2COFA

Solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
b'GSSGSSGLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein KIAA1914
publication title Solution structure of the C-terminal PH domain of hypothetical protein KIAA1914 from human
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cofA00
1MKEA 2EJ8A 2L1CA 2D9VA 4EJNA 2DX1A 2Z0QA 3PZDA 3O96A 1MIXA 4B6HA 1GG3A 2KCJA 1NTVA 4TKNA 4WJ7A 2YF0A 2COCA 3OANA 1UNRA 2LOZA 3WYFB 1WG7A 1W1DA 4HDOA 2AL6A 3KRXA 1FGZA 2Z0OA 4PQ0A 3U8ZA 1XR0B 5HE1A 3PG7A 1U5DA 1WJ1A 5D3WA 4CHJA 3ML4A 2DHIA 3G9WA 1H4RA 2RNRB 2E2XA 4YL8A 1ZSQA 5FI1A 3ODXA 1MK7B 3PVLA 3RCPA 4CHMA 1UNQA 3P6AA 1KZGA 2DN6A 1U27A 3U7DA 2D4QA 1FHXA 3A8PA 4A5KA 1RJ2A 2DA0A 1DDWA 2DYNA 5D3VA 2YS3A 1FGYA 5DH9B 3BINA 1GC6A 2IYBA 2W2WA 3TVVA 4A6FA 2DFKA 2Q13A 2KGXB 1V61A 4HAUB 4K2OA 2GS0A 1ZC4B 2D9ZA 1V5PA 2ADZA 1P5TA 2LULA 1GC7A 4F7HA 4IAPA 1WVHA 3QIJA 2I1KA 2VRWB 2JP2A 3MDBC 3F5RA 2GCJA 3PP2A 4NSWA 1BTKA 3FSSA 2YS1A 2ELBA 3PSCA 2D2QA 2R09A 1I2HA 2I1JA 4Z2MB 3D8EA 5J3QA 5L81A 1WI1A 2D11A 5JHGA 1P3RA 4DX8A 2UZRA 1WJMA 2M38A 2K00A 1EF1A 2ROZB 5HE2A 1I7AA 4HAYB 3GYPA 4EKUA 1V5UA 1EVHA 1AWEA 1X86A 3CIKA 1UPQA 1XCGA 2N23A 1WGUA 1Q67A 1OQNA 3SUZA 2MFQA 3DXEA 1MAIA 2P0HA 3M1IB 4PNKA 3WA0A 3BJIA 2DYQA 4H8SA 3SYXA 2LYDA 1V5MA 4Y94A 1X05A 4ZRIA 3DXCA 5GOWB 3FEHA 4HB2B 4KAXB 1AQCA 2J59M 1DROA 3TCAA 2K2UA 4A6FB 1PFJA 4HAVB 3PVWA 2DTCA 2I5FA 3TW1A 2AEHA 3HW2B 5J3TA 4ZRKA 5D27A 5DHAB 2P0DA 3AU5A 1NU2A 3DXDA 5LONB 4TYZA 4C0AA 3VOQA 1MIZB 4GXBA 2J0JA 2LKOA 2ZPYA 5DI9B 2NZ8B 3D8DA 1X1GA 2DLWA 2DKQA 2D10A 1OY2A 1U5GA 5FI0A 2LG1A 1E5WA 4WSFA 4BBKA 4F7GA 1W1HA 4YONA 3ZVRA 3ODOA 1DBHA 1W1GA 4MT7A 2YT1A 2CRFA 3T06A 1FHWA 4HAXB 1U5FA 1K5DB 4GMXB 2EC1A 2P0FA 1XODA 1KZ7A 1RRPB 4IOYX 2L2IA 4MY6A 2H7EA 3AJ4A 2RSGA 1QQGA 1V88A 2MKRA 3ZDTA 1XKEA 5J3YA 4K2PA 4DBBA 2EMTA 1BWNA 1BAKA 1QC6A 2N0YA 2XQNM 4HHVA 2M14A 1IRSA 5CLQB 4HB3B 1DDMA 2YS5A 3LJUX 5LOPB 2OQBA 2ELAA 3ULBA 2GCLA 4KHBB 1FB8A 2W2XD 3PVUA 4L6EA 4A6HA 2VKIA 2CAYA 1J0WA 4GZUA 2Y8GA 1U29A 2PZ1A 4HB4B 1Y5OA 2FJLA 1X1FA 4Z2NA 1P6SA 5C16A 3QBVB 2RLOA 4K17A 4D0NB 4F7UP 5DHFB 3FM8C 1KI1B 4IFSA 2IFSA 1NTYA 2DHKA 2D9YA 3KSYA 2QKLA 3A98B 1Z87A 3NSUA 4HB0B 3QWMA 2UVMA 1NI2A 4EMOA 3AU4A 3ULCA 1PMSA 2Z0PA 1LW3A 2X18A 4HAWB 2CODA 2GJYA 2UZSA 1EAZA 3UZTA 1LB1A 1MK9B 1B55A 4HDQA 3N7CA 2ROVA 4XWXA 1XX0A 5C5BA 1M7EA 2P8VA 3A8QA 3F0WA 1DYNA 4HAZB 1SGHA 4KVGB 2YVCA 3V5WA 4GMVA 2LOXA 1EGXA 2NMBA 1M7RA 1UPRA 3VIAA 2H7DA 1U5EA 3HQCA 4NY0A 4ZRJA 2YRYA 4WVFB 3GYOA 2EMSA 4HATB 5HE0A 1Y19B 4KHOA 2Y7BA 1V89A 4GN1A 3KRWA 5JHHA 1OMWA 2RUKB 2YSZA 5DIFB 1MPHA 3D8FA 3P7ZA 1SHCA 1XD4A 2R0DA 2DX5A 1TJ6A 1TQZA 1K5GB 1PLSA 3PEGA 2I5CA 3ODWA 5KCVA 2D9WA 4GPTB 2RVBB 1FAOA 1UEFA 2YT0A 2Y8FA 3CXBB 2RGNB 3MPXA 5JLJB 1FOEA 1ISNA 2OTXA 5KQ1A 3SV1A 3SNHA 2G35A 3TFMA 2QKMA 5JP4A 2COAA 2CY4A 1ZVRA 5C5BB 2HE7A 1FHOA 1UNPA 5CLLB 4KHAA 5HE3A 1DDVA 1WGQA 5C79A 2VSZA 3SO6A 5EFXA 3HK0A 1ZC3B 2KUPA 1ZM0A 2K2JA 5C6RA 5D3YA 2BCJA 4DX90 5KQ4A 3IVFA 1H10A 5D3XA 2J0KA 1U2BA 1N3HA 4MK0A 3KZ1A 2DKPA 1J19A 4K81A 4P7IA 4A6KA 1TXDA 2DHJA 1BTNA 3X23A 3KY9A 2D9XA 2V76A 2W2XC 2HTHB 3TO1A 2MWNB 2MDXA 4DXAB 4CYEA 1X11A 2J0MA 2CY5A 2COFA
chains in the Genus database with same CATH superfamily
1MKEA 2EJ8A 2L1CA 2D9VA 4OSNA 5M4YB 4EJNA 2DX1A 4GOUA 2Z0QA 3PZDA 3O96A 1MIXA 3NWDA 4B6HA 1GG3A 2KCJA 1NTVA 4TKNA 2KR0A 4WJ7A 2YF0A 2COCA 3OANA 1UNRA 2LOZA 3WYFB 1WG7A 1W1DA 4HDOA 2AL6A 2ZKMX 3KRXA 1FGZA 2Z0OA 4PQ0A 3U8ZA 1XR0B 5HE1A 3PG7A 1U5DA 1WJ1A 5D3WA 4CHJA 3ML4A 2DHIA 3G9WA 1H4RA 2RNRB 2E2XA 4YL8A 1ZSQA 5FI1A 3ODXA 1MK7B 3PVLA 2Z13A 3RCPA 2Z14A 4CHMA 1UNQA 3P6AA 3NWFA 1KZGA 2DN6A 1U27A 3U7DA 2D4QA 1FHXA 3A8PA 4A5KA 1RJ2A 2DA0A 3U12A 1DDWA 2DYNA 5D3VA 2YS3A 1FGYA 5DH9B 2KIGA 3BINA 1GC6A 2IYBA 2W2WA 3TVVA 4A6FA 2DFKA 2Q13A 2KGXB 1V61A 4HAUB 4K2OA 2GS0A 1ZC4B 2D9ZA 1V5PA 2ADZA 1P5TA 2LULA 1GC7A 4F7HA 4IAPA 1WVHA 3QIJA 2I1KA 2VRWB 2JP2A 3MDBC 3F5RA 2GCJA 3PP2A 4NSWA 1BTKA 3FSSA 2YS1A 2ELBA 3PSCA 3DCXA 2D2QA 2R09A 1I2HA 2I1JA 4Z2MB 3D8EA 5J3QA 5L81A 1WI1A 2D11A 5JHGA 1P3RA 4DX8A 2UZRA 1WJMA 2M38A 2K00A 1EF1A 2ROZB 5HE2A 1I7AA 4HAYB 3GYPA 4EKUA 1V5UA 1EVHA 1AWEA 1X86A 3CIKA 1UPQA 1XCGA 2N23A 1WGUA 1Q67A 1OQNA 3SUZA 1T77A 2MFQA 3DXEA 1MAIA 2P0HA 3M1IB 4PNKA 3WA0A 5IRSA 3BJIA 2DYQA 4H8SA 3SYXA 2LYDA 1V5MA 4Y94A 1X05A 4ZRIA 3DXCA 5GOWB 3FEHA 4HB2B 4KAXB 3OHMB 1AQCA 4KHBA 2J59M 1DROA 3TCAA 2K2UA 4A6FB 1PFJA 4HAVB 3PVWA 2DTCA 2RRFA 2I5FA 3TW1A 2AEHA 2YT2A 3HW2B 5J3TA 4ZRKA 5D27A 5DHAB 2P0DA 3AU5A 5I2SA 1NU2A 3DXDA 5LONB 4TYZA 5LG4B 4C0AA 3VOQA 1MIZB 4QXAB 4GXBA 2J0JA 2LKOA 2ZPYA 5DI9B 2NZ8B 3D8DA 1X1GA 2DLWA 2DKQA 2D10A 3HIEA 1OY2A 1U5GA 5FI0A 2LG1A 1E5WA 3NWAA 4WSFA 4BBKA 4F7GA 1W1HA 4YONA 3ZVRA 3ODOA 1DBHA 1W1GA 4MT7A 2YT1A 2CRFA 3T06A 1FHWA 4HAXB 1U5FA 4DIXA 1K5DB 4GMXB 2EC1A 3A58A 2P0FA 1XODA 1KZ7A 1RRPB 4IOYX 2L2IA 4MY6A 2H7EA 3AJ4A 2RSGA 2R2YA 1QQGA 1V88A 2MKRA 3ZDTA 1XKEA 5J3YA 4K2PA 4DBBA 2EMTA 1BWNA 1BAKA 1QC6A 2N0YA 2XQNM 4HHVA 2M14A 1IRSA 5CLQB 4QJ3B 4HB3B 1DDMA 2YS5A 3LJUX 5LOPB 2OQBA 2ELAA 3ULBA 2GCLA 4KHBB 1FB8A 2W2XD 3PVUA 4L6EA 4A6HA 1MI1A 2VKIA 2CAYA 1J0WA 4CSQA 4GZUA 2Y8GA 1U29A 2PZ1A 4HB4B 1Y5OA 2FJLA 1X1FA 4Z2NA 1P6SA 5C16A 3QBVB 2RLOA 4K17A 4D0NB 4F7UP 5DHFB 3FM8C 1KI1B 4IFSA 2GUMA 2IFSA 1NTYA 2DHKA 2D9YA 3KSYA 2QKLA 3A98B 1Z87A 3NSUA 4HB0B 3QWMA 2UVMA 1NI2A 4EMOA 3B77A 3AU4A 3ULCA 1PMSA 2Z0PA 1LW3A 2X18A 4HAWB 2CODA 2GJYA 2UZSA 1EAZA 3UZTA 1LB1A 4D6WA 1MK9B 1B55A 5I2MA 4HDQA 3N7CA 2K8EA 2ROVA 4QJ4B 4XWXA 1XX0A 5C5BA 1M7EA 2P8VA 3A8QA 3F0WA 1DYNA 4HAZB 1SGHA 4KVGB 2YVCA 3V5WA 4GMVA 2LOXA 1EGXA 2Z4DA 2NMBA 2KIEA 1M7RA 1UPRA 3VIAA 2H7DA 4HSIA 1U5EA 3HQCA 4NY0A 4ZRJA 4L1RA 2YRYA 4WVFB 3GYOA 2EMSA 2NBVA 4HATB 5HE0A 1Y19B 4KHOA 2Z59A 2Y7BA 1V89A 2KUQA 4GN1A 3KRWA 5JHHA 1OMWA 2RUKB 2YSZA 5DIFB 1MPHA 3D8FA 3P7ZA 1SHCA 1XD4A 2R0DA 2DX5A 1TJ6A 1TQZA 1K5GB 1PLSA 3PEGA 2I5CA 3ODWA 5KCVA 2D9WA 4GPTB 2RVBB 1FAOA 1UEFA 2YT0A 2Y8FA 3CXBB 2RGNB 3MPXA 5JLJB 1FOEA 1ISNA 2OTXA 5KQ1A 2FJUB 3SV1A 3SNHA 2G35A 3TFMA 2QKMA 5JP4A 2COAA 2CY4A 1ZVRA 5C5BB 2HE7A 1FHOA 1UNPA 5CLLB 4KHAA 5HE3A 1DDVA 1WGQA 5C79A 2VSZA 3SO6A 1ZYIA 5EFXA 3HK0A 1ZC3B 2KUPA 1ZM0A 2K2JA 5C6RA 5D3YA 2BCJA 4DX90 5KQ4A 3IVFA 1H10A 5D3XA 2J0KA 1U2BA 4GNKB 1N3HA 4MK0A 3KZ1A 2DKPA 1J19A 4K81A 4P7IA 4A6KA 1TXDA 2DHJA 4QJ5B 1BTNA 3FVCA 3X23A 3KY9A 2D9XA 3NW8A 4OT1A 2V76A 2W2XC 2HTHB 2K49A 3TO1A 2MWNB 2MDXA 4DXAB 3HSAA 4CYEA 1X11A 2J0MA 2CY5A 2COFA
chains in the Genus database with same CATH topology
1MKEA 2EJ8A 2L1CA 2D9VA 4EJNA 2DX1A 2Z0QA 3PZDA 3O96A 1MIXA 4B6HA 1GG3A 2KCJA 1NTVA 4TKNA 4WJ7A 2YF0A 2COCA 3OANA 1UNRA 2LOZA 3WYFB 1WG7A 1W1DA 4HDOA 2AL6A 3KRXA 1FGZA 2Z0OA 4PQ0A 3U8ZA 1XR0B 5HE1A 3PG7A 1U5DA 1WJ1A 5D3WA 4CHJA 3ML4A 2DHIA 3G9WA 1H4RA 2RNRB 2E2XA 4YL8A 1ZSQA 5FI1A 3ODXA 1MK7B 3PVLA 3RCPA 4CHMA 1UNQA 3P6AA 1KZGA 2DN6A 1U27A 3U7DA 2D4QA 1FHXA 3A8PA 4A5KA 1RJ2A 2DA0A 1DDWA 2DYNA 5D3VA 2YS3A 1FGYA 5DH9B 3BINA 1GC6A 2IYBA 2W2WA 3TVVA 4A6FA 2DFKA 2Q13A 2KGXB 1V61A 4HAUB 4K2OA 2GS0A 1ZC4B 2D9ZA 1V5PA 2ADZA 1P5TA 2LULA 1GC7A 4F7HA 4IAPA 1WVHA 3QIJA 2I1KA 2VRWB 2JP2A 3MDBC 3F5RA 2GCJA 3PP2A 4NSWA 1BTKA 3FSSA 2YS1A 2ELBA 3PSCA 2D2QA 2R09A 1I2HA 2I1JA 4Z2MB 3D8EA 5J3QA 5L81A 1WI1A 2D11A 5JHGA 1P3RA 4DX8A 2UZRA 1WJMA 2M38A 2K00A 1EF1A 2ROZB 5HE2A 1I7AA 4HAYB 3GYPA 4EKUA 1V5UA 1EVHA 1AWEA 1X86A 3CIKA 1UPQA 1XCGA 2N23A 1WGUA 1Q67A 1OQNA 3SUZA 2MFQA 3DXEA 1MAIA 2P0HA 3M1IB 4PNKA 3WA0A 3BJIA 2DYQA 4H8SA 3SYXA 2LYDA 1V5MA 4Y94A 1X05A 4ZRIA 3DXCA 5GOWB 3FEHA 4HB2B 4KAXB 1AQCA 2J59M 1DROA 3TCAA 2K2UA 4A6FB 1PFJA 4HAVB 3PVWA 2DTCA 2I5FA 3TW1A 2AEHA 3HW2B 5J3TA 4ZRKA 5D27A 5DHAB 2P0DA 3AU5A 1NU2A 3DXDA 5LONB 4TYZA 4C0AA 3VOQA 1MIZB 4GXBA 2J0JA 2LKOA 2ZPYA 5DI9B 2NZ8B 3D8DA 1X1GA 2DLWA 2DKQA 2D10A 1OY2A 1U5GA 5FI0A 2LG1A 1E5WA 4WSFA 4BBKA 4F7GA 1W1HA 4YONA 3ZVRA 3ODOA 1DBHA 1W1GA 4MT7A 2YT1A 2CRFA 3T06A 1FHWA 4HAXB 1U5FA 1K5DB 4GMXB 2EC1A 2P0FA 1XODA 1KZ7A 1RRPB 4IOYX 2L2IA 4MY6A 2H7EA 3AJ4A 2RSGA 1QQGA 1V88A 2MKRA 3ZDTA 1XKEA 5J3YA 4K2PA 4DBBA 2EMTA 1BWNA 1BAKA 1QC6A 2N0YA 2XQNM 4HHVA 2M14A 1IRSA 5CLQB 4HB3B 1DDMA 2YS5A 3LJUX 5LOPB 2OQBA 2ELAA 3ULBA 2GCLA 4KHBB 1FB8A 2W2XD 3PVUA 4L6EA 4A6HA 2VKIA 2CAYA 1J0WA 4GZUA 2Y8GA 1U29A 2PZ1A 4HB4B 1Y5OA 2FJLA 1X1FA 4Z2NA 1P6SA 5C16A 3QBVB 2RLOA 4K17A 4D0NB 4F7UP 5DHFB 3FM8C 1KI1B 4IFSA 2IFSA 1NTYA 2DHKA 2D9YA 3KSYA 2QKLA 3A98B 1Z87A 3NSUA 4HB0B 3QWMA 2UVMA 1NI2A 4EMOA 3AU4A 3ULCA 1PMSA 2Z0PA 1LW3A 2X18A 4HAWB 2CODA 2GJYA 2UZSA 1EAZA 3UZTA 1LB1A 1MK9B 1B55A 4HDQA 3N7CA 2ROVA 4XWXA 1XX0A 5C5BA 1M7EA 2P8VA 3A8QA 3F0WA 1DYNA 4HAZB 1SGHA 4KVGB 2YVCA 3V5WA 4GMVA 2LOXA 1EGXA 2NMBA 1M7RA 1UPRA 3VIAA 2H7DA 1U5EA 3HQCA 4NY0A 4ZRJA 2YRYA 4WVFB 3GYOA 2EMSA 4HATB 5HE0A 1Y19B 4KHOA 2Y7BA 1V89A 4GN1A 3KRWA 5JHHA 1OMWA 2RUKB 2YSZA 5DIFB 1MPHA 3D8FA 3P7ZA 1SHCA 1XD4A 2R0DA 2DX5A 1TJ6A 1TQZA 1K5GB 1PLSA 3PEGA 2I5CA 3ODWA 5KCVA 2D9WA 4GPTB 2RVBB 1FAOA 1UEFA 2YT0A 2Y8FA 3CXBB 2RGNB 3MPXA 5JLJB 1FOEA 1ISNA 2OTXA 5KQ1A 3SV1A 3SNHA 2G35A 3TFMA 2QKMA 5JP4A 2COAA 2CY4A 1ZVRA 5C5BB 2HE7A 1FHOA 1UNPA 5CLLB 4KHAA 5HE3A 1DDVA 1WGQA 5C79A 2VSZA 3SO6A 5EFXA 3HK0A 1ZC3B 2KUPA 1ZM0A 2K2JA 5C6RA 5D3YA 2BCJA 4DX90 5KQ4A 3IVFA 1H10A 5D3XA 2J0KA 1U2BA 1N3HA 4MK0A 3KZ1A 2DKPA 1J19A 4K81A 4P7IA 4A6KA 1TXDA 2DHJA 1BTNA 3X23A 3KY9A 2D9XA 2V76A 2W2XC 2HTHB 3TO1A 2MWNB 2MDXA 4DXAB 4CYEA 1X11A 2J0MA 2CY5A 2COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKE A;  2EJ8 A;  2L1C A;  2D9V A;  4EJN A;  2DX1 A;  2Z0Q A;  3PZD A;  3O96 A;  1MIX A;  4B6H A;  1GG3 A;  2KCJ A;  1NTV A;  4TKN A;  4WJ7 A;  2YF0 A;  2COC A;  3OAN A;  1UNR A;  2LOZ A;  3WYF B;  1WG7 A;  1W1D A;  4HDO A;  2AL6 A;  3KRX A;  1FGZ A;  2Z0O A;  4PQ0 A;  3U8Z A;  1XR0 B;  5HE1 A;  3PG7 A;  1U5D A;  1WJ1 A;  5D3W A;  4CHJ A;  3ML4 A;  2DHI A;  3G9W A;  1H4R A;  2RNR B;  2E2X A;  4YL8 A;  1ZSQ A;  5FI1 A;  3ODX A;  1MK7 B;  3PVL A;  3RCP A;  4CHM A;  1UNQ A;  3P6A A;  1KZG A;  2DN6 A;  1U27 A;  3U7D A;  2D4Q A;  1FHX A;  3A8P A;  4A5K A;  1RJ2 A;  2DA0 A;  1DDW A;  2DYN A;  5D3V A;  2YS3 A;  1FGY A;  5DH9 B;  3BIN A;  1GC6 A;  2IYB A;  2W2W A;  3TVV A;  4A6F A;  2DFK A;  2Q13 A;  2KGX B;  1V61 A;  4HAU B;  4K2O A;  2GS0 A;  1ZC4 B;  2D9Z A;  1V5P A;  2ADZ A;  1P5T A;  2LUL A;  1GC7 A;  4F7H A;  4IAP A;  1WVH A;  3QIJ A;  2I1K A;  2VRW B;  2JP2 A;  3MDB C;  3F5R A;  2GCJ A;  3PP2 A;  4NSW A;  1BTK A;  3FSS A;  2YS1 A;  2ELB A;  3PSC A;  2D2Q A;  2R09 A;  1I2H A;  2I1J A;  4Z2M B;  3D8E A;  5J3Q A;  5L81 A;  1WI1 A;  2D11 A;  5JHG A;  1P3R A;  4DX8 A;  2UZR A;  1WJM A;  2M38 A;  2K00 A;  1EF1 A;  2ROZ B;  5HE2 A;  1I7A A;  4HAY B;  3GYP A;  4EKU A;  1V5U A;  1EVH A;  1AWE A;  1X86 A;  3CIK A;  1UPQ A;  1XCG A;  2N23 A;  1WGU A;  1Q67 A;  1OQN A;  3SUZ A;  2MFQ A;  3DXE A;  1MAI A;  2P0H A;  3M1I B;  4PNK A;  3WA0 A;  3BJI A;  2DYQ A;  4H8S A;  3SYX A;  2LYD A;  1V5M A;  4Y94 A;  1X05 A;  4ZRI A;  3DXC A;  5GOW B;  3FEH A;  4HB2 B;  4KAX B;  1AQC A;  2J59 M;  1DRO A;  3TCA A;  2K2U A;  4A6F B;  1PFJ A;  4HAV B;  3PVW A;  2DTC A;  2I5F A;  3TW1 A;  2AEH A;  3HW2 B;  5J3T A;  4ZRK A;  5D27 A;  5DHA B;  2P0D A;  3AU5 A;  1NU2 A;  3DXD A;  5LON B;  4TYZ A;  4C0A A;  3VOQ A;  1MIZ B;  4GXB A;  2J0J A;  2LKO A;  2ZPY A;  5DI9 B;  2NZ8 B;  3D8D A;  1X1G A;  2DLW A;  2DKQ A;  2D10 A;  1OY2 A;  1U5G A;  5FI0 A;  2LG1 A;  1E5W A;  4WSF A;  4BBK A;  4F7G A;  1W1H A;  4YON A;  3ZVR A;  3ODO A;  1DBH A;  1W1G A;  4MT7 A;  2YT1 A;  2CRF A;  3T06 A;  1FHW A;  4HAX B;  1U5F A;  1K5D B;  4GMX B;  2EC1 A;  2P0F A;  1XOD A;  1KZ7 A;  1RRP B;  4IOY X;  2L2I A;  4MY6 A;  2H7E A;  3AJ4 A;  2RSG A;  1QQG A;  1V88 A;  2MKR A;  3ZDT A;  1XKE A;  5J3Y A;  4K2P A;  4DBB A;  2EMT A;  1BWN A;  1BAK A;  1QC6 A;  2N0Y A;  2XQN M;  4HHV A;  2M14 A;  1IRS A;  5CLQ B;  4HB3 B;  1DDM A;  2YS5 A;  3LJU X;  5LOP B;  2OQB A;  2ELA A;  3ULB A;  2GCL A;  4KHB B;  1FB8 A;  2W2X D;  3PVU A;  4L6E A;  4A6H A;  2VKI A;  2CAY A;  1J0W A;  4GZU A;  2Y8G A;  1U29 A;  2PZ1 A;  4HB4 B;  1Y5O A;  2FJL A;  1X1F A;  4Z2N A;  1P6S A;  5C16 A;  3QBV B;  2RLO A;  4K17 A;  4D0N B;  4F7U P;  5DHF B;  3FM8 C;  1KI1 B;  4IFS A;  2IFS A;  1NTY A;  2DHK A;  2D9Y A;  3KSY A;  2QKL A;  3A98 B;  1Z87 A;  3NSU A;  4HB0 B;  3QWM A;  2UVM A;  1NI2 A;  4EMO A;  3AU4 A;  3ULC A;  1PMS A;  2Z0P A;  1LW3 A;  2X18 A;  4HAW B;  2COD A;  2GJY A;  2UZS A;  1EAZ A;  3UZT A;  1LB1 A;  1MK9 B;  1B55 A;  4HDQ A;  3N7C A;  2ROV A;  4XWX A;  1XX0 A;  5C5B A;  1M7E A;  2P8V A;  3A8Q A;  3F0W A;  1DYN A;  4HAZ B;  1SGH A;  4KVG B;  2YVC A;  3V5W A;  4GMV A;  2LOX A;  1EGX A;  2NMB A;  1M7R A;  1UPR A;  3VIA A;  2H7D A;  1U5E A;  3HQC A;  4NY0 A;  4ZRJ A;  2YRY A;  4WVF B;  3GYO A;  2EMS A;  4HAT B;  5HE0 A;  1Y19 B;  4KHO A;  2Y7B A;  1V89 A;  4GN1 A;  3KRW A;  5JHH A;  1OMW A;  2RUK B;  2YSZ A;  5DIF B;  1MPH A;  3D8F A;  3P7Z A;  1SHC A;  1XD4 A;  2R0D A;  2DX5 A;  1TJ6 A;  1TQZ A;  1K5G B;  1PLS A;  3PEG A;  2I5C A;  3ODW A;  5KCV A;  2D9W A;  4GPT B;  2RVB B;  1FAO A;  1UEF A;  2YT0 A;  2Y8F A;  3CXB B;  2RGN B;  3MPX A;  5JLJ B;  1FOE A;  1ISN A;  2OTX A;  5KQ1 A;  3SV1 A;  3SNH A;  2G35 A;  3TFM A;  2QKM A;  5JP4 A;  2COA A;  2CY4 A;  1ZVR A;  5C5B B;  2HE7 A;  1FHO A;  1UNP A;  5CLL B;  4KHA A;  5HE3 A;  1DDV A;  1WGQ A;  5C79 A;  2VSZ A;  3SO6 A;  5EFX A;  3HK0 A;  1ZC3 B;  2KUP A;  1ZM0 A;  2K2J A;  5C6R A;  5D3Y A;  2BCJ A;  4DX9 0;  5KQ4 A;  3IVF A;  1H10 A;  5D3X A;  2J0K A;  1U2B A;  1N3H A;  4MK0 A;  3KZ1 A;  2DKP A;  1J19 A;  4K81 A;  4P7I A;  4A6K A;  1TXD A;  2DHJ A;  1BTN A;  3X23 A;  3KY9 A;  2D9X A;  2V76 A;  2W2X C;  2HTH B;  3TO1 A;  2MWN B;  2MDX A;  4DXA B;  4CYE A;  1X11 A;  2J0M A;  2CY5 A;  2COF A; 
#chains in the Genus database with same CATH topology
 1MKE A;  2EJ8 A;  2L1C A;  2D9V A;  4OSN A;  5M4Y B;  4EJN A;  2DX1 A;  4GOU A;  2Z0Q A;  3PZD A;  3O96 A;  1MIX A;  3NWD A;  4B6H A;  1GG3 A;  2KCJ A;  1NTV A;  4TKN A;  2KR0 A;  4WJ7 A;  2YF0 A;  2COC A;  3OAN A;  1UNR A;  2LOZ A;  3WYF B;  1WG7 A;  1W1D A;  4HDO A;  2AL6 A;  2ZKM X;  3KRX A;  1FGZ A;  2Z0O A;  4PQ0 A;  3U8Z A;  1XR0 B;  5HE1 A;  3PG7 A;  1U5D A;  1WJ1 A;  5D3W A;  4CHJ A;  3ML4 A;  2DHI A;  3G9W A;  1H4R A;  2RNR B;  2E2X A;  4YL8 A;  1ZSQ A;  5FI1 A;  3ODX A;  1MK7 B;  3PVL A;  2Z13 A;  3RCP A;  2Z14 A;  4CHM A;  1UNQ A;  3P6A A;  3NWF A;  1KZG A;  2DN6 A;  1U27 A;  3U7D A;  2D4Q A;  1FHX A;  3A8P A;  4A5K A;  1RJ2 A;  2DA0 A;  3U12 A;  1DDW A;  2DYN A;  5D3V A;  2YS3 A;  1FGY A;  5DH9 B;  2KIG A;  3BIN A;  1GC6 A;  2IYB A;  2W2W A;  3TVV A;  4A6F A;  2DFK A;  2Q13 A;  2KGX B;  1V61 A;  4HAU B;  4K2O A;  2GS0 A;  1ZC4 B;  2D9Z A;  1V5P A;  2ADZ A;  1P5T A;  2LUL A;  1GC7 A;  4F7H A;  4IAP A;  1WVH A;  3QIJ A;  2I1K A;  2VRW B;  2JP2 A;  3MDB C;  3F5R A;  2GCJ A;  3PP2 A;  4NSW A;  1BTK A;  3FSS A;  2YS1 A;  2ELB A;  3PSC A;  3DCX A;  2D2Q A;  2R09 A;  1I2H A;  2I1J A;  4Z2M B;  3D8E A;  5J3Q A;  5L81 A;  1WI1 A;  2D11 A;  5JHG A;  1P3R A;  4DX8 A;  2UZR A;  1WJM A;  2M38 A;  2K00 A;  1EF1 A;  2ROZ B;  5HE2 A;  1I7A A;  4HAY B;  3GYP A;  4EKU A;  1V5U A;  1EVH A;  1AWE A;  1X86 A;  3CIK A;  1UPQ A;  1XCG A;  2N23 A;  1WGU A;  1Q67 A;  1OQN A;  3SUZ A;  1T77 A;  2MFQ A;  3DXE A;  1MAI A;  2P0H A;  3M1I B;  4PNK A;  3WA0 A;  5IRS A;  3BJI A;  2DYQ A;  4H8S A;  3SYX A;  2LYD A;  1V5M A;  4Y94 A;  1X05 A;  4ZRI A;  3DXC A;  5GOW B;  3FEH A;  4HB2 B;  4KAX B;  3OHM B;  1AQC A;  4KHB A;  2J59 M;  1DRO A;  3TCA A;  2K2U A;  4A6F B;  1PFJ A;  4HAV B;  3PVW A;  2DTC A;  2RRF A;  2I5F A;  3TW1 A;  2AEH A;  2YT2 A;  3HW2 B;  5J3T A;  4ZRK A;  5D27 A;  5DHA B;  2P0D A;  3AU5 A;  5I2S A;  1NU2 A;  3DXD A;  5LON B;  4TYZ A;  5LG4 B;  4C0A A;  3VOQ A;  1MIZ B;  4QXA B;  4GXB A;  2J0J A;  2LKO A;  2ZPY A;  5DI9 B;  2NZ8 B;  3D8D A;  1X1G A;  2DLW A;  2DKQ A;  2D10 A;  3HIE A;  1OY2 A;  1U5G A;  5FI0 A;  2LG1 A;  1E5W A;  3NWA A;  4WSF A;  4BBK A;  4F7G A;  1W1H A;  4YON A;  3ZVR A;  3ODO A;  1DBH A;  1W1G A;  4MT7 A;  2YT1 A;  2CRF A;  3T06 A;  1FHW A;  4HAX B;  1U5F A;  4DIX A;  1K5D B;  4GMX B;  2EC1 A;  3A58 A;  2P0F A;  1XOD A;  1KZ7 A;  1RRP B;  4IOY X;  2L2I A;  4MY6 A;  2H7E A;  3AJ4 A;  2RSG A;  2R2Y A;  1QQG A;  1V88 A;  2MKR A;  3ZDT A;  1XKE A;  5J3Y A;  4K2P A;  4DBB A;  2EMT A;  1BWN A;  1BAK A;  1QC6 A;  2N0Y A;  2XQN M;  4HHV A;  2M14 A;  1IRS A;  5CLQ B;  4QJ3 B;  4HB3 B;  1DDM A;  2YS5 A;  3LJU X;  5LOP B;  2OQB A;  2ELA A;  3ULB A;  2GCL A;  4KHB B;  1FB8 A;  2W2X D;  3PVU A;  4L6E A;  4A6H A;  1MI1 A;  2VKI A;  2CAY A;  1J0W A;  4CSQ A;  4GZU A;  2Y8G A;  1U29 A;  2PZ1 A;  4HB4 B;  1Y5O A;  2FJL A;  1X1F A;  4Z2N A;  1P6S A;  5C16 A;  3QBV B;  2RLO A;  4K17 A;  4D0N B;  4F7U P;  5DHF B;  3FM8 C;  1KI1 B;  4IFS A;  2GUM A;  2IFS A;  1NTY A;  2DHK A;  2D9Y A;  3KSY A;  2QKL A;  3A98 B;  1Z87 A;  3NSU A;  4HB0 B;  3QWM A;  2UVM A;  1NI2 A;  4EMO A;  3B77 A;  3AU4 A;  3ULC A;  1PMS A;  2Z0P A;  1LW3 A;  2X18 A;  4HAW B;  2COD A;  2GJY A;  2UZS A;  1EAZ A;  3UZT A;  1LB1 A;  4D6W A;  1MK9 B;  1B55 A;  5I2M A;  4HDQ A;  3N7C A;  2K8E A;  2ROV A;  4QJ4 B;  4XWX A;  1XX0 A;  5C5B A;  1M7E A;  2P8V A;  3A8Q A;  3F0W A;  1DYN A;  4HAZ B;  1SGH A;  4KVG B;  2YVC A;  3V5W A;  4GMV A;  2LOX A;  1EGX A;  2Z4D A;  2NMB A;  2KIE A;  1M7R A;  1UPR A;  3VIA A;  2H7D A;  4HSI A;  1U5E A;  3HQC A;  4NY0 A;  4ZRJ A;  4L1R A;  2YRY A;  4WVF B;  3GYO A;  2EMS A;  2NBV A;  4HAT B;  5HE0 A;  1Y19 B;  4KHO A;  2Z59 A;  2Y7B A;  1V89 A;  2KUQ A;  4GN1 A;  3KRW A;  5JHH A;  1OMW A;  2RUK B;  2YSZ A;  5DIF B;  1MPH A;  3D8F A;  3P7Z A;  1SHC A;  1XD4 A;  2R0D A;  2DX5 A;  1TJ6 A;  1TQZ A;  1K5G B;  1PLS A;  3PEG A;  2I5C A;  3ODW A;  5KCV A;  2D9W A;  4GPT B;  2RVB B;  1FAO A;  1UEF A;  2YT0 A;  2Y8F A;  3CXB B;  2RGN B;  3MPX A;  5JLJ B;  1FOE A;  1ISN A;  2OTX A;  5KQ1 A;  2FJU B;  3SV1 A;  3SNH A;  2G35 A;  3TFM A;  2QKM A;  5JP4 A;  2COA A;  2CY4 A;  1ZVR A;  5C5B B;  2HE7 A;  1FHO A;  1UNP A;  5CLL B;  4KHA A;  5HE3 A;  1DDV A;  1WGQ A;  5C79 A;  2VSZ A;  3SO6 A;  1ZYI A;  5EFX A;  3HK0 A;  1ZC3 B;  2KUP A;  1ZM0 A;  2K2J A;  5C6R A;  5D3Y A;  2BCJ A;  4DX9 0;  5KQ4 A;  3IVF A;  1H10 A;  5D3X A;  2J0K A;  1U2B A;  4GNK B;  1N3H A;  4MK0 A;  3KZ1 A;  2DKP A;  1J19 A;  4K81 A;  4P7I A;  4A6K A;  1TXD A;  2DHJ A;  4QJ5 B;  1BTN A;  3FVC A;  3X23 A;  3KY9 A;  2D9X A;  3NW8 A;  4OT1 A;  2V76 A;  2W2X C;  2HTH B;  2K49 A;  3TO1 A;  2MWN B;  2MDX A;  4DXA B;  3HSA A;  4CYE A;  1X11 A;  2J0M A;  2CY5 A;  2COF A; 
#chains in the Genus database with same CATH homology
 1MKE A;  2EJ8 A;  2L1C A;  2D9V A;  4EJN A;  2DX1 A;  2Z0Q A;  3PZD A;  3O96 A;  1MIX A;  4B6H A;  1GG3 A;  2KCJ A;  1NTV A;  4TKN A;  4WJ7 A;  2YF0 A;  2COC A;  3OAN A;  1UNR A;  2LOZ A;  3WYF B;  1WG7 A;  1W1D A;  4HDO A;  2AL6 A;  3KRX A;  1FGZ A;  2Z0O A;  4PQ0 A;  3U8Z A;  1XR0 B;  5HE1 A;  3PG7 A;  1U5D A;  1WJ1 A;  5D3W A;  4CHJ A;  3ML4 A;  2DHI A;  3G9W A;  1H4R A;  2RNR B;  2E2X A;  4YL8 A;  1ZSQ A;  5FI1 A;  3ODX A;  1MK7 B;  3PVL A;  3RCP A;  4CHM A;  1UNQ A;  3P6A A;  1KZG A;  2DN6 A;  1U27 A;  3U7D A;  2D4Q A;  1FHX A;  3A8P A;  4A5K A;  1RJ2 A;  2DA0 A;  1DDW A;  2DYN A;  5D3V A;  2YS3 A;  1FGY A;  5DH9 B;  3BIN A;  1GC6 A;  2IYB A;  2W2W A;  3TVV A;  4A6F A;  2DFK A;  2Q13 A;  2KGX B;  1V61 A;  4HAU B;  4K2O A;  2GS0 A;  1ZC4 B;  2D9Z A;  1V5P A;  2ADZ A;  1P5T A;  2LUL A;  1GC7 A;  4F7H A;  4IAP A;  1WVH A;  3QIJ A;  2I1K A;  2VRW B;  2JP2 A;  3MDB C;  3F5R A;  2GCJ A;  3PP2 A;  4NSW A;  1BTK A;  3FSS A;  2YS1 A;  2ELB A;  3PSC A;  2D2Q A;  2R09 A;  1I2H A;  2I1J A;  4Z2M B;  3D8E A;  5J3Q A;  5L81 A;  1WI1 A;  2D11 A;  5JHG A;  1P3R A;  4DX8 A;  2UZR A;  1WJM A;  2M38 A;  2K00 A;  1EF1 A;  2ROZ B;  5HE2 A;  1I7A A;  4HAY B;  3GYP A;  4EKU A;  1V5U A;  1EVH A;  1AWE A;  1X86 A;  3CIK A;  1UPQ A;  1XCG A;  2N23 A;  1WGU A;  1Q67 A;  1OQN A;  3SUZ A;  2MFQ A;  3DXE A;  1MAI A;  2P0H A;  3M1I B;  4PNK A;  3WA0 A;  3BJI A;  2DYQ A;  4H8S A;  3SYX A;  2LYD A;  1V5M A;  4Y94 A;  1X05 A;  4ZRI A;  3DXC A;  5GOW B;  3FEH A;  4HB2 B;  4KAX B;  1AQC A;  2J59 M;  1DRO A;  3TCA A;  2K2U A;  4A6F B;  1PFJ A;  4HAV B;  3PVW A;  2DTC A;  2I5F A;  3TW1 A;  2AEH A;  3HW2 B;  5J3T A;  4ZRK A;  5D27 A;  5DHA B;  2P0D A;  3AU5 A;  1NU2 A;  3DXD A;  5LON B;  4TYZ A;  4C0A A;  3VOQ A;  1MIZ B;  4GXB A;  2J0J A;  2LKO A;  2ZPY A;  5DI9 B;  2NZ8 B;  3D8D A;  1X1G A;  2DLW A;  2DKQ A;  2D10 A;  1OY2 A;  1U5G A;  5FI0 A;  2LG1 A;  1E5W A;  4WSF A;  4BBK A;  4F7G A;  1W1H A;  4YON A;  3ZVR A;  3ODO A;  1DBH A;  1W1G A;  4MT7 A;  2YT1 A;  2CRF A;  3T06 A;  1FHW A;  4HAX B;  1U5F A;  1K5D B;  4GMX B;  2EC1 A;  2P0F A;  1XOD A;  1KZ7 A;  1RRP B;  4IOY X;  2L2I A;  4MY6 A;  2H7E A;  3AJ4 A;  2RSG A;  1QQG A;  1V88 A;  2MKR A;  3ZDT A;  1XKE A;  5J3Y A;  4K2P A;  4DBB A;  2EMT A;  1BWN A;  1BAK A;  1QC6 A;  2N0Y A;  2XQN M;  4HHV A;  2M14 A;  1IRS A;  5CLQ B;  4HB3 B;  1DDM A;  2YS5 A;  3LJU X;  5LOP B;  2OQB A;  2ELA A;  3ULB A;  2GCL A;  4KHB B;  1FB8 A;  2W2X D;  3PVU A;  4L6E A;  4A6H A;  2VKI A;  2CAY A;  1J0W A;  4GZU A;  2Y8G A;  1U29 A;  2PZ1 A;  4HB4 B;  1Y5O A;  2FJL A;  1X1F A;  4Z2N A;  1P6S A;  5C16 A;  3QBV B;  2RLO A;  4K17 A;  4D0N B;  4F7U P;  5DHF B;  3FM8 C;  1KI1 B;  4IFS A;  2IFS A;  1NTY A;  2DHK A;  2D9Y A;  3KSY A;  2QKL A;  3A98 B;  1Z87 A;  3NSU A;  4HB0 B;  3QWM A;  2UVM A;  1NI2 A;  4EMO A;  3AU4 A;  3ULC A;  1PMS A;  2Z0P A;  1LW3 A;  2X18 A;  4HAW B;  2COD A;  2GJY A;  2UZS A;  1EAZ A;  3UZT A;  1LB1 A;  1MK9 B;  1B55 A;  4HDQ A;  3N7C A;  2ROV A;  4XWX A;  1XX0 A;  5C5B A;  1M7E A;  2P8V A;  3A8Q A;  3F0W A;  1DYN A;  4HAZ B;  1SGH A;  4KVG B;  2YVC A;  3V5W A;  4GMV A;  2LOX A;  1EGX A;  2NMB A;  1M7R A;  1UPR A;  3VIA A;  2H7D A;  1U5E A;  3HQC A;  4NY0 A;  4ZRJ A;  2YRY A;  4WVF B;  3GYO A;  2EMS A;  4HAT B;  5HE0 A;  1Y19 B;  4KHO A;  2Y7B A;  1V89 A;  4GN1 A;  3KRW A;  5JHH A;  1OMW A;  2RUK B;  2YSZ A;  5DIF B;  1MPH A;  3D8F A;  3P7Z A;  1SHC A;  1XD4 A;  2R0D A;  2DX5 A;  1TJ6 A;  1TQZ A;  1K5G B;  1PLS A;  3PEG A;  2I5C A;  3ODW A;  5KCV A;  2D9W A;  4GPT B;  2RVB B;  1FAO A;  1UEF A;  2YT0 A;  2Y8F A;  3CXB B;  2RGN B;  3MPX A;  5JLJ B;  1FOE A;  1ISN A;  2OTX A;  5KQ1 A;  3SV1 A;  3SNH A;  2G35 A;  3TFM A;  2QKM A;  5JP4 A;  2COA A;  2CY4 A;  1ZVR A;  5C5B B;  2HE7 A;  1FHO A;  1UNP A;  5CLL B;  4KHA A;  5HE3 A;  1DDV A;  1WGQ A;  5C79 A;  2VSZ A;  3SO6 A;  5EFX A;  3HK0 A;  1ZC3 B;  2KUP A;  1ZM0 A;  2K2J A;  5C6R A;  5D3Y A;  2BCJ A;  4DX9 0;  5KQ4 A;  3IVF A;  1H10 A;  5D3X A;  2J0K A;  1U2B A;  1N3H A;  4MK0 A;  3KZ1 A;  2DKP A;  1J19 A;  4K81 A;  4P7I A;  4A6K A;  1TXD A;  2DHJ A;  1BTN A;  3X23 A;  3KY9 A;  2D9X A;  2V76 A;  2W2X C;  2HTH B;  3TO1 A;  2MWN B;  2MDX A;  4DXA B;  4CYE A;  1X11 A;  2J0M A;  2CY5 A;  2COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...