1M7EA

Crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Disabled homolog 2
total genus 50
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1m7eA00
1PMSA 5C5BB 3PVUA 3IVFA 1EF1A 4HAWB 2KCJA 5C6RA 3RCPA 4A6KA 2I1KA 2DHKA 1MIZB 3LJUX 3P6AA 1BTNA 2DHJA 4WJ7A 2W2WA 1FAOA 4HB4B 2M14A 3WA0A 5EFXA 1W1DA 1FGZA 3V5WA 1U5DA 1WGQA 4KHBB 1U5GA 1X11A 1KZ7A 3ODWA 3U7DA 3PSCA 5DI9B 3FEHA 3PVWA 3QWMA 1WJ1A 5KQ4A 1BWNA 2CY5A 3ULCA 1FB8A 2GCJA 2Z0QA 5HE1A 2K00A 1GG3A 2HE7A 2YSZA 3A98B 3VOQA 2MKRA 1LB1A 2J0KA 2X18A 1FOEA 1IRSA 1QC6A 2W2XD 2ELBA 4EKUA 2R0DA 5DHFB 1NTYA 5DHAB 3D8EA 2ROZB 2GJYA 2YS3A 3KRXA 2UVMA 1W1GA 2COCA 1V5UA 1DBHA 1MAIA 3SV1A 3SYXA 4BBKA 2V76A 4XWXA 1U2BA 3KSYA 1K5DB 2RLOA 1P5TA 1W1HA 1XD4A 1AWEA 5LONB 2YF0A 5FI1A 1NTVA 2P0HA 4HAXB 3CXBB 4KHOA 1AQCA 2Y8FA 1Y5OA 1XCGA 2AEHA 2Z0PA 2VSZA 1RJ2A 3PP2A 1EVHA 2DA0A 1V5PA 5HE2A 2CRFA 1QQGA 1M7EA 4HB3B 4IAPA 2YS5A 1J0WA 1OY2A 3MPXA 2MFQA 3AU4A 3BJIA 4EJNA 4TKNA 2OQBA 2QKMA 2LOZA 2NZ8B 3SO6A 4MK0A 1UNRA 4Z2NA 1XR0B 1X1GA 4ZRJA 2CAYA 2D9VA 2JP2A 2L1CA 3N7CA 2M38A 3HQCA 2DKPA 4GPTB 2VRWB 4DX90 5JP4A 1V88A 1M7RA 4PQ0A 1LW3A 3ZDTA 2CY4A 2GS0A 2VKIA 2KGXB 1H4RA 3ODXA 1I2HA 2R09A 4HATB 1U27A 1UPRA 5DIFB 5J3YA 3BINA 2K2JA 4IFSA 4MY6A 2IYBA 1Z87A 3TW1A 4NY0A 5JLJB 1OMWA 1ZM0A 3F5RA 3ODOA 4HDOA 2D2QA 2N0YA 4DX8A 4HB0B 4B6HA 1UNPA 2I5FA 3HK0A 1U29A 4KVGB 2HTHB 1E5WA 1ZVRA 2K2UA 3ULBA 4H8SA 1UPQA 5KQ1A 3OANA 2Y7BA 2P8VA 1GC6A 2AL6A 1SHCA 3PG7A 1TXDA 1DDWA 4D0NB 3TO1A 1WG7A 4PNKA 1BAKA 3F0WA 1XODA 5CLQB 1FHOA 3D8FA 1I7AA 4HB2B 4WVFB 4YONA 2LKOA 2PZ1A 4HHVA 2UZRA 1MK7B 1EAZA 4K2OA 5D27A 1DDMA 2Z0OA 4GMVA 1U5EA 1B55A 2J59M 2D11A 3A8PA 2IFSA 1BTKA 2LULA 3ML4A 1DROA 4HAVB 1PFJA 2GCLA 3MDBC 4HAYB 2D10A 4P7IA 5JHGA 3G9WA 2CODA 2LG1A 5JHHA 1WI1A 4C0AA 2DTCA 1ZC3B 4Y94A 2J0JA 2FJLA 2MDXA 2YT1A 1KI1B 4DXAB 1WJMA 1KZGA 1TQZA 5D3WA 3VIAA 3O96A 3TVVA 4A6HA 1MKEA 5FI0A 5C79A 1V5MA 1EGXA 3QBVB 2P0FA 2W2XC 2RSGA 1P3RA 5HE0A 3WYFB 4YL8A 1ISNA 1NU2A 3GYPA 5J3TA 2LOXA 5D3XA 1V89A 1WGUA 3SUZA 4CHJA 3ZVRA 3FSSA 1RRPB 2UZSA 3D8DA 5D3VA 4NSWA 2QKLA 1XKEA 3DXCA 3QIJA 4K17A 2DHIA 3KY9A 2EC1A 2DLWA 2ADZA 5DH9B 1MK9B 4F7HA 3X23A 2DFKA 2D4QA 3U8ZA 1PLSA 3SNHA 2LYDA 4L6EA 5J3QA 1UEFA 4HAUB 5KCVA 1N3HA 2DN6A 2BCJA 3FM8C 4K2PA 2YRYA 2E2XA 5CLLB 2Q13A 1ZSQA 3DXDA 1DDVA 2I5CA 2ZPYA 4F7GA 2J0MA 2XQNM 1TJ6A 2MWNB 2G35A 1UNQA 1WVHA 1DYNA 3A8QA 4HAZB 2Y8GA 3P7ZA 4GMXB 3T06A 4GN1A 1P6SA 2YS1A 2DX5A 1FHXA 2COFA 3PVLA 1K5GB 2RVBB 2DYQA 4EMOA 5LOPB 1OQNA 4Z2MB 3GYOA 3KZ1A 4ZRIA 1Y19B 2YT0A 2D9YA 2DKQA 4A6FB 1Q67A 4K81A 1GC7A 1FGYA 4MT7A 1FHWA 3AU5A 3PEGA 3TFMA 3HW2B 5GOWB 1X05A 1J19A 1X1FA 2H7EA 1H10A 3NSUA 5C16A 2I1JA 2RUKB 5C5BA 3DXEA 4CYEA 2EMSA 4DBBA 5HE3A 1V61A 4KAXB 1SGHA 4IOYX 2D9XA 4F7UP 2EJ8A 1XX0A 2P0DA 4ZRKA 5L81A 4GXBA 1MPHA 1U5FA 2N23A 2RGNB 4WSFA 1ZC4B 2D9ZA 2OTXA 4TYZA 2ELAA 3CIKA 2KUPA 2ROVA 4A6FA 2D9WA 5D3YA 3M1IB 1MIXA 2EMTA 3TCAA 3KRWA 4GZUA 4CHMA 4KHAA 2H7DA 2YVCA 4A5KA 1NI2A 2L2IA 2RNRB 2DYNA 4HDQA 3UZTA 2DX1A 1X86A 3AJ4A 2NMBA 3PZDA 2COAA
chains in the Genus database with same CATH superfamily
1PMSA 2FJUB 5C5BB 3PVUA 3IVFA 4CSQA 1EF1A 4HAWB 2KCJA 5C6RA 3RCPA 2YT2A 4A6KA 2I1KA 2DHKA 1MIZB 3LJUX 5I2SA 3P6AA 1BTNA 2DHJA 4WJ7A 2W2WA 1FAOA 4HB4B 2M14A 3WA0A 5EFXA 1W1DA 1FGZA 3V5WA 1U5DA 1WGQA 4KHBB 1U5GA 1X11A 1KZ7A 3ODWA 3U7DA 3PSCA 5DI9B 3FEHA 3PVWA 3QWMA 1WJ1A 5KQ4A 1BWNA 2CY5A 3ULCA 1FB8A 2GCJA 5M4YB 2Z0QA 4GOUA 5HE1A 2K00A 1GG3A 2HE7A 2YSZA 3A98B 3VOQA 2MKRA 1LB1A 2J0KA 2X18A 1FOEA 1IRSA 1QC6A 2W2XD 2ELBA 4EKUA 2R0DA 5DHFB 1NTYA 5DHAB 3D8EA 2ROZB 2GJYA 2YS3A 3KRXA 2UVMA 1W1GA 2COCA 1DBHA 1MAIA 1V5UA 3SV1A 3SYXA 4BBKA 2V76A 4XWXA 1U2BA 3KSYA 1K5DB 2RLOA 1P5TA 1W1HA 1XD4A 1AWEA 5LONB 2YF0A 5FI1A 1NTVA 2P0HA 4HAXB 3CXBB 4KHOA 1AQCA 2Y8FA 1Y5OA 1XCGA 2AEHA 2Z0PA 2VSZA 1RJ2A 3PP2A 1EVHA 2DA0A 1V5PA 5HE2A 2CRFA 1QQGA 1M7EA 4HB3B 4IAPA 2YS5A 1J0WA 1OY2A 3MPXA 2MFQA 3AU4A 2Z13A 3BJIA 4EJNA 3NW8A 4TKNA 2OQBA 2QKMA 2LOZA 2NZ8B 3SO6A 4QJ5B 4MK0A 1UNRA 4Z2NA 1XR0B 1X1GA 4ZRJA 2CAYA 2D9VA 2JP2A 2L1CA 3N7CA 2M38A 3HQCA 2DKPA 2VRWB 4GPTB 4DX90 5JP4A 1V88A 1M7RA 3A58A 2KR0A 4PQ0A 1LW3A 3ZDTA 2CY4A 2GS0A 2VKIA 1T77A 2KGXB 1H4RA 3ODXA 1I2HA 2R09A 4HATB 1U27A 1UPRA 4QJ3B 5DIFB 5J3YA 3BINA 2K2JA 4IFSA 4MY6A 2IYBA 4D6WA 1Z87A 4QXAB 1ZYIA 3TW1A 2Z59A 4NY0A 5JLJB 5LG4B 1OMWA 1ZM0A 3F5RA 3ODOA 2RRFA 4HDOA 2D2QA 2N0YA 4DX8A 4HB0B 4B6HA 1UNPA 2I5FA 3HK0A 1U29A 2GUMA 4KVGB 2HTHB 1E5WA 1ZVRA 2K2UA 3ULBA 2K49A 2ZKMX 4H8SA 1UPQA 5KQ1A 3OANA 2Y7BA 2P8VA 1GC6A 4L1RA 2AL6A 1SHCA 3PG7A 1TXDA 1DDWA 4D0NB 3TO1A 1WG7A 4PNKA 1BAKA 3F0WA 1XODA 5CLQB 3NWDA 1FHOA 3D8FA 1I7AA 4HB2B 4WVFB 4YONA 2LKOA 2PZ1A 4HHVA 3U12A 2UZRA 1MK7B 3B77A 1EAZA 4K2OA 5D27A 1DDMA 2Z0OA 4GMVA 1U5EA 1B55A 2J59M 2D11A 3A8PA 2IFSA 2NBVA 1BTKA 2LULA 3ML4A 1DROA 4HAVB 1PFJA 2GCLA 3MDBC 4HAYB 2D10A 4P7IA 5JHGA 3G9WA 3OHMB 2CODA 2LG1A 5JHHA 1WI1A 4C0AA 2DTCA 3HIEA 1ZC3B 4Y94A 2J0JA 4DIXA 2Z14A 2FJLA 2MDXA 2YT1A 1KI1B 4DXAB 2Z4DA 1WJMA 1KZGA 1TQZA 5D3WA 3VIAA 3O96A 3TVVA 4A6HA 4KHBA 1MKEA 5FI0A 5C79A 1V5MA 1EGXA 3QBVB 2P0FA 2W2XC 2RSGA 1P3RA 5HE0A 3WYFB 4YL8A 1ISNA 1NU2A 3GYPA 5J3TA 2LOXA 5D3XA 1V89A 1WGUA 3SUZA 4CHJA 3ZVRA 3FSSA 1RRPB 2UZSA 3D8DA 5D3VA 4NSWA 2QKLA 1XKEA 3DXCA 3QIJA 4K17A 2DHIA 3KY9A 2EC1A 2DLWA 2ADZA 5DH9B 1MK9B 4F7HA 3X23A 2DFKA 2D4QA 3U8ZA 3NWAA 3HSAA 1PLSA 3SNHA 2LYDA 4L6EA 5J3QA 1UEFA 4HAUB 5KCVA 1N3HA 2DN6A 2BCJA 3FM8C 4K2PA 2YRYA 2E2XA 4OSNA 5CLLB 2Q13A 4QJ4B 1ZSQA 3DXDA 1DDVA 2I5CA 2ZPYA 4F7GA 2J0MA 4OT1A 2XQNM 1TJ6A 2MWNB 2G35A 1UNQA 2KUQA 1WVHA 1DYNA 3A8QA 4HAZB 2Y8GA 3P7ZA 4GMXB 3T06A 4GN1A 1P6SA 2YS1A 2DX5A 1FHXA 2COFA 3PVLA 1K5GB 2RVBB 2DYQA 4EMOA 5LOPB 1OQNA 2KIGA 4Z2MB 3GYOA 4GNKB 3KZ1A 4ZRIA 1Y19B 2YT0A 2D9YA 2DKQA 4A6FB 1Q67A 4K81A 1GC7A 1FGYA 4MT7A 1FHWA 3AU5A 3PEGA 3TFMA 3HW2B 5GOWB 1MI1A 1X05A 1J19A 1X1FA 2H7EA 1H10A 3NSUA 5C16A 2I1JA 2RUKB 5C5BA 2R2YA 3DXEA 3FVCA 4CYEA 3NWFA 2EMSA 4DBBA 5HE3A 1V61A 4KAXB 4HSIA 1SGHA 4IOYX 2D9XA 4F7UP 2K8EA 2EJ8A 1XX0A 2P0DA 4ZRKA 5L81A 4GXBA 1MPHA 1U5FA 2N23A 2RGNB 4WSFA 1ZC4B 2D9ZA 2OTXA 4TYZA 2ELAA 2KIEA 3CIKA 2KUPA 2ROVA 4A6FA 2D9WA 5D3YA 3M1IB 1MIXA 2EMTA 3TCAA 3KRWA 4GZUA 4CHMA 5I2MA 4KHAA 2H7DA 2YVCA 4A5KA 1NI2A 2L2IA 2RNRB 2DYNA 5IRSA 4HDQA 3UZTA 2DX1A 1X86A 3AJ4A 2NMBA 3PZDA 3DCXA 2COAA
chains in the Genus database with same CATH topology
1PMSA 5C5BB 3PVUA 3IVFA 1EF1A 4HAWB 2KCJA 5C6RA 3RCPA 4A6KA 2I1KA 2DHKA 1MIZB 3LJUX 3P6AA 1BTNA 2DHJA 4WJ7A 2W2WA 1FAOA 4HB4B 2M14A 3WA0A 5EFXA 1W1DA 1FGZA 3V5WA 1U5DA 1WGQA 4KHBB 1U5GA 1X11A 1KZ7A 3ODWA 3U7DA 3PSCA 5DI9B 3FEHA 3PVWA 3QWMA 1WJ1A 5KQ4A 1BWNA 2CY5A 3ULCA 1FB8A 2GCJA 2Z0QA 5HE1A 2K00A 1GG3A 2HE7A 2YSZA 3A98B 3VOQA 2MKRA 1LB1A 2J0KA 2X18A 1FOEA 1IRSA 1QC6A 2W2XD 2ELBA 4EKUA 2R0DA 5DHFB 1NTYA 5DHAB 3D8EA 2ROZB 2GJYA 2YS3A 3KRXA 2UVMA 1W1GA 2COCA 1V5UA 1DBHA 1MAIA 3SV1A 3SYXA 4BBKA 2V76A 4XWXA 1U2BA 3KSYA 1K5DB 2RLOA 1P5TA 1W1HA 1XD4A 1AWEA 5LONB 2YF0A 5FI1A 1NTVA 2P0HA 4HAXB 3CXBB 4KHOA 1AQCA 2Y8FA 1Y5OA 1XCGA 2AEHA 2Z0PA 2VSZA 1RJ2A 3PP2A 1EVHA 2DA0A 1V5PA 5HE2A 2CRFA 1QQGA 1M7EA 4HB3B 4IAPA 2YS5A 1J0WA 1OY2A 3MPXA 2MFQA 3AU4A 3BJIA 4EJNA 4TKNA 2OQBA 2QKMA 2LOZA 2NZ8B 3SO6A 4MK0A 1UNRA 4Z2NA 1XR0B 1X1GA 4ZRJA 2CAYA 2D9VA 2JP2A 2L1CA 3N7CA 2M38A 3HQCA 2DKPA 4GPTB 2VRWB 4DX90 5JP4A 1V88A 1M7RA 4PQ0A 1LW3A 3ZDTA 2CY4A 2GS0A 2VKIA 2KGXB 1H4RA 3ODXA 1I2HA 2R09A 4HATB 1U27A 1UPRA 5DIFB 5J3YA 3BINA 2K2JA 4IFSA 4MY6A 2IYBA 1Z87A 3TW1A 4NY0A 5JLJB 1OMWA 1ZM0A 3F5RA 3ODOA 4HDOA 2D2QA 2N0YA 4DX8A 4HB0B 4B6HA 1UNPA 2I5FA 3HK0A 1U29A 4KVGB 2HTHB 1E5WA 1ZVRA 2K2UA 3ULBA 4H8SA 1UPQA 5KQ1A 3OANA 2Y7BA 2P8VA 1GC6A 2AL6A 1SHCA 3PG7A 1TXDA 1DDWA 4D0NB 3TO1A 1WG7A 4PNKA 1BAKA 3F0WA 1XODA 5CLQB 1FHOA 3D8FA 1I7AA 4HB2B 4WVFB 4YONA 2LKOA 2PZ1A 4HHVA 2UZRA 1MK7B 1EAZA 4K2OA 5D27A 1DDMA 2Z0OA 4GMVA 1U5EA 1B55A 2J59M 2D11A 3A8PA 2IFSA 1BTKA 2LULA 3ML4A 1DROA 4HAVB 1PFJA 2GCLA 3MDBC 4HAYB 2D10A 4P7IA 5JHGA 3G9WA 2CODA 2LG1A 5JHHA 1WI1A 4C0AA 2DTCA 1ZC3B 4Y94A 2J0JA 2FJLA 2MDXA 2YT1A 1KI1B 4DXAB 1WJMA 1KZGA 1TQZA 5D3WA 3VIAA 3O96A 3TVVA 4A6HA 1MKEA 5FI0A 5C79A 1V5MA 1EGXA 3QBVB 2P0FA 2W2XC 2RSGA 1P3RA 5HE0A 3WYFB 4YL8A 1ISNA 1NU2A 3GYPA 5J3TA 2LOXA 5D3XA 1V89A 1WGUA 3SUZA 4CHJA 3ZVRA 3FSSA 1RRPB 2UZSA 3D8DA 5D3VA 4NSWA 2QKLA 1XKEA 3DXCA 3QIJA 4K17A 2DHIA 3KY9A 2EC1A 2DLWA 2ADZA 5DH9B 1MK9B 4F7HA 3X23A 2DFKA 2D4QA 3U8ZA 1PLSA 3SNHA 2LYDA 4L6EA 5J3QA 1UEFA 4HAUB 5KCVA 1N3HA 2DN6A 2BCJA 3FM8C 4K2PA 2YRYA 2E2XA 5CLLB 2Q13A 1ZSQA 3DXDA 1DDVA 2I5CA 2ZPYA 4F7GA 2J0MA 2XQNM 1TJ6A 2MWNB 2G35A 1UNQA 1WVHA 1DYNA 3A8QA 4HAZB 2Y8GA 3P7ZA 4GMXB 3T06A 4GN1A 1P6SA 2YS1A 2DX5A 1FHXA 2COFA 3PVLA 1K5GB 2RVBB 2DYQA 4EMOA 5LOPB 1OQNA 4Z2MB 3GYOA 3KZ1A 4ZRIA 1Y19B 2YT0A 2D9YA 2DKQA 4A6FB 1Q67A 4K81A 1GC7A 1FGYA 4MT7A 1FHWA 3AU5A 3PEGA 3TFMA 3HW2B 5GOWB 1X05A 1J19A 1X1FA 2H7EA 1H10A 3NSUA 5C16A 2I1JA 2RUKB 5C5BA 3DXEA 4CYEA 2EMSA 4DBBA 5HE3A 1V61A 4KAXB 1SGHA 4IOYX 2D9XA 4F7UP 2EJ8A 1XX0A 2P0DA 4ZRKA 5L81A 4GXBA 1MPHA 1U5FA 2N23A 2RGNB 4WSFA 1ZC4B 2D9ZA 2OTXA 4TYZA 2ELAA 3CIKA 2KUPA 2ROVA 4A6FA 2D9WA 5D3YA 3M1IB 1MIXA 2EMTA 3TCAA 3KRWA 4GZUA 4CHMA 4KHAA 2H7DA 2YVCA 4A5KA 1NI2A 2L2IA 2RNRB 2DYNA 4HDQA 3UZTA 2DX1A 1X86A 3AJ4A 2NMBA 3PZDA 2COAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PMS A;  5C5B B;  3PVU A;  3IVF A;  1EF1 A;  4HAW B;  2KCJ A;  5C6R A;  3RCP A;  4A6K A;  2I1K A;  2DHK A;  1MIZ B;  3LJU X;  3P6A A;  1BTN A;  2DHJ A;  4WJ7 A;  2W2W A;  1FAO A;  4HB4 B;  2M14 A;  3WA0 A;  5EFX A;  1W1D A;  1FGZ A;  3V5W A;  1U5D A;  1WGQ A;  4KHB B;  1U5G A;  1X11 A;  1KZ7 A;  3ODW A;  3U7D A;  3PSC A;  5DI9 B;  3FEH A;  3PVW A;  3QWM A;  1WJ1 A;  5KQ4 A;  1BWN A;  2CY5 A;  3ULC A;  1FB8 A;  2GCJ A;  2Z0Q A;  5HE1 A;  2K00 A;  1GG3 A;  2HE7 A;  2YSZ A;  3A98 B;  3VOQ A;  2MKR A;  1LB1 A;  2J0K A;  2X18 A;  1FOE A;  1IRS A;  1QC6 A;  2W2X D;  2ELB A;  4EKU A;  2R0D A;  5DHF B;  1NTY A;  5DHA B;  3D8E A;  2ROZ B;  2GJY A;  2YS3 A;  3KRX A;  2UVM A;  1W1G A;  2COC A;  1V5U A;  1DBH A;  1MAI A;  3SV1 A;  3SYX A;  4BBK A;  2V76 A;  4XWX A;  1U2B A;  3KSY A;  1K5D B;  2RLO A;  1P5T A;  1W1H A;  1XD4 A;  1AWE A;  5LON B;  2YF0 A;  5FI1 A;  1NTV A;  2P0H A;  4HAX B;  3CXB B;  4KHO A;  1AQC A;  2Y8F A;  1Y5O A;  1XCG A;  2AEH A;  2Z0P A;  2VSZ A;  1RJ2 A;  3PP2 A;  1EVH A;  2DA0 A;  1V5P A;  5HE2 A;  2CRF A;  1QQG A;  1M7E A;  4HB3 B;  4IAP A;  2YS5 A;  1J0W A;  1OY2 A;  3MPX A;  2MFQ A;  3AU4 A;  3BJI A;  4EJN A;  4TKN A;  2OQB A;  2QKM A;  2LOZ A;  2NZ8 B;  3SO6 A;  4MK0 A;  1UNR A;  4Z2N A;  1XR0 B;  1X1G A;  4ZRJ A;  2CAY A;  2D9V A;  2JP2 A;  2L1C A;  3N7C A;  2M38 A;  3HQC A;  2DKP A;  4GPT B;  2VRW B;  4DX9 0;  5JP4 A;  1V88 A;  1M7R A;  4PQ0 A;  1LW3 A;  3ZDT A;  2CY4 A;  2GS0 A;  2VKI A;  2KGX B;  1H4R A;  3ODX A;  1I2H A;  2R09 A;  4HAT B;  1U27 A;  1UPR A;  5DIF B;  5J3Y A;  3BIN A;  2K2J A;  4IFS A;  4MY6 A;  2IYB A;  1Z87 A;  3TW1 A;  4NY0 A;  5JLJ B;  1OMW A;  1ZM0 A;  3F5R A;  3ODO A;  4HDO A;  2D2Q A;  2N0Y A;  4DX8 A;  4HB0 B;  4B6H A;  1UNP A;  2I5F A;  3HK0 A;  1U29 A;  4KVG B;  2HTH B;  1E5W A;  1ZVR A;  2K2U A;  3ULB A;  4H8S A;  1UPQ A;  5KQ1 A;  3OAN A;  2Y7B A;  2P8V A;  1GC6 A;  2AL6 A;  1SHC A;  3PG7 A;  1TXD A;  1DDW A;  4D0N B;  3TO1 A;  1WG7 A;  4PNK A;  1BAK A;  3F0W A;  1XOD A;  5CLQ B;  1FHO A;  3D8F A;  1I7A A;  4HB2 B;  4WVF B;  4YON A;  2LKO A;  2PZ1 A;  4HHV A;  2UZR A;  1MK7 B;  1EAZ A;  4K2O A;  5D27 A;  1DDM A;  2Z0O A;  4GMV A;  1U5E A;  1B55 A;  2J59 M;  2D11 A;  3A8P A;  2IFS A;  1BTK A;  2LUL A;  3ML4 A;  1DRO A;  4HAV B;  1PFJ A;  2GCL A;  3MDB C;  4HAY B;  2D10 A;  4P7I A;  5JHG A;  3G9W A;  2COD A;  2LG1 A;  5JHH A;  1WI1 A;  4C0A A;  2DTC A;  1ZC3 B;  4Y94 A;  2J0J A;  2FJL A;  2MDX A;  2YT1 A;  1KI1 B;  4DXA B;  1WJM A;  1KZG A;  1TQZ A;  5D3W A;  3VIA A;  3O96 A;  3TVV A;  4A6H A;  1MKE A;  5FI0 A;  5C79 A;  1V5M A;  1EGX A;  3QBV B;  2P0F A;  2W2X C;  2RSG A;  1P3R A;  5HE0 A;  3WYF B;  4YL8 A;  1ISN A;  1NU2 A;  3GYP A;  5J3T A;  2LOX A;  5D3X A;  1V89 A;  1WGU A;  3SUZ A;  4CHJ A;  3ZVR A;  3FSS A;  1RRP B;  2UZS A;  3D8D A;  5D3V A;  4NSW A;  2QKL A;  1XKE A;  3DXC A;  3QIJ A;  4K17 A;  2DHI A;  3KY9 A;  2EC1 A;  2DLW A;  2ADZ A;  5DH9 B;  1MK9 B;  4F7H A;  3X23 A;  2DFK A;  2D4Q A;  3U8Z A;  1PLS A;  3SNH A;  2LYD A;  4L6E A;  5J3Q A;  1UEF A;  4HAU B;  5KCV A;  1N3H A;  2DN6 A;  2BCJ A;  3FM8 C;  4K2P A;  2YRY A;  2E2X A;  5CLL B;  2Q13 A;  1ZSQ A;  3DXD A;  1DDV A;  2I5C A;  2ZPY A;  4F7G A;  2J0M A;  2XQN M;  1TJ6 A;  2MWN B;  2G35 A;  1UNQ A;  1WVH A;  1DYN A;  3A8Q A;  4HAZ B;  2Y8G A;  3P7Z A;  4GMX B;  3T06 A;  4GN1 A;  1P6S A;  2YS1 A;  2DX5 A;  1FHX A;  2COF A;  3PVL A;  1K5G B;  2RVB B;  2DYQ A;  4EMO A;  5LOP B;  1OQN A;  4Z2M B;  3GYO A;  3KZ1 A;  4ZRI A;  1Y19 B;  2YT0 A;  2D9Y A;  2DKQ A;  4A6F B;  1Q67 A;  4K81 A;  1GC7 A;  1FGY A;  4MT7 A;  1FHW A;  3AU5 A;  3PEG A;  3TFM A;  3HW2 B;  5GOW B;  1X05 A;  1J19 A;  1X1F A;  2H7E A;  1H10 A;  3NSU A;  5C16 A;  2I1J A;  2RUK B;  5C5B A;  3DXE A;  4CYE A;  2EMS A;  4DBB A;  5HE3 A;  1V61 A;  4KAX B;  1SGH A;  4IOY X;  2D9X A;  4F7U P;  2EJ8 A;  1XX0 A;  2P0D A;  4ZRK A;  5L81 A;  4GXB A;  1MPH A;  1U5F A;  2N23 A;  2RGN B;  4WSF A;  1ZC4 B;  2D9Z A;  2OTX A;  4TYZ A;  2ELA A;  3CIK A;  2KUP A;  2ROV A;  4A6F A;  2D9W A;  5D3Y A;  3M1I B;  1MIX A;  2EMT A;  3TCA A;  3KRW A;  4GZU A;  4CHM A;  4KHA A;  2H7D A;  2YVC A;  4A5K A;  1NI2 A;  2L2I A;  2RNR B;  2DYN A;  4HDQ A;  3UZT A;  2DX1 A;  1X86 A;  3AJ4 A;  2NMB A;  3PZD A;  2COA A; 
#chains in the Genus database with same CATH topology
 1PMS A;  2FJU B;  5C5B B;  3PVU A;  3IVF A;  4CSQ A;  1EF1 A;  4HAW B;  2KCJ A;  5C6R A;  3RCP A;  2YT2 A;  4A6K A;  2I1K A;  2DHK A;  1MIZ B;  3LJU X;  5I2S A;  3P6A A;  1BTN A;  2DHJ A;  4WJ7 A;  2W2W A;  1FAO A;  4HB4 B;  2M14 A;  3WA0 A;  5EFX A;  1W1D A;  1FGZ A;  3V5W A;  1U5D A;  1WGQ A;  4KHB B;  1U5G A;  1X11 A;  1KZ7 A;  3ODW A;  3U7D A;  3PSC A;  5DI9 B;  3FEH A;  3PVW A;  3QWM A;  1WJ1 A;  5KQ4 A;  1BWN A;  2CY5 A;  3ULC A;  1FB8 A;  2GCJ A;  5M4Y B;  2Z0Q A;  4GOU A;  5HE1 A;  2K00 A;  1GG3 A;  2HE7 A;  2YSZ A;  3A98 B;  3VOQ A;  2MKR A;  1LB1 A;  2J0K A;  2X18 A;  1FOE A;  1IRS A;  1QC6 A;  2W2X D;  2ELB A;  4EKU A;  2R0D A;  5DHF B;  1NTY A;  5DHA B;  3D8E A;  2ROZ B;  2GJY A;  2YS3 A;  3KRX A;  2UVM A;  1W1G A;  2COC A;  1DBH A;  1MAI A;  1V5U A;  3SV1 A;  3SYX A;  4BBK A;  2V76 A;  4XWX A;  1U2B A;  3KSY A;  1K5D B;  2RLO A;  1P5T A;  1W1H A;  1XD4 A;  1AWE A;  5LON B;  2YF0 A;  5FI1 A;  1NTV A;  2P0H A;  4HAX B;  3CXB B;  4KHO A;  1AQC A;  2Y8F A;  1Y5O A;  1XCG A;  2AEH A;  2Z0P A;  2VSZ A;  1RJ2 A;  3PP2 A;  1EVH A;  2DA0 A;  1V5P A;  5HE2 A;  2CRF A;  1QQG A;  1M7E A;  4HB3 B;  4IAP A;  2YS5 A;  1J0W A;  1OY2 A;  3MPX A;  2MFQ A;  3AU4 A;  2Z13 A;  3BJI A;  4EJN A;  3NW8 A;  4TKN A;  2OQB A;  2QKM A;  2LOZ A;  2NZ8 B;  3SO6 A;  4QJ5 B;  4MK0 A;  1UNR A;  4Z2N A;  1XR0 B;  1X1G A;  4ZRJ A;  2CAY A;  2D9V A;  2JP2 A;  2L1C A;  3N7C A;  2M38 A;  3HQC A;  2DKP A;  2VRW B;  4GPT B;  4DX9 0;  5JP4 A;  1V88 A;  1M7R A;  3A58 A;  2KR0 A;  4PQ0 A;  1LW3 A;  3ZDT A;  2CY4 A;  2GS0 A;  2VKI A;  1T77 A;  2KGX B;  1H4R A;  3ODX A;  1I2H A;  2R09 A;  4HAT B;  1U27 A;  1UPR A;  4QJ3 B;  5DIF B;  5J3Y A;  3BIN A;  2K2J A;  4IFS A;  4MY6 A;  2IYB A;  4D6W A;  1Z87 A;  4QXA B;  1ZYI A;  3TW1 A;  2Z59 A;  4NY0 A;  5JLJ B;  5LG4 B;  1OMW A;  1ZM0 A;  3F5R A;  3ODO A;  2RRF A;  4HDO A;  2D2Q A;  2N0Y A;  4DX8 A;  4HB0 B;  4B6H A;  1UNP A;  2I5F A;  3HK0 A;  1U29 A;  2GUM A;  4KVG B;  2HTH B;  1E5W A;  1ZVR A;  2K2U A;  3ULB A;  2K49 A;  2ZKM X;  4H8S A;  1UPQ A;  5KQ1 A;  3OAN A;  2Y7B A;  2P8V A;  1GC6 A;  4L1R A;  2AL6 A;  1SHC A;  3PG7 A;  1TXD A;  1DDW A;  4D0N B;  3TO1 A;  1WG7 A;  4PNK A;  1BAK A;  3F0W A;  1XOD A;  5CLQ B;  3NWD A;  1FHO A;  3D8F A;  1I7A A;  4HB2 B;  4WVF B;  4YON A;  2LKO A;  2PZ1 A;  4HHV A;  3U12 A;  2UZR A;  1MK7 B;  3B77 A;  1EAZ A;  4K2O A;  5D27 A;  1DDM A;  2Z0O A;  4GMV A;  1U5E A;  1B55 A;  2J59 M;  2D11 A;  3A8P A;  2IFS A;  2NBV A;  1BTK A;  2LUL A;  3ML4 A;  1DRO A;  4HAV B;  1PFJ A;  2GCL A;  3MDB C;  4HAY B;  2D10 A;  4P7I A;  5JHG A;  3G9W A;  3OHM B;  2COD A;  2LG1 A;  5JHH A;  1WI1 A;  4C0A A;  2DTC A;  3HIE A;  1ZC3 B;  4Y94 A;  2J0J A;  4DIX A;  2Z14 A;  2FJL A;  2MDX A;  2YT1 A;  1KI1 B;  4DXA B;  2Z4D A;  1WJM A;  1KZG A;  1TQZ A;  5D3W A;  3VIA A;  3O96 A;  3TVV A;  4A6H A;  4KHB A;  1MKE A;  5FI0 A;  5C79 A;  1V5M A;  1EGX A;  3QBV B;  2P0F A;  2W2X C;  2RSG A;  1P3R A;  5HE0 A;  3WYF B;  4YL8 A;  1ISN A;  1NU2 A;  3GYP A;  5J3T A;  2LOX A;  5D3X A;  1V89 A;  1WGU A;  3SUZ A;  4CHJ A;  3ZVR A;  3FSS A;  1RRP B;  2UZS A;  3D8D A;  5D3V A;  4NSW A;  2QKL A;  1XKE A;  3DXC A;  3QIJ A;  4K17 A;  2DHI A;  3KY9 A;  2EC1 A;  2DLW A;  2ADZ A;  5DH9 B;  1MK9 B;  4F7H A;  3X23 A;  2DFK A;  2D4Q A;  3U8Z A;  3NWA A;  3HSA A;  1PLS A;  3SNH A;  2LYD A;  4L6E A;  5J3Q A;  1UEF A;  4HAU B;  5KCV A;  1N3H A;  2DN6 A;  2BCJ A;  3FM8 C;  4K2P A;  2YRY A;  2E2X A;  4OSN A;  5CLL B;  2Q13 A;  4QJ4 B;  1ZSQ A;  3DXD A;  1DDV A;  2I5C A;  2ZPY A;  4F7G A;  2J0M A;  4OT1 A;  2XQN M;  1TJ6 A;  2MWN B;  2G35 A;  1UNQ A;  2KUQ A;  1WVH A;  1DYN A;  3A8Q A;  4HAZ B;  2Y8G A;  3P7Z A;  4GMX B;  3T06 A;  4GN1 A;  1P6S A;  2YS1 A;  2DX5 A;  1FHX A;  2COF A;  3PVL A;  1K5G B;  2RVB B;  2DYQ A;  4EMO A;  5LOP B;  1OQN A;  2KIG A;  4Z2M B;  3GYO A;  4GNK B;  3KZ1 A;  4ZRI A;  1Y19 B;  2YT0 A;  2D9Y A;  2DKQ A;  4A6F B;  1Q67 A;  4K81 A;  1GC7 A;  1FGY A;  4MT7 A;  1FHW A;  3AU5 A;  3PEG A;  3TFM A;  3HW2 B;  5GOW B;  1MI1 A;  1X05 A;  1J19 A;  1X1F A;  2H7E A;  1H10 A;  3NSU A;  5C16 A;  2I1J A;  2RUK B;  5C5B A;  2R2Y A;  3DXE A;  3FVC A;  4CYE A;  3NWF A;  2EMS A;  4DBB A;  5HE3 A;  1V61 A;  4KAX B;  4HSI A;  1SGH A;  4IOY X;  2D9X A;  4F7U P;  2K8E A;  2EJ8 A;  1XX0 A;  2P0D A;  4ZRK A;  5L81 A;  4GXB A;  1MPH A;  1U5F A;  2N23 A;  2RGN B;  4WSF A;  1ZC4 B;  2D9Z A;  2OTX A;  4TYZ A;  2ELA A;  2KIE A;  3CIK A;  2KUP A;  2ROV A;  4A6F A;  2D9W A;  5D3Y A;  3M1I B;  1MIX A;  2EMT A;  3TCA A;  3KRW A;  4GZU A;  4CHM A;  5I2M A;  4KHA A;  2H7D A;  2YVC A;  4A5K A;  1NI2 A;  2L2I A;  2RNR B;  2DYN A;  5IRS A;  4HDQ A;  3UZT A;  2DX1 A;  1X86 A;  3AJ4 A;  2NMB A;  3PZD A;  3DCX A;  2COA A; 
#chains in the Genus database with same CATH homology
 1PMS A;  5C5B B;  3PVU A;  3IVF A;  1EF1 A;  4HAW B;  2KCJ A;  5C6R A;  3RCP A;  4A6K A;  2I1K A;  2DHK A;  1MIZ B;  3LJU X;  3P6A A;  1BTN A;  2DHJ A;  4WJ7 A;  2W2W A;  1FAO A;  4HB4 B;  2M14 A;  3WA0 A;  5EFX A;  1W1D A;  1FGZ A;  3V5W A;  1U5D A;  1WGQ A;  4KHB B;  1U5G A;  1X11 A;  1KZ7 A;  3ODW A;  3U7D A;  3PSC A;  5DI9 B;  3FEH A;  3PVW A;  3QWM A;  1WJ1 A;  5KQ4 A;  1BWN A;  2CY5 A;  3ULC A;  1FB8 A;  2GCJ A;  2Z0Q A;  5HE1 A;  2K00 A;  1GG3 A;  2HE7 A;  2YSZ A;  3A98 B;  3VOQ A;  2MKR A;  1LB1 A;  2J0K A;  2X18 A;  1FOE A;  1IRS A;  1QC6 A;  2W2X D;  2ELB A;  4EKU A;  2R0D A;  5DHF B;  1NTY A;  5DHA B;  3D8E A;  2ROZ B;  2GJY A;  2YS3 A;  3KRX A;  2UVM A;  1W1G A;  2COC A;  1V5U A;  1DBH A;  1MAI A;  3SV1 A;  3SYX A;  4BBK A;  2V76 A;  4XWX A;  1U2B A;  3KSY A;  1K5D B;  2RLO A;  1P5T A;  1W1H A;  1XD4 A;  1AWE A;  5LON B;  2YF0 A;  5FI1 A;  1NTV A;  2P0H A;  4HAX B;  3CXB B;  4KHO A;  1AQC A;  2Y8F A;  1Y5O A;  1XCG A;  2AEH A;  2Z0P A;  2VSZ A;  1RJ2 A;  3PP2 A;  1EVH A;  2DA0 A;  1V5P A;  5HE2 A;  2CRF A;  1QQG A;  1M7E A;  4HB3 B;  4IAP A;  2YS5 A;  1J0W A;  1OY2 A;  3MPX A;  2MFQ A;  3AU4 A;  3BJI A;  4EJN A;  4TKN A;  2OQB A;  2QKM A;  2LOZ A;  2NZ8 B;  3SO6 A;  4MK0 A;  1UNR A;  4Z2N A;  1XR0 B;  1X1G A;  4ZRJ A;  2CAY A;  2D9V A;  2JP2 A;  2L1C A;  3N7C A;  2M38 A;  3HQC A;  2DKP A;  4GPT B;  2VRW B;  4DX9 0;  5JP4 A;  1V88 A;  1M7R A;  4PQ0 A;  1LW3 A;  3ZDT A;  2CY4 A;  2GS0 A;  2VKI A;  2KGX B;  1H4R A;  3ODX A;  1I2H A;  2R09 A;  4HAT B;  1U27 A;  1UPR A;  5DIF B;  5J3Y A;  3BIN A;  2K2J A;  4IFS A;  4MY6 A;  2IYB A;  1Z87 A;  3TW1 A;  4NY0 A;  5JLJ B;  1OMW A;  1ZM0 A;  3F5R A;  3ODO A;  4HDO A;  2D2Q A;  2N0Y A;  4DX8 A;  4HB0 B;  4B6H A;  1UNP A;  2I5F A;  3HK0 A;  1U29 A;  4KVG B;  2HTH B;  1E5W A;  1ZVR A;  2K2U A;  3ULB A;  4H8S A;  1UPQ A;  5KQ1 A;  3OAN A;  2Y7B A;  2P8V A;  1GC6 A;  2AL6 A;  1SHC A;  3PG7 A;  1TXD A;  1DDW A;  4D0N B;  3TO1 A;  1WG7 A;  4PNK A;  1BAK A;  3F0W A;  1XOD A;  5CLQ B;  1FHO A;  3D8F A;  1I7A A;  4HB2 B;  4WVF B;  4YON A;  2LKO A;  2PZ1 A;  4HHV A;  2UZR A;  1MK7 B;  1EAZ A;  4K2O A;  5D27 A;  1DDM A;  2Z0O A;  4GMV A;  1U5E A;  1B55 A;  2J59 M;  2D11 A;  3A8P A;  2IFS A;  1BTK A;  2LUL A;  3ML4 A;  1DRO A;  4HAV B;  1PFJ A;  2GCL A;  3MDB C;  4HAY B;  2D10 A;  4P7I A;  5JHG A;  3G9W A;  2COD A;  2LG1 A;  5JHH A;  1WI1 A;  4C0A A;  2DTC A;  1ZC3 B;  4Y94 A;  2J0J A;  2FJL A;  2MDX A;  2YT1 A;  1KI1 B;  4DXA B;  1WJM A;  1KZG A;  1TQZ A;  5D3W A;  3VIA A;  3O96 A;  3TVV A;  4A6H A;  1MKE A;  5FI0 A;  5C79 A;  1V5M A;  1EGX A;  3QBV B;  2P0F A;  2W2X C;  2RSG A;  1P3R A;  5HE0 A;  3WYF B;  4YL8 A;  1ISN A;  1NU2 A;  3GYP A;  5J3T A;  2LOX A;  5D3X A;  1V89 A;  1WGU A;  3SUZ A;  4CHJ A;  3ZVR A;  3FSS A;  1RRP B;  2UZS A;  3D8D A;  5D3V A;  4NSW A;  2QKL A;  1XKE A;  3DXC A;  3QIJ A;  4K17 A;  2DHI A;  3KY9 A;  2EC1 A;  2DLW A;  2ADZ A;  5DH9 B;  1MK9 B;  4F7H A;  3X23 A;  2DFK A;  2D4Q A;  3U8Z A;  1PLS A;  3SNH A;  2LYD A;  4L6E A;  5J3Q A;  1UEF A;  4HAU B;  5KCV A;  1N3H A;  2DN6 A;  2BCJ A;  3FM8 C;  4K2P A;  2YRY A;  2E2X A;  5CLL B;  2Q13 A;  1ZSQ A;  3DXD A;  1DDV A;  2I5C A;  2ZPY A;  4F7G A;  2J0M A;  2XQN M;  1TJ6 A;  2MWN B;  2G35 A;  1UNQ A;  1WVH A;  1DYN A;  3A8Q A;  4HAZ B;  2Y8G A;  3P7Z A;  4GMX B;  3T06 A;  4GN1 A;  1P6S A;  2YS1 A;  2DX5 A;  1FHX A;  2COF A;  3PVL A;  1K5G B;  2RVB B;  2DYQ A;  4EMO A;  5LOP B;  1OQN A;  4Z2M B;  3GYO A;  3KZ1 A;  4ZRI A;  1Y19 B;  2YT0 A;  2D9Y A;  2DKQ A;  4A6F B;  1Q67 A;  4K81 A;  1GC7 A;  1FGY A;  4MT7 A;  1FHW A;  3AU5 A;  3PEG A;  3TFM A;  3HW2 B;  5GOW B;  1X05 A;  1J19 A;  1X1F A;  2H7E A;  1H10 A;  3NSU A;  5C16 A;  2I1J A;  2RUK B;  5C5B A;  3DXE A;  4CYE A;  2EMS A;  4DBB A;  5HE3 A;  1V61 A;  4KAX B;  1SGH A;  4IOY X;  2D9X A;  4F7U P;  2EJ8 A;  1XX0 A;  2P0D A;  4ZRK A;  5L81 A;  4GXB A;  1MPH A;  1U5F A;  2N23 A;  2RGN B;  4WSF A;  1ZC4 B;  2D9Z A;  2OTX A;  4TYZ A;  2ELA A;  3CIK A;  2KUP A;  2ROV A;  4A6F A;  2D9W A;  5D3Y A;  3M1I B;  1MIX A;  2EMT A;  3TCA A;  3KRW A;  4GZU A;  4CHM A;  4KHA A;  2H7D A;  2YVC A;  4A5K A;  1NI2 A;  2L2I A;  2RNR B;  2DYN A;  4HDQ A;  3UZT A;  2DX1 A;  1X86 A;  3AJ4 A;  2NMB A;  3PZD A;  2COA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...