2K2UA

Nmr structure of the complex between tfb1 subunit of tfiih and the activation domain of vp16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title NMR Structure of the Complex between the Tfb1 Subunit of TFIIH and the Activation Domain of VP16: Structural Similarities between VP16 and p53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k2uA00
1UPQA 1WG7A 2I1JA 5C5BB 5L81A 3P7ZA 1GC6A 3ZVRA 2J0MA 1ZVRA 4Y94A 3T06A 4HAYB 2CRFA 3QIJA 1AQCA 1DROA 2Y8GA 4IFSA 3PG7A 2DTCA 3DXCA 5HE2A 2Z0PA 2YF0A 2COCA 1MPHA 4K2OA 2ROVA 2Z0QA 5D3VA 2K00A 4GN1A 1X1GA 2GCLA 4P7IA 1E5WA 4MK0A 3FEHA 1FHOA 5JHHA 4ZRKA 2DHKA 1M7EA 4NY0A 3AJ4A 4F7UP 2N23A 2YSZA 5J3YA 1OMWA 2AL6A 2UZSA 2ELAA 2W2WA 4CHMA 2AEHA 2H7DA 2YT1A 2W2XC 1BTKA 1WGUA 4L6EA 1XX0A 2D2QA 1M7RA 2EJ8A 5HE1A 1EVHA 1U27A 1H4RA 3ULCA 1FHWA 2EMTA 4ZRJA 4NSWA 3F0WA 4PQ0A 4HHVA 2CAYA 3A8QA 4A6FA 2IFSA 2M38A 2DX1A 1J0WA 2JP2A 2P8VA 2P0FA 1W1DA 1X11A 1EAZA 4KHBB 3DXDA 1Q67A 2DKQA 1KZGA 5D3YA 1DDVA 1H10A 2K2UA 1DBHA 4F7GA 2GJYA 5J3QA 2RGNB 3HK0A 3D8EA 1V89A 2D4QA 2RVBB 5CLLB 4ZRIA 3KRXA 1I7AA 3SV1A 4MY6A 1TJ6A 1K5DB 3UZTA 1ZSQA 2LOZA 2YS5A 3PSCA 5JLJB 2G35A 4BBKA 4D0NB 2D9YA 1W1HA 2D9ZA 2UZRA 1RRPB 2KGXB 1MIXA 5GOWB 1V5MA 3A8PA 5HE3A 5DH9B 4C0AA 1PFJA 3VIAA 1K5GB 3AU5A 4A6FB 4Z2NA 2H7EA 2XQNM 2M14A 1TXDA 4K17A 3KZ1A 4HB3B 1KI1B 1NTYA 4GXBA 3HW2B 1Z87A 4A5KA 2K2JA 4HAUB 4HDOA 3NSUA 2MWNB 3D8FA 4XWXA 2VRWB 2KUPA 4MT7A 2NMBA 4A6HA 1V5PA 2YT0A 2VSZA 1UEFA 1U5DA 2KCJA 1BAKA 1X05A 1QC6A 2N0YA 2YRYA 4B6HA 2DFKA 1MK7B 3WYFB 2CODA 1QQGA 2VKIA 2I5CA 4HATB 3V5WA 3SUZA 2D9XA 1MKEA 4GMVA 4DX8A 3PVWA 2R0DA 4TYZA 2RNRB 3ODXA 1B55A 3FM8C 1U2BA 2BCJA 4H8SA 1XODA 3U8ZA 5JP4A 2MDXA 3TVVA 1V88A 1V5UA 5D3XA 3PVLA 3ULBA 1KZ7A 5C6RA 2CY5A 2D9VA 3BINA 4K2PA 2MKRA 2QKMA 5J3TA 1WJMA 3LJUX 4DX90 4KHOA 1LW3A 1X86A 3KY9A 3TFMA 2FJLA 3BJIA 2DLWA 4TKNA 3TCAA 4CYEA 1Y19B 2I1KA 4EJNA 2YS1A 5LONB 1DDWA 2YS3A 3ZDTA 2DA0A 2X18A 3O96A 5DHAB 1OQNA 5KQ4A 1WI1A 2LG1A 1UNPA 3F5RA 1XR0B 2RUKB 1WGQA 2DHIA 4IOYX 5C79A 3HQCA 3U7DA 1MIZB 4PNKA 4DBBA 1N3HA 2DX5A 1ZC3B 2LKOA 2P0HA 4HAVB 5EFXA 1RJ2A 1NTVA 2Q13A 1OY2A 3TO1A 4EKUA 1SHCA 2ROZB 3ML4A 2HTHB 4A6KA 1P3RA 1Y5OA 2RSGA 5JHGA 3N7CA 2Z0OA 2Y7BA 3FSSA 2J59M 2CY4A 4HAZB 1X1FA 3DXEA 1PMSA 1UNRA 3GYOA 3G9WA 1I2HA 4HB2B 4DXAB 1NU2A 2COAA 1SGHA 1ZC4B 4HAXB 3ODOA 1P5TA 1XCGA 2COFA 3IVFA 1P6SA 1GC7A 2W2XD 1ISNA 1TQZA 1U5FA 4YL8A 1UPRA 1ZM0A 2LYDA 3D8DA 4CHJA 1V61A 4HB4B 2D10A 1DDMA 1FAOA 5DHFB 5LOPB 1GG3A 3SO6A 5KCVA 2PZ1A 2I5FA 4IAPA 2P0DA 1U29A 5C16A 1WJ1A 2V76A 1BTNA 2J0KA 2DN6A 4KAXB 2OQBA 3KSYA 4WSFA 5DI9B 5FI1A 1EGXA 2L2IA 2DHJA 4F7HA 2QKLA 3SNHA 1NI2A 1J19A 3QBVB 4KVGB 3CXBB 1MAIA 3PP2A 1XKEA 1DYNA 3PVUA 5CLQB 1FHXA 1BWNA 4HDQA 3RCPA 4HB0B 3CIKA 2UVMA 3MPXA 2L1CA 3X23A 2MFQA 2YVCA 5D3WA 3QWMA 1FGZA 3MDBC 3PZDA 1W1GA 2E2XA 3A98B 3AU4A 4GPTB 3KRWA 1WVHA 1FGYA 4GMXB 2LOXA 2DYQA 2ELBA 4HAWB 1XD4A 4K81A 2OTXA 2ZPYA 5C5BA 1U5GA 2DKPA 3M1IB 5FI0A 4WJ7A 2GS0A 4WVFB 4EMOA 5HE0A 3P6AA 2EMSA 4YONA 5D27A 2NZ8B 2IYBA 1FOEA 4KHAA 3WA0A 1FB8A 1AWEA 1IRSA 2EC1A 2GCJA 5DIFB 2LULA 1LB1A 2D11A 3PEGA 3OANA 4Z2MB 3TW1A 1MK9B 3ODWA 4GZUA 2ADZA 3VOQA 2J0JA 1UNQA 3GYPA 2Y8FA 2D9WA 5KQ1A 1U5EA 2HE7A 2RLOA 1EF1A 3SYXA 2DYNA 2R09A 1PLSA
chains in the Genus database with same CATH superfamily
2FJUB 1UPQA 1WG7A 2I1JA 5C5BB 5L81A 3P7ZA 1GC6A 3ZVRA 2J0MA 1ZVRA 4Y94A 3T06A 4HAYB 2CRFA 3QIJA 1AQCA 1DROA 2Y8GA 4IFSA 4CSQA 3PG7A 2DTCA 3DXCA 5HE2A 2Z0PA 2YF0A 2COCA 2KIEA 1MPHA 4K2OA 2ROVA 4KHBA 2Z0QA 5D3VA 2K00A 4GN1A 1X1GA 2GCLA 4P7IA 1E5WA 2KIGA 4MK0A 3FEHA 1FHOA 5JHHA 4ZRKA 2DHKA 1M7EA 4NY0A 3AJ4A 4F7UP 2N23A 2YSZA 5J3YA 1OMWA 2AL6A 3HIEA 2UZSA 2ELAA 2W2WA 4CHMA 2GUMA 2AEHA 2H7DA 2YT1A 2W2XC 1MI1A 1BTKA 1WGUA 4L6EA 1XX0A 2D2QA 1M7RA 2EJ8A 5HE1A 1EVHA 1U27A 1H4RA 3ULCA 1FHWA 2EMTA 4ZRJA 4NSWA 3F0WA 4DIXA 4PQ0A 4HHVA 2CAYA 3A8QA 4A6FA 2IFSA 2M38A 2DX1A 3NWDA 1J0WA 2JP2A 2P8VA 2P0FA 1W1DA 1X11A 1EAZA 4KHBB 3DXDA 1Q67A 2DKQA 1KZGA 5D3YA 1DDVA 1H10A 4GOUA 2K2UA 1DBHA 4F7GA 2GJYA 5J3QA 2RGNB 3HK0A 3D8EA 1V89A 2D4QA 2RVBB 5CLLB 4ZRIA 3KRXA 1I7AA 3SV1A 4MY6A 1TJ6A 1K5DB 3OHMB 3UZTA 1ZSQA 2LOZA 2YS5A 3PSCA 5JLJB 2G35A 4BBKA 4D0NB 2D9YA 1W1HA 2D9ZA 2UZRA 1RRPB 2KGXB 1MIXA 5GOWB 1V5MA 3A8PA 5HE3A 5DH9B 4C0AA 1PFJA 3VIAA 1K5GB 4L1RA 3AU5A 4A6FB 4Z2NA 2H7EA 4GNKB 2XQNM 2M14A 1TXDA 4K17A 3KZ1A 4HB3B 1KI1B 1NTYA 4GXBA 3HW2B 1Z87A 4A5KA 2K2JA 4HAUB 4HDOA 3B77A 3NSUA 2MWNB 3D8FA 4XWXA 2VRWB 2KUPA 4MT7A 2NMBA 4A6HA 1V5PA 2YT0A 2VSZA 1UEFA 1U5DA 5I2SA 2KCJA 1BAKA 1X05A 1QC6A 4OSNA 2N0YA 2YRYA 4B6HA 3NW8A 2DFKA 1MK7B 3WYFB 2CODA 4QJ5B 1QQGA 2VKIA 2I5CA 4HATB 3V5WA 3SUZA 2D9XA 1MKEA 4GMVA 4DX8A 1T77A 3PVWA 2R0DA 4TYZA 2RNRB 3ODXA 2NBVA 1B55A 3FM8C 1U2BA 2BCJA 4H8SA 1XODA 3U8ZA 5JP4A 2MDXA 3TVVA 1V88A 1V5UA 5D3XA 3PVLA 3ULBA 1KZ7A 5C6RA 2CY5A 2D9VA 3FVCA 3BINA 4K2PA 2MKRA 2KR0A 2QKMA 5J3TA 1WJMA 3LJUX 4DX90 4KHOA 1LW3A 1X86A 3KY9A 3TFMA 2FJLA 3BJIA 2DLWA 3HSAA 4TKNA 4D6WA 3TCAA 4CYEA 2RRFA 1Y19B 2I1KA 4EJNA 2YS1A 5LONB 1DDWA 2K8EA 2YS3A 3ZDTA 2DA0A 2ZKMX 2X18A 3O96A 5M4YB 5DHAB 1OQNA 5KQ4A 2Z13A 1WI1A 2LG1A 1UNPA 3F5RA 1XR0B 2RUKB 1WGQA 2DHIA 4IOYX 5C79A 3HQCA 3U7DA 1MIZB 4PNKA 4DBBA 1N3HA 2DX5A 1ZC3B 2LKOA 2P0HA 4HAVB 5EFXA 1RJ2A 1NTVA 2Q13A 1OY2A 3TO1A 4EKUA 1SHCA 2ROZB 3ML4A 2HTHB 4A6KA 1P3RA 1Y5OA 2RSGA 5JHGA 3N7CA 2Z0OA 5I2MA 2Y7BA 3FSSA 2J59M 2CY4A 4HAZB 1X1FA 2Z4DA 3NWAA 3DXEA 1PMSA 1UNRA 3GYOA 3G9WA 1I2HA 4HB2B 4DXAB 1NU2A 2COAA 1SGHA 4QXAB 1ZC4B 4HAXB 3ODOA 1P5TA 1XCGA 2COFA 2KUQA 1P6SA 3IVFA 1GC7A 2Z59A 1ISNA 2W2XD 1TQZA 1U5FA 4YL8A 1ZYIA 1UPRA 1ZM0A 2LYDA 3D8DA 4CHJA 1V61A 4HB4B 2D10A 1DDMA 1FAOA 5DHFB 5LOPB 1GG3A 3SO6A 5KCVA 2PZ1A 2I5FA 4IAPA 2P0DA 1U29A 5C16A 1WJ1A 2V76A 1BTNA 2J0KA 2DN6A 4KAXB 2OQBA 3KSYA 3NWFA 4WSFA 5DI9B 5FI1A 1EGXA 2L2IA 2DHJA 4F7HA 2QKLA 3SNHA 1NI2A 2YT2A 1J19A 3QBVB 4KVGB 3CXBB 1MAIA 3PP2A 1XKEA 1DYNA 3PVUA 5CLQB 1FHXA 1BWNA 4HDQA 3RCPA 4HB0B 3CIKA 2UVMA 3MPXA 2L1CA 3X23A 2MFQA 2YVCA 5D3WA 3QWMA 1FGZA 3MDBC 3PZDA 3U12A 1W1GA 2E2XA 3A98B 3AU4A 4GPTB 3KRWA 1WVHA 1FGYA 4GMXB 2LOXA 2DYQA 2ELBA 3A58A 4HAWB 1XD4A 4K81A 4HSIA 2OTXA 2ZPYA 5C5BA 1U5GA 2DKPA 3M1IB 4OT1A 4WJ7A 2GS0A 5FI0A 4QJ4B 4WVFB 4EMOA 5HE0A 3P6AA 2EMSA 2K49A 4YONA 5D27A 2NZ8B 2IYBA 1FOEA 4KHAA 3WA0A 1FB8A 1AWEA 1IRSA 2EC1A 2GCJA 5DIFB 2LULA 1LB1A 2D11A 3PEGA 3OANA 4Z2MB 3TW1A 2Z14A 5IRSA 1MK9B 3ODWA 4GZUA 2ADZA 3VOQA 5LG4B 3DCXA 2J0JA 1UNQA 3GYPA 2Y8FA 2R2YA 2D9WA 5KQ1A 1U5EA 2HE7A 2RLOA 4QJ3B 1EF1A 3SYXA 2DYNA 2R09A 1PLSA
chains in the Genus database with same CATH topology
1UPQA 1WG7A 2I1JA 5C5BB 5L81A 3P7ZA 1GC6A 3ZVRA 2J0MA 1ZVRA 4Y94A 3T06A 4HAYB 2CRFA 3QIJA 1AQCA 1DROA 2Y8GA 4IFSA 3PG7A 2DTCA 3DXCA 5HE2A 2Z0PA 2YF0A 2COCA 1MPHA 4K2OA 2ROVA 2Z0QA 5D3VA 2K00A 4GN1A 1X1GA 2GCLA 4P7IA 1E5WA 4MK0A 3FEHA 1FHOA 5JHHA 4ZRKA 2DHKA 1M7EA 4NY0A 3AJ4A 4F7UP 2N23A 2YSZA 5J3YA 1OMWA 2AL6A 2UZSA 2ELAA 2W2WA 4CHMA 2AEHA 2H7DA 2YT1A 2W2XC 1BTKA 1WGUA 4L6EA 1XX0A 2D2QA 1M7RA 2EJ8A 5HE1A 1EVHA 1U27A 1H4RA 3ULCA 1FHWA 2EMTA 4ZRJA 4NSWA 3F0WA 4PQ0A 4HHVA 2CAYA 3A8QA 4A6FA 2IFSA 2M38A 2DX1A 1J0WA 2JP2A 2P8VA 2P0FA 1W1DA 1X11A 1EAZA 4KHBB 3DXDA 1Q67A 2DKQA 1KZGA 5D3YA 1DDVA 1H10A 2K2UA 1DBHA 4F7GA 2GJYA 5J3QA 2RGNB 3HK0A 3D8EA 1V89A 2D4QA 2RVBB 5CLLB 4ZRIA 3KRXA 1I7AA 3SV1A 4MY6A 1TJ6A 1K5DB 3UZTA 1ZSQA 2LOZA 2YS5A 3PSCA 5JLJB 2G35A 4BBKA 4D0NB 2D9YA 1W1HA 2D9ZA 2UZRA 1RRPB 2KGXB 1MIXA 5GOWB 1V5MA 3A8PA 5HE3A 5DH9B 4C0AA 1PFJA 3VIAA 1K5GB 3AU5A 4A6FB 4Z2NA 2H7EA 2XQNM 2M14A 1TXDA 4K17A 3KZ1A 4HB3B 1KI1B 1NTYA 4GXBA 3HW2B 1Z87A 4A5KA 2K2JA 4HAUB 4HDOA 3NSUA 2MWNB 3D8FA 4XWXA 2VRWB 2KUPA 4MT7A 2NMBA 4A6HA 1V5PA 2YT0A 2VSZA 1UEFA 1U5DA 2KCJA 1BAKA 1X05A 1QC6A 2N0YA 2YRYA 4B6HA 2DFKA 1MK7B 3WYFB 2CODA 1QQGA 2VKIA 2I5CA 4HATB 3V5WA 3SUZA 2D9XA 1MKEA 4GMVA 4DX8A 3PVWA 2R0DA 4TYZA 2RNRB 3ODXA 1B55A 3FM8C 1U2BA 2BCJA 4H8SA 1XODA 3U8ZA 5JP4A 2MDXA 3TVVA 1V88A 1V5UA 5D3XA 3PVLA 3ULBA 1KZ7A 5C6RA 2CY5A 2D9VA 3BINA 4K2PA 2MKRA 2QKMA 5J3TA 1WJMA 3LJUX 4DX90 4KHOA 1LW3A 1X86A 3KY9A 3TFMA 2FJLA 3BJIA 2DLWA 4TKNA 3TCAA 4CYEA 1Y19B 2I1KA 4EJNA 2YS1A 5LONB 1DDWA 2YS3A 3ZDTA 2DA0A 2X18A 3O96A 5DHAB 1OQNA 5KQ4A 1WI1A 2LG1A 1UNPA 3F5RA 1XR0B 2RUKB 1WGQA 2DHIA 4IOYX 5C79A 3HQCA 3U7DA 1MIZB 4PNKA 4DBBA 1N3HA 2DX5A 1ZC3B 2LKOA 2P0HA 4HAVB 5EFXA 1RJ2A 1NTVA 2Q13A 1OY2A 3TO1A 4EKUA 1SHCA 2ROZB 3ML4A 2HTHB 4A6KA 1P3RA 1Y5OA 2RSGA 5JHGA 3N7CA 2Z0OA 2Y7BA 3FSSA 2J59M 2CY4A 4HAZB 1X1FA 3DXEA 1PMSA 1UNRA 3GYOA 3G9WA 1I2HA 4HB2B 4DXAB 1NU2A 2COAA 1SGHA 1ZC4B 4HAXB 3ODOA 1P5TA 1XCGA 2COFA 3IVFA 1P6SA 1GC7A 2W2XD 1ISNA 1TQZA 1U5FA 4YL8A 1UPRA 1ZM0A 2LYDA 3D8DA 4CHJA 1V61A 4HB4B 2D10A 1DDMA 1FAOA 5DHFB 5LOPB 1GG3A 3SO6A 5KCVA 2PZ1A 2I5FA 4IAPA 2P0DA 1U29A 5C16A 1WJ1A 2V76A 1BTNA 2J0KA 2DN6A 4KAXB 2OQBA 3KSYA 4WSFA 5DI9B 5FI1A 1EGXA 2L2IA 2DHJA 4F7HA 2QKLA 3SNHA 1NI2A 1J19A 3QBVB 4KVGB 3CXBB 1MAIA 3PP2A 1XKEA 1DYNA 3PVUA 5CLQB 1FHXA 1BWNA 4HDQA 3RCPA 4HB0B 3CIKA 2UVMA 3MPXA 2L1CA 3X23A 2MFQA 2YVCA 5D3WA 3QWMA 1FGZA 3MDBC 3PZDA 1W1GA 2E2XA 3A98B 3AU4A 4GPTB 3KRWA 1WVHA 1FGYA 4GMXB 2LOXA 2DYQA 2ELBA 4HAWB 1XD4A 4K81A 2OTXA 2ZPYA 5C5BA 1U5GA 2DKPA 3M1IB 5FI0A 4WJ7A 2GS0A 4WVFB 4EMOA 5HE0A 3P6AA 2EMSA 4YONA 5D27A 2NZ8B 2IYBA 1FOEA 4KHAA 3WA0A 1FB8A 1AWEA 1IRSA 2EC1A 2GCJA 5DIFB 2LULA 1LB1A 2D11A 3PEGA 3OANA 4Z2MB 3TW1A 1MK9B 3ODWA 4GZUA 2ADZA 3VOQA 2J0JA 1UNQA 3GYPA 2Y8FA 2D9WA 5KQ1A 1U5EA 2HE7A 2RLOA 1EF1A 3SYXA 2DYNA 2R09A 1PLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPQ A;  1WG7 A;  2I1J A;  5C5B B;  5L81 A;  3P7Z A;  1GC6 A;  3ZVR A;  2J0M A;  1ZVR A;  4Y94 A;  3T06 A;  4HAY B;  2CRF A;  3QIJ A;  1AQC A;  1DRO A;  2Y8G A;  4IFS A;  3PG7 A;  2DTC A;  3DXC A;  5HE2 A;  2Z0P A;  2YF0 A;  2COC A;  1MPH A;  4K2O A;  2ROV A;  2Z0Q A;  5D3V A;  2K00 A;  4GN1 A;  1X1G A;  2GCL A;  4P7I A;  1E5W A;  4MK0 A;  3FEH A;  1FHO A;  5JHH A;  4ZRK A;  2DHK A;  1M7E A;  4NY0 A;  3AJ4 A;  4F7U P;  2N23 A;  2YSZ A;  5J3Y A;  1OMW A;  2AL6 A;  2UZS A;  2ELA A;  2W2W A;  4CHM A;  2AEH A;  2H7D A;  2YT1 A;  2W2X C;  1BTK A;  1WGU A;  4L6E A;  1XX0 A;  2D2Q A;  1M7R A;  2EJ8 A;  5HE1 A;  1EVH A;  1U27 A;  1H4R A;  3ULC A;  1FHW A;  2EMT A;  4ZRJ A;  4NSW A;  3F0W A;  4PQ0 A;  4HHV A;  2CAY A;  3A8Q A;  4A6F A;  2IFS A;  2M38 A;  2DX1 A;  1J0W A;  2JP2 A;  2P8V A;  2P0F A;  1W1D A;  1X11 A;  1EAZ A;  4KHB B;  3DXD A;  1Q67 A;  2DKQ A;  1KZG A;  5D3Y A;  1DDV A;  1H10 A;  2K2U A;  1DBH A;  4F7G A;  2GJY A;  5J3Q A;  2RGN B;  3HK0 A;  3D8E A;  1V89 A;  2D4Q A;  2RVB B;  5CLL B;  4ZRI A;  3KRX A;  1I7A A;  3SV1 A;  4MY6 A;  1TJ6 A;  1K5D B;  3UZT A;  1ZSQ A;  2LOZ A;  2YS5 A;  3PSC A;  5JLJ B;  2G35 A;  4BBK A;  4D0N B;  2D9Y A;  1W1H A;  2D9Z A;  2UZR A;  1RRP B;  2KGX B;  1MIX A;  5GOW B;  1V5M A;  3A8P A;  5HE3 A;  5DH9 B;  4C0A A;  1PFJ A;  3VIA A;  1K5G B;  3AU5 A;  4A6F B;  4Z2N A;  2H7E A;  2XQN M;  2M14 A;  1TXD A;  4K17 A;  3KZ1 A;  4HB3 B;  1KI1 B;  1NTY A;  4GXB A;  3HW2 B;  1Z87 A;  4A5K A;  2K2J A;  4HAU B;  4HDO A;  3NSU A;  2MWN B;  3D8F A;  4XWX A;  2VRW B;  2KUP A;  4MT7 A;  2NMB A;  4A6H A;  1V5P A;  2YT0 A;  2VSZ A;  1UEF A;  1U5D A;  2KCJ A;  1BAK A;  1X05 A;  1QC6 A;  2N0Y A;  2YRY A;  4B6H A;  2DFK A;  1MK7 B;  3WYF B;  2COD A;  1QQG A;  2VKI A;  2I5C A;  4HAT B;  3V5W A;  3SUZ A;  2D9X A;  1MKE A;  4GMV A;  4DX8 A;  3PVW A;  2R0D A;  4TYZ A;  2RNR B;  3ODX A;  1B55 A;  3FM8 C;  1U2B A;  2BCJ A;  4H8S A;  1XOD A;  3U8Z A;  5JP4 A;  2MDX A;  3TVV A;  1V88 A;  1V5U A;  5D3X A;  3PVL A;  3ULB A;  1KZ7 A;  5C6R A;  2CY5 A;  2D9V A;  3BIN A;  4K2P A;  2MKR A;  2QKM A;  5J3T A;  1WJM A;  3LJU X;  4DX9 0;  4KHO A;  1LW3 A;  1X86 A;  3KY9 A;  3TFM A;  2FJL A;  3BJI A;  2DLW A;  4TKN A;  3TCA A;  4CYE A;  1Y19 B;  2I1K A;  4EJN A;  2YS1 A;  5LON B;  1DDW A;  2YS3 A;  3ZDT A;  2DA0 A;  2X18 A;  3O96 A;  5DHA B;  1OQN A;  5KQ4 A;  1WI1 A;  2LG1 A;  1UNP A;  3F5R A;  1XR0 B;  2RUK B;  1WGQ A;  2DHI A;  4IOY X;  5C79 A;  3HQC A;  3U7D A;  1MIZ B;  4PNK A;  4DBB A;  1N3H A;  2DX5 A;  1ZC3 B;  2LKO A;  2P0H A;  4HAV B;  5EFX A;  1RJ2 A;  1NTV A;  2Q13 A;  1OY2 A;  3TO1 A;  4EKU A;  1SHC A;  2ROZ B;  3ML4 A;  2HTH B;  4A6K A;  1P3R A;  1Y5O A;  2RSG A;  5JHG A;  3N7C A;  2Z0O A;  2Y7B A;  3FSS A;  2J59 M;  2CY4 A;  4HAZ B;  1X1F A;  3DXE A;  1PMS A;  1UNR A;  3GYO A;  3G9W A;  1I2H A;  4HB2 B;  4DXA B;  1NU2 A;  2COA A;  1SGH A;  1ZC4 B;  4HAX B;  3ODO A;  1P5T A;  1XCG A;  2COF A;  3IVF A;  1P6S A;  1GC7 A;  2W2X D;  1ISN A;  1TQZ A;  1U5F A;  4YL8 A;  1UPR A;  1ZM0 A;  2LYD A;  3D8D A;  4CHJ A;  1V61 A;  4HB4 B;  2D10 A;  1DDM A;  1FAO A;  5DHF B;  5LOP B;  1GG3 A;  3SO6 A;  5KCV A;  2PZ1 A;  2I5F A;  4IAP A;  2P0D A;  1U29 A;  5C16 A;  1WJ1 A;  2V76 A;  1BTN A;  2J0K A;  2DN6 A;  4KAX B;  2OQB A;  3KSY A;  4WSF A;  5DI9 B;  5FI1 A;  1EGX A;  2L2I A;  2DHJ A;  4F7H A;  2QKL A;  3SNH A;  1NI2 A;  1J19 A;  3QBV B;  4KVG B;  3CXB B;  1MAI A;  3PP2 A;  1XKE A;  1DYN A;  3PVU A;  5CLQ B;  1FHX A;  1BWN A;  4HDQ A;  3RCP A;  4HB0 B;  3CIK A;  2UVM A;  3MPX A;  2L1C A;  3X23 A;  2MFQ A;  2YVC A;  5D3W A;  3QWM A;  1FGZ A;  3MDB C;  3PZD A;  1W1G A;  2E2X A;  3A98 B;  3AU4 A;  4GPT B;  3KRW A;  1WVH A;  1FGY A;  4GMX B;  2LOX A;  2DYQ A;  2ELB A;  4HAW B;  1XD4 A;  4K81 A;  2OTX A;  2ZPY A;  5C5B A;  1U5G A;  2DKP A;  3M1I B;  5FI0 A;  4WJ7 A;  2GS0 A;  4WVF B;  4EMO A;  5HE0 A;  3P6A A;  2EMS A;  4YON A;  5D27 A;  2NZ8 B;  2IYB A;  1FOE A;  4KHA A;  3WA0 A;  1FB8 A;  1AWE A;  1IRS A;  2EC1 A;  2GCJ A;  5DIF B;  2LUL A;  1LB1 A;  2D11 A;  3PEG A;  3OAN A;  4Z2M B;  3TW1 A;  1MK9 B;  3ODW A;  4GZU A;  2ADZ A;  3VOQ A;  2J0J A;  1UNQ A;  3GYP A;  2Y8F A;  2D9W A;  5KQ1 A;  1U5E A;  2HE7 A;  2RLO A;  1EF1 A;  3SYX A;  2DYN A;  2R09 A;  1PLS A; 
#chains in the Genus database with same CATH topology
 2FJU B;  1UPQ A;  1WG7 A;  2I1J A;  5C5B B;  5L81 A;  3P7Z A;  1GC6 A;  3ZVR A;  2J0M A;  1ZVR A;  4Y94 A;  3T06 A;  4HAY B;  2CRF A;  3QIJ A;  1AQC A;  1DRO A;  2Y8G A;  4IFS A;  4CSQ A;  3PG7 A;  2DTC A;  3DXC A;  5HE2 A;  2Z0P A;  2YF0 A;  2COC A;  2KIE A;  1MPH A;  4K2O A;  2ROV A;  4KHB A;  2Z0Q A;  5D3V A;  2K00 A;  4GN1 A;  1X1G A;  2GCL A;  4P7I A;  1E5W A;  2KIG A;  4MK0 A;  3FEH A;  1FHO A;  5JHH A;  4ZRK A;  2DHK A;  1M7E A;  4NY0 A;  3AJ4 A;  4F7U P;  2N23 A;  2YSZ A;  5J3Y A;  1OMW A;  2AL6 A;  3HIE A;  2UZS A;  2ELA A;  2W2W A;  4CHM A;  2GUM A;  2AEH A;  2H7D A;  2YT1 A;  2W2X C;  1MI1 A;  1BTK A;  1WGU A;  4L6E A;  1XX0 A;  2D2Q A;  1M7R A;  2EJ8 A;  5HE1 A;  1EVH A;  1U27 A;  1H4R A;  3ULC A;  1FHW A;  2EMT A;  4ZRJ A;  4NSW A;  3F0W A;  4DIX A;  4PQ0 A;  4HHV A;  2CAY A;  3A8Q A;  4A6F A;  2IFS A;  2M38 A;  2DX1 A;  3NWD A;  1J0W A;  2JP2 A;  2P8V A;  2P0F A;  1W1D A;  1X11 A;  1EAZ A;  4KHB B;  3DXD A;  1Q67 A;  2DKQ A;  1KZG A;  5D3Y A;  1DDV A;  1H10 A;  4GOU A;  2K2U A;  1DBH A;  4F7G A;  2GJY A;  5J3Q A;  2RGN B;  3HK0 A;  3D8E A;  1V89 A;  2D4Q A;  2RVB B;  5CLL B;  4ZRI A;  3KRX A;  1I7A A;  3SV1 A;  4MY6 A;  1TJ6 A;  1K5D B;  3OHM B;  3UZT A;  1ZSQ A;  2LOZ A;  2YS5 A;  3PSC A;  5JLJ B;  2G35 A;  4BBK A;  4D0N B;  2D9Y A;  1W1H A;  2D9Z A;  2UZR A;  1RRP B;  2KGX B;  1MIX A;  5GOW B;  1V5M A;  3A8P A;  5HE3 A;  5DH9 B;  4C0A A;  1PFJ A;  3VIA A;  1K5G B;  4L1R A;  3AU5 A;  4A6F B;  4Z2N A;  2H7E A;  4GNK B;  2XQN M;  2M14 A;  1TXD A;  4K17 A;  3KZ1 A;  4HB3 B;  1KI1 B;  1NTY A;  4GXB A;  3HW2 B;  1Z87 A;  4A5K A;  2K2J A;  4HAU B;  4HDO A;  3B77 A;  3NSU A;  2MWN B;  3D8F A;  4XWX A;  2VRW B;  2KUP A;  4MT7 A;  2NMB A;  4A6H A;  1V5P A;  2YT0 A;  2VSZ A;  1UEF A;  1U5D A;  5I2S A;  2KCJ A;  1BAK A;  1X05 A;  1QC6 A;  4OSN A;  2N0Y A;  2YRY A;  4B6H A;  3NW8 A;  2DFK A;  1MK7 B;  3WYF B;  2COD A;  4QJ5 B;  1QQG A;  2VKI A;  2I5C A;  4HAT B;  3V5W A;  3SUZ A;  2D9X A;  1MKE A;  4GMV A;  4DX8 A;  1T77 A;  3PVW A;  2R0D A;  4TYZ A;  2RNR B;  3ODX A;  2NBV A;  1B55 A;  3FM8 C;  1U2B A;  2BCJ A;  4H8S A;  1XOD A;  3U8Z A;  5JP4 A;  2MDX A;  3TVV A;  1V88 A;  1V5U A;  5D3X A;  3PVL A;  3ULB A;  1KZ7 A;  5C6R A;  2CY5 A;  2D9V A;  3FVC A;  3BIN A;  4K2P A;  2MKR A;  2KR0 A;  2QKM A;  5J3T A;  1WJM A;  3LJU X;  4DX9 0;  4KHO A;  1LW3 A;  1X86 A;  3KY9 A;  3TFM A;  2FJL A;  3BJI A;  2DLW A;  3HSA A;  4TKN A;  4D6W A;  3TCA A;  4CYE A;  2RRF A;  1Y19 B;  2I1K A;  4EJN A;  2YS1 A;  5LON B;  1DDW A;  2K8E A;  2YS3 A;  3ZDT A;  2DA0 A;  2ZKM X;  2X18 A;  3O96 A;  5M4Y B;  5DHA B;  1OQN A;  5KQ4 A;  2Z13 A;  1WI1 A;  2LG1 A;  1UNP A;  3F5R A;  1XR0 B;  2RUK B;  1WGQ A;  2DHI A;  4IOY X;  5C79 A;  3HQC A;  3U7D A;  1MIZ B;  4PNK A;  4DBB A;  1N3H A;  2DX5 A;  1ZC3 B;  2LKO A;  2P0H A;  4HAV B;  5EFX A;  1RJ2 A;  1NTV A;  2Q13 A;  1OY2 A;  3TO1 A;  4EKU A;  1SHC A;  2ROZ B;  3ML4 A;  2HTH B;  4A6K A;  1P3R A;  1Y5O A;  2RSG A;  5JHG A;  3N7C A;  2Z0O A;  5I2M A;  2Y7B A;  3FSS A;  2J59 M;  2CY4 A;  4HAZ B;  1X1F A;  2Z4D A;  3NWA A;  3DXE A;  1PMS A;  1UNR A;  3GYO A;  3G9W A;  1I2H A;  4HB2 B;  4DXA B;  1NU2 A;  2COA A;  1SGH A;  4QXA B;  1ZC4 B;  4HAX B;  3ODO A;  1P5T A;  1XCG A;  2COF A;  2KUQ A;  1P6S A;  3IVF A;  1GC7 A;  2Z59 A;  1ISN A;  2W2X D;  1TQZ A;  1U5F A;  4YL8 A;  1ZYI A;  1UPR A;  1ZM0 A;  2LYD A;  3D8D A;  4CHJ A;  1V61 A;  4HB4 B;  2D10 A;  1DDM A;  1FAO A;  5DHF B;  5LOP B;  1GG3 A;  3SO6 A;  5KCV A;  2PZ1 A;  2I5F A;  4IAP A;  2P0D A;  1U29 A;  5C16 A;  1WJ1 A;  2V76 A;  1BTN A;  2J0K A;  2DN6 A;  4KAX B;  2OQB A;  3KSY A;  3NWF A;  4WSF A;  5DI9 B;  5FI1 A;  1EGX A;  2L2I A;  2DHJ A;  4F7H A;  2QKL A;  3SNH A;  1NI2 A;  2YT2 A;  1J19 A;  3QBV B;  4KVG B;  3CXB B;  1MAI A;  3PP2 A;  1XKE A;  1DYN A;  3PVU A;  5CLQ B;  1FHX A;  1BWN A;  4HDQ A;  3RCP A;  4HB0 B;  3CIK A;  2UVM A;  3MPX A;  2L1C A;  3X23 A;  2MFQ A;  2YVC A;  5D3W A;  3QWM A;  1FGZ A;  3MDB C;  3PZD A;  3U12 A;  1W1G A;  2E2X A;  3A98 B;  3AU4 A;  4GPT B;  3KRW A;  1WVH A;  1FGY A;  4GMX B;  2LOX A;  2DYQ A;  2ELB A;  3A58 A;  4HAW B;  1XD4 A;  4K81 A;  4HSI A;  2OTX A;  2ZPY A;  5C5B A;  1U5G A;  2DKP A;  3M1I B;  4OT1 A;  4WJ7 A;  2GS0 A;  5FI0 A;  4QJ4 B;  4WVF B;  4EMO A;  5HE0 A;  3P6A A;  2EMS A;  2K49 A;  4YON A;  5D27 A;  2NZ8 B;  2IYB A;  1FOE A;  4KHA A;  3WA0 A;  1FB8 A;  1AWE A;  1IRS A;  2EC1 A;  2GCJ A;  5DIF B;  2LUL A;  1LB1 A;  2D11 A;  3PEG A;  3OAN A;  4Z2M B;  3TW1 A;  2Z14 A;  5IRS A;  1MK9 B;  3ODW A;  4GZU A;  2ADZ A;  3VOQ A;  5LG4 B;  3DCX A;  2J0J A;  1UNQ A;  3GYP A;  2Y8F A;  2R2Y A;  2D9W A;  5KQ1 A;  1U5E A;  2HE7 A;  2RLO A;  4QJ3 B;  1EF1 A;  3SYX A;  2DYN A;  2R09 A;  1PLS A; 
#chains in the Genus database with same CATH homology
 1UPQ A;  1WG7 A;  2I1J A;  5C5B B;  5L81 A;  3P7Z A;  1GC6 A;  3ZVR A;  2J0M A;  1ZVR A;  4Y94 A;  3T06 A;  4HAY B;  2CRF A;  3QIJ A;  1AQC A;  1DRO A;  2Y8G A;  4IFS A;  3PG7 A;  2DTC A;  3DXC A;  5HE2 A;  2Z0P A;  2YF0 A;  2COC A;  1MPH A;  4K2O A;  2ROV A;  2Z0Q A;  5D3V A;  2K00 A;  4GN1 A;  1X1G A;  2GCL A;  4P7I A;  1E5W A;  4MK0 A;  3FEH A;  1FHO A;  5JHH A;  4ZRK A;  2DHK A;  1M7E A;  4NY0 A;  3AJ4 A;  4F7U P;  2N23 A;  2YSZ A;  5J3Y A;  1OMW A;  2AL6 A;  2UZS A;  2ELA A;  2W2W A;  4CHM A;  2AEH A;  2H7D A;  2YT1 A;  2W2X C;  1BTK A;  1WGU A;  4L6E A;  1XX0 A;  2D2Q A;  1M7R A;  2EJ8 A;  5HE1 A;  1EVH A;  1U27 A;  1H4R A;  3ULC A;  1FHW A;  2EMT A;  4ZRJ A;  4NSW A;  3F0W A;  4PQ0 A;  4HHV A;  2CAY A;  3A8Q A;  4A6F A;  2IFS A;  2M38 A;  2DX1 A;  1J0W A;  2JP2 A;  2P8V A;  2P0F A;  1W1D A;  1X11 A;  1EAZ A;  4KHB B;  3DXD A;  1Q67 A;  2DKQ A;  1KZG A;  5D3Y A;  1DDV A;  1H10 A;  2K2U A;  1DBH A;  4F7G A;  2GJY A;  5J3Q A;  2RGN B;  3HK0 A;  3D8E A;  1V89 A;  2D4Q A;  2RVB B;  5CLL B;  4ZRI A;  3KRX A;  1I7A A;  3SV1 A;  4MY6 A;  1TJ6 A;  1K5D B;  3UZT A;  1ZSQ A;  2LOZ A;  2YS5 A;  3PSC A;  5JLJ B;  2G35 A;  4BBK A;  4D0N B;  2D9Y A;  1W1H A;  2D9Z A;  2UZR A;  1RRP B;  2KGX B;  1MIX A;  5GOW B;  1V5M A;  3A8P A;  5HE3 A;  5DH9 B;  4C0A A;  1PFJ A;  3VIA A;  1K5G B;  3AU5 A;  4A6F B;  4Z2N A;  2H7E A;  2XQN M;  2M14 A;  1TXD A;  4K17 A;  3KZ1 A;  4HB3 B;  1KI1 B;  1NTY A;  4GXB A;  3HW2 B;  1Z87 A;  4A5K A;  2K2J A;  4HAU B;  4HDO A;  3NSU A;  2MWN B;  3D8F A;  4XWX A;  2VRW B;  2KUP A;  4MT7 A;  2NMB A;  4A6H A;  1V5P A;  2YT0 A;  2VSZ A;  1UEF A;  1U5D A;  2KCJ A;  1BAK A;  1X05 A;  1QC6 A;  2N0Y A;  2YRY A;  4B6H A;  2DFK A;  1MK7 B;  3WYF B;  2COD A;  1QQG A;  2VKI A;  2I5C A;  4HAT B;  3V5W A;  3SUZ A;  2D9X A;  1MKE A;  4GMV A;  4DX8 A;  3PVW A;  2R0D A;  4TYZ A;  2RNR B;  3ODX A;  1B55 A;  3FM8 C;  1U2B A;  2BCJ A;  4H8S A;  1XOD A;  3U8Z A;  5JP4 A;  2MDX A;  3TVV A;  1V88 A;  1V5U A;  5D3X A;  3PVL A;  3ULB A;  1KZ7 A;  5C6R A;  2CY5 A;  2D9V A;  3BIN A;  4K2P A;  2MKR A;  2QKM A;  5J3T A;  1WJM A;  3LJU X;  4DX9 0;  4KHO A;  1LW3 A;  1X86 A;  3KY9 A;  3TFM A;  2FJL A;  3BJI A;  2DLW A;  4TKN A;  3TCA A;  4CYE A;  1Y19 B;  2I1K A;  4EJN A;  2YS1 A;  5LON B;  1DDW A;  2YS3 A;  3ZDT A;  2DA0 A;  2X18 A;  3O96 A;  5DHA B;  1OQN A;  5KQ4 A;  1WI1 A;  2LG1 A;  1UNP A;  3F5R A;  1XR0 B;  2RUK B;  1WGQ A;  2DHI A;  4IOY X;  5C79 A;  3HQC A;  3U7D A;  1MIZ B;  4PNK A;  4DBB A;  1N3H A;  2DX5 A;  1ZC3 B;  2LKO A;  2P0H A;  4HAV B;  5EFX A;  1RJ2 A;  1NTV A;  2Q13 A;  1OY2 A;  3TO1 A;  4EKU A;  1SHC A;  2ROZ B;  3ML4 A;  2HTH B;  4A6K A;  1P3R A;  1Y5O A;  2RSG A;  5JHG A;  3N7C A;  2Z0O A;  2Y7B A;  3FSS A;  2J59 M;  2CY4 A;  4HAZ B;  1X1F A;  3DXE A;  1PMS A;  1UNR A;  3GYO A;  3G9W A;  1I2H A;  4HB2 B;  4DXA B;  1NU2 A;  2COA A;  1SGH A;  1ZC4 B;  4HAX B;  3ODO A;  1P5T A;  1XCG A;  2COF A;  3IVF A;  1P6S A;  1GC7 A;  2W2X D;  1ISN A;  1TQZ A;  1U5F A;  4YL8 A;  1UPR A;  1ZM0 A;  2LYD A;  3D8D A;  4CHJ A;  1V61 A;  4HB4 B;  2D10 A;  1DDM A;  1FAO A;  5DHF B;  5LOP B;  1GG3 A;  3SO6 A;  5KCV A;  2PZ1 A;  2I5F A;  4IAP A;  2P0D A;  1U29 A;  5C16 A;  1WJ1 A;  2V76 A;  1BTN A;  2J0K A;  2DN6 A;  4KAX B;  2OQB A;  3KSY A;  4WSF A;  5DI9 B;  5FI1 A;  1EGX A;  2L2I A;  2DHJ A;  4F7H A;  2QKL A;  3SNH A;  1NI2 A;  1J19 A;  3QBV B;  4KVG B;  3CXB B;  1MAI A;  3PP2 A;  1XKE A;  1DYN A;  3PVU A;  5CLQ B;  1FHX A;  1BWN A;  4HDQ A;  3RCP A;  4HB0 B;  3CIK A;  2UVM A;  3MPX A;  2L1C A;  3X23 A;  2MFQ A;  2YVC A;  5D3W A;  3QWM A;  1FGZ A;  3MDB C;  3PZD A;  1W1G A;  2E2X A;  3A98 B;  3AU4 A;  4GPT B;  3KRW A;  1WVH A;  1FGY A;  4GMX B;  2LOX A;  2DYQ A;  2ELB A;  4HAW B;  1XD4 A;  4K81 A;  2OTX A;  2ZPY A;  5C5B A;  1U5G A;  2DKP A;  3M1I B;  5FI0 A;  4WJ7 A;  2GS0 A;  4WVF B;  4EMO A;  5HE0 A;  3P6A A;  2EMS A;  4YON A;  5D27 A;  2NZ8 B;  2IYB A;  1FOE A;  4KHA A;  3WA0 A;  1FB8 A;  1AWE A;  1IRS A;  2EC1 A;  2GCJ A;  5DIF B;  2LUL A;  1LB1 A;  2D11 A;  3PEG A;  3OAN A;  4Z2M B;  3TW1 A;  1MK9 B;  3ODW A;  4GZU A;  2ADZ A;  3VOQ A;  2J0J A;  1UNQ A;  3GYP A;  2Y8F A;  2D9W A;  5KQ1 A;  1U5E A;  2HE7 A;  2RLO A;  1EF1 A;  3SYX A;  2DYN A;  2R09 A;  1PLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...