2COFA

Solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GSSGSSGLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein KIAA1914
publication title Solution structure of the C-terminal PH domain of hypothetical protein KIAA1914 from human
rcsb
source organism Homo sapiens
total genus 13
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cofA00
3PVLA 4ZRKA 2MWNB 2UVMA 3ULCA 1Y19B 1DDMA 3P7ZA 2LOXA 1J0WA 3U8ZA 1FGZA 4Y94A 1MIXA 4C0AA 1DDWA 3D8FA 2D9VA 5C79A 1BAKA 4GPTB 1NTYA 1ZC3B 4GMVA 4Z2MB 1V5PA 3PVUA 2NMBA 2CY5A 2YS1A 3TFMA 1U5GA 4A6HA 1UEFA 3LJUX 2MDXA 1QQGA 3AU4A 1FHXA 1NTVA 4D0NB 2LULA 1NU2A 4K17A 1RJ2A 1LB1A 4HB4B 1I7AA 2Y8GA 2GS0A 5JP4A 1UNRA 2J0KA 3F0WA 2VRWB 3SUZA 4IFSA 2I5CA 5C5BA 2GCLA 2G35A 1P5TA 5JHHA 4F7UP 2LOZA 2R09A 3FSSA 2DYQA 4YONA 4A6FA 1U27A 2KCJA 2RUKB 2W2XC 4F7GA 2J0JA 1ZVRA 2R0DA 2BCJA 2DX1A 2ADZA 1ZM0A 2GCJA 4EJNA 3D8EA 5J3QA 2N0YA 4CHJA 1E5WA 1N3HA 2PZ1A 5HE0A 1XKEA 1AWEA 2CY4A 4KAXB 2VSZA 1V61A 2ZPYA 1KZGA 2DX5A 1Y5OA 3KZ1A 2P0HA 1WG7A 2ROZB 3VIAA 1U5DA 3KY9A 1NI2A 2H7DA 1U5FA 2KUPA 3SV1A 1P6SA 1H10A 1H4RA 1AQCA 1K5DB 1M7RA 3T06A 3VOQA 4HB0B 1QC6A 5KQ4A 2LG1A 1MPHA 3PZDA 4P7IA 2D9WA 3X23A 1X05A 2DTCA 1MKEA 3TVVA 3QWMA 3FEHA 5JLJB 4Z2NA 4HB2B 1BWNA 2M14A 3AU5A 2CAYA 4ZRIA 1ISNA 2J59M 2P8VA 2I1KA 3F5RA 5HE1A 4F7HA 2N23A 5EFXA 1U5EA 2HTHB 2ROVA 4WVFB 1J19A 2D10A 4K2OA 2EMTA 1RRPB 1MAIA 1EF1A 2I1JA 2VKIA 2HE7A 1TJ6A 1DBHA 2E2XA 2I5FA 3DXEA 2JP2A 3TW1A 2EC1A 4H8SA 4HAYB 1V89A 4CHMA 3QIJA 2CRFA 4PQ0A 2Q13A 2W2XD 5LOPB 1W1GA 4DXAB 3MPXA 3HK0A 5LONB 4PNKA 2D9XA 1SGHA 2ELAA 4XWXA 1V5UA 3TO1A 2NZ8B 4KHOA 1BTKA 2D9ZA 2RSGA 2DHIA 4MY6A 2Z0PA 1K5GB 2P0FA 4WSFA 3U7DA 2IFSA 2J0MA 1MIZB 3N7CA 1FHOA 3D8DA 3QBVB 2RNRB 2DA0A 1FAOA 3DXCA 4KVGB 3ULBA 2D2QA 2COCA 3SYXA 4TKNA 4A6KA 2KGXB 3HQCA 4EKUA 1GG3A 1WJ1A 2RLOA 4DX90 2AEHA 3DXDA 1EGXA 2L2IA 4HATB 1PLSA 2LYDA 4MK0A 1FOEA 3P6AA 4EMOA 3TCAA 1Z87A 2P0DA 1XCGA 4HB3B 5HE3A 2K00A 1Q67A 4GZUA 2YVCA 3KRXA 2YS5A 5KCVA 2YT0A 4CYEA 3ML4A 2ELBA 3BINA 1ZC4B 1EAZA 1WVHA 1M7EA 1GC6A 3O96A 2X18A 1X11A 4DBBA 2IYBA 4TYZA 2M38A 2DLWA 3V5WA 2D11A 3SO6A 2MKRA 2Y8FA 5CLLB 5D27A 2RVBB 4NY0A 1DROA 1UPQA 3BJIA 5FI0A 2CODA 4B6HA 2W2WA 1UNQA 1ZSQA 1FHWA 1KZ7A 3PSCA 1FGYA 5JHGA 1X86A 4HHVA 3CXBB 3MDBC 1X1GA 3IVFA 5DHAB 5DHFB 2Y7BA 3PG7A 1PFJA 1V88A 2RGNB 1XD4A 2YT1A 2YRYA 2XQNM 3ODOA 3AJ4A 3KRWA 4BBKA 4YL8A 5C5BB 3ODXA 5D3VA 3NSUA 1FB8A 5C16A 1U29A 2QKLA 1KI1B 1WGUA 4A6FB 4ZRJA 1V5MA 4IAPA 5D3WA 1UNPA 4HAZB 2Z0OA 2DYNA 3A8PA 3PEGA 1XX0A 1MK7B 1BTNA 1LW3A 1XODA 2UZSA 3RCPA 5FI1A 4GN1A 4HAXB 3GYOA 4DX8A 3G9WA 1SHCA 1U2BA 2UZRA 3ODWA 1GC7A 3A98B 4K2PA 2EJ8A 5GOWB 5L81A 2OQBA 1B55A 4WJ7A 2MFQA 3A8QA 1W1HA 2COFA 3UZTA 5KQ1A 2LKOA 2DKPA 1P3RA 2COAA 2D4QA 1TXDA 2EMSA 3GYPA 4GXBA 2DHKA 2DKQA 1WGQA 3CIKA 4NSWA 5DH9B 4HAWB 1I2HA 1TQZA 1MK9B 4HDOA 3SNHA 2L1CA 3KSYA 3WA0A 1WJMA 1EVHA 3ZDTA 3HW2B 1OY2A 4KHAA 4HAVB 2YSZA 2QKMA 2H7EA 1X1FA 1DYNA 4K81A 4IOYX 3M1IB 2AL6A 1XR0B 1PMSA 5DI9B 1DDVA 2DN6A 4HDQA 2Z0QA 4HAUB 5HE2A 4L6EA 2OTXA 2DFKA 1OQNA 3FM8C 5DIFB 1WI1A 3OANA 3ZVRA 2FJLA 5C6RA 4A5KA 2K2UA 4MT7A 1OMWA 3WYFB 5J3YA 2K2JA 2D9YA 5CLQB 2GJYA 5J3TA 2DHJA 3PVWA 4GMXB 1IRSA 2V76A 4KHBB 2YF0A 5D3XA 1UPRA 1W1DA 3PP2A 2YS3A 5D3YA
chains in the Genus database with same CATH superfamily
3PVLA 4ZRKA 3NWAA 2MWNB 2UVMA 3ULCA 1Y19B 1DDMA 2Z13A 5LG4B 1MI1A 3P7ZA 2LOXA 1J0WA 3U8ZA 1FGZA 4Y94A 5I2MA 1MIXA 4C0AA 1DDWA 3D8FA 2D9VA 2ZKMX 5C79A 1BAKA 4GPTB 1NTYA 1ZC3B 4GMVA 4OSNA 2Z59A 4Z2MB 3FVCA 1V5PA 3PVUA 3U12A 2NMBA 2CY5A 2YS1A 3TFMA 1U5GA 4A6HA 1UEFA 3LJUX 2MDXA 1QQGA 3AU4A 1FHXA 1NTVA 4D0NB 2LULA 1NU2A 4K17A 1RJ2A 1LB1A 4HB4B 1I7AA 2Y8GA 2GS0A 5JP4A 1UNRA 2J0KA 3F0WA 2VRWB 3SUZA 4IFSA 2I5CA 5C5BA 2GCLA 2G35A 1P5TA 5JHHA 4F7UP 2LOZA 2R09A 3FSSA 2DYQA 4L1RA 4YONA 4A6FA 1U27A 2KCJA 2RUKB 2W2XC 4F7GA 2J0JA 1ZVRA 2R0DA 2BCJA 2DX1A 2ADZA 1ZM0A 2GCJA 4EJNA 3D8EA 5J3QA 2N0YA 4CHJA 1E5WA 1N3HA 2GUMA 2PZ1A 5HE0A 1XKEA 1AWEA 2CY4A 4KAXB 2VSZA 1V61A 2ZPYA 1KZGA 2DX5A 1Y5OA 3KZ1A 4QXAB 2P0HA 1WG7A 2ROZB 3VIAA 1U5DA 3KY9A 2K8EA 1NI2A 2H7DA 1U5FA 2KUPA 3SV1A 1P6SA 1H10A 1H4RA 1AQCA 1K5DB 1M7RA 3T06A 3VOQA 4HB0B 1QC6A 5KQ4A 2LG1A 1MPHA 3PZDA 4P7IA 2D9WA 3X23A 1X05A 2DTCA 1MKEA 2K49A 3TVVA 3QWMA 3FEHA 5JLJB 4Z2NA 4HB2B 1T77A 1BWNA 2M14A 3AU5A 2CAYA 4ZRIA 1ISNA 2J59M 2P8VA 2I1KA 3F5RA 5HE1A 4F7HA 2N23A 5EFXA 1U5EA 2HTHB 2ROVA 4WVFB 1J19A 2Z4DA 2D10A 4K2OA 2EMTA 3NW8A 1RRPB 1MAIA 1EF1A 2I1JA 2VKIA 2HE7A 1TJ6A 1DBHA 2E2XA 2I5FA 3DXEA 2JP2A 3TW1A 2EC1A 4H8SA 4HAYB 1V89A 4CHMA 3QIJA 2CRFA 4PQ0A 2Q13A 2W2XD 5LOPB 1W1GA 3NWDA 4DXAB 3MPXA 3HK0A 5LONB 4KHBA 1ZYIA 4PNKA 2D9XA 1SGHA 2ELAA 4XWXA 1V5UA 3TO1A 2NZ8B 4KHOA 1BTKA 2D9ZA 5IRSA 2RSGA 4CSQA 2DHIA 4MY6A 2KUQA 2Z0PA 1K5GB 2P0FA 4WSFA 3U7DA 2IFSA 2J0MA 1MIZB 3N7CA 1FHOA 3D8DA 3QBVB 3HSAA 2RNRB 2R2YA 2DA0A 1FAOA 3DXCA 4KVGB 4QJ3B 3ULBA 2D2QA 2COCA 3SYXA 4TKNA 4A6KA 2KGXB 3HQCA 4EKUA 1GG3A 1WJ1A 2RLOA 4DX90 2AEHA 3DXDA 1EGXA 2L2IA 4HATB 1PLSA 2LYDA 4MK0A 1FOEA 3P6AA 4EMOA 3TCAA 1Z87A 2P0DA 1XCGA 4HB3B 5HE3A 2K00A 1Q67A 4GZUA 2YVCA 3KRXA 2YS5A 5KCVA 2YT0A 4CYEA 3ML4A 2ELBA 3BINA 1ZC4B 1EAZA 3DCXA 1WVHA 1M7EA 3NWFA 1GC6A 3O96A 4DIXA 2X18A 1X11A 4DBBA 2IYBA 4TYZA 2M38A 2DLWA 3V5WA 2D11A 3SO6A 2MKRA 4HSIA 2Y8FA 5CLLB 5D27A 2RVBB 4NY0A 1DROA 1UPQA 3BJIA 5FI0A 2CODA 4B6HA 2W2WA 2Z14A 1UNQA 1ZSQA 1FHWA 1KZ7A 3PSCA 1FGYA 5JHGA 1X86A 4HHVA 3CXBB 3MDBC 1X1GA 3IVFA 5DHAB 3A58A 5DHFB 2Y7BA 3PG7A 1PFJA 1V88A 2RGNB 1XD4A 2YT1A 2YRYA 2KIGA 2XQNM 3ODOA 3AJ4A 3KRWA 4BBKA 4YL8A 5C5BB 3ODXA 4QJ4B 5D3VA 3NSUA 1FB8A 5C16A 1U29A 2QKLA 1KI1B 1WGUA 2KIEA 4A6FB 4ZRJA 1V5MA 4IAPA 5D3WA 1UNPA 4HAZB 2Z0OA 4GOUA 2DYNA 3A8PA 3PEGA 1XX0A 1MK7B 2FJUB 1BTNA 2KR0A 1LW3A 1XODA 2UZSA 4GNKB 3RCPA 3OHMB 5FI1A 4GN1A 4HAXB 3GYOA 4DX8A 3G9WA 4D6WA 1SHCA 1U2BA 2UZRA 3ODWA 1GC7A 5M4YB 3A98B 4K2PA 2EJ8A 5GOWB 5L81A 2OQBA 1B55A 4OT1A 4WJ7A 2MFQA 3A8QA 2NBVA 1W1HA 2COFA 3UZTA 5KQ1A 2LKOA 2DKPA 1P3RA 2COAA 2D4QA 1TXDA 2EMSA 3GYPA 4GXBA 2DHKA 2DKQA 1WGQA 3CIKA 4NSWA 5DH9B 4HAWB 1I2HA 1TQZA 1MK9B 4HDOA 3SNHA 2L1CA 3KSYA 3WA0A 1WJMA 1EVHA 3ZDTA 3HW2B 1OY2A 4KHAA 4HAVB 2YSZA 2QKMA 2H7EA 2YT2A 1X1FA 1DYNA 4K81A 3HIEA 4IOYX 3M1IB 2AL6A 1XR0B 4QJ5B 1PMSA 5DI9B 1DDVA 2DN6A 4HDQA 2Z0QA 4HAUB 5HE2A 4L6EA 2OTXA 2DFKA 1OQNA 3FM8C 5DIFB 1WI1A 3OANA 3ZVRA 2FJLA 5C6RA 4A5KA 2K2UA 4MT7A 1OMWA 3WYFB 5I2SA 2RRFA 5J3YA 2K2JA 2D9YA 5CLQB 2GJYA 5J3TA 2DHJA 3B77A 3PVWA 4GMXB 1IRSA 2V76A 4KHBB 2YF0A 5D3XA 1UPRA 1W1DA 3PP2A 2YS3A 5D3YA
chains in the Genus database with same CATH topology
3PVLA 4ZRKA 2MWNB 2UVMA 3ULCA 1Y19B 1DDMA 3P7ZA 2LOXA 1J0WA 3U8ZA 1FGZA 4Y94A 1MIXA 4C0AA 1DDWA 3D8FA 2D9VA 5C79A 1BAKA 4GPTB 1NTYA 1ZC3B 4GMVA 4Z2MB 1V5PA 3PVUA 2NMBA 2CY5A 2YS1A 3TFMA 1U5GA 4A6HA 1UEFA 3LJUX 2MDXA 1QQGA 3AU4A 1FHXA 1NTVA 4D0NB 2LULA 1NU2A 4K17A 1RJ2A 1LB1A 4HB4B 1I7AA 2Y8GA 2GS0A 5JP4A 1UNRA 2J0KA 3F0WA 2VRWB 3SUZA 4IFSA 2I5CA 5C5BA 2GCLA 2G35A 1P5TA 5JHHA 4F7UP 2LOZA 2R09A 3FSSA 2DYQA 4YONA 4A6FA 1U27A 2KCJA 2RUKB 2W2XC 4F7GA 2J0JA 1ZVRA 2R0DA 2BCJA 2DX1A 2ADZA 1ZM0A 2GCJA 4EJNA 3D8EA 5J3QA 2N0YA 4CHJA 1E5WA 1N3HA 2PZ1A 5HE0A 1XKEA 1AWEA 2CY4A 4KAXB 2VSZA 1V61A 2ZPYA 1KZGA 2DX5A 1Y5OA 3KZ1A 2P0HA 1WG7A 2ROZB 3VIAA 1U5DA 3KY9A 1NI2A 2H7DA 1U5FA 2KUPA 3SV1A 1P6SA 1H10A 1H4RA 1AQCA 1K5DB 1M7RA 3T06A 3VOQA 4HB0B 1QC6A 5KQ4A 2LG1A 1MPHA 3PZDA 4P7IA 2D9WA 3X23A 1X05A 2DTCA 1MKEA 3TVVA 3QWMA 3FEHA 5JLJB 4Z2NA 4HB2B 1BWNA 2M14A 3AU5A 2CAYA 4ZRIA 1ISNA 2J59M 2P8VA 2I1KA 3F5RA 5HE1A 4F7HA 2N23A 5EFXA 1U5EA 2HTHB 2ROVA 4WVFB 1J19A 2D10A 4K2OA 2EMTA 1RRPB 1MAIA 1EF1A 2I1JA 2VKIA 2HE7A 1TJ6A 1DBHA 2E2XA 2I5FA 3DXEA 2JP2A 3TW1A 2EC1A 4H8SA 4HAYB 1V89A 4CHMA 3QIJA 2CRFA 4PQ0A 2Q13A 2W2XD 5LOPB 1W1GA 4DXAB 3MPXA 3HK0A 5LONB 4PNKA 2D9XA 1SGHA 2ELAA 4XWXA 1V5UA 3TO1A 2NZ8B 4KHOA 1BTKA 2D9ZA 2RSGA 2DHIA 4MY6A 2Z0PA 1K5GB 2P0FA 4WSFA 3U7DA 2IFSA 2J0MA 1MIZB 3N7CA 1FHOA 3D8DA 3QBVB 2RNRB 2DA0A 1FAOA 3DXCA 4KVGB 3ULBA 2D2QA 2COCA 3SYXA 4TKNA 4A6KA 2KGXB 3HQCA 4EKUA 1GG3A 1WJ1A 2RLOA 4DX90 2AEHA 3DXDA 1EGXA 2L2IA 4HATB 1PLSA 2LYDA 4MK0A 1FOEA 3P6AA 4EMOA 3TCAA 1Z87A 2P0DA 1XCGA 4HB3B 5HE3A 2K00A 1Q67A 4GZUA 2YVCA 3KRXA 2YS5A 5KCVA 2YT0A 4CYEA 3ML4A 2ELBA 3BINA 1ZC4B 1EAZA 1WVHA 1M7EA 1GC6A 3O96A 2X18A 1X11A 4DBBA 2IYBA 4TYZA 2M38A 2DLWA 3V5WA 2D11A 3SO6A 2MKRA 2Y8FA 5CLLB 5D27A 2RVBB 4NY0A 1DROA 1UPQA 3BJIA 5FI0A 2CODA 4B6HA 2W2WA 1UNQA 1ZSQA 1FHWA 1KZ7A 3PSCA 1FGYA 5JHGA 1X86A 4HHVA 3CXBB 3MDBC 1X1GA 3IVFA 5DHAB 5DHFB 2Y7BA 3PG7A 1PFJA 1V88A 2RGNB 1XD4A 2YT1A 2YRYA 2XQNM 3ODOA 3AJ4A 3KRWA 4BBKA 4YL8A 5C5BB 3ODXA 5D3VA 3NSUA 1FB8A 5C16A 1U29A 2QKLA 1KI1B 1WGUA 4A6FB 4ZRJA 1V5MA 4IAPA 5D3WA 1UNPA 4HAZB 2Z0OA 2DYNA 3A8PA 3PEGA 1XX0A 1MK7B 1BTNA 1LW3A 1XODA 2UZSA 3RCPA 5FI1A 4GN1A 4HAXB 3GYOA 4DX8A 3G9WA 1SHCA 1U2BA 2UZRA 3ODWA 1GC7A 3A98B 4K2PA 2EJ8A 5GOWB 5L81A 2OQBA 1B55A 4WJ7A 2MFQA 3A8QA 1W1HA 2COFA 3UZTA 5KQ1A 2LKOA 2DKPA 1P3RA 2COAA 2D4QA 1TXDA 2EMSA 3GYPA 4GXBA 2DHKA 2DKQA 1WGQA 3CIKA 4NSWA 5DH9B 4HAWB 1I2HA 1TQZA 1MK9B 4HDOA 3SNHA 2L1CA 3KSYA 3WA0A 1WJMA 1EVHA 3ZDTA 3HW2B 1OY2A 4KHAA 4HAVB 2YSZA 2QKMA 2H7EA 1X1FA 1DYNA 4K81A 4IOYX 3M1IB 2AL6A 1XR0B 1PMSA 5DI9B 1DDVA 2DN6A 4HDQA 2Z0QA 4HAUB 5HE2A 4L6EA 2OTXA 2DFKA 1OQNA 3FM8C 5DIFB 1WI1A 3OANA 3ZVRA 2FJLA 5C6RA 4A5KA 2K2UA 4MT7A 1OMWA 3WYFB 5J3YA 2K2JA 2D9YA 5CLQB 2GJYA 5J3TA 2DHJA 3PVWA 4GMXB 1IRSA 2V76A 4KHBB 2YF0A 5D3XA 1UPRA 1W1DA 3PP2A 2YS3A 5D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  4ZRK A;  2MWN B;  2UVM A;  3ULC A;  1Y19 B;  1DDM A;  3P7Z A;  2LOX A;  1J0W A;  3U8Z A;  1FGZ A;  4Y94 A;  1MIX A;  4C0A A;  1DDW A;  3D8F A;  2D9V A;  5C79 A;  1BAK A;  4GPT B;  1NTY A;  1ZC3 B;  4GMV A;  4Z2M B;  1V5P A;  3PVU A;  2NMB A;  2CY5 A;  2YS1 A;  3TFM A;  1U5G A;  4A6H A;  1UEF A;  3LJU X;  2MDX A;  1QQG A;  3AU4 A;  1FHX A;  1NTV A;  4D0N B;  2LUL A;  1NU2 A;  4K17 A;  1RJ2 A;  1LB1 A;  4HB4 B;  1I7A A;  2Y8G A;  2GS0 A;  5JP4 A;  1UNR A;  2J0K A;  3F0W A;  2VRW B;  3SUZ A;  4IFS A;  2I5C A;  5C5B A;  2GCL A;  2G35 A;  1P5T A;  5JHH A;  4F7U P;  2LOZ A;  2R09 A;  3FSS A;  2DYQ A;  4YON A;  4A6F A;  1U27 A;  2KCJ A;  2RUK B;  2W2X C;  4F7G A;  2J0J A;  1ZVR A;  2R0D A;  2BCJ A;  2DX1 A;  2ADZ A;  1ZM0 A;  2GCJ A;  4EJN A;  3D8E A;  5J3Q A;  2N0Y A;  4CHJ A;  1E5W A;  1N3H A;  2PZ1 A;  5HE0 A;  1XKE A;  1AWE A;  2CY4 A;  4KAX B;  2VSZ A;  1V61 A;  2ZPY A;  1KZG A;  2DX5 A;  1Y5O A;  3KZ1 A;  2P0H A;  1WG7 A;  2ROZ B;  3VIA A;  1U5D A;  3KY9 A;  1NI2 A;  2H7D A;  1U5F A;  2KUP A;  3SV1 A;  1P6S A;  1H10 A;  1H4R A;  1AQC A;  1K5D B;  1M7R A;  3T06 A;  3VOQ A;  4HB0 B;  1QC6 A;  5KQ4 A;  2LG1 A;  1MPH A;  3PZD A;  4P7I A;  2D9W A;  3X23 A;  1X05 A;  2DTC A;  1MKE A;  3TVV A;  3QWM A;  3FEH A;  5JLJ B;  4Z2N A;  4HB2 B;  1BWN A;  2M14 A;  3AU5 A;  2CAY A;  4ZRI A;  1ISN A;  2J59 M;  2P8V A;  2I1K A;  3F5R A;  5HE1 A;  4F7H A;  2N23 A;  5EFX A;  1U5E A;  2HTH B;  2ROV A;  4WVF B;  1J19 A;  2D10 A;  4K2O A;  2EMT A;  1RRP B;  1MAI A;  1EF1 A;  2I1J A;  2VKI A;  2HE7 A;  1TJ6 A;  1DBH A;  2E2X A;  2I5F A;  3DXE A;  2JP2 A;  3TW1 A;  2EC1 A;  4H8S A;  4HAY B;  1V89 A;  4CHM A;  3QIJ A;  2CRF A;  4PQ0 A;  2Q13 A;  2W2X D;  5LOP B;  1W1G A;  4DXA B;  3MPX A;  3HK0 A;  5LON B;  4PNK A;  2D9X A;  1SGH A;  2ELA A;  4XWX A;  1V5U A;  3TO1 A;  2NZ8 B;  4KHO A;  1BTK A;  2D9Z A;  2RSG A;  2DHI A;  4MY6 A;  2Z0P A;  1K5G B;  2P0F A;  4WSF A;  3U7D A;  2IFS A;  2J0M A;  1MIZ B;  3N7C A;  1FHO A;  3D8D A;  3QBV B;  2RNR B;  2DA0 A;  1FAO A;  3DXC A;  4KVG B;  3ULB A;  2D2Q A;  2COC A;  3SYX A;  4TKN A;  4A6K A;  2KGX B;  3HQC A;  4EKU A;  1GG3 A;  1WJ1 A;  2RLO A;  4DX9 0;  2AEH A;  3DXD A;  1EGX A;  2L2I A;  4HAT B;  1PLS A;  2LYD A;  4MK0 A;  1FOE A;  3P6A A;  4EMO A;  3TCA A;  1Z87 A;  2P0D A;  1XCG A;  4HB3 B;  5HE3 A;  2K00 A;  1Q67 A;  4GZU A;  2YVC A;  3KRX A;  2YS5 A;  5KCV A;  2YT0 A;  4CYE A;  3ML4 A;  2ELB A;  3BIN A;  1ZC4 B;  1EAZ A;  1WVH A;  1M7E A;  1GC6 A;  3O96 A;  2X18 A;  1X11 A;  4DBB A;  2IYB A;  4TYZ A;  2M38 A;  2DLW A;  3V5W A;  2D11 A;  3SO6 A;  2MKR A;  2Y8F A;  5CLL B;  5D27 A;  2RVB B;  4NY0 A;  1DRO A;  1UPQ A;  3BJI A;  5FI0 A;  2COD A;  4B6H A;  2W2W A;  1UNQ A;  1ZSQ A;  1FHW A;  1KZ7 A;  3PSC A;  1FGY A;  5JHG A;  1X86 A;  4HHV A;  3CXB B;  3MDB C;  1X1G A;  3IVF A;  5DHA B;  5DHF B;  2Y7B A;  3PG7 A;  1PFJ A;  1V88 A;  2RGN B;  1XD4 A;  2YT1 A;  2YRY A;  2XQN M;  3ODO A;  3AJ4 A;  3KRW A;  4BBK A;  4YL8 A;  5C5B B;  3ODX A;  5D3V A;  3NSU A;  1FB8 A;  5C16 A;  1U29 A;  2QKL A;  1KI1 B;  1WGU A;  4A6F B;  4ZRJ A;  1V5M A;  4IAP A;  5D3W A;  1UNP A;  4HAZ B;  2Z0O A;  2DYN A;  3A8P A;  3PEG A;  1XX0 A;  1MK7 B;  1BTN A;  1LW3 A;  1XOD A;  2UZS A;  3RCP A;  5FI1 A;  4GN1 A;  4HAX B;  3GYO A;  4DX8 A;  3G9W A;  1SHC A;  1U2B A;  2UZR A;  3ODW A;  1GC7 A;  3A98 B;  4K2P A;  2EJ8 A;  5GOW B;  5L81 A;  2OQB A;  1B55 A;  4WJ7 A;  2MFQ A;  3A8Q A;  1W1H A;  2COF A;  3UZT A;  5KQ1 A;  2LKO A;  2DKP A;  1P3R A;  2COA A;  2D4Q A;  1TXD A;  2EMS A;  3GYP A;  4GXB A;  2DHK A;  2DKQ A;  1WGQ A;  3CIK A;  4NSW A;  5DH9 B;  4HAW B;  1I2H A;  1TQZ A;  1MK9 B;  4HDO A;  3SNH A;  2L1C A;  3KSY A;  3WA0 A;  1WJM A;  1EVH A;  3ZDT A;  3HW2 B;  1OY2 A;  4KHA A;  4HAV B;  2YSZ A;  2QKM A;  2H7E A;  1X1F A;  1DYN A;  4K81 A;  4IOY X;  3M1I B;  2AL6 A;  1XR0 B;  1PMS A;  5DI9 B;  1DDV A;  2DN6 A;  4HDQ A;  2Z0Q A;  4HAU B;  5HE2 A;  4L6E A;  2OTX A;  2DFK A;  1OQN A;  3FM8 C;  5DIF B;  1WI1 A;  3OAN A;  3ZVR A;  2FJL A;  5C6R A;  4A5K A;  2K2U A;  4MT7 A;  1OMW A;  3WYF B;  5J3Y A;  2K2J A;  2D9Y A;  5CLQ B;  2GJY A;  5J3T A;  2DHJ A;  3PVW A;  4GMX B;  1IRS A;  2V76 A;  4KHB B;  2YF0 A;  5D3X A;  1UPR A;  1W1D A;  3PP2 A;  2YS3 A;  5D3Y A; 
#chains in the Genus database with same CATH topology
 3PVL A;  4ZRK A;  3NWA A;  2MWN B;  2UVM A;  3ULC A;  1Y19 B;  1DDM A;  2Z13 A;  5LG4 B;  1MI1 A;  3P7Z A;  2LOX A;  1J0W A;  3U8Z A;  1FGZ A;  4Y94 A;  5I2M A;  1MIX A;  4C0A A;  1DDW A;  3D8F A;  2D9V A;  2ZKM X;  5C79 A;  1BAK A;  4GPT B;  1NTY A;  1ZC3 B;  4GMV A;  4OSN A;  2Z59 A;  4Z2M B;  3FVC A;  1V5P A;  3PVU A;  3U12 A;  2NMB A;  2CY5 A;  2YS1 A;  3TFM A;  1U5G A;  4A6H A;  1UEF A;  3LJU X;  2MDX A;  1QQG A;  3AU4 A;  1FHX A;  1NTV A;  4D0N B;  2LUL A;  1NU2 A;  4K17 A;  1RJ2 A;  1LB1 A;  4HB4 B;  1I7A A;  2Y8G A;  2GS0 A;  5JP4 A;  1UNR A;  2J0K A;  3F0W A;  2VRW B;  3SUZ A;  4IFS A;  2I5C A;  5C5B A;  2GCL A;  2G35 A;  1P5T A;  5JHH A;  4F7U P;  2LOZ A;  2R09 A;  3FSS A;  2DYQ A;  4L1R A;  4YON A;  4A6F A;  1U27 A;  2KCJ A;  2RUK B;  2W2X C;  4F7G A;  2J0J A;  1ZVR A;  2R0D A;  2BCJ A;  2DX1 A;  2ADZ A;  1ZM0 A;  2GCJ A;  4EJN A;  3D8E A;  5J3Q A;  2N0Y A;  4CHJ A;  1E5W A;  1N3H A;  2GUM A;  2PZ1 A;  5HE0 A;  1XKE A;  1AWE A;  2CY4 A;  4KAX B;  2VSZ A;  1V61 A;  2ZPY A;  1KZG A;  2DX5 A;  1Y5O A;  3KZ1 A;  4QXA B;  2P0H A;  1WG7 A;  2ROZ B;  3VIA A;  1U5D A;  3KY9 A;  2K8E A;  1NI2 A;  2H7D A;  1U5F A;  2KUP A;  3SV1 A;  1P6S A;  1H10 A;  1H4R A;  1AQC A;  1K5D B;  1M7R A;  3T06 A;  3VOQ A;  4HB0 B;  1QC6 A;  5KQ4 A;  2LG1 A;  1MPH A;  3PZD A;  4P7I A;  2D9W A;  3X23 A;  1X05 A;  2DTC A;  1MKE A;  2K49 A;  3TVV A;  3QWM A;  3FEH A;  5JLJ B;  4Z2N A;  4HB2 B;  1T77 A;  1BWN A;  2M14 A;  3AU5 A;  2CAY A;  4ZRI A;  1ISN A;  2J59 M;  2P8V A;  2I1K A;  3F5R A;  5HE1 A;  4F7H A;  2N23 A;  5EFX A;  1U5E A;  2HTH B;  2ROV A;  4WVF B;  1J19 A;  2Z4D A;  2D10 A;  4K2O A;  2EMT A;  3NW8 A;  1RRP B;  1MAI A;  1EF1 A;  2I1J A;  2VKI A;  2HE7 A;  1TJ6 A;  1DBH A;  2E2X A;  2I5F A;  3DXE A;  2JP2 A;  3TW1 A;  2EC1 A;  4H8S A;  4HAY B;  1V89 A;  4CHM A;  3QIJ A;  2CRF A;  4PQ0 A;  2Q13 A;  2W2X D;  5LOP B;  1W1G A;  3NWD A;  4DXA B;  3MPX A;  3HK0 A;  5LON B;  4KHB A;  1ZYI A;  4PNK A;  2D9X A;  1SGH A;  2ELA A;  4XWX A;  1V5U A;  3TO1 A;  2NZ8 B;  4KHO A;  1BTK A;  2D9Z A;  5IRS A;  2RSG A;  4CSQ A;  2DHI A;  4MY6 A;  2KUQ A;  2Z0P A;  1K5G B;  2P0F A;  4WSF A;  3U7D A;  2IFS A;  2J0M A;  1MIZ B;  3N7C A;  1FHO A;  3D8D A;  3QBV B;  3HSA A;  2RNR B;  2R2Y A;  2DA0 A;  1FAO A;  3DXC A;  4KVG B;  4QJ3 B;  3ULB A;  2D2Q A;  2COC A;  3SYX A;  4TKN A;  4A6K A;  2KGX B;  3HQC A;  4EKU A;  1GG3 A;  1WJ1 A;  2RLO A;  4DX9 0;  2AEH A;  3DXD A;  1EGX A;  2L2I A;  4HAT B;  1PLS A;  2LYD A;  4MK0 A;  1FOE A;  3P6A A;  4EMO A;  3TCA A;  1Z87 A;  2P0D A;  1XCG A;  4HB3 B;  5HE3 A;  2K00 A;  1Q67 A;  4GZU A;  2YVC A;  3KRX A;  2YS5 A;  5KCV A;  2YT0 A;  4CYE A;  3ML4 A;  2ELB A;  3BIN A;  1ZC4 B;  1EAZ A;  3DCX A;  1WVH A;  1M7E A;  3NWF A;  1GC6 A;  3O96 A;  4DIX A;  2X18 A;  1X11 A;  4DBB A;  2IYB A;  4TYZ A;  2M38 A;  2DLW A;  3V5W A;  2D11 A;  3SO6 A;  2MKR A;  4HSI A;  2Y8F A;  5CLL B;  5D27 A;  2RVB B;  4NY0 A;  1DRO A;  1UPQ A;  3BJI A;  5FI0 A;  2COD A;  4B6H A;  2W2W A;  2Z14 A;  1UNQ A;  1ZSQ A;  1FHW A;  1KZ7 A;  3PSC A;  1FGY A;  5JHG A;  1X86 A;  4HHV A;  3CXB B;  3MDB C;  1X1G A;  3IVF A;  5DHA B;  3A58 A;  5DHF B;  2Y7B A;  3PG7 A;  1PFJ A;  1V88 A;  2RGN B;  1XD4 A;  2YT1 A;  2YRY A;  2KIG A;  2XQN M;  3ODO A;  3AJ4 A;  3KRW A;  4BBK A;  4YL8 A;  5C5B B;  3ODX A;  4QJ4 B;  5D3V A;  3NSU A;  1FB8 A;  5C16 A;  1U29 A;  2QKL A;  1KI1 B;  1WGU A;  2KIE A;  4A6F B;  4ZRJ A;  1V5M A;  4IAP A;  5D3W A;  1UNP A;  4HAZ B;  2Z0O A;  4GOU A;  2DYN A;  3A8P A;  3PEG A;  1XX0 A;  1MK7 B;  2FJU B;  1BTN A;  2KR0 A;  1LW3 A;  1XOD A;  2UZS A;  4GNK B;  3RCP A;  3OHM B;  5FI1 A;  4GN1 A;  4HAX B;  3GYO A;  4DX8 A;  3G9W A;  4D6W A;  1SHC A;  1U2B A;  2UZR A;  3ODW A;  1GC7 A;  5M4Y B;  3A98 B;  4K2P A;  2EJ8 A;  5GOW B;  5L81 A;  2OQB A;  1B55 A;  4OT1 A;  4WJ7 A;  2MFQ A;  3A8Q A;  2NBV A;  1W1H A;  2COF A;  3UZT A;  5KQ1 A;  2LKO A;  2DKP A;  1P3R A;  2COA A;  2D4Q A;  1TXD A;  2EMS A;  3GYP A;  4GXB A;  2DHK A;  2DKQ A;  1WGQ A;  3CIK A;  4NSW A;  5DH9 B;  4HAW B;  1I2H A;  1TQZ A;  1MK9 B;  4HDO A;  3SNH A;  2L1C A;  3KSY A;  3WA0 A;  1WJM A;  1EVH A;  3ZDT A;  3HW2 B;  1OY2 A;  4KHA A;  4HAV B;  2YSZ A;  2QKM A;  2H7E A;  2YT2 A;  1X1F A;  1DYN A;  4K81 A;  3HIE A;  4IOY X;  3M1I B;  2AL6 A;  1XR0 B;  4QJ5 B;  1PMS A;  5DI9 B;  1DDV A;  2DN6 A;  4HDQ A;  2Z0Q A;  4HAU B;  5HE2 A;  4L6E A;  2OTX A;  2DFK A;  1OQN A;  3FM8 C;  5DIF B;  1WI1 A;  3OAN A;  3ZVR A;  2FJL A;  5C6R A;  4A5K A;  2K2U A;  4MT7 A;  1OMW A;  3WYF B;  5I2S A;  2RRF A;  5J3Y A;  2K2J A;  2D9Y A;  5CLQ B;  2GJY A;  5J3T A;  2DHJ A;  3B77 A;  3PVW A;  4GMX B;  1IRS A;  2V76 A;  4KHB B;  2YF0 A;  5D3X A;  1UPR A;  1W1D A;  3PP2 A;  2YS3 A;  5D3Y A; 
#chains in the Genus database with same CATH homology
 3PVL A;  4ZRK A;  2MWN B;  2UVM A;  3ULC A;  1Y19 B;  1DDM A;  3P7Z A;  2LOX A;  1J0W A;  3U8Z A;  1FGZ A;  4Y94 A;  1MIX A;  4C0A A;  1DDW A;  3D8F A;  2D9V A;  5C79 A;  1BAK A;  4GPT B;  1NTY A;  1ZC3 B;  4GMV A;  4Z2M B;  1V5P A;  3PVU A;  2NMB A;  2CY5 A;  2YS1 A;  3TFM A;  1U5G A;  4A6H A;  1UEF A;  3LJU X;  2MDX A;  1QQG A;  3AU4 A;  1FHX A;  1NTV A;  4D0N B;  2LUL A;  1NU2 A;  4K17 A;  1RJ2 A;  1LB1 A;  4HB4 B;  1I7A A;  2Y8G A;  2GS0 A;  5JP4 A;  1UNR A;  2J0K A;  3F0W A;  2VRW B;  3SUZ A;  4IFS A;  2I5C A;  5C5B A;  2GCL A;  2G35 A;  1P5T A;  5JHH A;  4F7U P;  2LOZ A;  2R09 A;  3FSS A;  2DYQ A;  4YON A;  4A6F A;  1U27 A;  2KCJ A;  2RUK B;  2W2X C;  4F7G A;  2J0J A;  1ZVR A;  2R0D A;  2BCJ A;  2DX1 A;  2ADZ A;  1ZM0 A;  2GCJ A;  4EJN A;  3D8E A;  5J3Q A;  2N0Y A;  4CHJ A;  1E5W A;  1N3H A;  2PZ1 A;  5HE0 A;  1XKE A;  1AWE A;  2CY4 A;  4KAX B;  2VSZ A;  1V61 A;  2ZPY A;  1KZG A;  2DX5 A;  1Y5O A;  3KZ1 A;  2P0H A;  1WG7 A;  2ROZ B;  3VIA A;  1U5D A;  3KY9 A;  1NI2 A;  2H7D A;  1U5F A;  2KUP A;  3SV1 A;  1P6S A;  1H10 A;  1H4R A;  1AQC A;  1K5D B;  1M7R A;  3T06 A;  3VOQ A;  4HB0 B;  1QC6 A;  5KQ4 A;  2LG1 A;  1MPH A;  3PZD A;  4P7I A;  2D9W A;  3X23 A;  1X05 A;  2DTC A;  1MKE A;  3TVV A;  3QWM A;  3FEH A;  5JLJ B;  4Z2N A;  4HB2 B;  1BWN A;  2M14 A;  3AU5 A;  2CAY A;  4ZRI A;  1ISN A;  2J59 M;  2P8V A;  2I1K A;  3F5R A;  5HE1 A;  4F7H A;  2N23 A;  5EFX A;  1U5E A;  2HTH B;  2ROV A;  4WVF B;  1J19 A;  2D10 A;  4K2O A;  2EMT A;  1RRP B;  1MAI A;  1EF1 A;  2I1J A;  2VKI A;  2HE7 A;  1TJ6 A;  1DBH A;  2E2X A;  2I5F A;  3DXE A;  2JP2 A;  3TW1 A;  2EC1 A;  4H8S A;  4HAY B;  1V89 A;  4CHM A;  3QIJ A;  2CRF A;  4PQ0 A;  2Q13 A;  2W2X D;  5LOP B;  1W1G A;  4DXA B;  3MPX A;  3HK0 A;  5LON B;  4PNK A;  2D9X A;  1SGH A;  2ELA A;  4XWX A;  1V5U A;  3TO1 A;  2NZ8 B;  4KHO A;  1BTK A;  2D9Z A;  2RSG A;  2DHI A;  4MY6 A;  2Z0P A;  1K5G B;  2P0F A;  4WSF A;  3U7D A;  2IFS A;  2J0M A;  1MIZ B;  3N7C A;  1FHO A;  3D8D A;  3QBV B;  2RNR B;  2DA0 A;  1FAO A;  3DXC A;  4KVG B;  3ULB A;  2D2Q A;  2COC A;  3SYX A;  4TKN A;  4A6K A;  2KGX B;  3HQC A;  4EKU A;  1GG3 A;  1WJ1 A;  2RLO A;  4DX9 0;  2AEH A;  3DXD A;  1EGX A;  2L2I A;  4HAT B;  1PLS A;  2LYD A;  4MK0 A;  1FOE A;  3P6A A;  4EMO A;  3TCA A;  1Z87 A;  2P0D A;  1XCG A;  4HB3 B;  5HE3 A;  2K00 A;  1Q67 A;  4GZU A;  2YVC A;  3KRX A;  2YS5 A;  5KCV A;  2YT0 A;  4CYE A;  3ML4 A;  2ELB A;  3BIN A;  1ZC4 B;  1EAZ A;  1WVH A;  1M7E A;  1GC6 A;  3O96 A;  2X18 A;  1X11 A;  4DBB A;  2IYB A;  4TYZ A;  2M38 A;  2DLW A;  3V5W A;  2D11 A;  3SO6 A;  2MKR A;  2Y8F A;  5CLL B;  5D27 A;  2RVB B;  4NY0 A;  1DRO A;  1UPQ A;  3BJI A;  5FI0 A;  2COD A;  4B6H A;  2W2W A;  1UNQ A;  1ZSQ A;  1FHW A;  1KZ7 A;  3PSC A;  1FGY A;  5JHG A;  1X86 A;  4HHV A;  3CXB B;  3MDB C;  1X1G A;  3IVF A;  5DHA B;  5DHF B;  2Y7B A;  3PG7 A;  1PFJ A;  1V88 A;  2RGN B;  1XD4 A;  2YT1 A;  2YRY A;  2XQN M;  3ODO A;  3AJ4 A;  3KRW A;  4BBK A;  4YL8 A;  5C5B B;  3ODX A;  5D3V A;  3NSU A;  1FB8 A;  5C16 A;  1U29 A;  2QKL A;  1KI1 B;  1WGU A;  4A6F B;  4ZRJ A;  1V5M A;  4IAP A;  5D3W A;  1UNP A;  4HAZ B;  2Z0O A;  2DYN A;  3A8P A;  3PEG A;  1XX0 A;  1MK7 B;  1BTN A;  1LW3 A;  1XOD A;  2UZS A;  3RCP A;  5FI1 A;  4GN1 A;  4HAX B;  3GYO A;  4DX8 A;  3G9W A;  1SHC A;  1U2B A;  2UZR A;  3ODW A;  1GC7 A;  3A98 B;  4K2P A;  2EJ8 A;  5GOW B;  5L81 A;  2OQB A;  1B55 A;  4WJ7 A;  2MFQ A;  3A8Q A;  1W1H A;  2COF A;  3UZT A;  5KQ1 A;  2LKO A;  2DKP A;  1P3R A;  2COA A;  2D4Q A;  1TXD A;  2EMS A;  3GYP A;  4GXB A;  2DHK A;  2DKQ A;  1WGQ A;  3CIK A;  4NSW A;  5DH9 B;  4HAW B;  1I2H A;  1TQZ A;  1MK9 B;  4HDO A;  3SNH A;  2L1C A;  3KSY A;  3WA0 A;  1WJM A;  1EVH A;  3ZDT A;  3HW2 B;  1OY2 A;  4KHA A;  4HAV B;  2YSZ A;  2QKM A;  2H7E A;  1X1F A;  1DYN A;  4K81 A;  4IOY X;  3M1I B;  2AL6 A;  1XR0 B;  1PMS A;  5DI9 B;  1DDV A;  2DN6 A;  4HDQ A;  2Z0Q A;  4HAU B;  5HE2 A;  4L6E A;  2OTX A;  2DFK A;  1OQN A;  3FM8 C;  5DIF B;  1WI1 A;  3OAN A;  3ZVR A;  2FJL A;  5C6R A;  4A5K A;  2K2U A;  4MT7 A;  1OMW A;  3WYF B;  5J3Y A;  2K2J A;  2D9Y A;  5CLQ B;  2GJY A;  5J3T A;  2DHJ A;  3PVW A;  4GMX B;  1IRS A;  2V76 A;  4KHB B;  2YF0 A;  5D3X A;  1UPR A;  1W1D A;  3PP2 A;  2YS3 A;  5D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...