2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 2, isoform a
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
2MFQA 2LG1A 1H10A 3PZDA 5C16A 4EJNA 4TYZA 3PG7A 5FI1A 1PLSA 2NZ8B 2CAYA 5KCVA 5KQ4A 3MPXA 3A8PA 1XX0A 2R09A 2ADZA 4CYEA 1W1GA 3TO1A 1ZC4B 2DLWA 1UNRA 2MWNB 1U5FA 2YS3A 4DX90 1NU2A 5EFXA 1AWEA 1MK9B 3WYFB 4MK0A 2W2XD 4MT7A 1DROA 3D8DA 2P0DA 2UVMA 3CXBB 1SGHA 2AL6A 3U7DA 3TW1A 1RJ2A 1LB1A 3ML4A 5JHGA 1XCGA 1X1FA 3TCAA 2DTCA 5LONB 2I1KA 4HAXB 4A5KA 3AJ4A 5D27A 5C6RA 1TQZA 2FJLA 4Z2MB 4K2PA 3CIKA 4Y94A 1FHOA 2YS5A 4H8SA 2G35A 4ZRJA 1FOEA 3VOQA 2J59M 1UNQA 1UPQA 4IFSA 2BCJA 3PVLA 2IFSA 3A8QA 3P6AA 2D2QA 2VKIA 1I2HA 4K81A 2DKQA 2P0FA 1MPHA 3N7CA 3A98B 3SNHA 2I1JA 5JP4A 1Q67A 2DYNA 3AU5A 1AQCA 2OTXA 1NI2A 2D9YA 2Y8FA 1MKEA 4K2OA 3D8EA 4HB0B 1ZC3B 2DKPA 4EKUA 1NTVA 4CHJA 4DBBA 2YF0A 2Y7BA 2KGXB 1MIZB 2YRYA 2LOXA 1FHXA 3UZTA 2V76A 2D11A 5J3TA 5DHFB 5KQ1A 4TKNA 2DHJA 1XD4A 1M7EA 2UZSA 2YT1A 1J0WA 1WJ1A 4L6EA 2DFKA 2RNRB 5DH9B 2ROVA 1EAZA 2N0YA 4GZUA 1ZM0A 2ZPYA 3QBVB 2Y8GA 5FI0A 3P7ZA 1BTKA 3SV1A 1NTYA 5LOPB 1EGXA 5C5BA 2JP2A 3X23A 2COFA 5CLQB 5D3XA 2GS0A 2KUPA 1OMWA 4Z2NA 4KHOA 4HAUB 1P3RA 1X86A 4D0NB 2D9WA 1WVHA 4IOYX 1XR0B 2CRFA 4XWXA 3KSYA 3PVWA 1UNPA 4WJ7A 4F7GA 2RVBB 1E5WA 1MAIA 2H7EA 2D10A 2K2UA 1WGQA 2GCJA 2Z0OA 3HK0A 2IYBA 1GG3A 1BWNA 1UEFA 2P0HA 2DA0A 3KY9A 4CHMA 4YL8A 4DXAB 1H4RA 3VIAA 2XQNM 5DIFB 2DHIA 1UPRA 5CLLB 4F7HA 2M38A 3SYXA 1V5MA 1V61A 1MIXA 3NSUA 5D3YA 1EF1A 2YT0A 1I7AA 4P7IA 2NMBA 1Z87A 4PQ0A 3KRXA 5HE0A 2ELAA 3HW2B 1WI1A 1GC6A 1QQGA 3U8ZA 2VSZA 4KHAA 1W1HA 1U2BA 2ROZB 3SUZA 2YVCA 2EMTA 1DBHA 2CODA 1OQNA 4DX8A 1FAOA 1MK7B 2KCJA 4A6FB 2DYQA 2PZ1A 5J3YA 2COCA 2J0KA 1ZSQA 4NSWA 1U5GA 2MDXA 2DX5A 3QIJA 1PFJA 4KVGB 2RSGA 3F5RA 2VRWB 2LYDA 3IVFA 2AEHA 2W2WA 2QKMA 3GYOA 1V88A 5DI9B 3DXCA 4ZRIA 1DDVA 1QC6A 1W1DA 4KAXB 1EVHA 3SO6A 3WA0A 4HATB 4HDQA 4F7UP 1OY2A 1X1GA 3GYPA 3PEGA 1K5DB 1RRPB 5GOWB 3PVUA 4MY6A 3F0WA 3ULCA 1N3HA 1FGYA 5HE3A 2MKRA 2D9XA 2HTHB 3ODWA 4HAWB 4K17A 2J0JA 1BTNA 5J3QA 3KZ1A 2QKLA 3PSCA 5JLJB 1KZ7A 3DXDA 3HQCA 4HAVB 3TFMA 2W2XC 1ZVRA 2D4QA 2RUKB 3DXEA 5D3VA 2N23A 5JHHA 1SHCA 2Z0QA 5D3WA 5HE1A 3ZDTA 2ELBA 1B55A 2UZRA 4C0AA 2LKOA 1XKEA 3FM8C 2LULA 3TVVA 2J0MA 1KZGA 5HE2A 4IAPA 5C79A 3O96A 1V5UA 4A6HA 2CY4A 1DDMA 1WGUA 5C5BB 1IRSA 2EMSA 1KI1B 1GC7A 4KHBB 3V5WA 2P8VA 1V89A 2EJ8A 4HB2B 2YSZA 1ISNA 5L81A 3FEHA 1U5DA 2HE7A 3MDBC 4A6FA 2L2IA 2YS1A 4NY0A 2K00A 3BJIA 1U27A 2CY5A 2E2XA 1TXDA 3BINA 1V5PA 3PP2A 3OANA 1U29A 3RCPA 3FSSA 3LJUX 2I5CA 3AU4A 2OQBA 2GJYA 2L1CA 4WVFB 4EMOA 2DHKA 2Z0PA 1FHWA 1FGZA 4BBKA 4HAYB 2DX1A 4GN1A 1TJ6A 2R0DA 4GPTB 4GXBA 4HB4B 1P5TA 5DHAB 1M7RA 2I5FA 1U5EA 4PNKA 1BAKA 2D9VA 3M1IB 2K2JA 3ULBA 2EC1A 1X11A 1J19A 4WSFA 1WG7A 4B6HA 4GMXB 1DYNA 1FB8A 1WJMA 1Y19B 2COAA 2RGNB 4YONA 2X18A 1K5GB 1Y5OA 2D9ZA 2H7DA 1P6SA 3QWMA 3ZVRA 3ODXA 3KRWA 4ZRKA 2GCLA 4HDOA 3T06A 1X05A 1LW3A 4HHVA 4HAZB 4HB3B 1DDWA 2LOZA 2Q13A 1PMSA 4GMVA 2RLOA 3ODOA 4A6KA 3D8FA 2M14A 3G9WA 1XODA 2DN6A
chains in the Genus database with same CATH superfamily
2MFQA 2LG1A 1H10A 3PZDA 5C16A 4EJNA 4TYZA 3PG7A 5FI1A 1PLSA 2NZ8B 2CAYA 5KCVA 5KQ4A 2K49A 3MPXA 3A8PA 3HSAA 4CSQA 1XX0A 2R09A 2ADZA 4CYEA 1W1GA 2Z13A 3TO1A 1ZC4B 2DLWA 1UNRA 2MWNB 1U5FA 4KHBA 2YS3A 4DX90 1NU2A 5EFXA 1AWEA 1MK9B 3WYFB 4MK0A 2W2XD 4MT7A 1DROA 3D8DA 2P0DA 2UVMA 3CXBB 1SGHA 3OHMB 2AL6A 3U7DA 3TW1A 1RJ2A 1LB1A 4OT1A 3ML4A 5JHGA 1XCGA 1X1FA 3TCAA 2DTCA 5LONB 2I1KA 4HAXB 4A5KA 3AJ4A 5D27A 4HSIA 4QJ4B 5C6RA 1TQZA 3HIEA 2FJLA 4Z2MB 4K2PA 3CIKA 4Y94A 1FHOA 2YS5A 4H8SA 2G35A 4ZRJA 1FOEA 3VOQA 2J59M 1UNQA 1UPQA 3A58A 4IFSA 2BCJA 3PVLA 2IFSA 3A8QA 3P6AA 2D2QA 2VKIA 1I2HA 4K81A 2DKQA 2P0FA 1MPHA 3N7CA 3A98B 3SNHA 2I1JA 5JP4A 1Q67A 2DYNA 3AU5A 1AQCA 2OTXA 1NI2A 2R2YA 2D9YA 2Y8FA 1MKEA 4K2OA 3D8EA 4HB0B 1ZC3B 2DKPA 4EKUA 1NTVA 4CHJA 5I2MA 4DBBA 3U12A 2YF0A 2Y7BA 2KGXB 1MIZB 2YRYA 2LOXA 1FHXA 3UZTA 2V76A 2D11A 5J3TA 5DHFB 5KQ1A 4TKNA 2DHJA 1XD4A 1M7EA 2UZSA 2YT1A 1J0WA 1WJ1A 3B77A 2DFKA 2RNRB 4L6EA 2ROVA 5DH9B 1EAZA 2N0YA 3FVCA 4GZUA 2GUMA 1ZM0A 2ZPYA 3QBVB 2NBVA 2Y8GA 5FI0A 3P7ZA 4QJ5B 1BTKA 3SV1A 1NTYA 5LOPB 1EGXA 5C5BA 2JP2A 3X23A 2COFA 5CLQB 5D3XA 2GS0A 2KUPA 1OMWA 4Z2NA 4KHOA 4HAUB 1P3RA 1X86A 4L1RA 4DIXA 2RRFA 2D9WA 4D0NB 1WVHA 4IOYX 1XR0B 2CRFA 4XWXA 3KSYA 3PVWA 5I2SA 1UNPA 4WJ7A 4F7GA 2RVBB 1E5WA 1MAIA 2H7EA 2D10A 2K2UA 1WGQA 2GCJA 2Z0OA 3HK0A 2IYBA 1GG3A 1BWNA 3NWAA 1UEFA 2P0HA 2DA0A 3KY9A 4CHMA 4YL8A 4DXAB 1H4RA 3VIAA 3DCXA 2XQNM 5DIFB 2DHIA 1UPRA 5CLLB 4F7HA 2M38A 3SYXA 1V5MA 1V61A 1MIXA 3NSUA 2KIGA 5D3YA 2YT0A 1EF1A 5LG4B 1I7AA 4P7IA 2NMBA 1Z87A 4PQ0A 3KRXA 5HE0A 2ELAA 3HW2B 1WI1A 1GC6A 1QQGA 3U8ZA 1ZYIA 2VSZA 4KHAA 4D6WA 1W1HA 1U2BA 2ROZB 2YT2A 3SUZA 2YVCA 2EMTA 1DBHA 2CODA 1OQNA 3NWDA 4DX8A 1FAOA 1MK7B 2KCJA 4A6FB 1MI1A 2DYQA 2PZ1A 5J3YA 2COCA 2J0KA 2KIEA 1ZSQA 4NSWA 1U5GA 2MDXA 2DX5A 3QIJA 1PFJA 4KVGB 2RSGA 3F5RA 2VRWB 2LYDA 3IVFA 2AEHA 2KUQA 2W2WA 2QKMA 3GYOA 1V88A 5DI9B 3DXCA 4ZRIA 1DDVA 2Z14A 1QC6A 1W1DA 4KAXB 1EVHA 3SO6A 3WA0A 2Z4DA 4HATB 3NWFA 4HDQA 4F7UP 1OY2A 1X1GA 3GYPA 3PEGA 1K5DB 1RRPB 5GOWB 3PVUA 4MY6A 3F0WA 3ULCA 1N3HA 1FGYA 5HE3A 2MKRA 2D9XA 2HTHB 3ODWA 4HAWB 4K17A 2J0JA 1BTNA 1T77A 5J3QA 3KZ1A 2QKLA 3NW8A 3PSCA 5JLJB 1KZ7A 3DXDA 3HQCA 4HAVB 3TFMA 2W2XC 2KR0A 1ZVRA 2D4QA 2RUKB 3DXEA 5D3VA 2N23A 5JHHA 1SHCA 5M4YB 2Z0QA 2FJUB 5D3WA 5HE1A 3ZDTA 4QJ3B 2ELBA 1B55A 2UZRA 4C0AA 2LKOA 1XKEA 3FM8C 2LULA 3TVVA 4GOUA 2J0MA 1KZGA 5HE2A 4IAPA 5C79A 3O96A 1V5UA 4A6HA 2CY4A 1DDMA 1WGUA 5C5BB 1IRSA 2EMSA 1KI1B 1GC7A 4KHBB 3V5WA 2P8VA 1V89A 2EJ8A 4HB2B 2YSZA 1ISNA 5L81A 3FEHA 1U5DA 2HE7A 3MDBC 4A6FA 2L2IA 2YS1A 4NY0A 2K00A 3BJIA 1U27A 2CY5A 4GNKB 2E2XA 1TXDA 3BINA 1V5PA 3PP2A 3OANA 1U29A 3RCPA 3FSSA 2ZKMX 3LJUX 2I5CA 3AU4A 2OQBA 2GJYA 2L1CA 4WVFB 4EMOA 2DHKA 2Z0PA 1FHWA 1FGZA 4BBKA 4HAYB 2DX1A 4GN1A 1TJ6A 2R0DA 4GPTB 4GXBA 4HB4B 1P5TA 5DHAB 1M7RA 2I5FA 1U5EA 4PNKA 1BAKA 2D9VA 3M1IB 2K2JA 3ULBA 2EC1A 1X11A 1J19A 4WSFA 1WG7A 4B6HA 4GMXB 1DYNA 5IRSA 1FB8A 1WJMA 1Y19B 2COAA 2RGNB 2K8EA 4YONA 2X18A 1K5GB 1Y5OA 2D9ZA 2H7DA 1P6SA 3QWMA 3ZVRA 3ODXA 4OSNA 3KRWA 4ZRKA 2GCLA 2Z59A 4HDOA 3T06A 1X05A 1LW3A 4HHVA 4HAZB 4HB3B 1DDWA 2LOZA 2Q13A 1PMSA 4GMVA 2RLOA 3ODOA 4A6KA 3D8FA 2M14A 3G9WA 4QXAB 1XODA 2DN6A
chains in the Genus database with same CATH topology
2MFQA 2LG1A 1H10A 3PZDA 5C16A 4EJNA 4TYZA 3PG7A 5FI1A 1PLSA 2NZ8B 2CAYA 5KCVA 5KQ4A 3MPXA 3A8PA 1XX0A 2R09A 2ADZA 4CYEA 1W1GA 3TO1A 1ZC4B 2DLWA 1UNRA 2MWNB 1U5FA 2YS3A 4DX90 1NU2A 5EFXA 1AWEA 1MK9B 3WYFB 4MK0A 2W2XD 4MT7A 1DROA 3D8DA 2P0DA 2UVMA 3CXBB 1SGHA 2AL6A 3U7DA 3TW1A 1RJ2A 1LB1A 3ML4A 5JHGA 1XCGA 1X1FA 3TCAA 2DTCA 5LONB 2I1KA 4HAXB 4A5KA 3AJ4A 5D27A 5C6RA 1TQZA 2FJLA 4Z2MB 4K2PA 3CIKA 4Y94A 1FHOA 2YS5A 4H8SA 2G35A 4ZRJA 1FOEA 3VOQA 2J59M 1UNQA 1UPQA 4IFSA 2BCJA 3PVLA 2IFSA 3A8QA 3P6AA 2D2QA 2VKIA 1I2HA 4K81A 2DKQA 2P0FA 1MPHA 3N7CA 3A98B 3SNHA 2I1JA 5JP4A 1Q67A 2DYNA 3AU5A 1AQCA 2OTXA 1NI2A 2D9YA 2Y8FA 1MKEA 4K2OA 3D8EA 4HB0B 1ZC3B 2DKPA 4EKUA 1NTVA 4CHJA 4DBBA 2YF0A 2Y7BA 2KGXB 1MIZB 2YRYA 2LOXA 1FHXA 3UZTA 2V76A 2D11A 5J3TA 5DHFB 5KQ1A 4TKNA 2DHJA 1XD4A 1M7EA 2UZSA 2YT1A 1J0WA 1WJ1A 4L6EA 2DFKA 2RNRB 5DH9B 2ROVA 1EAZA 2N0YA 4GZUA 1ZM0A 2ZPYA 3QBVB 2Y8GA 5FI0A 3P7ZA 1BTKA 3SV1A 1NTYA 5LOPB 1EGXA 5C5BA 2JP2A 3X23A 2COFA 5CLQB 5D3XA 2GS0A 2KUPA 1OMWA 4Z2NA 4KHOA 4HAUB 1P3RA 1X86A 4D0NB 2D9WA 1WVHA 4IOYX 1XR0B 2CRFA 4XWXA 3KSYA 3PVWA 1UNPA 4WJ7A 4F7GA 2RVBB 1E5WA 1MAIA 2H7EA 2D10A 2K2UA 1WGQA 2GCJA 2Z0OA 3HK0A 2IYBA 1GG3A 1BWNA 1UEFA 2P0HA 2DA0A 3KY9A 4CHMA 4YL8A 4DXAB 1H4RA 3VIAA 2XQNM 5DIFB 2DHIA 1UPRA 5CLLB 4F7HA 2M38A 3SYXA 1V5MA 1V61A 1MIXA 3NSUA 5D3YA 1EF1A 2YT0A 1I7AA 4P7IA 2NMBA 1Z87A 4PQ0A 3KRXA 5HE0A 2ELAA 3HW2B 1WI1A 1GC6A 1QQGA 3U8ZA 2VSZA 4KHAA 1W1HA 1U2BA 2ROZB 3SUZA 2YVCA 2EMTA 1DBHA 2CODA 1OQNA 4DX8A 1FAOA 1MK7B 2KCJA 4A6FB 2DYQA 2PZ1A 5J3YA 2COCA 2J0KA 1ZSQA 4NSWA 1U5GA 2MDXA 2DX5A 3QIJA 1PFJA 4KVGB 2RSGA 3F5RA 2VRWB 2LYDA 3IVFA 2AEHA 2W2WA 2QKMA 3GYOA 1V88A 5DI9B 3DXCA 4ZRIA 1DDVA 1QC6A 1W1DA 4KAXB 1EVHA 3SO6A 3WA0A 4HATB 4HDQA 4F7UP 1OY2A 1X1GA 3GYPA 3PEGA 1K5DB 1RRPB 5GOWB 3PVUA 4MY6A 3F0WA 3ULCA 1N3HA 1FGYA 5HE3A 2MKRA 2D9XA 2HTHB 3ODWA 4HAWB 4K17A 2J0JA 1BTNA 5J3QA 3KZ1A 2QKLA 3PSCA 5JLJB 1KZ7A 3DXDA 3HQCA 4HAVB 3TFMA 2W2XC 1ZVRA 2D4QA 2RUKB 3DXEA 5D3VA 2N23A 5JHHA 1SHCA 2Z0QA 5D3WA 5HE1A 3ZDTA 2ELBA 1B55A 2UZRA 4C0AA 2LKOA 1XKEA 3FM8C 2LULA 3TVVA 2J0MA 1KZGA 5HE2A 4IAPA 5C79A 3O96A 1V5UA 4A6HA 2CY4A 1DDMA 1WGUA 5C5BB 1IRSA 2EMSA 1KI1B 1GC7A 4KHBB 3V5WA 2P8VA 1V89A 2EJ8A 4HB2B 2YSZA 1ISNA 5L81A 3FEHA 1U5DA 2HE7A 3MDBC 4A6FA 2L2IA 2YS1A 4NY0A 2K00A 3BJIA 1U27A 2CY5A 2E2XA 1TXDA 3BINA 1V5PA 3PP2A 3OANA 1U29A 3RCPA 3FSSA 3LJUX 2I5CA 3AU4A 2OQBA 2GJYA 2L1CA 4WVFB 4EMOA 2DHKA 2Z0PA 1FHWA 1FGZA 4BBKA 4HAYB 2DX1A 4GN1A 1TJ6A 2R0DA 4GPTB 4GXBA 4HB4B 1P5TA 5DHAB 1M7RA 2I5FA 1U5EA 4PNKA 1BAKA 2D9VA 3M1IB 2K2JA 3ULBA 2EC1A 1X11A 1J19A 4WSFA 1WG7A 4B6HA 4GMXB 1DYNA 1FB8A 1WJMA 1Y19B 2COAA 2RGNB 4YONA 2X18A 1K5GB 1Y5OA 2D9ZA 2H7DA 1P6SA 3QWMA 3ZVRA 3ODXA 3KRWA 4ZRKA 2GCLA 4HDOA 3T06A 1X05A 1LW3A 4HHVA 4HAZB 4HB3B 1DDWA 2LOZA 2Q13A 1PMSA 4GMVA 2RLOA 3ODOA 4A6KA 3D8FA 2M14A 3G9WA 1XODA 2DN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFQ A;  2LG1 A;  1H10 A;  3PZD A;  5C16 A;  4EJN A;  4TYZ A;  3PG7 A;  5FI1 A;  1PLS A;  2NZ8 B;  2CAY A;  5KCV A;  5KQ4 A;  3MPX A;  3A8P A;  1XX0 A;  2R09 A;  2ADZ A;  4CYE A;  1W1G A;  3TO1 A;  1ZC4 B;  2DLW A;  1UNR A;  2MWN B;  1U5F A;  2YS3 A;  4DX9 0;  1NU2 A;  5EFX A;  1AWE A;  1MK9 B;  3WYF B;  4MK0 A;  2W2X D;  4MT7 A;  1DRO A;  3D8D A;  2P0D A;  2UVM A;  3CXB B;  1SGH A;  2AL6 A;  3U7D A;  3TW1 A;  1RJ2 A;  1LB1 A;  3ML4 A;  5JHG A;  1XCG A;  1X1F A;  3TCA A;  2DTC A;  5LON B;  2I1K A;  4HAX B;  4A5K A;  3AJ4 A;  5D27 A;  5C6R A;  1TQZ A;  2FJL A;  4Z2M B;  4K2P A;  3CIK A;  4Y94 A;  1FHO A;  2YS5 A;  4H8S A;  2G35 A;  4ZRJ A;  1FOE A;  3VOQ A;  2J59 M;  1UNQ A;  1UPQ A;  4IFS A;  2BCJ A;  3PVL A;  2IFS A;  3A8Q A;  3P6A A;  2D2Q A;  2VKI A;  1I2H A;  4K81 A;  2DKQ A;  2P0F A;  1MPH A;  3N7C A;  3A98 B;  3SNH A;  2I1J A;  5JP4 A;  1Q67 A;  2DYN A;  3AU5 A;  1AQC A;  2OTX A;  1NI2 A;  2D9Y A;  2Y8F A;  1MKE A;  4K2O A;  3D8E A;  4HB0 B;  1ZC3 B;  2DKP A;  4EKU A;  1NTV A;  4CHJ A;  4DBB A;  2YF0 A;  2Y7B A;  2KGX B;  1MIZ B;  2YRY A;  2LOX A;  1FHX A;  3UZT A;  2V76 A;  2D11 A;  5J3T A;  5DHF B;  5KQ1 A;  4TKN A;  2DHJ A;  1XD4 A;  1M7E A;  2UZS A;  2YT1 A;  1J0W A;  1WJ1 A;  4L6E A;  2DFK A;  2RNR B;  5DH9 B;  2ROV A;  1EAZ A;  2N0Y A;  4GZU A;  1ZM0 A;  2ZPY A;  3QBV B;  2Y8G A;  5FI0 A;  3P7Z A;  1BTK A;  3SV1 A;  1NTY A;  5LOP B;  1EGX A;  5C5B A;  2JP2 A;  3X23 A;  2COF A;  5CLQ B;  5D3X A;  2GS0 A;  2KUP A;  1OMW A;  4Z2N A;  4KHO A;  4HAU B;  1P3R A;  1X86 A;  4D0N B;  2D9W A;  1WVH A;  4IOY X;  1XR0 B;  2CRF A;  4XWX A;  3KSY A;  3PVW A;  1UNP A;  4WJ7 A;  4F7G A;  2RVB B;  1E5W A;  1MAI A;  2H7E A;  2D10 A;  2K2U A;  1WGQ A;  2GCJ A;  2Z0O A;  3HK0 A;  2IYB A;  1GG3 A;  1BWN A;  1UEF A;  2P0H A;  2DA0 A;  3KY9 A;  4CHM A;  4YL8 A;  4DXA B;  1H4R A;  3VIA A;  2XQN M;  5DIF B;  2DHI A;  1UPR A;  5CLL B;  4F7H A;  2M38 A;  3SYX A;  1V5M A;  1V61 A;  1MIX A;  3NSU A;  5D3Y A;  1EF1 A;  2YT0 A;  1I7A A;  4P7I A;  2NMB A;  1Z87 A;  4PQ0 A;  3KRX A;  5HE0 A;  2ELA A;  3HW2 B;  1WI1 A;  1GC6 A;  1QQG A;  3U8Z A;  2VSZ A;  4KHA A;  1W1H A;  1U2B A;  2ROZ B;  3SUZ A;  2YVC A;  2EMT A;  1DBH A;  2COD A;  1OQN A;  4DX8 A;  1FAO A;  1MK7 B;  2KCJ A;  4A6F B;  2DYQ A;  2PZ1 A;  5J3Y A;  2COC A;  2J0K A;  1ZSQ A;  4NSW A;  1U5G A;  2MDX A;  2DX5 A;  3QIJ A;  1PFJ A;  4KVG B;  2RSG A;  3F5R A;  2VRW B;  2LYD A;  3IVF A;  2AEH A;  2W2W A;  2QKM A;  3GYO A;  1V88 A;  5DI9 B;  3DXC A;  4ZRI A;  1DDV A;  1QC6 A;  1W1D A;  4KAX B;  1EVH A;  3SO6 A;  3WA0 A;  4HAT B;  4HDQ A;  4F7U P;  1OY2 A;  1X1G A;  3GYP A;  3PEG A;  1K5D B;  1RRP B;  5GOW B;  3PVU A;  4MY6 A;  3F0W A;  3ULC A;  1N3H A;  1FGY A;  5HE3 A;  2MKR A;  2D9X A;  2HTH B;  3ODW A;  4HAW B;  4K17 A;  2J0J A;  1BTN A;  5J3Q A;  3KZ1 A;  2QKL A;  3PSC A;  5JLJ B;  1KZ7 A;  3DXD A;  3HQC A;  4HAV B;  3TFM A;  2W2X C;  1ZVR A;  2D4Q A;  2RUK B;  3DXE A;  5D3V A;  2N23 A;  5JHH A;  1SHC A;  2Z0Q A;  5D3W A;  5HE1 A;  3ZDT A;  2ELB A;  1B55 A;  2UZR A;  4C0A A;  2LKO A;  1XKE A;  3FM8 C;  2LUL A;  3TVV A;  2J0M A;  1KZG A;  5HE2 A;  4IAP A;  5C79 A;  3O96 A;  1V5U A;  4A6H A;  2CY4 A;  1DDM A;  1WGU A;  5C5B B;  1IRS A;  2EMS A;  1KI1 B;  1GC7 A;  4KHB B;  3V5W A;  2P8V A;  1V89 A;  2EJ8 A;  4HB2 B;  2YSZ A;  1ISN A;  5L81 A;  3FEH A;  1U5D A;  2HE7 A;  3MDB C;  4A6F A;  2L2I A;  2YS1 A;  4NY0 A;  2K00 A;  3BJI A;  1U27 A;  2CY5 A;  2E2X A;  1TXD A;  3BIN A;  1V5P A;  3PP2 A;  3OAN A;  1U29 A;  3RCP A;  3FSS A;  3LJU X;  2I5C A;  3AU4 A;  2OQB A;  2GJY A;  2L1C A;  4WVF B;  4EMO A;  2DHK A;  2Z0P A;  1FHW A;  1FGZ A;  4BBK A;  4HAY B;  2DX1 A;  4GN1 A;  1TJ6 A;  2R0D A;  4GPT B;  4GXB A;  4HB4 B;  1P5T A;  5DHA B;  1M7R A;  2I5F A;  1U5E A;  4PNK A;  1BAK A;  2D9V A;  3M1I B;  2K2J A;  3ULB A;  2EC1 A;  1X11 A;  1J19 A;  4WSF A;  1WG7 A;  4B6H A;  4GMX B;  1DYN A;  1FB8 A;  1WJM A;  1Y19 B;  2COA A;  2RGN B;  4YON A;  2X18 A;  1K5G B;  1Y5O A;  2D9Z A;  2H7D A;  1P6S A;  3QWM A;  3ZVR A;  3ODX A;  3KRW A;  4ZRK A;  2GCL A;  4HDO A;  3T06 A;  1X05 A;  1LW3 A;  4HHV A;  4HAZ B;  4HB3 B;  1DDW A;  2LOZ A;  2Q13 A;  1PMS A;  4GMV A;  2RLO A;  3ODO A;  4A6K A;  3D8F A;  2M14 A;  3G9W A;  1XOD A;  2DN6 A; 
#chains in the Genus database with same CATH topology
 2MFQ A;  2LG1 A;  1H10 A;  3PZD A;  5C16 A;  4EJN A;  4TYZ A;  3PG7 A;  5FI1 A;  1PLS A;  2NZ8 B;  2CAY A;  5KCV A;  5KQ4 A;  2K49 A;  3MPX A;  3A8P A;  3HSA A;  4CSQ A;  1XX0 A;  2R09 A;  2ADZ A;  4CYE A;  1W1G A;  2Z13 A;  3TO1 A;  1ZC4 B;  2DLW A;  1UNR A;  2MWN B;  1U5F A;  4KHB A;  2YS3 A;  4DX9 0;  1NU2 A;  5EFX A;  1AWE A;  1MK9 B;  3WYF B;  4MK0 A;  2W2X D;  4MT7 A;  1DRO A;  3D8D A;  2P0D A;  2UVM A;  3CXB B;  1SGH A;  3OHM B;  2AL6 A;  3U7D A;  3TW1 A;  1RJ2 A;  1LB1 A;  4OT1 A;  3ML4 A;  5JHG A;  1XCG A;  1X1F A;  3TCA A;  2DTC A;  5LON B;  2I1K A;  4HAX B;  4A5K A;  3AJ4 A;  5D27 A;  4HSI A;  4QJ4 B;  5C6R A;  1TQZ A;  3HIE A;  2FJL A;  4Z2M B;  4K2P A;  3CIK A;  4Y94 A;  1FHO A;  2YS5 A;  4H8S A;  2G35 A;  4ZRJ A;  1FOE A;  3VOQ A;  2J59 M;  1UNQ A;  1UPQ A;  3A58 A;  4IFS A;  2BCJ A;  3PVL A;  2IFS A;  3A8Q A;  3P6A A;  2D2Q A;  2VKI A;  1I2H A;  4K81 A;  2DKQ A;  2P0F A;  1MPH A;  3N7C A;  3A98 B;  3SNH A;  2I1J A;  5JP4 A;  1Q67 A;  2DYN A;  3AU5 A;  1AQC A;  2OTX A;  1NI2 A;  2R2Y A;  2D9Y A;  2Y8F A;  1MKE A;  4K2O A;  3D8E A;  4HB0 B;  1ZC3 B;  2DKP A;  4EKU A;  1NTV A;  4CHJ A;  5I2M A;  4DBB A;  3U12 A;  2YF0 A;  2Y7B A;  2KGX B;  1MIZ B;  2YRY A;  2LOX A;  1FHX A;  3UZT A;  2V76 A;  2D11 A;  5J3T A;  5DHF B;  5KQ1 A;  4TKN A;  2DHJ A;  1XD4 A;  1M7E A;  2UZS A;  2YT1 A;  1J0W A;  1WJ1 A;  3B77 A;  2DFK A;  2RNR B;  4L6E A;  2ROV A;  5DH9 B;  1EAZ A;  2N0Y A;  3FVC A;  4GZU A;  2GUM A;  1ZM0 A;  2ZPY A;  3QBV B;  2NBV A;  2Y8G A;  5FI0 A;  3P7Z A;  4QJ5 B;  1BTK A;  3SV1 A;  1NTY A;  5LOP B;  1EGX A;  5C5B A;  2JP2 A;  3X23 A;  2COF A;  5CLQ B;  5D3X A;  2GS0 A;  2KUP A;  1OMW A;  4Z2N A;  4KHO A;  4HAU B;  1P3R A;  1X86 A;  4L1R A;  4DIX A;  2RRF A;  2D9W A;  4D0N B;  1WVH A;  4IOY X;  1XR0 B;  2CRF A;  4XWX A;  3KSY A;  3PVW A;  5I2S A;  1UNP A;  4WJ7 A;  4F7G A;  2RVB B;  1E5W A;  1MAI A;  2H7E A;  2D10 A;  2K2U A;  1WGQ A;  2GCJ A;  2Z0O A;  3HK0 A;  2IYB A;  1GG3 A;  1BWN A;  3NWA A;  1UEF A;  2P0H A;  2DA0 A;  3KY9 A;  4CHM A;  4YL8 A;  4DXA B;  1H4R A;  3VIA A;  3DCX A;  2XQN M;  5DIF B;  2DHI A;  1UPR A;  5CLL B;  4F7H A;  2M38 A;  3SYX A;  1V5M A;  1V61 A;  1MIX A;  3NSU A;  2KIG A;  5D3Y A;  2YT0 A;  1EF1 A;  5LG4 B;  1I7A A;  4P7I A;  2NMB A;  1Z87 A;  4PQ0 A;  3KRX A;  5HE0 A;  2ELA A;  3HW2 B;  1WI1 A;  1GC6 A;  1QQG A;  3U8Z A;  1ZYI A;  2VSZ A;  4KHA A;  4D6W A;  1W1H A;  1U2B A;  2ROZ B;  2YT2 A;  3SUZ A;  2YVC A;  2EMT A;  1DBH A;  2COD A;  1OQN A;  3NWD A;  4DX8 A;  1FAO A;  1MK7 B;  2KCJ A;  4A6F B;  1MI1 A;  2DYQ A;  2PZ1 A;  5J3Y A;  2COC A;  2J0K A;  2KIE A;  1ZSQ A;  4NSW A;  1U5G A;  2MDX A;  2DX5 A;  3QIJ A;  1PFJ A;  4KVG B;  2RSG A;  3F5R A;  2VRW B;  2LYD A;  3IVF A;  2AEH A;  2KUQ A;  2W2W A;  2QKM A;  3GYO A;  1V88 A;  5DI9 B;  3DXC A;  4ZRI A;  1DDV A;  2Z14 A;  1QC6 A;  1W1D A;  4KAX B;  1EVH A;  3SO6 A;  3WA0 A;  2Z4D A;  4HAT B;  3NWF A;  4HDQ A;  4F7U P;  1OY2 A;  1X1G A;  3GYP A;  3PEG A;  1K5D B;  1RRP B;  5GOW B;  3PVU A;  4MY6 A;  3F0W A;  3ULC A;  1N3H A;  1FGY A;  5HE3 A;  2MKR A;  2D9X A;  2HTH B;  3ODW A;  4HAW B;  4K17 A;  2J0J A;  1BTN A;  1T77 A;  5J3Q A;  3KZ1 A;  2QKL A;  3NW8 A;  3PSC A;  5JLJ B;  1KZ7 A;  3DXD A;  3HQC A;  4HAV B;  3TFM A;  2W2X C;  2KR0 A;  1ZVR A;  2D4Q A;  2RUK B;  3DXE A;  5D3V A;  2N23 A;  5JHH A;  1SHC A;  5M4Y B;  2Z0Q A;  2FJU B;  5D3W A;  5HE1 A;  3ZDT A;  4QJ3 B;  2ELB A;  1B55 A;  2UZR A;  4C0A A;  2LKO A;  1XKE A;  3FM8 C;  2LUL A;  3TVV A;  4GOU A;  2J0M A;  1KZG A;  5HE2 A;  4IAP A;  5C79 A;  3O96 A;  1V5U A;  4A6H A;  2CY4 A;  1DDM A;  1WGU A;  5C5B B;  1IRS A;  2EMS A;  1KI1 B;  1GC7 A;  4KHB B;  3V5W A;  2P8V A;  1V89 A;  2EJ8 A;  4HB2 B;  2YSZ A;  1ISN A;  5L81 A;  3FEH A;  1U5D A;  2HE7 A;  3MDB C;  4A6F A;  2L2I A;  2YS1 A;  4NY0 A;  2K00 A;  3BJI A;  1U27 A;  2CY5 A;  4GNK B;  2E2X A;  1TXD A;  3BIN A;  1V5P A;  3PP2 A;  3OAN A;  1U29 A;  3RCP A;  3FSS A;  2ZKM X;  3LJU X;  2I5C A;  3AU4 A;  2OQB A;  2GJY A;  2L1C A;  4WVF B;  4EMO A;  2DHK A;  2Z0P A;  1FHW A;  1FGZ A;  4BBK A;  4HAY B;  2DX1 A;  4GN1 A;  1TJ6 A;  2R0D A;  4GPT B;  4GXB A;  4HB4 B;  1P5T A;  5DHA B;  1M7R A;  2I5F A;  1U5E A;  4PNK A;  1BAK A;  2D9V A;  3M1I B;  2K2J A;  3ULB A;  2EC1 A;  1X11 A;  1J19 A;  4WSF A;  1WG7 A;  4B6H A;  4GMX B;  1DYN A;  5IRS A;  1FB8 A;  1WJM A;  1Y19 B;  2COA A;  2RGN B;  2K8E A;  4YON A;  2X18 A;  1K5G B;  1Y5O A;  2D9Z A;  2H7D A;  1P6S A;  3QWM A;  3ZVR A;  3ODX A;  4OSN A;  3KRW A;  4ZRK A;  2GCL A;  2Z59 A;  4HDO A;  3T06 A;  1X05 A;  1LW3 A;  4HHV A;  4HAZ B;  4HB3 B;  1DDW A;  2LOZ A;  2Q13 A;  1PMS A;  4GMV A;  2RLO A;  3ODO A;  4A6K A;  3D8F A;  2M14 A;  3G9W A;  4QXA B;  1XOD A;  2DN6 A; 
#chains in the Genus database with same CATH homology
 2MFQ A;  2LG1 A;  1H10 A;  3PZD A;  5C16 A;  4EJN A;  4TYZ A;  3PG7 A;  5FI1 A;  1PLS A;  2NZ8 B;  2CAY A;  5KCV A;  5KQ4 A;  3MPX A;  3A8P A;  1XX0 A;  2R09 A;  2ADZ A;  4CYE A;  1W1G A;  3TO1 A;  1ZC4 B;  2DLW A;  1UNR A;  2MWN B;  1U5F A;  2YS3 A;  4DX9 0;  1NU2 A;  5EFX A;  1AWE A;  1MK9 B;  3WYF B;  4MK0 A;  2W2X D;  4MT7 A;  1DRO A;  3D8D A;  2P0D A;  2UVM A;  3CXB B;  1SGH A;  2AL6 A;  3U7D A;  3TW1 A;  1RJ2 A;  1LB1 A;  3ML4 A;  5JHG A;  1XCG A;  1X1F A;  3TCA A;  2DTC A;  5LON B;  2I1K A;  4HAX B;  4A5K A;  3AJ4 A;  5D27 A;  5C6R A;  1TQZ A;  2FJL A;  4Z2M B;  4K2P A;  3CIK A;  4Y94 A;  1FHO A;  2YS5 A;  4H8S A;  2G35 A;  4ZRJ A;  1FOE A;  3VOQ A;  2J59 M;  1UNQ A;  1UPQ A;  4IFS A;  2BCJ A;  3PVL A;  2IFS A;  3A8Q A;  3P6A A;  2D2Q A;  2VKI A;  1I2H A;  4K81 A;  2DKQ A;  2P0F A;  1MPH A;  3N7C A;  3A98 B;  3SNH A;  2I1J A;  5JP4 A;  1Q67 A;  2DYN A;  3AU5 A;  1AQC A;  2OTX A;  1NI2 A;  2D9Y A;  2Y8F A;  1MKE A;  4K2O A;  3D8E A;  4HB0 B;  1ZC3 B;  2DKP A;  4EKU A;  1NTV A;  4CHJ A;  4DBB A;  2YF0 A;  2Y7B A;  2KGX B;  1MIZ B;  2YRY A;  2LOX A;  1FHX A;  3UZT A;  2V76 A;  2D11 A;  5J3T A;  5DHF B;  5KQ1 A;  4TKN A;  2DHJ A;  1XD4 A;  1M7E A;  2UZS A;  2YT1 A;  1J0W A;  1WJ1 A;  4L6E A;  2DFK A;  2RNR B;  5DH9 B;  2ROV A;  1EAZ A;  2N0Y A;  4GZU A;  1ZM0 A;  2ZPY A;  3QBV B;  2Y8G A;  5FI0 A;  3P7Z A;  1BTK A;  3SV1 A;  1NTY A;  5LOP B;  1EGX A;  5C5B A;  2JP2 A;  3X23 A;  2COF A;  5CLQ B;  5D3X A;  2GS0 A;  2KUP A;  1OMW A;  4Z2N A;  4KHO A;  4HAU B;  1P3R A;  1X86 A;  4D0N B;  2D9W A;  1WVH A;  4IOY X;  1XR0 B;  2CRF A;  4XWX A;  3KSY A;  3PVW A;  1UNP A;  4WJ7 A;  4F7G A;  2RVB B;  1E5W A;  1MAI A;  2H7E A;  2D10 A;  2K2U A;  1WGQ A;  2GCJ A;  2Z0O A;  3HK0 A;  2IYB A;  1GG3 A;  1BWN A;  1UEF A;  2P0H A;  2DA0 A;  3KY9 A;  4CHM A;  4YL8 A;  4DXA B;  1H4R A;  3VIA A;  2XQN M;  5DIF B;  2DHI A;  1UPR A;  5CLL B;  4F7H A;  2M38 A;  3SYX A;  1V5M A;  1V61 A;  1MIX A;  3NSU A;  5D3Y A;  1EF1 A;  2YT0 A;  1I7A A;  4P7I A;  2NMB A;  1Z87 A;  4PQ0 A;  3KRX A;  5HE0 A;  2ELA A;  3HW2 B;  1WI1 A;  1GC6 A;  1QQG A;  3U8Z A;  2VSZ A;  4KHA A;  1W1H A;  1U2B A;  2ROZ B;  3SUZ A;  2YVC A;  2EMT A;  1DBH A;  2COD A;  1OQN A;  4DX8 A;  1FAO A;  1MK7 B;  2KCJ A;  4A6F B;  2DYQ A;  2PZ1 A;  5J3Y A;  2COC A;  2J0K A;  1ZSQ A;  4NSW A;  1U5G A;  2MDX A;  2DX5 A;  3QIJ A;  1PFJ A;  4KVG B;  2RSG A;  3F5R A;  2VRW B;  2LYD A;  3IVF A;  2AEH A;  2W2W A;  2QKM A;  3GYO A;  1V88 A;  5DI9 B;  3DXC A;  4ZRI A;  1DDV A;  1QC6 A;  1W1D A;  4KAX B;  1EVH A;  3SO6 A;  3WA0 A;  4HAT B;  4HDQ A;  4F7U P;  1OY2 A;  1X1G A;  3GYP A;  3PEG A;  1K5D B;  1RRP B;  5GOW B;  3PVU A;  4MY6 A;  3F0W A;  3ULC A;  1N3H A;  1FGY A;  5HE3 A;  2MKR A;  2D9X A;  2HTH B;  3ODW A;  4HAW B;  4K17 A;  2J0J A;  1BTN A;  5J3Q A;  3KZ1 A;  2QKL A;  3PSC A;  5JLJ B;  1KZ7 A;  3DXD A;  3HQC A;  4HAV B;  3TFM A;  2W2X C;  1ZVR A;  2D4Q A;  2RUK B;  3DXE A;  5D3V A;  2N23 A;  5JHH A;  1SHC A;  2Z0Q A;  5D3W A;  5HE1 A;  3ZDT A;  2ELB A;  1B55 A;  2UZR A;  4C0A A;  2LKO A;  1XKE A;  3FM8 C;  2LUL A;  3TVV A;  2J0M A;  1KZG A;  5HE2 A;  4IAP A;  5C79 A;  3O96 A;  1V5U A;  4A6H A;  2CY4 A;  1DDM A;  1WGU A;  5C5B B;  1IRS A;  2EMS A;  1KI1 B;  1GC7 A;  4KHB B;  3V5W A;  2P8V A;  1V89 A;  2EJ8 A;  4HB2 B;  2YSZ A;  1ISN A;  5L81 A;  3FEH A;  1U5D A;  2HE7 A;  3MDB C;  4A6F A;  2L2I A;  2YS1 A;  4NY0 A;  2K00 A;  3BJI A;  1U27 A;  2CY5 A;  2E2X A;  1TXD A;  3BIN A;  1V5P A;  3PP2 A;  3OAN A;  1U29 A;  3RCP A;  3FSS A;  3LJU X;  2I5C A;  3AU4 A;  2OQB A;  2GJY A;  2L1C A;  4WVF B;  4EMO A;  2DHK A;  2Z0P A;  1FHW A;  1FGZ A;  4BBK A;  4HAY B;  2DX1 A;  4GN1 A;  1TJ6 A;  2R0D A;  4GPT B;  4GXB A;  4HB4 B;  1P5T A;  5DHA B;  1M7R A;  2I5F A;  1U5E A;  4PNK A;  1BAK A;  2D9V A;  3M1I B;  2K2J A;  3ULB A;  2EC1 A;  1X11 A;  1J19 A;  4WSF A;  1WG7 A;  4B6H A;  4GMX B;  1DYN A;  1FB8 A;  1WJM A;  1Y19 B;  2COA A;  2RGN B;  4YON A;  2X18 A;  1K5G B;  1Y5O A;  2D9Z A;  2H7D A;  1P6S A;  3QWM A;  3ZVR A;  3ODX A;  3KRW A;  4ZRK A;  2GCL A;  4HDO A;  3T06 A;  1X05 A;  1LW3 A;  4HHV A;  4HAZ B;  4HB3 B;  1DDW A;  2LOZ A;  2Q13 A;  1PMS A;  4GMV A;  2RLO A;  3ODO A;  4A6K A;  3D8F A;  2M14 A;  3G9W A;  1XOD A;  2DN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...