2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Docking protein 2, isoform a
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
1NI2A 2N23A 4KHBB 2W2WA 4ZRJA 2J59M 2W2XC 2YF0A 1NU2A 2D4QA 1EGXA 3F5RA 1DDVA 2RGNB 2H7DA 5FI0A 1OQNA 1XODA 1W1GA 3PSCA 2DTCA 1GC6A 1Z87A 5LONB 2NZ8B 4P7IA 3SO6A 5C79A 4HAZB 3A8PA 5GOWB 1OMWA 2DA0A 3F0WA 5KQ4A 4CHJA 3GYOA 2XQNM 5JHHA 1E5WA 2OTXA 4XWXA 2D11A 3VOQA 1BTKA 2DKPA 4EJNA 2ELAA 2DX1A 4ZRKA 2W2XD 3QIJA 3FSSA 1WVHA 3P6AA 2Z0OA 2Y7BA 1PLSA 1FAOA 2DYNA 2D9VA 1U5GA 2I5CA 2EC1A 1FB8A 1FGZA 2FJLA 1ZSQA 1H10A 1QC6A 4HB4B 1GC7A 3PG7A 3HW2B 4HB0B 1W1HA 3A8QA 1W1DA 2E2XA 2EJ8A 2P8VA 1MKEA 3G9WA 1LW3A 1K5GB 2Y8FA 5KCVA 1AWEA 1MAIA 1FHWA 2CRFA 2D2QA 1P3RA 3AU4A 1BAKA 4GXBA 1U5FA 2IYBA 3D8DA 3DXCA 2K2UA 3ULBA 2L1CA 2P0DA 4HAWB 2YVCA 3M1IB 1RRPB 4MK0A 3V5WA 1WI1A 2ELBA 1V5UA 3LJUX 3PP2A 4TYZA 2DHKA 1UPRA 2YS5A 4GN1A 4BBKA 1EF1A 1XCGA 3ODWA 1X1GA 1N3HA 2COCA 5J3QA 3TW1A 3SV1A 2DKQA 4WJ7A 3QBVB 4GMXB 5KQ1A 4GMVA 5CLLB 4PQ0A 2BCJA 1QQGA 3TVVA 2ROVA 5L81A 3MPXA 2R09A 2LG1A 4Z2NA 2AEHA 2DHIA 3DXEA 3TFMA 4EKUA 5D3VA 5FI1A 5JP4A 3KY9A 3ODOA 2COAA 1XX0A 1U5DA 3PEGA 2X18A 3VIAA 2VSZA 4A6KA 4Y94A 4F7HA 5DHFB 1X11A 2ROZB 2DYQA 4HAVB 1LB1A 1P5TA 4K2PA 5DI9B 2CY5A 1WJMA 2DN6A 1RJ2A 4DXAB 2LKOA 4F7GA 2LOXA 2RVBB 3BINA 1IRSA 2YS3A 1SHCA 4CHMA 2HE7A 3IVFA 3TO1A 1V5MA 2DX5A 1ZC4B 4HAUB 4HDQA 1P6SA 1V89A 1X1FA 1U29A 3A98B 3KRWA 5EFXA 5C16A 4K17A 2YT1A 5DH9B 3N7CA 4DBBA 1ZC3B 3AJ4A 2Q13A 4KVGB 2J0MA 1PFJA 1AQCA 3HQCA 1WJ1A 2MKRA 1X86A 2UZRA 1BTNA 2RNRB 5C5BA 3P7ZA 3ODXA 1WG7A 1EAZA 1BWNA 4MT7A 3ULCA 1TXDA 2KGXB 4MY6A 4CYEA 5LOPB 1DROA 3UZTA 3KSYA 1K5DB 1ISNA 2LULA 2P0HA 2CODA 1V5PA 2DHJA 1J19A 1ZM0A 4B6HA 5CLQB 4HHVA 2VKIA 2VRWB 2KCJA 5J3YA 4HAXB 2GCLA 2M38A 1J0WA 1MIXA 1SGHA 4KHOA 4TKNA 2L2IA 2NMBA 4A5KA 2D9ZA 1I7AA 1DYNA 2CAYA 2UZSA 1XD4A 2GS0A 2V76A 4WSFA 2YS1A 3D8EA 5JLJB 2P0FA 2MWNB 2I1KA 1U27A 1U2BA 1EVHA 4KHAA 2MFQA 2Y8GA 3SUZA 1Q67A 2HTHB 5D27A 3X23A 2COFA 3ZDTA 2H7EA 4A6FA 4C0AA 1DBHA 3D8FA 5D3YA 3WA0A 3PZDA 2JP2A 3OANA 1UNPA 2J0KA 2D9YA 2QKLA 4F7UP 5JHGA 1TQZA 4EMOA 4GZUA 4WVFB 1XR0B 5C6RA 1DDWA 2RUKB 4K2OA 2G35A 3CXBB 2OQBA 4HAYB 4A6FB 4HB3B 3DXDA 3HK0A 5C5BB 1I2HA 4GPTB 2I5FA 5DIFB 2KUPA 3WYFB 1FOEA 3PVWA 1Y5OA 3QWMA 1GG3A 2PZ1A 5HE0A 4YL8A 5D3XA 1FHXA 3PVLA 3FEHA 1NTVA 1M7RA 3SNHA 3CIKA 3ML4A 2K00A 4NSWA 2Z0PA 5HE3A 1MK7B 3PVUA 3TCAA 2I1JA 2ZPYA 3SYXA 2MDXA 3U8ZA 1NTYA 1ZVRA 4KAXB 1FGYA 2M14A 2R0DA 3T06A 4HB2B 2RSGA 2QKMA 1PMSA 4DX90 5D3WA 4Z2MB 3FM8C 1OY2A 2DFKA 1KI1B 2CY4A 2RLOA 2LOZA 2D9WA 2YRYA 3O96A 4PNKA 4H8SA 1UEFA 5HE2A 2UVMA 1V88A 3RCPA 3AU5A 2YT0A 2J0JA 5DHAB 4NY0A 2ADZA 2YSZA 3KRXA 2LYDA 2N0YA 4IFSA 4L6EA 2D10A 2EMSA 1XKEA 4HDOA 3GYPA 1U5EA 4K81A 3BJIA 1MIZB 1KZ7A 1Y19B 5HE1A 4D0NB 1H4RA 1KZGA 3NSUA 1WGQA 1FHOA 1DDMA 1UPQA 4ZRIA 1MK9B 4DX8A 4YONA 1UNRA 4A6HA 1B55A 1X05A 2IFSA 3U7DA 1V61A 2D9XA 4HATB 4IAPA 1TJ6A 3KZ1A 4IOYX 1MPHA 2AL6A 2GCJA 2GJYA 1M7EA 2K2JA 2Z0QA 5J3TA 1UNQA 1WGUA 3MDBC 2DLWA 2EMTA 3ZVRA
chains in the Genus database with same CATH superfamily
1NI2A 2N23A 4KHBB 2W2WA 4ZRJA 2J59M 2W2XC 2YF0A 1NU2A 2D4QA 1EGXA 5M4YB 3NWDA 3F5RA 1DDVA 4GOUA 2RGNB 2H7DA 5FI0A 1OQNA 1XODA 2R2YA 1W1GA 3PSCA 2DTCA 1GC6A 1Z87A 4KHBA 5LONB 1ZYIA 2NZ8B 4OT1A 4P7IA 3SO6A 5C79A 4HAZB 3A8PA 5GOWB 1OMWA 2DA0A 3F0WA 5KQ4A 4CHJA 3GYOA 2XQNM 5JHHA 1E5WA 2OTXA 4XWXA 2D11A 3VOQA 1BTKA 2DKPA 4EJNA 2ELAA 2KIEA 2DX1A 4ZRKA 5LG4B 2W2XD 3NW8A 3QIJA 3FSSA 1WVHA 3P6AA 2Z0OA 2Y7BA 5I2MA 1PLSA 1FAOA 2DYNA 2D9VA 1U5GA 2I5CA 2EC1A 1FB8A 1FGZA 2FJLA 1ZSQA 1H10A 1QC6A 3HIEA 4HB4B 1GC7A 3PG7A 3HW2B 4HB0B 1W1HA 3A8QA 1W1DA 2E2XA 2EJ8A 2P8VA 1MKEA 3G9WA 1LW3A 1K5GB 2Y8FA 4HSIA 5KCVA 1AWEA 1MAIA 1FHWA 2CRFA 2D2QA 2Z14A 1P3RA 4QJ3B 3AU4A 1BAKA 4GXBA 5I2SA 1U5FA 2IYBA 3D8DA 3DXCA 2K2UA 3ULBA 2L1CA 2P0DA 4HAWB 2YVCA 3M1IB 1RRPB 4MK0A 3V5WA 1WI1A 2ELBA 1V5UA 3LJUX 3PP2A 4TYZA 2DHKA 1UPRA 2YS5A 4GN1A 4BBKA 1EF1A 1XCGA 3ODWA 2Z13A 1X1GA 1N3HA 2KUQA 2COCA 5J3QA 3DCXA 3TW1A 3SV1A 2DKQA 4WJ7A 4QJ4B 3QBVB 4GMXB 5KQ1A 4GMVA 5CLLB 4PQ0A 2BCJA 1QQGA 3TVVA 2ROVA 5L81A 3MPXA 2R09A 2LG1A 4Z2NA 2AEHA 2DHIA 3DXEA 3TFMA 4EKUA 5D3VA 5FI1A 5JP4A 3KY9A 3ODOA 2COAA 4L1RA 1XX0A 1U5DA 3PEGA 2X18A 3VIAA 2VSZA 4A6KA 2NBVA 4Y94A 4F7HA 5DHFB 1X11A 2ROZB 2DYQA 3OHMB 4HAVB 1LB1A 1P5TA 4K2PA 5DI9B 2CY5A 1WJMA 2DN6A 1RJ2A 4DXAB 2LKOA 4F7GA 2LOXA 2RVBB 3BINA 1IRSA 2YS3A 1SHCA 3A58A 4CHMA 2HE7A 3IVFA 3TO1A 1V5MA 2DX5A 1ZC4B 4HAUB 4HDQA 4CSQA 1P6SA 1V89A 1X1FA 2Z59A 1U29A 3A98B 3KRWA 5EFXA 5C16A 4K17A 2YT1A 5DH9B 3N7CA 4DBBA 1ZC3B 3AJ4A 2Q13A 4KVGB 2J0MA 3U12A 1PFJA 1AQCA 3HQCA 1WJ1A 2MKRA 1X86A 2UZRA 1BTNA 2RNRB 5C5BA 3P7ZA 3ODXA 1WG7A 1EAZA 1BWNA 4MT7A 3ULCA 1TXDA 2KGXB 4MY6A 4CYEA 5LOPB 1DROA 3UZTA 3KSYA 2K49A 1K5DB 1ISNA 2LULA 2P0HA 2CODA 2GUMA 1V5PA 2DHJA 1J19A 1ZM0A 4B6HA 5CLQB 4HHVA 2VKIA 2VRWB 2KCJA 5J3YA 4HAXB 2GCLA 2M38A 1J0WA 1MIXA 1SGHA 4QJ5B 4KHOA 4TKNA 2L2IA 2NMBA 4A5KA 2D9ZA 1I7AA 1DYNA 2CAYA 2UZSA 1XD4A 2GS0A 2V76A 4WSFA 2YS1A 1MI1A 3D8EA 3B77A 1T77A 5JLJB 2P0FA 2MWNB 2I1KA 1U27A 1U2BA 1EVHA 4KHAA 2MFQA 2Y8GA 3SUZA 1Q67A 2HTHB 5D27A 3X23A 2COFA 3ZDTA 2H7EA 4A6FA 4D6WA 4C0AA 1DBHA 3D8FA 5D3YA 3WA0A 3PZDA 2JP2A 3OANA 1UNPA 2J0KA 2D9YA 2QKLA 4F7UP 5JHGA 2RRFA 1TQZA 4QXAB 4EMOA 4GZUA 3FVCA 4WVFB 1XR0B 5C6RA 1DDWA 2RUKB 4K2OA 2G35A 3CXBB 2OQBA 4HAYB 4A6FB 4HB3B 3DXDA 3HK0A 5C5BB 1I2HA 4GPTB 2I5FA 5DIFB 2KUPA 2Z4DA 3WYFB 1FOEA 3PVWA 1Y5OA 3QWMA 2ZKMX 1GG3A 2PZ1A 5HE0A 2KR0A 4YL8A 5D3XA 1FHXA 3PVLA 3FEHA 1NTVA 1M7RA 3SNHA 3CIKA 3ML4A 2K00A 4GNKB 4NSWA 2Z0PA 5HE3A 1MK7B 3PVUA 3TCAA 2I1JA 2ZPYA 3SYXA 2MDXA 3U8ZA 1NTYA 1ZVRA 4KAXB 1FGYA 2KIGA 2M14A 2R0DA 3T06A 4HB2B 4OSNA 2RSGA 2QKMA 1PMSA 4DX90 5D3WA 4Z2MB 3FM8C 1OY2A 2DFKA 1KI1B 2CY4A 2RLOA 2LOZA 2D9WA 2YRYA 2FJUB 3O96A 2YT2A 4PNKA 4H8SA 1UEFA 5HE2A 2UVMA 1V88A 3RCPA 3AU5A 2YT0A 2J0JA 5DHAB 4NY0A 2ADZA 2YSZA 3KRXA 2LYDA 2N0YA 4IFSA 4L6EA 2D10A 2EMSA 1XKEA 4DIXA 4HDOA 3GYPA 1U5EA 4K81A 3BJIA 1MIZB 1KZ7A 1Y19B 3NWFA 5HE1A 4D0NB 1H4RA 1KZGA 3NSUA 1WGQA 1FHOA 1DDMA 1UPQA 4ZRIA 1MK9B 4DX8A 2K8EA 4YONA 1UNRA 4A6HA 1B55A 1X05A 2IFSA 3U7DA 3NWAA 1V61A 2D9XA 4HATB 1TJ6A 4IAPA 3KZ1A 4IOYX 1MPHA 5IRSA 2AL6A 2GCJA 2GJYA 1M7EA 2K2JA 2Z0QA 5J3TA 1UNQA 3HSAA 1WGUA 3MDBC 2DLWA 2EMTA 3ZVRA
chains in the Genus database with same CATH topology
1NI2A 2N23A 4KHBB 2W2WA 4ZRJA 2J59M 2W2XC 2YF0A 1NU2A 2D4QA 1EGXA 3F5RA 1DDVA 2RGNB 2H7DA 5FI0A 1OQNA 1XODA 1W1GA 3PSCA 2DTCA 1GC6A 1Z87A 5LONB 2NZ8B 4P7IA 3SO6A 5C79A 4HAZB 3A8PA 5GOWB 1OMWA 2DA0A 3F0WA 5KQ4A 4CHJA 3GYOA 2XQNM 5JHHA 1E5WA 2OTXA 4XWXA 2D11A 3VOQA 1BTKA 2DKPA 4EJNA 2ELAA 2DX1A 4ZRKA 2W2XD 3QIJA 3FSSA 1WVHA 3P6AA 2Z0OA 2Y7BA 1PLSA 1FAOA 2DYNA 2D9VA 1U5GA 2I5CA 2EC1A 1FB8A 1FGZA 2FJLA 1ZSQA 1H10A 1QC6A 4HB4B 1GC7A 3PG7A 3HW2B 4HB0B 1W1HA 3A8QA 1W1DA 2E2XA 2EJ8A 2P8VA 1MKEA 3G9WA 1LW3A 1K5GB 2Y8FA 5KCVA 1AWEA 1MAIA 1FHWA 2CRFA 2D2QA 1P3RA 3AU4A 1BAKA 4GXBA 1U5FA 2IYBA 3D8DA 3DXCA 2K2UA 3ULBA 2L1CA 2P0DA 4HAWB 2YVCA 3M1IB 1RRPB 4MK0A 3V5WA 1WI1A 2ELBA 1V5UA 3LJUX 3PP2A 4TYZA 2DHKA 1UPRA 2YS5A 4GN1A 4BBKA 1EF1A 1XCGA 3ODWA 1X1GA 1N3HA 2COCA 5J3QA 3TW1A 3SV1A 2DKQA 4WJ7A 3QBVB 4GMXB 5KQ1A 4GMVA 5CLLB 4PQ0A 2BCJA 1QQGA 3TVVA 2ROVA 5L81A 3MPXA 2R09A 2LG1A 4Z2NA 2AEHA 2DHIA 3DXEA 3TFMA 4EKUA 5D3VA 5FI1A 5JP4A 3KY9A 3ODOA 2COAA 1XX0A 1U5DA 3PEGA 2X18A 3VIAA 2VSZA 4A6KA 4Y94A 4F7HA 5DHFB 1X11A 2ROZB 2DYQA 4HAVB 1LB1A 1P5TA 4K2PA 5DI9B 2CY5A 1WJMA 2DN6A 1RJ2A 4DXAB 2LKOA 4F7GA 2LOXA 2RVBB 3BINA 1IRSA 2YS3A 1SHCA 4CHMA 2HE7A 3IVFA 3TO1A 1V5MA 2DX5A 1ZC4B 4HAUB 4HDQA 1P6SA 1V89A 1X1FA 1U29A 3A98B 3KRWA 5EFXA 5C16A 4K17A 2YT1A 5DH9B 3N7CA 4DBBA 1ZC3B 3AJ4A 2Q13A 4KVGB 2J0MA 1PFJA 1AQCA 3HQCA 1WJ1A 2MKRA 1X86A 2UZRA 1BTNA 2RNRB 5C5BA 3P7ZA 3ODXA 1WG7A 1EAZA 1BWNA 4MT7A 3ULCA 1TXDA 2KGXB 4MY6A 4CYEA 5LOPB 1DROA 3UZTA 3KSYA 1K5DB 1ISNA 2LULA 2P0HA 2CODA 1V5PA 2DHJA 1J19A 1ZM0A 4B6HA 5CLQB 4HHVA 2VKIA 2VRWB 2KCJA 5J3YA 4HAXB 2GCLA 2M38A 1J0WA 1MIXA 1SGHA 4KHOA 4TKNA 2L2IA 2NMBA 4A5KA 2D9ZA 1I7AA 1DYNA 2CAYA 2UZSA 1XD4A 2GS0A 2V76A 4WSFA 2YS1A 3D8EA 5JLJB 2P0FA 2MWNB 2I1KA 1U27A 1U2BA 1EVHA 4KHAA 2MFQA 2Y8GA 3SUZA 1Q67A 2HTHB 5D27A 3X23A 2COFA 3ZDTA 2H7EA 4A6FA 4C0AA 1DBHA 3D8FA 5D3YA 3WA0A 3PZDA 2JP2A 3OANA 1UNPA 2J0KA 2D9YA 2QKLA 4F7UP 5JHGA 1TQZA 4EMOA 4GZUA 4WVFB 1XR0B 5C6RA 1DDWA 2RUKB 4K2OA 2G35A 3CXBB 2OQBA 4HAYB 4A6FB 4HB3B 3DXDA 3HK0A 5C5BB 1I2HA 4GPTB 2I5FA 5DIFB 2KUPA 3WYFB 1FOEA 3PVWA 1Y5OA 3QWMA 1GG3A 2PZ1A 5HE0A 4YL8A 5D3XA 1FHXA 3PVLA 3FEHA 1NTVA 1M7RA 3SNHA 3CIKA 3ML4A 2K00A 4NSWA 2Z0PA 5HE3A 1MK7B 3PVUA 3TCAA 2I1JA 2ZPYA 3SYXA 2MDXA 3U8ZA 1NTYA 1ZVRA 4KAXB 1FGYA 2M14A 2R0DA 3T06A 4HB2B 2RSGA 2QKMA 1PMSA 4DX90 5D3WA 4Z2MB 3FM8C 1OY2A 2DFKA 1KI1B 2CY4A 2RLOA 2LOZA 2D9WA 2YRYA 3O96A 4PNKA 4H8SA 1UEFA 5HE2A 2UVMA 1V88A 3RCPA 3AU5A 2YT0A 2J0JA 5DHAB 4NY0A 2ADZA 2YSZA 3KRXA 2LYDA 2N0YA 4IFSA 4L6EA 2D10A 2EMSA 1XKEA 4HDOA 3GYPA 1U5EA 4K81A 3BJIA 1MIZB 1KZ7A 1Y19B 5HE1A 4D0NB 1H4RA 1KZGA 3NSUA 1WGQA 1FHOA 1DDMA 1UPQA 4ZRIA 1MK9B 4DX8A 4YONA 1UNRA 4A6HA 1B55A 1X05A 2IFSA 3U7DA 1V61A 2D9XA 4HATB 4IAPA 1TJ6A 3KZ1A 4IOYX 1MPHA 2AL6A 2GCJA 2GJYA 1M7EA 2K2JA 2Z0QA 5J3TA 1UNQA 1WGUA 3MDBC 2DLWA 2EMTA 3ZVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  2N23 A;  4KHB B;  2W2W A;  4ZRJ A;  2J59 M;  2W2X C;  2YF0 A;  1NU2 A;  2D4Q A;  1EGX A;  3F5R A;  1DDV A;  2RGN B;  2H7D A;  5FI0 A;  1OQN A;  1XOD A;  1W1G A;  3PSC A;  2DTC A;  1GC6 A;  1Z87 A;  5LON B;  2NZ8 B;  4P7I A;  3SO6 A;  5C79 A;  4HAZ B;  3A8P A;  5GOW B;  1OMW A;  2DA0 A;  3F0W A;  5KQ4 A;  4CHJ A;  3GYO A;  2XQN M;  5JHH A;  1E5W A;  2OTX A;  4XWX A;  2D11 A;  3VOQ A;  1BTK A;  2DKP A;  4EJN A;  2ELA A;  2DX1 A;  4ZRK A;  2W2X D;  3QIJ A;  3FSS A;  1WVH A;  3P6A A;  2Z0O A;  2Y7B A;  1PLS A;  1FAO A;  2DYN A;  2D9V A;  1U5G A;  2I5C A;  2EC1 A;  1FB8 A;  1FGZ A;  2FJL A;  1ZSQ A;  1H10 A;  1QC6 A;  4HB4 B;  1GC7 A;  3PG7 A;  3HW2 B;  4HB0 B;  1W1H A;  3A8Q A;  1W1D A;  2E2X A;  2EJ8 A;  2P8V A;  1MKE A;  3G9W A;  1LW3 A;  1K5G B;  2Y8F A;  5KCV A;  1AWE A;  1MAI A;  1FHW A;  2CRF A;  2D2Q A;  1P3R A;  3AU4 A;  1BAK A;  4GXB A;  1U5F A;  2IYB A;  3D8D A;  3DXC A;  2K2U A;  3ULB A;  2L1C A;  2P0D A;  4HAW B;  2YVC A;  3M1I B;  1RRP B;  4MK0 A;  3V5W A;  1WI1 A;  2ELB A;  1V5U A;  3LJU X;  3PP2 A;  4TYZ A;  2DHK A;  1UPR A;  2YS5 A;  4GN1 A;  4BBK A;  1EF1 A;  1XCG A;  3ODW A;  1X1G A;  1N3H A;  2COC A;  5J3Q A;  3TW1 A;  3SV1 A;  2DKQ A;  4WJ7 A;  3QBV B;  4GMX B;  5KQ1 A;  4GMV A;  5CLL B;  4PQ0 A;  2BCJ A;  1QQG A;  3TVV A;  2ROV A;  5L81 A;  3MPX A;  2R09 A;  2LG1 A;  4Z2N A;  2AEH A;  2DHI A;  3DXE A;  3TFM A;  4EKU A;  5D3V A;  5FI1 A;  5JP4 A;  3KY9 A;  3ODO A;  2COA A;  1XX0 A;  1U5D A;  3PEG A;  2X18 A;  3VIA A;  2VSZ A;  4A6K A;  4Y94 A;  4F7H A;  5DHF B;  1X11 A;  2ROZ B;  2DYQ A;  4HAV B;  1LB1 A;  1P5T A;  4K2P A;  5DI9 B;  2CY5 A;  1WJM A;  2DN6 A;  1RJ2 A;  4DXA B;  2LKO A;  4F7G A;  2LOX A;  2RVB B;  3BIN A;  1IRS A;  2YS3 A;  1SHC A;  4CHM A;  2HE7 A;  3IVF A;  3TO1 A;  1V5M A;  2DX5 A;  1ZC4 B;  4HAU B;  4HDQ A;  1P6S A;  1V89 A;  1X1F A;  1U29 A;  3A98 B;  3KRW A;  5EFX A;  5C16 A;  4K17 A;  2YT1 A;  5DH9 B;  3N7C A;  4DBB A;  1ZC3 B;  3AJ4 A;  2Q13 A;  4KVG B;  2J0M A;  1PFJ A;  1AQC A;  3HQC A;  1WJ1 A;  2MKR A;  1X86 A;  2UZR A;  1BTN A;  2RNR B;  5C5B A;  3P7Z A;  3ODX A;  1WG7 A;  1EAZ A;  1BWN A;  4MT7 A;  3ULC A;  1TXD A;  2KGX B;  4MY6 A;  4CYE A;  5LOP B;  1DRO A;  3UZT A;  3KSY A;  1K5D B;  1ISN A;  2LUL A;  2P0H A;  2COD A;  1V5P A;  2DHJ A;  1J19 A;  1ZM0 A;  4B6H A;  5CLQ B;  4HHV A;  2VKI A;  2VRW B;  2KCJ A;  5J3Y A;  4HAX B;  2GCL A;  2M38 A;  1J0W A;  1MIX A;  1SGH A;  4KHO A;  4TKN A;  2L2I A;  2NMB A;  4A5K A;  2D9Z A;  1I7A A;  1DYN A;  2CAY A;  2UZS A;  1XD4 A;  2GS0 A;  2V76 A;  4WSF A;  2YS1 A;  3D8E A;  5JLJ B;  2P0F A;  2MWN B;  2I1K A;  1U27 A;  1U2B A;  1EVH A;  4KHA A;  2MFQ A;  2Y8G A;  3SUZ A;  1Q67 A;  2HTH B;  5D27 A;  3X23 A;  2COF A;  3ZDT A;  2H7E A;  4A6F A;  4C0A A;  1DBH A;  3D8F A;  5D3Y A;  3WA0 A;  3PZD A;  2JP2 A;  3OAN A;  1UNP A;  2J0K A;  2D9Y A;  2QKL A;  4F7U P;  5JHG A;  1TQZ A;  4EMO A;  4GZU A;  4WVF B;  1XR0 B;  5C6R A;  1DDW A;  2RUK B;  4K2O A;  2G35 A;  3CXB B;  2OQB A;  4HAY B;  4A6F B;  4HB3 B;  3DXD A;  3HK0 A;  5C5B B;  1I2H A;  4GPT B;  2I5F A;  5DIF B;  2KUP A;  3WYF B;  1FOE A;  3PVW A;  1Y5O A;  3QWM A;  1GG3 A;  2PZ1 A;  5HE0 A;  4YL8 A;  5D3X A;  1FHX A;  3PVL A;  3FEH A;  1NTV A;  1M7R A;  3SNH A;  3CIK A;  3ML4 A;  2K00 A;  4NSW A;  2Z0P A;  5HE3 A;  1MK7 B;  3PVU A;  3TCA A;  2I1J A;  2ZPY A;  3SYX A;  2MDX A;  3U8Z A;  1NTY A;  1ZVR A;  4KAX B;  1FGY A;  2M14 A;  2R0D A;  3T06 A;  4HB2 B;  2RSG A;  2QKM A;  1PMS A;  4DX9 0;  5D3W A;  4Z2M B;  3FM8 C;  1OY2 A;  2DFK A;  1KI1 B;  2CY4 A;  2RLO A;  2LOZ A;  2D9W A;  2YRY A;  3O96 A;  4PNK A;  4H8S A;  1UEF A;  5HE2 A;  2UVM A;  1V88 A;  3RCP A;  3AU5 A;  2YT0 A;  2J0J A;  5DHA B;  4NY0 A;  2ADZ A;  2YSZ A;  3KRX A;  2LYD A;  2N0Y A;  4IFS A;  4L6E A;  2D10 A;  2EMS A;  1XKE A;  4HDO A;  3GYP A;  1U5E A;  4K81 A;  3BJI A;  1MIZ B;  1KZ7 A;  1Y19 B;  5HE1 A;  4D0N B;  1H4R A;  1KZG A;  3NSU A;  1WGQ A;  1FHO A;  1DDM A;  1UPQ A;  4ZRI A;  1MK9 B;  4DX8 A;  4YON A;  1UNR A;  4A6H A;  1B55 A;  1X05 A;  2IFS A;  3U7D A;  1V61 A;  2D9X A;  4HAT B;  4IAP A;  1TJ6 A;  3KZ1 A;  4IOY X;  1MPH A;  2AL6 A;  2GCJ A;  2GJY A;  1M7E A;  2K2J A;  2Z0Q A;  5J3T A;  1UNQ A;  1WGU A;  3MDB C;  2DLW A;  2EMT A;  3ZVR A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  2N23 A;  4KHB B;  2W2W A;  4ZRJ A;  2J59 M;  2W2X C;  2YF0 A;  1NU2 A;  2D4Q A;  1EGX A;  5M4Y B;  3NWD A;  3F5R A;  1DDV A;  4GOU A;  2RGN B;  2H7D A;  5FI0 A;  1OQN A;  1XOD A;  2R2Y A;  1W1G A;  3PSC A;  2DTC A;  1GC6 A;  1Z87 A;  4KHB A;  5LON B;  1ZYI A;  2NZ8 B;  4OT1 A;  4P7I A;  3SO6 A;  5C79 A;  4HAZ B;  3A8P A;  5GOW B;  1OMW A;  2DA0 A;  3F0W A;  5KQ4 A;  4CHJ A;  3GYO A;  2XQN M;  5JHH A;  1E5W A;  2OTX A;  4XWX A;  2D11 A;  3VOQ A;  1BTK A;  2DKP A;  4EJN A;  2ELA A;  2KIE A;  2DX1 A;  4ZRK A;  5LG4 B;  2W2X D;  3NW8 A;  3QIJ A;  3FSS A;  1WVH A;  3P6A A;  2Z0O A;  2Y7B A;  5I2M A;  1PLS A;  1FAO A;  2DYN A;  2D9V A;  1U5G A;  2I5C A;  2EC1 A;  1FB8 A;  1FGZ A;  2FJL A;  1ZSQ A;  1H10 A;  1QC6 A;  3HIE A;  4HB4 B;  1GC7 A;  3PG7 A;  3HW2 B;  4HB0 B;  1W1H A;  3A8Q A;  1W1D A;  2E2X A;  2EJ8 A;  2P8V A;  1MKE A;  3G9W A;  1LW3 A;  1K5G B;  2Y8F A;  4HSI A;  5KCV A;  1AWE A;  1MAI A;  1FHW A;  2CRF A;  2D2Q A;  2Z14 A;  1P3R A;  4QJ3 B;  3AU4 A;  1BAK A;  4GXB A;  5I2S A;  1U5F A;  2IYB A;  3D8D A;  3DXC A;  2K2U A;  3ULB A;  2L1C A;  2P0D A;  4HAW B;  2YVC A;  3M1I B;  1RRP B;  4MK0 A;  3V5W A;  1WI1 A;  2ELB A;  1V5U A;  3LJU X;  3PP2 A;  4TYZ A;  2DHK A;  1UPR A;  2YS5 A;  4GN1 A;  4BBK A;  1EF1 A;  1XCG A;  3ODW A;  2Z13 A;  1X1G A;  1N3H A;  2KUQ A;  2COC A;  5J3Q A;  3DCX A;  3TW1 A;  3SV1 A;  2DKQ A;  4WJ7 A;  4QJ4 B;  3QBV B;  4GMX B;  5KQ1 A;  4GMV A;  5CLL B;  4PQ0 A;  2BCJ A;  1QQG A;  3TVV A;  2ROV A;  5L81 A;  3MPX A;  2R09 A;  2LG1 A;  4Z2N A;  2AEH A;  2DHI A;  3DXE A;  3TFM A;  4EKU A;  5D3V A;  5FI1 A;  5JP4 A;  3KY9 A;  3ODO A;  2COA A;  4L1R A;  1XX0 A;  1U5D A;  3PEG A;  2X18 A;  3VIA A;  2VSZ A;  4A6K A;  2NBV A;  4Y94 A;  4F7H A;  5DHF B;  1X11 A;  2ROZ B;  2DYQ A;  3OHM B;  4HAV B;  1LB1 A;  1P5T A;  4K2P A;  5DI9 B;  2CY5 A;  1WJM A;  2DN6 A;  1RJ2 A;  4DXA B;  2LKO A;  4F7G A;  2LOX A;  2RVB B;  3BIN A;  1IRS A;  2YS3 A;  1SHC A;  3A58 A;  4CHM A;  2HE7 A;  3IVF A;  3TO1 A;  1V5M A;  2DX5 A;  1ZC4 B;  4HAU B;  4HDQ A;  4CSQ A;  1P6S A;  1V89 A;  1X1F A;  2Z59 A;  1U29 A;  3A98 B;  3KRW A;  5EFX A;  5C16 A;  4K17 A;  2YT1 A;  5DH9 B;  3N7C A;  4DBB A;  1ZC3 B;  3AJ4 A;  2Q13 A;  4KVG B;  2J0M A;  3U12 A;  1PFJ A;  1AQC A;  3HQC A;  1WJ1 A;  2MKR A;  1X86 A;  2UZR A;  1BTN A;  2RNR B;  5C5B A;  3P7Z A;  3ODX A;  1WG7 A;  1EAZ A;  1BWN A;  4MT7 A;  3ULC A;  1TXD A;  2KGX B;  4MY6 A;  4CYE A;  5LOP B;  1DRO A;  3UZT A;  3KSY A;  2K49 A;  1K5D B;  1ISN A;  2LUL A;  2P0H A;  2COD A;  2GUM A;  1V5P A;  2DHJ A;  1J19 A;  1ZM0 A;  4B6H A;  5CLQ B;  4HHV A;  2VKI A;  2VRW B;  2KCJ A;  5J3Y A;  4HAX B;  2GCL A;  2M38 A;  1J0W A;  1MIX A;  1SGH A;  4QJ5 B;  4KHO A;  4TKN A;  2L2I A;  2NMB A;  4A5K A;  2D9Z A;  1I7A A;  1DYN A;  2CAY A;  2UZS A;  1XD4 A;  2GS0 A;  2V76 A;  4WSF A;  2YS1 A;  1MI1 A;  3D8E A;  3B77 A;  1T77 A;  5JLJ B;  2P0F A;  2MWN B;  2I1K A;  1U27 A;  1U2B A;  1EVH A;  4KHA A;  2MFQ A;  2Y8G A;  3SUZ A;  1Q67 A;  2HTH B;  5D27 A;  3X23 A;  2COF A;  3ZDT A;  2H7E A;  4A6F A;  4D6W A;  4C0A A;  1DBH A;  3D8F A;  5D3Y A;  3WA0 A;  3PZD A;  2JP2 A;  3OAN A;  1UNP A;  2J0K A;  2D9Y A;  2QKL A;  4F7U P;  5JHG A;  2RRF A;  1TQZ A;  4QXA B;  4EMO A;  4GZU A;  3FVC A;  4WVF B;  1XR0 B;  5C6R A;  1DDW A;  2RUK B;  4K2O A;  2G35 A;  3CXB B;  2OQB A;  4HAY B;  4A6F B;  4HB3 B;  3DXD A;  3HK0 A;  5C5B B;  1I2H A;  4GPT B;  2I5F A;  5DIF B;  2KUP A;  2Z4D A;  3WYF B;  1FOE A;  3PVW A;  1Y5O A;  3QWM A;  2ZKM X;  1GG3 A;  2PZ1 A;  5HE0 A;  2KR0 A;  4YL8 A;  5D3X A;  1FHX A;  3PVL A;  3FEH A;  1NTV A;  1M7R A;  3SNH A;  3CIK A;  3ML4 A;  2K00 A;  4GNK B;  4NSW A;  2Z0P A;  5HE3 A;  1MK7 B;  3PVU A;  3TCA A;  2I1J A;  2ZPY A;  3SYX A;  2MDX A;  3U8Z A;  1NTY A;  1ZVR A;  4KAX B;  1FGY A;  2KIG A;  2M14 A;  2R0D A;  3T06 A;  4HB2 B;  4OSN A;  2RSG A;  2QKM A;  1PMS A;  4DX9 0;  5D3W A;  4Z2M B;  3FM8 C;  1OY2 A;  2DFK A;  1KI1 B;  2CY4 A;  2RLO A;  2LOZ A;  2D9W A;  2YRY A;  2FJU B;  3O96 A;  2YT2 A;  4PNK A;  4H8S A;  1UEF A;  5HE2 A;  2UVM A;  1V88 A;  3RCP A;  3AU5 A;  2YT0 A;  2J0J A;  5DHA B;  4NY0 A;  2ADZ A;  2YSZ A;  3KRX A;  2LYD A;  2N0Y A;  4IFS A;  4L6E A;  2D10 A;  2EMS A;  1XKE A;  4DIX A;  4HDO A;  3GYP A;  1U5E A;  4K81 A;  3BJI A;  1MIZ B;  1KZ7 A;  1Y19 B;  3NWF A;  5HE1 A;  4D0N B;  1H4R A;  1KZG A;  3NSU A;  1WGQ A;  1FHO A;  1DDM A;  1UPQ A;  4ZRI A;  1MK9 B;  4DX8 A;  2K8E A;  4YON A;  1UNR A;  4A6H A;  1B55 A;  1X05 A;  2IFS A;  3U7D A;  3NWA A;  1V61 A;  2D9X A;  4HAT B;  1TJ6 A;  4IAP A;  3KZ1 A;  4IOY X;  1MPH A;  5IRS A;  2AL6 A;  2GCJ A;  2GJY A;  1M7E A;  2K2J A;  2Z0Q A;  5J3T A;  1UNQ A;  3HSA A;  1WGU A;  3MDB C;  2DLW A;  2EMT A;  3ZVR A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  2N23 A;  4KHB B;  2W2W A;  4ZRJ A;  2J59 M;  2W2X C;  2YF0 A;  1NU2 A;  2D4Q A;  1EGX A;  3F5R A;  1DDV A;  2RGN B;  2H7D A;  5FI0 A;  1OQN A;  1XOD A;  1W1G A;  3PSC A;  2DTC A;  1GC6 A;  1Z87 A;  5LON B;  2NZ8 B;  4P7I A;  3SO6 A;  5C79 A;  4HAZ B;  3A8P A;  5GOW B;  1OMW A;  2DA0 A;  3F0W A;  5KQ4 A;  4CHJ A;  3GYO A;  2XQN M;  5JHH A;  1E5W A;  2OTX A;  4XWX A;  2D11 A;  3VOQ A;  1BTK A;  2DKP A;  4EJN A;  2ELA A;  2DX1 A;  4ZRK A;  2W2X D;  3QIJ A;  3FSS A;  1WVH A;  3P6A A;  2Z0O A;  2Y7B A;  1PLS A;  1FAO A;  2DYN A;  2D9V A;  1U5G A;  2I5C A;  2EC1 A;  1FB8 A;  1FGZ A;  2FJL A;  1ZSQ A;  1H10 A;  1QC6 A;  4HB4 B;  1GC7 A;  3PG7 A;  3HW2 B;  4HB0 B;  1W1H A;  3A8Q A;  1W1D A;  2E2X A;  2EJ8 A;  2P8V A;  1MKE A;  3G9W A;  1LW3 A;  1K5G B;  2Y8F A;  5KCV A;  1AWE A;  1MAI A;  1FHW A;  2CRF A;  2D2Q A;  1P3R A;  3AU4 A;  1BAK A;  4GXB A;  1U5F A;  2IYB A;  3D8D A;  3DXC A;  2K2U A;  3ULB A;  2L1C A;  2P0D A;  4HAW B;  2YVC A;  3M1I B;  1RRP B;  4MK0 A;  3V5W A;  1WI1 A;  2ELB A;  1V5U A;  3LJU X;  3PP2 A;  4TYZ A;  2DHK A;  1UPR A;  2YS5 A;  4GN1 A;  4BBK A;  1EF1 A;  1XCG A;  3ODW A;  1X1G A;  1N3H A;  2COC A;  5J3Q A;  3TW1 A;  3SV1 A;  2DKQ A;  4WJ7 A;  3QBV B;  4GMX B;  5KQ1 A;  4GMV A;  5CLL B;  4PQ0 A;  2BCJ A;  1QQG A;  3TVV A;  2ROV A;  5L81 A;  3MPX A;  2R09 A;  2LG1 A;  4Z2N A;  2AEH A;  2DHI A;  3DXE A;  3TFM A;  4EKU A;  5D3V A;  5FI1 A;  5JP4 A;  3KY9 A;  3ODO A;  2COA A;  1XX0 A;  1U5D A;  3PEG A;  2X18 A;  3VIA A;  2VSZ A;  4A6K A;  4Y94 A;  4F7H A;  5DHF B;  1X11 A;  2ROZ B;  2DYQ A;  4HAV B;  1LB1 A;  1P5T A;  4K2P A;  5DI9 B;  2CY5 A;  1WJM A;  2DN6 A;  1RJ2 A;  4DXA B;  2LKO A;  4F7G A;  2LOX A;  2RVB B;  3BIN A;  1IRS A;  2YS3 A;  1SHC A;  4CHM A;  2HE7 A;  3IVF A;  3TO1 A;  1V5M A;  2DX5 A;  1ZC4 B;  4HAU B;  4HDQ A;  1P6S A;  1V89 A;  1X1F A;  1U29 A;  3A98 B;  3KRW A;  5EFX A;  5C16 A;  4K17 A;  2YT1 A;  5DH9 B;  3N7C A;  4DBB A;  1ZC3 B;  3AJ4 A;  2Q13 A;  4KVG B;  2J0M A;  1PFJ A;  1AQC A;  3HQC A;  1WJ1 A;  2MKR A;  1X86 A;  2UZR A;  1BTN A;  2RNR B;  5C5B A;  3P7Z A;  3ODX A;  1WG7 A;  1EAZ A;  1BWN A;  4MT7 A;  3ULC A;  1TXD A;  2KGX B;  4MY6 A;  4CYE A;  5LOP B;  1DRO A;  3UZT A;  3KSY A;  1K5D B;  1ISN A;  2LUL A;  2P0H A;  2COD A;  1V5P A;  2DHJ A;  1J19 A;  1ZM0 A;  4B6H A;  5CLQ B;  4HHV A;  2VKI A;  2VRW B;  2KCJ A;  5J3Y A;  4HAX B;  2GCL A;  2M38 A;  1J0W A;  1MIX A;  1SGH A;  4KHO A;  4TKN A;  2L2I A;  2NMB A;  4A5K A;  2D9Z A;  1I7A A;  1DYN A;  2CAY A;  2UZS A;  1XD4 A;  2GS0 A;  2V76 A;  4WSF A;  2YS1 A;  3D8E A;  5JLJ B;  2P0F A;  2MWN B;  2I1K A;  1U27 A;  1U2B A;  1EVH A;  4KHA A;  2MFQ A;  2Y8G A;  3SUZ A;  1Q67 A;  2HTH B;  5D27 A;  3X23 A;  2COF A;  3ZDT A;  2H7E A;  4A6F A;  4C0A A;  1DBH A;  3D8F A;  5D3Y A;  3WA0 A;  3PZD A;  2JP2 A;  3OAN A;  1UNP A;  2J0K A;  2D9Y A;  2QKL A;  4F7U P;  5JHG A;  1TQZ A;  4EMO A;  4GZU A;  4WVF B;  1XR0 B;  5C6R A;  1DDW A;  2RUK B;  4K2O A;  2G35 A;  3CXB B;  2OQB A;  4HAY B;  4A6F B;  4HB3 B;  3DXD A;  3HK0 A;  5C5B B;  1I2H A;  4GPT B;  2I5F A;  5DIF B;  2KUP A;  3WYF B;  1FOE A;  3PVW A;  1Y5O A;  3QWM A;  1GG3 A;  2PZ1 A;  5HE0 A;  4YL8 A;  5D3X A;  1FHX A;  3PVL A;  3FEH A;  1NTV A;  1M7R A;  3SNH A;  3CIK A;  3ML4 A;  2K00 A;  4NSW A;  2Z0P A;  5HE3 A;  1MK7 B;  3PVU A;  3TCA A;  2I1J A;  2ZPY A;  3SYX A;  2MDX A;  3U8Z A;  1NTY A;  1ZVR A;  4KAX B;  1FGY A;  2M14 A;  2R0D A;  3T06 A;  4HB2 B;  2RSG A;  2QKM A;  1PMS A;  4DX9 0;  5D3W A;  4Z2M B;  3FM8 C;  1OY2 A;  2DFK A;  1KI1 B;  2CY4 A;  2RLO A;  2LOZ A;  2D9W A;  2YRY A;  3O96 A;  4PNK A;  4H8S A;  1UEF A;  5HE2 A;  2UVM A;  1V88 A;  3RCP A;  3AU5 A;  2YT0 A;  2J0J A;  5DHA B;  4NY0 A;  2ADZ A;  2YSZ A;  3KRX A;  2LYD A;  2N0Y A;  4IFS A;  4L6E A;  2D10 A;  2EMS A;  1XKE A;  4HDO A;  3GYP A;  1U5E A;  4K81 A;  3BJI A;  1MIZ B;  1KZ7 A;  1Y19 B;  5HE1 A;  4D0N B;  1H4R A;  1KZG A;  3NSU A;  1WGQ A;  1FHO A;  1DDM A;  1UPQ A;  4ZRI A;  1MK9 B;  4DX8 A;  4YON A;  1UNR A;  4A6H A;  1B55 A;  1X05 A;  2IFS A;  3U7D A;  1V61 A;  2D9X A;  4HAT B;  4IAP A;  1TJ6 A;  3KZ1 A;  4IOY X;  1MPH A;  2AL6 A;  2GCJ A;  2GJY A;  1M7E A;  2K2J A;  2Z0Q A;  5J3T A;  1UNQ A;  1WGU A;  3MDB C;  2DLW A;  2EMT A;  3ZVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...