2COFA

Solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GSSGSSGLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein KIAA1914
publication title Solution structure of the C-terminal PH domain of hypothetical protein KIAA1914 from human
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cofA00
3V5WA 2DX1A 3CXBB 1PMSA 3ULBA 2XQNM 3DXCA 1UNRA 1MIXA 1U5FA 1BAKA 5D27A 2EMSA 4YL8A 2N0YA 4A5KA 1V61A 5DHFB 1BTKA 5D3VA 5CLQB 2DHIA 4CYEA 1UNPA 5C5BB 5C6RA 4P7IA 3ML4A 5HE3A 1V5PA 2DKPA 2MKRA 5D3YA 2D10A 1BWNA 4GXBA 3FEHA 5HE2A 2GS0A 2H7DA 2J0MA 3CIKA 3PVUA 1MIZB 2YF0A 1FHXA 1XR0B 1TQZA 1MAIA 4HB4B 4HHVA 1X1FA 2UZRA 1V5UA 2CY4A 2DLWA 2W2WA 1KZ7A 1NI2A 1OQNA 5D3XA 2LULA 2QKLA 1NTYA 2DX5A 2ELBA 2J59M 1NU2A 1I2HA 1B55A 2LOZA 2W2XD 1OY2A 2OTXA 1Y19B 4MY6A 2LYDA 2L1CA 1FGYA 2V76A 4MK0A 3KY9A 4TYZA 2DFKA 4A6KA 5C79A 5JHHA 1AWEA 2YT0A 2YRYA 2YS1A 5LONB 2Y8FA 1X05A 1MK7B 2K2JA 3RCPA 3PP2A 2L2IA 1EGXA 1H4RA 4HAZB 4WSFA 2DA0A 2YT1A 2KUPA 4HATB 5J3YA 4CHMA 1WI1A 2ROZB 4ZRIA 2K00A 1N3HA 3TO1A 4IAPA 2QKMA 3QBVB 1QC6A 1WG7A 3UZTA 1QQGA 1MKEA 2D4QA 2D9VA 1UPRA 3D8EA 2ADZA 4DX8A 4HAVB 1U2BA 4KHBB 1GC6A 3DXEA 4D0NB 2D9WA 2P0DA 2D11A 5KQ4A 3AU5A 3M1IB 4HB2B 5FI0A 2D2QA 5DI9B 4DX90 2W2XC 2D9YA 2I5FA 4WVFB 3X23A 2LOXA 1P6SA 1KZGA 2MWNB 2AL6A 4KAXB 3TFMA 4BBKA 2UZSA 3TCAA 1M7RA 3MPXA 2MDXA 4F7UP 1Z87A 1RRPB 1U27A 2IYBA 5EFXA 2GCJA 2HE7A 1TJ6A 2RVBB 3BINA 1W1GA 3NSUA 5DH9B 3O96A 3P7ZA 2VRWB 2I1JA 1EAZA 2RSGA 2AEHA 3SUZA 4ZRKA 4A6HA 3SO6A 2HTHB 2ZPYA 1WGUA 4A6FB 1XX0A 5JLJB 1RJ2A 1PFJA 3D8DA 4XWXA 3U7DA 1ZC3B 3TW1A 2Z0QA 3PVWA 1V89A 1Y5OA 1KI1B 5HE0A 3ODWA 4HAXB 1V5MA 1XODA 2DKQA 3D8FA 3WYFB 5DHAB 3ULCA 2DYNA 4K17A 1X1GA 2CODA 1DBHA 2EMTA 3F0WA 3GYPA 4HB3B 2J0JA 3HQCA 5C5BA 3PSCA 2P0FA 1E5WA 4HB0B 4K81A 2GJYA 4CHJA 1ZC4B 4GPTB 1V88A 2DN6A 5JP4A 3SNHA 2DHKA 4NY0A 1EVHA 3BJIA 2OQBA 2Y8GA 3U8ZA 2EJ8A 5DIFB 3A8PA 5L81A 2RGNB 1DROA 4GZUA 2VSZA 4NSWA 5J3TA 1H10A 2J0KA 4A6FA 4HDOA 4C0AA 4HAYB 2YS5A 1P3RA 3MDBC 4YONA 2ROVA 5CLLB 5J3QA 1BTNA 3F5RA 1X11A 2COFA 1UPQA 2H7EA 1W1DA 3DXDA 3KRXA 3AJ4A 2BCJA 4DBBA 1SGHA 1DDMA 3WA0A 4L6EA 3FSSA 2K2UA 3P6AA 2D9XA 4B6HA 4HAWB 1U5DA 1NTVA 4IFSA 3N7CA 3PZDA 1AQCA 4F7HA 3TVVA 1GC7A 2COAA 1UEFA 1UNQA 3QIJA 2CAYA 2LG1A 2X18A 2I1KA 2DYQA 3VIAA 1U29A 1ZSQA 2CRFA 2DHJA 2NMBA 3SYXA 5JHGA 1DDWA 3ZVRA 2Y7BA 1FAOA 1Q67A 4KVGB 2DTCA 3HK0A 3LJUX 1X86A 1J0WA 4Y94A 4F7GA 1FOEA 3AU4A 1DDVA 4PNKA 1FHOA 1I7AA 1XCGA 5KQ1A 3ODXA 5HE1A 4HAUB 1WJMA 5FI1A 4IOYX 1PLSA 1OMWA 3OANA 2GCLA 2I5CA 4EMOA 4EJNA 2JP2A 4K2OA 2P0HA 3G9WA 4MT7A 3GYOA 2YSZA 3PG7A 2VKIA 3PEGA 4KHAA 2EC1A 2FJLA 3A98B 4K2PA 2NZ8B 4DXAB 2RLOA 4GMVA 1WJ1A 4GMXB 2ELAA 4Z2NA 2RUKB 1W1HA 2M38A 1ZM0A 4GN1A 3KZ1A 1ISNA 2Q13A 1GG3A 4PQ0A 1J19A 1IRSA 1FGZA 3KSYA 3VOQA 4ZRJA 5GOWB 4KHOA 4TKNA 1K5DB 1XD4A 3A8QA 1U5GA 1WGQA 3FM8C 2LKOA 2KGXB 1SHCA 3QWMA 2COCA 2R0DA 4EKUA 5C16A 1K5GB 5LOPB 3HW2B 2PZ1A 1M7EA 3SV1A 2IFSA 2E2XA 1WVHA 2MFQA 1P5TA 1XKEA 3ZDTA 2P8VA 4HDQA 2D9ZA 5D3WA 1FHWA 3T06A 2KCJA 2R09A 1MK9B 2RNRB 2UVMA 1ZVRA 2Z0OA 2G35A 2N23A 1EF1A 1LW3A 1U5EA 1MPHA 1LB1A 2YS3A 1TXDA 2Z0PA 3IVFA 3PVLA 2CY5A 1DYNA 1FB8A 2M14A 3KRWA 2YVCA 4Z2MB 5KCVA 4WJ7A 3ODOA 4H8SA
chains in the Genus database with same CATH superfamily
3V5WA 2DX1A 3CXBB 1PMSA 3ULBA 2XQNM 3DXCA 1UNRA 1MIXA 2K49A 1U5FA 1BAKA 5D27A 1T77A 2EMSA 4YL8A 2N0YA 4A5KA 1V61A 5DHFB 2KUQA 4OT1A 1BTKA 5D3VA 5CLQB 2DHIA 4CYEA 1UNPA 5C5BB 5C6RA 4P7IA 3ML4A 5HE3A 1V5PA 2FJUB 2DKPA 2MKRA 5D3YA 2D10A 1BWNA 4GXBA 3FEHA 5HE2A 2GS0A 2H7DA 4GOUA 2J0MA 3CIKA 3PVUA 1MIZB 2YF0A 1FHXA 1XR0B 1TQZA 1MAIA 4HB4B 4HHVA 1X1FA 2UZRA 1V5UA 2CY4A 2DLWA 2W2WA 1KZ7A 4L1RA 1NI2A 1OQNA 5D3XA 2LULA 2QKLA 1NTYA 2DX5A 2ELBA 2J59M 1NU2A 1I2HA 1B55A 2LOZA 2W2XD 1OY2A 2OTXA 1Y19B 4MY6A 2LYDA 2L1CA 1FGYA 2V76A 4MK0A 3KY9A 4TYZA 2DFKA 4A6KA 5C79A 5JHHA 1AWEA 2YT0A 2YRYA 2YS1A 5LONB 2Y8FA 1X05A 1MK7B 2K2JA 2NBVA 3RCPA 3PP2A 2L2IA 1EGXA 1H4RA 4HAZB 4WSFA 2DA0A 2YT1A 2KUPA 4HATB 5J3YA 2K8EA 4CHMA 1WI1A 2ROZB 4ZRIA 2K00A 4OSNA 1N3HA 3TO1A 4IAPA 2QKMA 3QBVB 1QC6A 5M4YB 1WG7A 3UZTA 1QQGA 1MKEA 2D4QA 2D9VA 2RRFA 1UPRA 3D8EA 2ADZA 4DX8A 4HAVB 1U2BA 4KHBB 1GC6A 3DXEA 4D0NB 2D9WA 2P0DA 2D11A 5KQ4A 3AU5A 3M1IB 4HB2B 2R2YA 5FI0A 2D2QA 5DI9B 4DX90 2W2XC 2D9YA 2I5FA 4WVFB 3X23A 2LOXA 1P6SA 2KIGA 1KZGA 2MWNB 2AL6A 4KAXB 2YT2A 3TFMA 4BBKA 2UZSA 3TCAA 1M7RA 2MDXA 3MPXA 4F7UP 1Z87A 1RRPB 4D6WA 1U27A 2IYBA 5EFXA 4CSQA 2GCJA 2HE7A 1TJ6A 2RVBB 3DCXA 3BINA 1W1GA 3NSUA 5LG4B 5DH9B 3O96A 3P7ZA 2VRWB 2I1JA 1EAZA 4KHBA 2RSGA 2AEHA 3SUZA 4ZRKA 4A6HA 3SO6A 2HTHB 4QJ4B 2ZPYA 1WGUA 4A6FB 1XX0A 5JLJB 1RJ2A 1PFJA 3D8DA 4XWXA 3U7DA 1ZC3B 3TW1A 2Z0QA 3PVWA 1V89A 3NW8A 1Y5OA 1KI1B 5HE0A 3ODWA 4HAXB 3HSAA 1V5MA 1XODA 2DKQA 3D8FA 3WYFB 5DHAB 3ULCA 2DYNA 4K17A 1X1GA 2CODA 3U12A 1DBHA 2EMTA 3F0WA 3GYPA 4HB3B 2J0JA 3HQCA 5C5BA 3PSCA 2P0FA 1E5WA 4HB0B 5IRSA 4K81A 2GJYA 4CHJA 1ZC4B 4GPTB 1V88A 2DN6A 3HIEA 3NWFA 5JP4A 3SNHA 2DHKA 4NY0A 1EVHA 3BJIA 2OQBA 2Y8GA 3U8ZA 2EJ8A 3B77A 5DIFB 3A8PA 5L81A 3OHMB 2RGNB 2Z13A 1DROA 4GZUA 2VSZA 1MI1A 4NSWA 5J3TA 1H10A 2J0KA 4A6FA 4HDOA 4C0AA 4HAYB 2YS5A 1P3RA 3MDBC 4YONA 2ROVA 5CLLB 4DIXA 5J3QA 1BTNA 3F5RA 1X11A 2COFA 1UPQA 1ZYIA 2H7EA 1W1DA 3DXDA 3KRXA 3AJ4A 2BCJA 4DBBA 1SGHA 1DDMA 3WA0A 4L6EA 3FSSA 2K2UA 3P6AA 2D9XA 4B6HA 4HAWB 1U5DA 1NTVA 4IFSA 3N7CA 5I2SA 3PZDA 1AQCA 3NWDA 4F7HA 3TVVA 1GC7A 2COAA 4QJ3B 1UEFA 2ZKMX 1UNQA 3QIJA 4HSIA 2CAYA 2LG1A 2X18A 2Z4DA 2I1KA 2DYQA 3VIAA 1U29A 1ZSQA 2CRFA 2DHJA 2NMBA 3SYXA 5JHGA 1DDWA 3ZVRA 2Y7BA 1FAOA 1Q67A 4KVGB 2DTCA 2KIEA 3HK0A 3LJUX 1X86A 1J0WA 4Y94A 4F7GA 1FOEA 3AU4A 1DDVA 4PNKA 1FHOA 1I7AA 1XCGA 5KQ1A 3ODXA 5HE1A 4HAUB 1WJMA 5FI1A 4IOYX 3A58A 1PLSA 1OMWA 3OANA 5I2MA 2GCLA 2I5CA 4EMOA 4EJNA 2JP2A 4QXAB 4K2OA 2P0HA 3G9WA 4MT7A 3GYOA 3FVCA 2YSZA 3PG7A 2VKIA 3PEGA 4KHAA 2EC1A 2FJLA 3A98B 4K2PA 2NZ8B 4QJ5B 4DXAB 2RLOA 4GMVA 2KR0A 1WJ1A 2Z59A 4GMXB 2ELAA 2GUMA 4Z2NA 2RUKB 1W1HA 2M38A 1ZM0A 4GN1A 3KZ1A 2Z14A 1ISNA 2Q13A 1GG3A 4PQ0A 1J19A 1IRSA 1FGZA 3KSYA 3VOQA 4ZRJA 5GOWB 4KHOA 4TKNA 1K5DB 1XD4A 3A8QA 1U5GA 1WGQA 3FM8C 2LKOA 2KGXB 1SHCA 3QWMA 2COCA 2R0DA 4EKUA 5C16A 1K5GB 5LOPB 3HW2B 2PZ1A 1M7EA 3SV1A 4GNKB 2IFSA 2E2XA 1WVHA 2MFQA 1P5TA 1XKEA 3ZDTA 2P8VA 4HDQA 2D9ZA 5D3WA 1FHWA 3T06A 2KCJA 2R09A 1MK9B 2RNRB 2UVMA 1ZVRA 2Z0OA 2G35A 2N23A 1EF1A 1LW3A 1U5EA 1MPHA 1LB1A 2YS3A 1TXDA 2Z0PA 3IVFA 3PVLA 2CY5A 1DYNA 1FB8A 2M14A 3KRWA 2YVCA 4Z2MB 5KCVA 3NWAA 4WJ7A 3ODOA 4H8SA
chains in the Genus database with same CATH topology
3V5WA 2DX1A 3CXBB 1PMSA 3ULBA 2XQNM 3DXCA 1UNRA 1MIXA 1U5FA 1BAKA 5D27A 2EMSA 4YL8A 2N0YA 4A5KA 1V61A 5DHFB 1BTKA 5D3VA 5CLQB 2DHIA 4CYEA 1UNPA 5C5BB 5C6RA 4P7IA 3ML4A 5HE3A 1V5PA 2DKPA 2MKRA 5D3YA 2D10A 1BWNA 4GXBA 3FEHA 5HE2A 2GS0A 2H7DA 2J0MA 3CIKA 3PVUA 1MIZB 2YF0A 1FHXA 1XR0B 1TQZA 1MAIA 4HB4B 4HHVA 1X1FA 2UZRA 1V5UA 2CY4A 2DLWA 2W2WA 1KZ7A 1NI2A 1OQNA 5D3XA 2LULA 2QKLA 1NTYA 2DX5A 2ELBA 2J59M 1NU2A 1I2HA 1B55A 2LOZA 2W2XD 1OY2A 2OTXA 1Y19B 4MY6A 2LYDA 2L1CA 1FGYA 2V76A 4MK0A 3KY9A 4TYZA 2DFKA 4A6KA 5C79A 5JHHA 1AWEA 2YT0A 2YRYA 2YS1A 5LONB 2Y8FA 1X05A 1MK7B 2K2JA 3RCPA 3PP2A 2L2IA 1EGXA 1H4RA 4HAZB 4WSFA 2DA0A 2YT1A 2KUPA 4HATB 5J3YA 4CHMA 1WI1A 2ROZB 4ZRIA 2K00A 1N3HA 3TO1A 4IAPA 2QKMA 3QBVB 1QC6A 1WG7A 3UZTA 1QQGA 1MKEA 2D4QA 2D9VA 1UPRA 3D8EA 2ADZA 4DX8A 4HAVB 1U2BA 4KHBB 1GC6A 3DXEA 4D0NB 2D9WA 2P0DA 2D11A 5KQ4A 3AU5A 3M1IB 4HB2B 5FI0A 2D2QA 5DI9B 4DX90 2W2XC 2D9YA 2I5FA 4WVFB 3X23A 2LOXA 1P6SA 1KZGA 2MWNB 2AL6A 4KAXB 3TFMA 4BBKA 2UZSA 3TCAA 1M7RA 3MPXA 2MDXA 4F7UP 1Z87A 1RRPB 1U27A 2IYBA 5EFXA 2GCJA 2HE7A 1TJ6A 2RVBB 3BINA 1W1GA 3NSUA 5DH9B 3O96A 3P7ZA 2VRWB 2I1JA 1EAZA 2RSGA 2AEHA 3SUZA 4ZRKA 4A6HA 3SO6A 2HTHB 2ZPYA 1WGUA 4A6FB 1XX0A 5JLJB 1RJ2A 1PFJA 3D8DA 4XWXA 3U7DA 1ZC3B 3TW1A 2Z0QA 3PVWA 1V89A 1Y5OA 1KI1B 5HE0A 3ODWA 4HAXB 1V5MA 1XODA 2DKQA 3D8FA 3WYFB 5DHAB 3ULCA 2DYNA 4K17A 1X1GA 2CODA 1DBHA 2EMTA 3F0WA 3GYPA 4HB3B 2J0JA 3HQCA 5C5BA 3PSCA 2P0FA 1E5WA 4HB0B 4K81A 2GJYA 4CHJA 1ZC4B 4GPTB 1V88A 2DN6A 5JP4A 3SNHA 2DHKA 4NY0A 1EVHA 3BJIA 2OQBA 2Y8GA 3U8ZA 2EJ8A 5DIFB 3A8PA 5L81A 2RGNB 1DROA 4GZUA 2VSZA 4NSWA 5J3TA 1H10A 2J0KA 4A6FA 4HDOA 4C0AA 4HAYB 2YS5A 1P3RA 3MDBC 4YONA 2ROVA 5CLLB 5J3QA 1BTNA 3F5RA 1X11A 2COFA 1UPQA 2H7EA 1W1DA 3DXDA 3KRXA 3AJ4A 2BCJA 4DBBA 1SGHA 1DDMA 3WA0A 4L6EA 3FSSA 2K2UA 3P6AA 2D9XA 4B6HA 4HAWB 1U5DA 1NTVA 4IFSA 3N7CA 3PZDA 1AQCA 4F7HA 3TVVA 1GC7A 2COAA 1UEFA 1UNQA 3QIJA 2CAYA 2LG1A 2X18A 2I1KA 2DYQA 3VIAA 1U29A 1ZSQA 2CRFA 2DHJA 2NMBA 3SYXA 5JHGA 1DDWA 3ZVRA 2Y7BA 1FAOA 1Q67A 4KVGB 2DTCA 3HK0A 3LJUX 1X86A 1J0WA 4Y94A 4F7GA 1FOEA 3AU4A 1DDVA 4PNKA 1FHOA 1I7AA 1XCGA 5KQ1A 3ODXA 5HE1A 4HAUB 1WJMA 5FI1A 4IOYX 1PLSA 1OMWA 3OANA 2GCLA 2I5CA 4EMOA 4EJNA 2JP2A 4K2OA 2P0HA 3G9WA 4MT7A 3GYOA 2YSZA 3PG7A 2VKIA 3PEGA 4KHAA 2EC1A 2FJLA 3A98B 4K2PA 2NZ8B 4DXAB 2RLOA 4GMVA 1WJ1A 4GMXB 2ELAA 4Z2NA 2RUKB 1W1HA 2M38A 1ZM0A 4GN1A 3KZ1A 1ISNA 2Q13A 1GG3A 4PQ0A 1J19A 1IRSA 1FGZA 3KSYA 3VOQA 4ZRJA 5GOWB 4KHOA 4TKNA 1K5DB 1XD4A 3A8QA 1U5GA 1WGQA 3FM8C 2LKOA 2KGXB 1SHCA 3QWMA 2COCA 2R0DA 4EKUA 5C16A 1K5GB 5LOPB 3HW2B 2PZ1A 1M7EA 3SV1A 2IFSA 2E2XA 1WVHA 2MFQA 1P5TA 1XKEA 3ZDTA 2P8VA 4HDQA 2D9ZA 5D3WA 1FHWA 3T06A 2KCJA 2R09A 1MK9B 2RNRB 2UVMA 1ZVRA 2Z0OA 2G35A 2N23A 1EF1A 1LW3A 1U5EA 1MPHA 1LB1A 2YS3A 1TXDA 2Z0PA 3IVFA 3PVLA 2CY5A 1DYNA 1FB8A 2M14A 3KRWA 2YVCA 4Z2MB 5KCVA 4WJ7A 3ODOA 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5W A;  2DX1 A;  3CXB B;  1PMS A;  3ULB A;  2XQN M;  3DXC A;  1UNR A;  1MIX A;  1U5F A;  1BAK A;  5D27 A;  2EMS A;  4YL8 A;  2N0Y A;  4A5K A;  1V61 A;  5DHF B;  1BTK A;  5D3V A;  5CLQ B;  2DHI A;  4CYE A;  1UNP A;  5C5B B;  5C6R A;  4P7I A;  3ML4 A;  5HE3 A;  1V5P A;  2DKP A;  2MKR A;  5D3Y A;  2D10 A;  1BWN A;  4GXB A;  3FEH A;  5HE2 A;  2GS0 A;  2H7D A;  2J0M A;  3CIK A;  3PVU A;  1MIZ B;  2YF0 A;  1FHX A;  1XR0 B;  1TQZ A;  1MAI A;  4HB4 B;  4HHV A;  1X1F A;  2UZR A;  1V5U A;  2CY4 A;  2DLW A;  2W2W A;  1KZ7 A;  1NI2 A;  1OQN A;  5D3X A;  2LUL A;  2QKL A;  1NTY A;  2DX5 A;  2ELB A;  2J59 M;  1NU2 A;  1I2H A;  1B55 A;  2LOZ A;  2W2X D;  1OY2 A;  2OTX A;  1Y19 B;  4MY6 A;  2LYD A;  2L1C A;  1FGY A;  2V76 A;  4MK0 A;  3KY9 A;  4TYZ A;  2DFK A;  4A6K A;  5C79 A;  5JHH A;  1AWE A;  2YT0 A;  2YRY A;  2YS1 A;  5LON B;  2Y8F A;  1X05 A;  1MK7 B;  2K2J A;  3RCP A;  3PP2 A;  2L2I A;  1EGX A;  1H4R A;  4HAZ B;  4WSF A;  2DA0 A;  2YT1 A;  2KUP A;  4HAT B;  5J3Y A;  4CHM A;  1WI1 A;  2ROZ B;  4ZRI A;  2K00 A;  1N3H A;  3TO1 A;  4IAP A;  2QKM A;  3QBV B;  1QC6 A;  1WG7 A;  3UZT A;  1QQG A;  1MKE A;  2D4Q A;  2D9V A;  1UPR A;  3D8E A;  2ADZ A;  4DX8 A;  4HAV B;  1U2B A;  4KHB B;  1GC6 A;  3DXE A;  4D0N B;  2D9W A;  2P0D A;  2D11 A;  5KQ4 A;  3AU5 A;  3M1I B;  4HB2 B;  5FI0 A;  2D2Q A;  5DI9 B;  4DX9 0;  2W2X C;  2D9Y A;  2I5F A;  4WVF B;  3X23 A;  2LOX A;  1P6S A;  1KZG A;  2MWN B;  2AL6 A;  4KAX B;  3TFM A;  4BBK A;  2UZS A;  3TCA A;  1M7R A;  3MPX A;  2MDX A;  4F7U P;  1Z87 A;  1RRP B;  1U27 A;  2IYB A;  5EFX A;  2GCJ A;  2HE7 A;  1TJ6 A;  2RVB B;  3BIN A;  1W1G A;  3NSU A;  5DH9 B;  3O96 A;  3P7Z A;  2VRW B;  2I1J A;  1EAZ A;  2RSG A;  2AEH A;  3SUZ A;  4ZRK A;  4A6H A;  3SO6 A;  2HTH B;  2ZPY A;  1WGU A;  4A6F B;  1XX0 A;  5JLJ B;  1RJ2 A;  1PFJ A;  3D8D A;  4XWX A;  3U7D A;  1ZC3 B;  3TW1 A;  2Z0Q A;  3PVW A;  1V89 A;  1Y5O A;  1KI1 B;  5HE0 A;  3ODW A;  4HAX B;  1V5M A;  1XOD A;  2DKQ A;  3D8F A;  3WYF B;  5DHA B;  3ULC A;  2DYN A;  4K17 A;  1X1G A;  2COD A;  1DBH A;  2EMT A;  3F0W A;  3GYP A;  4HB3 B;  2J0J A;  3HQC A;  5C5B A;  3PSC A;  2P0F A;  1E5W A;  4HB0 B;  4K81 A;  2GJY A;  4CHJ A;  1ZC4 B;  4GPT B;  1V88 A;  2DN6 A;  5JP4 A;  3SNH A;  2DHK A;  4NY0 A;  1EVH A;  3BJI A;  2OQB A;  2Y8G A;  3U8Z A;  2EJ8 A;  5DIF B;  3A8P A;  5L81 A;  2RGN B;  1DRO A;  4GZU A;  2VSZ A;  4NSW A;  5J3T A;  1H10 A;  2J0K A;  4A6F A;  4HDO A;  4C0A A;  4HAY B;  2YS5 A;  1P3R A;  3MDB C;  4YON A;  2ROV A;  5CLL B;  5J3Q A;  1BTN A;  3F5R A;  1X11 A;  2COF A;  1UPQ A;  2H7E A;  1W1D A;  3DXD A;  3KRX A;  3AJ4 A;  2BCJ A;  4DBB A;  1SGH A;  1DDM A;  3WA0 A;  4L6E A;  3FSS A;  2K2U A;  3P6A A;  2D9X A;  4B6H A;  4HAW B;  1U5D A;  1NTV A;  4IFS A;  3N7C A;  3PZD A;  1AQC A;  4F7H A;  3TVV A;  1GC7 A;  2COA A;  1UEF A;  1UNQ A;  3QIJ A;  2CAY A;  2LG1 A;  2X18 A;  2I1K A;  2DYQ A;  3VIA A;  1U29 A;  1ZSQ A;  2CRF A;  2DHJ A;  2NMB A;  3SYX A;  5JHG A;  1DDW A;  3ZVR A;  2Y7B A;  1FAO A;  1Q67 A;  4KVG B;  2DTC A;  3HK0 A;  3LJU X;  1X86 A;  1J0W A;  4Y94 A;  4F7G A;  1FOE A;  3AU4 A;  1DDV A;  4PNK A;  1FHO A;  1I7A A;  1XCG A;  5KQ1 A;  3ODX A;  5HE1 A;  4HAU B;  1WJM A;  5FI1 A;  4IOY X;  1PLS A;  1OMW A;  3OAN A;  2GCL A;  2I5C A;  4EMO A;  4EJN A;  2JP2 A;  4K2O A;  2P0H A;  3G9W A;  4MT7 A;  3GYO A;  2YSZ A;  3PG7 A;  2VKI A;  3PEG A;  4KHA A;  2EC1 A;  2FJL A;  3A98 B;  4K2P A;  2NZ8 B;  4DXA B;  2RLO A;  4GMV A;  1WJ1 A;  4GMX B;  2ELA A;  4Z2N A;  2RUK B;  1W1H A;  2M38 A;  1ZM0 A;  4GN1 A;  3KZ1 A;  1ISN A;  2Q13 A;  1GG3 A;  4PQ0 A;  1J19 A;  1IRS A;  1FGZ A;  3KSY A;  3VOQ A;  4ZRJ A;  5GOW B;  4KHO A;  4TKN A;  1K5D B;  1XD4 A;  3A8Q A;  1U5G A;  1WGQ A;  3FM8 C;  2LKO A;  2KGX B;  1SHC A;  3QWM A;  2COC A;  2R0D A;  4EKU A;  5C16 A;  1K5G B;  5LOP B;  3HW2 B;  2PZ1 A;  1M7E A;  3SV1 A;  2IFS A;  2E2X A;  1WVH A;  2MFQ A;  1P5T A;  1XKE A;  3ZDT A;  2P8V A;  4HDQ A;  2D9Z A;  5D3W A;  1FHW A;  3T06 A;  2KCJ A;  2R09 A;  1MK9 B;  2RNR B;  2UVM A;  1ZVR A;  2Z0O A;  2G35 A;  2N23 A;  1EF1 A;  1LW3 A;  1U5E A;  1MPH A;  1LB1 A;  2YS3 A;  1TXD A;  2Z0P A;  3IVF A;  3PVL A;  2CY5 A;  1DYN A;  1FB8 A;  2M14 A;  3KRW A;  2YVC A;  4Z2M B;  5KCV A;  4WJ7 A;  3ODO A;  4H8S A; 
#chains in the Genus database with same CATH topology
 3V5W A;  2DX1 A;  3CXB B;  1PMS A;  3ULB A;  2XQN M;  3DXC A;  1UNR A;  1MIX A;  2K49 A;  1U5F A;  1BAK A;  5D27 A;  1T77 A;  2EMS A;  4YL8 A;  2N0Y A;  4A5K A;  1V61 A;  5DHF B;  2KUQ A;  4OT1 A;  1BTK A;  5D3V A;  5CLQ B;  2DHI A;  4CYE A;  1UNP A;  5C5B B;  5C6R A;  4P7I A;  3ML4 A;  5HE3 A;  1V5P A;  2FJU B;  2DKP A;  2MKR A;  5D3Y A;  2D10 A;  1BWN A;  4GXB A;  3FEH A;  5HE2 A;  2GS0 A;  2H7D A;  4GOU A;  2J0M A;  3CIK A;  3PVU A;  1MIZ B;  2YF0 A;  1FHX A;  1XR0 B;  1TQZ A;  1MAI A;  4HB4 B;  4HHV A;  1X1F A;  2UZR A;  1V5U A;  2CY4 A;  2DLW A;  2W2W A;  1KZ7 A;  4L1R A;  1NI2 A;  1OQN A;  5D3X A;  2LUL A;  2QKL A;  1NTY A;  2DX5 A;  2ELB A;  2J59 M;  1NU2 A;  1I2H A;  1B55 A;  2LOZ A;  2W2X D;  1OY2 A;  2OTX A;  1Y19 B;  4MY6 A;  2LYD A;  2L1C A;  1FGY A;  2V76 A;  4MK0 A;  3KY9 A;  4TYZ A;  2DFK A;  4A6K A;  5C79 A;  5JHH A;  1AWE A;  2YT0 A;  2YRY A;  2YS1 A;  5LON B;  2Y8F A;  1X05 A;  1MK7 B;  2K2J A;  2NBV A;  3RCP A;  3PP2 A;  2L2I A;  1EGX A;  1H4R A;  4HAZ B;  4WSF A;  2DA0 A;  2YT1 A;  2KUP A;  4HAT B;  5J3Y A;  2K8E A;  4CHM A;  1WI1 A;  2ROZ B;  4ZRI A;  2K00 A;  4OSN A;  1N3H A;  3TO1 A;  4IAP A;  2QKM A;  3QBV B;  1QC6 A;  5M4Y B;  1WG7 A;  3UZT A;  1QQG A;  1MKE A;  2D4Q A;  2D9V A;  2RRF A;  1UPR A;  3D8E A;  2ADZ A;  4DX8 A;  4HAV B;  1U2B A;  4KHB B;  1GC6 A;  3DXE A;  4D0N B;  2D9W A;  2P0D A;  2D11 A;  5KQ4 A;  3AU5 A;  3M1I B;  4HB2 B;  2R2Y A;  5FI0 A;  2D2Q A;  5DI9 B;  4DX9 0;  2W2X C;  2D9Y A;  2I5F A;  4WVF B;  3X23 A;  2LOX A;  1P6S A;  2KIG A;  1KZG A;  2MWN B;  2AL6 A;  4KAX B;  2YT2 A;  3TFM A;  4BBK A;  2UZS A;  3TCA A;  1M7R A;  2MDX A;  3MPX A;  4F7U P;  1Z87 A;  1RRP B;  4D6W A;  1U27 A;  2IYB A;  5EFX A;  4CSQ A;  2GCJ A;  2HE7 A;  1TJ6 A;  2RVB B;  3DCX A;  3BIN A;  1W1G A;  3NSU A;  5LG4 B;  5DH9 B;  3O96 A;  3P7Z A;  2VRW B;  2I1J A;  1EAZ A;  4KHB A;  2RSG A;  2AEH A;  3SUZ A;  4ZRK A;  4A6H A;  3SO6 A;  2HTH B;  4QJ4 B;  2ZPY A;  1WGU A;  4A6F B;  1XX0 A;  5JLJ B;  1RJ2 A;  1PFJ A;  3D8D A;  4XWX A;  3U7D A;  1ZC3 B;  3TW1 A;  2Z0Q A;  3PVW A;  1V89 A;  3NW8 A;  1Y5O A;  1KI1 B;  5HE0 A;  3ODW A;  4HAX B;  3HSA A;  1V5M A;  1XOD A;  2DKQ A;  3D8F A;  3WYF B;  5DHA B;  3ULC A;  2DYN A;  4K17 A;  1X1G A;  2COD A;  3U12 A;  1DBH A;  2EMT A;  3F0W A;  3GYP A;  4HB3 B;  2J0J A;  3HQC A;  5C5B A;  3PSC A;  2P0F A;  1E5W A;  4HB0 B;  5IRS A;  4K81 A;  2GJY A;  4CHJ A;  1ZC4 B;  4GPT B;  1V88 A;  2DN6 A;  3HIE A;  3NWF A;  5JP4 A;  3SNH A;  2DHK A;  4NY0 A;  1EVH A;  3BJI A;  2OQB A;  2Y8G A;  3U8Z A;  2EJ8 A;  3B77 A;  5DIF B;  3A8P A;  5L81 A;  3OHM B;  2RGN B;  2Z13 A;  1DRO A;  4GZU A;  2VSZ A;  1MI1 A;  4NSW A;  5J3T A;  1H10 A;  2J0K A;  4A6F A;  4HDO A;  4C0A A;  4HAY B;  2YS5 A;  1P3R A;  3MDB C;  4YON A;  2ROV A;  5CLL B;  4DIX A;  5J3Q A;  1BTN A;  3F5R A;  1X11 A;  2COF A;  1UPQ A;  1ZYI A;  2H7E A;  1W1D A;  3DXD A;  3KRX A;  3AJ4 A;  2BCJ A;  4DBB A;  1SGH A;  1DDM A;  3WA0 A;  4L6E A;  3FSS A;  2K2U A;  3P6A A;  2D9X A;  4B6H A;  4HAW B;  1U5D A;  1NTV A;  4IFS A;  3N7C A;  5I2S A;  3PZD A;  1AQC A;  3NWD A;  4F7H A;  3TVV A;  1GC7 A;  2COA A;  4QJ3 B;  1UEF A;  2ZKM X;  1UNQ A;  3QIJ A;  4HSI A;  2CAY A;  2LG1 A;  2X18 A;  2Z4D A;  2I1K A;  2DYQ A;  3VIA A;  1U29 A;  1ZSQ A;  2CRF A;  2DHJ A;  2NMB A;  3SYX A;  5JHG A;  1DDW A;  3ZVR A;  2Y7B A;  1FAO A;  1Q67 A;  4KVG B;  2DTC A;  2KIE A;  3HK0 A;  3LJU X;  1X86 A;  1J0W A;  4Y94 A;  4F7G A;  1FOE A;  3AU4 A;  1DDV A;  4PNK A;  1FHO A;  1I7A A;  1XCG A;  5KQ1 A;  3ODX A;  5HE1 A;  4HAU B;  1WJM A;  5FI1 A;  4IOY X;  3A58 A;  1PLS A;  1OMW A;  3OAN A;  5I2M A;  2GCL A;  2I5C A;  4EMO A;  4EJN A;  2JP2 A;  4QXA B;  4K2O A;  2P0H A;  3G9W A;  4MT7 A;  3GYO A;  3FVC A;  2YSZ A;  3PG7 A;  2VKI A;  3PEG A;  4KHA A;  2EC1 A;  2FJL A;  3A98 B;  4K2P A;  2NZ8 B;  4QJ5 B;  4DXA B;  2RLO A;  4GMV A;  2KR0 A;  1WJ1 A;  2Z59 A;  4GMX B;  2ELA A;  2GUM A;  4Z2N A;  2RUK B;  1W1H A;  2M38 A;  1ZM0 A;  4GN1 A;  3KZ1 A;  2Z14 A;  1ISN A;  2Q13 A;  1GG3 A;  4PQ0 A;  1J19 A;  1IRS A;  1FGZ A;  3KSY A;  3VOQ A;  4ZRJ A;  5GOW B;  4KHO A;  4TKN A;  1K5D B;  1XD4 A;  3A8Q A;  1U5G A;  1WGQ A;  3FM8 C;  2LKO A;  2KGX B;  1SHC A;  3QWM A;  2COC A;  2R0D A;  4EKU A;  5C16 A;  1K5G B;  5LOP B;  3HW2 B;  2PZ1 A;  1M7E A;  3SV1 A;  4GNK B;  2IFS A;  2E2X A;  1WVH A;  2MFQ A;  1P5T A;  1XKE A;  3ZDT A;  2P8V A;  4HDQ A;  2D9Z A;  5D3W A;  1FHW A;  3T06 A;  2KCJ A;  2R09 A;  1MK9 B;  2RNR B;  2UVM A;  1ZVR A;  2Z0O A;  2G35 A;  2N23 A;  1EF1 A;  1LW3 A;  1U5E A;  1MPH A;  1LB1 A;  2YS3 A;  1TXD A;  2Z0P A;  3IVF A;  3PVL A;  2CY5 A;  1DYN A;  1FB8 A;  2M14 A;  3KRW A;  2YVC A;  4Z2M B;  5KCV A;  3NWA A;  4WJ7 A;  3ODO A;  4H8S A; 
#chains in the Genus database with same CATH homology
 3V5W A;  2DX1 A;  3CXB B;  1PMS A;  3ULB A;  2XQN M;  3DXC A;  1UNR A;  1MIX A;  1U5F A;  1BAK A;  5D27 A;  2EMS A;  4YL8 A;  2N0Y A;  4A5K A;  1V61 A;  5DHF B;  1BTK A;  5D3V A;  5CLQ B;  2DHI A;  4CYE A;  1UNP A;  5C5B B;  5C6R A;  4P7I A;  3ML4 A;  5HE3 A;  1V5P A;  2DKP A;  2MKR A;  5D3Y A;  2D10 A;  1BWN A;  4GXB A;  3FEH A;  5HE2 A;  2GS0 A;  2H7D A;  2J0M A;  3CIK A;  3PVU A;  1MIZ B;  2YF0 A;  1FHX A;  1XR0 B;  1TQZ A;  1MAI A;  4HB4 B;  4HHV A;  1X1F A;  2UZR A;  1V5U A;  2CY4 A;  2DLW A;  2W2W A;  1KZ7 A;  1NI2 A;  1OQN A;  5D3X A;  2LUL A;  2QKL A;  1NTY A;  2DX5 A;  2ELB A;  2J59 M;  1NU2 A;  1I2H A;  1B55 A;  2LOZ A;  2W2X D;  1OY2 A;  2OTX A;  1Y19 B;  4MY6 A;  2LYD A;  2L1C A;  1FGY A;  2V76 A;  4MK0 A;  3KY9 A;  4TYZ A;  2DFK A;  4A6K A;  5C79 A;  5JHH A;  1AWE A;  2YT0 A;  2YRY A;  2YS1 A;  5LON B;  2Y8F A;  1X05 A;  1MK7 B;  2K2J A;  3RCP A;  3PP2 A;  2L2I A;  1EGX A;  1H4R A;  4HAZ B;  4WSF A;  2DA0 A;  2YT1 A;  2KUP A;  4HAT B;  5J3Y A;  4CHM A;  1WI1 A;  2ROZ B;  4ZRI A;  2K00 A;  1N3H A;  3TO1 A;  4IAP A;  2QKM A;  3QBV B;  1QC6 A;  1WG7 A;  3UZT A;  1QQG A;  1MKE A;  2D4Q A;  2D9V A;  1UPR A;  3D8E A;  2ADZ A;  4DX8 A;  4HAV B;  1U2B A;  4KHB B;  1GC6 A;  3DXE A;  4D0N B;  2D9W A;  2P0D A;  2D11 A;  5KQ4 A;  3AU5 A;  3M1I B;  4HB2 B;  5FI0 A;  2D2Q A;  5DI9 B;  4DX9 0;  2W2X C;  2D9Y A;  2I5F A;  4WVF B;  3X23 A;  2LOX A;  1P6S A;  1KZG A;  2MWN B;  2AL6 A;  4KAX B;  3TFM A;  4BBK A;  2UZS A;  3TCA A;  1M7R A;  3MPX A;  2MDX A;  4F7U P;  1Z87 A;  1RRP B;  1U27 A;  2IYB A;  5EFX A;  2GCJ A;  2HE7 A;  1TJ6 A;  2RVB B;  3BIN A;  1W1G A;  3NSU A;  5DH9 B;  3O96 A;  3P7Z A;  2VRW B;  2I1J A;  1EAZ A;  2RSG A;  2AEH A;  3SUZ A;  4ZRK A;  4A6H A;  3SO6 A;  2HTH B;  2ZPY A;  1WGU A;  4A6F B;  1XX0 A;  5JLJ B;  1RJ2 A;  1PFJ A;  3D8D A;  4XWX A;  3U7D A;  1ZC3 B;  3TW1 A;  2Z0Q A;  3PVW A;  1V89 A;  1Y5O A;  1KI1 B;  5HE0 A;  3ODW A;  4HAX B;  1V5M A;  1XOD A;  2DKQ A;  3D8F A;  3WYF B;  5DHA B;  3ULC A;  2DYN A;  4K17 A;  1X1G A;  2COD A;  1DBH A;  2EMT A;  3F0W A;  3GYP A;  4HB3 B;  2J0J A;  3HQC A;  5C5B A;  3PSC A;  2P0F A;  1E5W A;  4HB0 B;  4K81 A;  2GJY A;  4CHJ A;  1ZC4 B;  4GPT B;  1V88 A;  2DN6 A;  5JP4 A;  3SNH A;  2DHK A;  4NY0 A;  1EVH A;  3BJI A;  2OQB A;  2Y8G A;  3U8Z A;  2EJ8 A;  5DIF B;  3A8P A;  5L81 A;  2RGN B;  1DRO A;  4GZU A;  2VSZ A;  4NSW A;  5J3T A;  1H10 A;  2J0K A;  4A6F A;  4HDO A;  4C0A A;  4HAY B;  2YS5 A;  1P3R A;  3MDB C;  4YON A;  2ROV A;  5CLL B;  5J3Q A;  1BTN A;  3F5R A;  1X11 A;  2COF A;  1UPQ A;  2H7E A;  1W1D A;  3DXD A;  3KRX A;  3AJ4 A;  2BCJ A;  4DBB A;  1SGH A;  1DDM A;  3WA0 A;  4L6E A;  3FSS A;  2K2U A;  3P6A A;  2D9X A;  4B6H A;  4HAW B;  1U5D A;  1NTV A;  4IFS A;  3N7C A;  3PZD A;  1AQC A;  4F7H A;  3TVV A;  1GC7 A;  2COA A;  1UEF A;  1UNQ A;  3QIJ A;  2CAY A;  2LG1 A;  2X18 A;  2I1K A;  2DYQ A;  3VIA A;  1U29 A;  1ZSQ A;  2CRF A;  2DHJ A;  2NMB A;  3SYX A;  5JHG A;  1DDW A;  3ZVR A;  2Y7B A;  1FAO A;  1Q67 A;  4KVG B;  2DTC A;  3HK0 A;  3LJU X;  1X86 A;  1J0W A;  4Y94 A;  4F7G A;  1FOE A;  3AU4 A;  1DDV A;  4PNK A;  1FHO A;  1I7A A;  1XCG A;  5KQ1 A;  3ODX A;  5HE1 A;  4HAU B;  1WJM A;  5FI1 A;  4IOY X;  1PLS A;  1OMW A;  3OAN A;  2GCL A;  2I5C A;  4EMO A;  4EJN A;  2JP2 A;  4K2O A;  2P0H A;  3G9W A;  4MT7 A;  3GYO A;  2YSZ A;  3PG7 A;  2VKI A;  3PEG A;  4KHA A;  2EC1 A;  2FJL A;  3A98 B;  4K2P A;  2NZ8 B;  4DXA B;  2RLO A;  4GMV A;  1WJ1 A;  4GMX B;  2ELA A;  4Z2N A;  2RUK B;  1W1H A;  2M38 A;  1ZM0 A;  4GN1 A;  3KZ1 A;  1ISN A;  2Q13 A;  1GG3 A;  4PQ0 A;  1J19 A;  1IRS A;  1FGZ A;  3KSY A;  3VOQ A;  4ZRJ A;  5GOW B;  4KHO A;  4TKN A;  1K5D B;  1XD4 A;  3A8Q A;  1U5G A;  1WGQ A;  3FM8 C;  2LKO A;  2KGX B;  1SHC A;  3QWM A;  2COC A;  2R0D A;  4EKU A;  5C16 A;  1K5G B;  5LOP B;  3HW2 B;  2PZ1 A;  1M7E A;  3SV1 A;  2IFS A;  2E2X A;  1WVH A;  2MFQ A;  1P5T A;  1XKE A;  3ZDT A;  2P8V A;  4HDQ A;  2D9Z A;  5D3W A;  1FHW A;  3T06 A;  2KCJ A;  2R09 A;  1MK9 B;  2RNR B;  2UVM A;  1ZVR A;  2Z0O A;  2G35 A;  2N23 A;  1EF1 A;  1LW3 A;  1U5E A;  1MPH A;  1LB1 A;  2YS3 A;  1TXD A;  2Z0P A;  3IVF A;  3PVL A;  2CY5 A;  1DYN A;  1FB8 A;  2M14 A;  3KRW A;  2YVC A;  4Z2M B;  5KCV A;  4WJ7 A;  3ODO A;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...