA 2LYDA 1W1HA 1XCGA 2DTCA 2MDXA 2AEHA 3DXCA 2LULA 2MFQA 2YSZA 2MKRA 3A98B 2MWNB 1DYNA 1NI2A 1H10A 3PP2A 4GZUA 5KCVA 2YS3A 4A5KA 4IFSA 1XKEA 5HE2A 2DHJA 2ZPYA 4ZRKA 5DHAB 2Y8GA 2NZ8B 3QWMA 3P7ZA 1NTYA 3AU4A 4Y94A 5J3QA 1Y5OA 3KRWA 2DYQA 1EVHA 2J59M 5JP4A 4PNKA 1AQCA 4HAZB 1XR0B 2W2XD 3GYOA 1XODA 3TO1A 4Z2NA 1RJ2A 1XD4A 4D0NB 1V61A 3P6AA 1WG7A 3SV1A 2RUKB 4HAXB 5C16A 3TW1A 4KAXB 2RLOA 4ZRIA 2DX5A 5L81A 2W2WA 4A6KA 3SUZA 2YF0A 4HDOA 3CIKA 3QBVB 2DX1A 5C5BB 1FOEA 2CAYA 1DBHA 4TYZA 4CHJA 2DHKA 3VIAA 4KHOA 1MK9B 2DFKA 1FHWA 2RVBB 3PZDA 2DA0A 3D8EA 4K2PA 1KZ7A 2GCJA 2D4QA 4GMVA 4HAWB 2KGXB 1U2BA 5J3TA 3ML4A 2L2IA 4KVGB 4C0AA 4WVFB 2LG1A 5C5BA 3TCAA 2H7EA 1W1GA 2UVMA 3RCPA 3PEGA 1U5EA 2CODA 3FSSA 5CLLB 4GMXB 3CXBB 3IVFA 1QQGA 3DXDA 2CY5A 1BAKA 1LW3A 1UEFA 1P6SA 2XQNM 2D10A 4BBKA 4HB4B 1WI1A 2EMTA 3WA0A 1X11A 1KZGA 4KHAA 1MIXA 1ISNA 2DLWA 5DHFB 2IYBA 1GG3A 1FAOA 2I1KA 4WSFA 4CHMA 4NY0A 2ELAA 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  5FI1 A;  5JLJ B;  1KI1 B;  2IFS A;  2FJL A;  5JHG A;  1WGU A;  2G35 A;  3M1I B;  2EC1 A;  2N0Y A;  2J0J A;  3U7D A;  1WJ1 A;  1ZSQ A;  2D9X A;  1TQZ A;  2VKI A;  2K00 A;  1BTN A;  2I5F A;  1UNP A;  4HB2 B;  3PVL A;  5C6R A;  4EKU A;  1PMS A;  3WYF B;  3SYX A;  1EF1 A;  2NMB A;  5HE3 A;  1GC7 A;  5D27 A;  1BWN A;  2M14 A;  4HAV B;  2P0F A;  4TKN A;  5LOP B;  3DXE A;  1M7R A;  2Y7B A;  4A6F B;  3ZVR A;  2COA A;  3FM8 C;  1FHO A;  3MDB C;  2D9W A;  3PSC A;  1UPR A;  2L1C A;  2UZR A;  2D2Q A;  3MPX A;  2M38 A;  1V5M A;  3ZDT A;  1WGQ A;  3PVU A;  2Z0P A;  3TFM A;  2HE7 A;  4DX8 A;  4DBB A;  1V5P A;  3F0W A;  3HW2 B;  5KQ4 A;  1W1D A;  2J0K A;  4GPT B;  4EJN A;  3OAN A;  3PG7 A;  2P0H A;  1BTK A;  3GYP A;  1M7E A;  1TJ6 A;  4WJ7 A;  4DX9 0;  2D9Z A;  2PZ1 A;  1XX0 A;  2QKM A;  4A6F A;  3O96 A;  1UNR A;  1FHX A;  1U5D A;  2N23 A;  3ULB A;  1SHC A;  4B6H A;  4GN1 A;  3AJ4 A;  2D11 A;  1MPH A;  3F5R A;  3UZT A;  1MKE A;  5D3X A;  1NU2 A;  3BIN A;  1U27 A;  3HQC A;  3N7C A;  2D9V A;  5HE0 A;  1N3H A;  4HAT B;  1U5F A;  4MT7 A;  3D8D A;  4MY6 A;  2YS1 A;  4DXA B;  2EMS A;  2CRF A;  2V76 A;  1ZC4 B;  3TVV A;  2RGN B;  2HTH B;  4F7G A;  2COC A;  2ROV A;  3X23 A;  2YS5 A;  2GJY A;  4KHB B;  2BCJ A;  2Y8F A;  5KQ1 A;  1ZC3 B;  1SGH A;  3SO6 A;  2QKL A;  4HAY B;  2E2X A;  2UZS A;  1DDM A;  3ODO A;  1V88 A;  4F7U P;  1P3R A;  1DDV A;  2I1J A;  1EGX A;  2JP2 A;  1RRP B;  3NSU A;  2LOX A;  4HAU B;  1QC6 A;  2D9Y A;  1ZM0 A;  2VRW B;  1PLS A;  1WVH A;  5EFX A;  1Q67 A;  2ROZ B;  2H7D A;  3ULC A;  2Z0O A;  2K2U A;  2GCL A;  4F7H A;  3D8F A;  5DIF B;  3A8Q A;  1FGY A;  2RNR B;  4ZRJ A;  2P0D A;  3AU5 A;  1FB8 A;  4YL8 A;  3KRX A;  1X05 A;  5D3Y A;  2K2J A;  2R09 A;  4YON A;  2GS0 A;  3ODX A;  1MIZ B;  4GXB A;  1Z87 A;  2R0D A;  2P8V A;  1OY2 A;  2DKQ A;  5JHH A;  2J0M A;  3KY9 A;  1I7A A;  4MK0 A;  5DH9 B;  3FEH A;  1X1G A;  1AWE A;  2CY4 A;  3PVW A;  4HHV A;  3KSY A;  1PFJ A;  3VOQ A;  1H4R A;  3G9W A;  1LB1 A;  2DHI A;  2COF A;  1NTV A;  4K81 A;  1P5T A;  4Z2M B;  2ADZ A;  1X86 A;  1V5U A;  2LOZ A;  1I2H A;  2YT0 A;  3KZ1 A;  4IAP A;  5FI0 A;  2Z0Q A;  5C79 A;  2KCJ A;  2YT1 A;  1UPQ A;  4EMO A;  2AL6 A;  4NSW A;  1E5W A;  2EJ8 A;  4IOY X;  4HDQ A;  5D3W A;  2X18 A;  1J0W A;  5CLQ B;  1TXD A;  1K5D B;  1K5G B;  4XWX A;  4HB0 B;  4CYE A;  3BJI A;  1OMW A;  2Q13 A;  4K2O A;  2YVC A;  2W2X C;  3T06 A;  1V89 A;  2YRY A;  3LJU X;  3QIJ A;  1X1F A;  3V5W A;  4K17 A;  1WJM A;  1U29 A;  3A8P A;  4HB3 B;  1FGZ A;  2DYN A;  1MK7 B;  1ZVR A;  5GOW B;  3SNH A;  2ELB A;  1DDW A;  4PQ0 A;  4A6H A;  1GC6 A;  2I5C A;  2RSG A;  2DN6 A;  4L6E A;  5DI9 B;  1IRS A;  1J19 A;  2OQB A;  1Y19 B;  2OTX A;  1B55 A;  5HE1 A;  2KUP A;  1OQN A;  4P7I A;  2DKP A;  1MAI A;  1UNQ A;  5D3V A;  3ODW A;  2LKO A;  3HK0 A;  2VSZ A;  5LON B;  5J3Y A;  4H8S A;  1EAZ A;  3U8Z A;  2LYD A;  1W1H A;  1XCG A;  2DTC A;  2MDX A;  2AEH A;  3DXC A;  2LUL A;  2MFQ A;  2YSZ A;  2MKR A;  3A98 B;  2MWN B;  1DYN A;  1NI2 A;  1H10 A;  3PP2 A;  4GZU A;  5KCV A;  2YS3 A;  4A5K A;  4IFS A;  1XKE A;  5HE2 A;  2DHJ A;  2ZPY A;  4ZRK A;  5DHA B;  2Y8G A;  2NZ8 B;  3QWM A;  3P7Z A;  1NTY A;  3AU4 A;  4Y94 A;  5J3Q A;  1Y5O A;  3KRW A;  2DYQ A;  1EVH A;  2J59 M;  5JP4 A;  4PNK A;  1AQC A;  4HAZ B;  1XR0 B;  2W2X D;  3GYO A;  1XOD A;  3TO1 A;  4Z2N A;  1RJ2 A;  1XD4 A;  4D0N B;  1V61 A;  3P6A A;  1WG7 A;  3SV1 A;  2RUK B;  4HAX B;  5C16 A;  3TW1 A;  4KAX B;  2RLO A;  4ZRI A;  2DX5 A;  5L81 A;  2W2W A;  4A6K A;  3SUZ A;  2YF0 A;  4HDO A;  3CIK A;  3QBV B;  2DX1 A;  5C5B B;  1FOE A;  2CAY A;  1DBH A;  4TYZ A;  4CHJ A;  2DHK A;  3VIA A;  4KHO A;  1MK9 B;  2DFK A;  1FHW A;  2RVB B;  3PZD A;  2DA0 A;  3D8E A;  4K2P A;  1KZ7 A;  2GCJ A;  2D4Q A;  4GMV A;  4HAW B;  2KGX B;  1U2B A;  5J3T A;  3ML4 A;  2L2I A;  4KVG B;  4C0A A;  4WVF B;  2LG1 A;  5C5B A;  3TCA A;  2H7E A;  1W1G A;  2UVM A;  3RCP A;  3PEG A;  1U5E A;  2COD A;  3FSS A;  5CLL B;  4GMX B;  3CXB B;  3IVF A;  1QQG A;  3DXD A;  2CY5 A;  1BAK A;  1LW3 A;  1UEF A;  1P6S A;  2XQN M;  2D10 A;  4BBK A;  4HB4 B;  1WI1 A;  2EMT A;  3WA0 A;  1X11 A;  1KZG A;  4KHA A;  1MIX A;  1ISN A;  2DLW A;  5DHF B;  2IYB A;  1GG3 A;  1FAO A;  2I1K A;  4WSF A;  4CHM A;  4NY0 A;  2ELA A;  1U5G A; 
#chains in the Genus database with same CATH topology
 1DRO A;  5FI1 A;  5JLJ B;  1KI1 B;  3U12 A;  2IFS A;  2FJL A;  5JHG A;  1WGU A;  2G35 A;  3M1I B;  2EC1 A;  3NWA A;  2N0Y A;  2J0J A;  3U7D A;  1WJ1 A;  1ZSQ A;  2D9X A;  1TQZ A;  2VKI A;  2K00 A;  1BTN A;  2I5F A;  3NWF A;  1UNP A;  4HB2 B;  3PVL A;  5C6R A;  4EKU A;  1PMS A;  5M4Y B;  3WYF B;  3SYX A;  1EF1 A;  2NMB A;  2RRF A;  5HE3 A;  1GC7 A;  5D27 A;  1BWN A;  2M14 A;  4HAV B;  2P0F A;  4TKN A;  5LOP B;  3DXE A;  1M7R A;  2Y7B A;  5IRS A;  5I2M A;  4A6F B;  3ZVR A;  4GNK B;  2COA A;  3FM8 C;  1FHO A;  3MDB C;  2D9W A;  3PSC A;  1UPR A;  2L1C A;  2UZR A;  2D2Q A;  3MPX A;  2M38 A;  1V5M A;  3ZDT A;  3OHM B;  1WGQ A;  3PVU A;  2Z0P A;  3TFM A;  2HE7 A;  4DX8 A;  4DBB A;  1V5P A;  2NBV A;  3F0W A;  3HW2 B;  5KQ4 A;  1W1D A;  2J0K A;  4GPT B;  4EJN A;  3OAN A;  3PG7 A;  2P0H A;  1BTK A;  3GYP A;  1M7E A;  1TJ6 A;  4WJ7 A;  4DX9 0;  2D9Z A;  2PZ1 A;  1XX0 A;  2QKM A;  4A6F A;  3O96 A;  1UNR A;  1FHX A;  1U5D A;  2N23 A;  3ULB A;  1SHC A;  4B6H A;  4GN1 A;  3AJ4 A;  2D11 A;  1MPH A;  3F5R A;  3UZT A;  1MKE A;  5D3X A;  1NU2 A;  3BIN A;  1U27 A;  3HQC A;  3N7C A;  2D9V A;  5HE0 A;  1N3H A;  4HAT B;  1U5F A;  4MT7 A;  3D8D A;  2FJU B;  4MY6 A;  4QXA B;  2YS1 A;  4DXA B;  2KUQ A;  2EMS A;  2CRF A;  2V76 A;  1ZC4 B;  3TVV A;  2RGN B;  2YT2 A;  2HTH B;  4F7G A;  2COC A;  3A58 A;  2ROV A;  2GUM A;  2YS5 A;  3X23 A;  2GJY A;  1MI1 A;  4KHB B;  2BCJ A;  2Y8F A;  5KQ1 A;  1ZC3 B;  1SGH A;  3SO6 A;  2QKL A;  4HAY B;  2E2X A;  2UZS A;  1DDM A;  3ODO A;  1V88 A;  4F7U P;  1P3R A;  1DDV A;  2I1J A;  1EGX A;  2JP2 A;  1RRP B;  3NSU A;  2LOX A;  4HAU B;  1QC6 A;  2D9Y A;  1ZM0 A;  2VRW B;  1PLS A;  1WVH A;  4QJ4 B;  5EFX A;  1Q67 A;  2ROZ B;  2H7D A;  3ULC A;  2Z0O A;  2K2U A;  2GCL A;  4F7H A;  3D8F A;  5DIF B;  3A8Q A;  4KHB A;  1FGY A;  2KIE A;  2RNR B;  2KIG A;  4ZRJ A;  5LG4 B;  2P0D A;  3AU5 A;  1FB8 A;  4YL8 A;  3KRX A;  1X05 A;  5D3Y A;  2K2J A;  2R09 A;  2Z59 A;  4YON A;  2GS0 A;  3ODX A;  1MIZ B;  4GXB A;  1Z87 A;  2R0D A;  2P8V A;  1OY2 A;  2DKQ A;  3DCX A;  4D6W A;  5JHH A;  2J0M A;  3KY9 A;  1I7A A;  4MK0 A;  5DH9 B;  3FEH A;  1X1G A;  1AWE A;  2CY4 A;  3PVW A;  4HHV A;  3KSY A;  1PFJ A;  3VOQ A;  1H4R A;  3G9W A;  1LB1 A;  2DHI A;  2COF A;  1NTV A;  4K81 A;  1P5T A;  4Z2M B;  2ADZ A;  1X86 A;  1V5U A;  2LOZ A;  1I2H A;  2YT0 A;  3KZ1 A;  4IAP A;  5FI0 A;  2Z0Q A;  5C79 A;  2KCJ A;  2YT1 A;  1UPQ A;  4EMO A;  2AL6 A;  4NSW A;  1E5W A;  2EJ8 A;  4IOY X;  4HDQ A;  5D3W A;  2X18 A;  1J0W A;  5CLQ B;  1TXD A;  1K5D B;  1K5G B;  4XWX A;  4HB0 B;  4CYE A;  3BJI A;  1OMW A;  2Q13 A;  4K2O A;  2YVC A;  2W2X C;  3NWD A;  3T06 A;  1V89 A;  2YRY A;  3LJU X;  3QIJ A;  4HSI A;  1X1F A;  3V5W A;  4K17 A;  1WJM A;  1U29 A;  3A8P A;  3HSA A;  4HB3 B;  1FGZ A;  2DYN A;  1MK7 B;  1ZVR A;  5GOW B;  3SNH A;  2ELB A;  1DDW A;  4PQ0 A;  4A6H A;  1GC6 A;  2I5C A;  2RSG A;  2DN6 A;  4L6E A;  5DI9 B;  1IRS A;  1J19 A;  2OQB A;  1Y19 B;  2OTX A;  1B55 A;  3B77 A;  2Z13 A;  5HE1 A;  2KUP A;  1OQN A;  4L1R A;  4P7I A;  4DIX A;  2DKP A;  1MAI A;  1UNQ A;  5D3V A;  3ODW A;  2LKO A;  3HK0 A;  5I2S A;  2VSZ A;  5LON B;  5J3Y A;  4H8S A;  4QJ5 B;  1EAZ A;  3U8Z A;  2LYD A;  1W1H A;  1XCG A;  2DTC A;  2MDX A;  2AEH A;  3DXC A;  2LUL A;  2MFQ A;  1ZYI A;  2YSZ A;  2MKR A;  3A98 B;  3HIE A;  2MWN B;  1DYN A;  1NI2 A;  1H10 A;  3PP2 A;  4GZU A;  4OT1 A;  5KCV A;  2YS3 A;  4A5K A;  4CSQ A;  4OSN A;  4IFS A;  1XKE A;  5HE2 A;  2DHJ A;  2ZPY A;  4ZRK A;  5DHA B;  2Y8G A;  2NZ8 B;  3QWM A;  4GOU A;  3P7Z A;  2K49 A;  1NTY A;  3AU4 A;  4Y94 A;  5J3Q A;  3FVC A;  1Y5O A;  3KRW A;  2DYQ A;  1EVH A;  2J59 M;  5JP4 A;  4PNK A;  1AQC A;  4HAZ B;  1XR0 B;  2W2X D;  2K8E A;  3GYO A;  3NW8 A;  1XOD A;  3TO1 A;  4Z2N A;  1RJ2 A;  1XD4 A;  1T77 A;  4D0N B;  1V61 A;  3P6A A;  1WG7 A;  3SV1 A;  2RUK B;  4HAX B;  5C16 A;  3TW1 A;  4KAX B;  2RLO A;  4ZRI A;  2DX5 A;  5L81 A;  2W2W A;  4A6K A;  3SUZ A;  2YF0 A;  4HDO A;  3CIK A;  3QBV B;  2DX1 A;  5C5B B;  1FOE A;  2CAY A;  1DBH A;  4TYZ A;  4CHJ A;  2DHK A;  3VIA A;  4KHO A;  1MK9 B;  2DFK A;  1FHW A;  2RVB B;  3PZD A;  2DA0 A;  3D8E A;  4K2P A;  1KZ7 A;  2GCJ A;  2D4Q A;  4GMV A;  4HAW B;  2KGX B;  1U2B A;  2ZKM X;  5J3T A;  3ML4 A;  2L2I A;  4KVG B;  2Z14 A;  4C0A A;  2R2Y A;  4WVF B;  2LG1 A;  5C5B A;  3TCA A;  2H7E A;  1W1G A;  2UVM A;  3RCP A;  3PEG A;  1U5E A;  2COD A;  3FSS A;  5CLL B;  4GMX B;  3CXB B;  4QJ3 B;  2Z4D A;  1QQG A;  3DXD A;  2CY5 A;  3IVF A;  1BAK A;  1LW3 A;  1UEF A;  1P6S A;  2KR0 A;  2XQN M;  2D10 A;  4BBK A;  4HB4 B;  1WI1 A;  2EMT A;  3WA0 A;  1X11 A;  1KZG A;  4KHA A;  1MIX A;  1ISN A;  2DLW A;  5DHF B;  2IYB A;  1GG3 A;  1FAO A;  2I1K A;  4WSF A;  4CHM A;  4NY0 A;  2ELA A;  1U5G A; 
#chains in the Genus database with same CATH homology
 1DRO A;  5FI1 A;  5JLJ B;  1KI1 B;  2IFS A;  2FJL A;  5JHG A;  1WGU A;  2G35 A;  3M1I B;  2EC1 A;  2N0Y A;  2J0J A;  3U7D A;  1WJ1 A;  1ZSQ A;  2D9X A;  1TQZ A;  2VKI A;  2K00 A;  1BTN A;  2I5F A;  1UNP A;  4HB2 B;  3PVL A;  5C6R A;  4EKU A;  1PMS A;  3WYF B;  3SYX A;  1EF1 A;  2NMB A;  5HE3 A;  1GC7 A;  5D27 A;  1BWN A;  2M14 A;  4HAV B;  2P0F A;  4TKN A;  5LOP B;  3DXE A;  1M7R A;  2Y7B A;  4A6F B;  3ZVR A;  2COA A;  3FM8 C;  1FHO A;  3MDB C;  2D9W A;  3PSC A;  1UPR A;  2L1C A;  2UZR A;  2D2Q A;  3MPX A;  2M38 A;  1V5M A;  3ZDT A;  1WGQ A;  3PVU A;  2Z0P A;  3TFM A;  2HE7 A;  4DX8 A;  4DBB A;  1V5P A;  3F0W A;  3HW2 B;  5KQ4 A;  1W1D A;  2J0K A;  4GPT B;  4EJN A;  3OAN A;  3PG7 A;  2P0H A;  1BTK A;  3GYP A;  1M7E A;  1TJ6 A;  4WJ7 A;  4DX9 0;  2D9Z A;  2PZ1 A;  1XX0 A;  2QKM A;  4A6F A;  3O96 A;  1UNR A;  1FHX A;  1U5D A;  2N23 A;  3ULB A;  1SHC A;  4B6H A;  4GN1 A;  3AJ4 A;  2D11 A;  1MPH A;  3F5R A;  3UZT A;  1MKE A;  5D3X A;  1NU2 A;  3BIN A;  1U27 A;  3HQC A;  3N7C A;  2D9V A;  5HE0 A;  1N3H A;  4HAT B;  1U5F A;  4MT7 A;  3D8D A;  4MY6 A;  2YS1 A;  4DXA B;  2EMS A;  2CRF A;  2V76 A;  1ZC4 B;  3TVV A;  2RGN B;  2HTH B;  4F7G A;  2COC A;  2ROV A;  3X23 A;  2YS5 A;  2GJY A;  4KHB B;  2BCJ A;  2Y8F A;  5KQ1 A;  1ZC3 B;  1SGH A;  3SO6 A;  2QKL A;  4HAY B;  2E2X A;  2UZS A;  1DDM A;  3ODO A;  1V88 A;  4F7U P;  1P3R A;  1DDV A;  2I1J A;  1EGX A;  2JP2 A;  1RRP B;  3NSU A;  2LOX A;  4HAU B;  1QC6 A;  2D9Y A;  1ZM0 A;  2VRW B;  1PLS A;  1WVH A;  5EFX A;  1Q67 A;  2ROZ B;  2H7D A;  3ULC A;  2Z0O A;  2K2U A;  2GCL A;  4F7H A;  3D8F A;  5DIF B;  3A8Q A;  1FGY A;  2RNR B;  4ZRJ A;  2P0D A;  3AU5 A;  1FB8 A;  4YL8 A;  3KRX A;  1X05 A;  5D3Y A;  2K2J A;  2R09 A;  4YON A;  2GS0 A;  3ODX A;  1MIZ B;  4GXB A;  1Z87 A;  2R0D A;  2P8V A;  1OY2 A;  2DKQ A;  5JHH A;  2J0M A;  3KY9 A;  1I7A A;  4MK0 A;  5DH9 B;  3FEH A;  1X1G A;  1AWE A;  2CY4 A;  3PVW A;  4HHV A;  3KSY A;  1PFJ A;  3VOQ A;  1H4R A;  3G9W A;  1LB1 A;  2DHI A;  2COF A;  1NTV A;  4K81 A;  1P5T A;  4Z2M B;  2ADZ A;  1X86 A;  1V5U A;  2LOZ A;  1I2H A;  2YT0 A;  3KZ1 A;  4IAP A;  5FI0 A;  2Z0Q A;  5C79 A;  2KCJ A;  2YT1 A;  1UPQ A;  4EMO A;  2AL6 A;  4NSW A;  1E5W A;  2EJ8 A;  4IOY X;  4HDQ A;  5D3W A;  2X18 A;  1J0W A;  5CLQ B;  1TXD A;  1K5D B;  1K5G B;  4XWX A;  4HB0 B;  4CYE A;  3BJI A;  1OMW A;  2Q13 A;  4K2O A;  2YVC A;  2W2X C;  3T06 A;  1V89 A;  2YRY A;  3LJU X;  3QIJ A;  1X1F A;  3V5W A;  4K17 A;  1WJM A;  1U29 A;  3A8P A;  4HB3 B;  1FGZ A;  2DYN A;  1MK7 B;  1ZVR A;  5GOW B;  3SNH A;  2ELB A;  1DDW A;  4PQ0 A;  4A6H A;  1GC6 A;  2I5C A;  2RSG A;  2DN6 A;  4L6E A;  5DI9 B;  1IRS A;  1J19 A;  2OQB A;  1Y19 B;  2OTX A;  1B55 A;  5HE1 A;  2KUP A;  1OQN A;  4P7I A;  2DKP A;  1MAI A;  1UNQ A;  5D3V A;  3ODW A;  2LKO A;  3HK0 A;  2VSZ A;  5LON B;  5J3Y A;  4H8S A;  1EAZ A;  3U8Z A;  2LYD A;  1W1H A;  1XCG A;  2DTC A;  2MDX A;  2AEH A;  3DXC A;  2LUL A;  2MFQ A;  2YSZ A;  2MKR A;  3A98 B;  2MWN B;  1DYN A;  1NI2 A;  1H10 A;  3PP2 A;  4GZU A;  5KCV A;  2YS3 A;  4A5K A;  4IFS A;  1XKE A;  5HE2 A;  2DHJ A;  2ZPY A;  4ZRK A;  5DHA B;  2Y8G A;  2NZ8 B;  3QWM A;  3P7Z A;  1NTY A;  3AU4 A;  4Y94 A;  5J3Q A;  1Y5O A;  3KRW A;  2DYQ A;  1EVH A;  2J59 M;  5JP4 A;  4PNK A;  1AQC A;  4HAZ B;  1XR0 B;  2W2X D;  3GYO A;  1XOD A;  3TO1 A;  4Z2N A;  1RJ2 A;  1XD4 A;  4D0N B;  1V61 A;  3P6A A;  1WG7 A;  3SV1 A;  2RUK B;  4HAX B;  5C16 A;  3TW1 A;  4KAX B;  2RLO A;  4ZRI A;  2DX5 A;  5L81 A;  2W2W A;  4A6K A;  3SUZ A;  2YF0 A;  4HDO A;  3CIK A;  3QBV B;  2DX1 A;  5C5B B;  1FOE A;  2CAY A;  1DBH A;  4TYZ A;  4CHJ A;  2DHK A;  3VIA A;  4KHO A;  1MK9 B;  2DFK A;  1FHW A;  2RVB B;  3PZD A;  2DA0 A;  3D8E A;  4K2P A;  1KZ7 A;  2GCJ A;  2D4Q A;  4GMV A;  4HAW B;  2KGX B;  1U2B A;  5J3T A;  3ML4 A;  2L2I A;  4KVG B;  4C0A A;  4WVF B;  2LG1 A;  5C5B A;  3TCA A;  2H7E A;  1W1G A;  2UVM A;  3RCP A;  3PEG A;  1U5E A;  2COD A;  3FSS A;  5CLL B;  4GMX B;  3CXB B;  3IVF A;  1QQG A;  3DXD A;  2CY5 A;  1BAK A;  1LW3 A;  1UEF A;  1P6S A;  2XQN M;  2D10 A;  4BBK A;  4HB4 B;  1WI1 A;  2EMT A;  3WA0 A;  1X11 A;  1KZG A;  4KHA A;  1MIX A;  1ISN A;  2DLW A;  5DHF B;  2IYB A;  1GG3 A;  1FAO A;  2I1K A;  4WSF A;  4CHM A;  4NY0 A;  2ELA A;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...