2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 2, isoform a
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
3SNHA 3QBVB 1XX0A 1J19A 3TVVA 4A6FB 2HTHB 3KRXA 5DIFB 2P0DA 2J59M 2AEHA 2GJYA 3SUZA 2D10A 2YS1A 1GG3A 3AU5A 3SYXA 2LOXA 2DKQA 1X1FA 2DHIA 1W1DA 3IVFA 1U5DA 1UEFA 1Y5OA 2M38A 2MFQA 1LW3A 2QKLA 3HK0A 2MKRA 2VKIA 3BINA 2RVBB 1EGXA 3O96A 2J0MA 2GS0A 2N0YA 3D8EA 3PVUA 1X05A 2CODA 3TFMA 3KY9A 1DDVA 2DYNA 1V5MA 4IFSA 4Z2MB 2I1JA 4HAXB 4TYZA 4ZRJA 1PLSA 4ZRKA 4CHMA 4TKNA 2JP2A 1V61A 1P6SA 2LKOA 4KHAA 4KAXB 1NI2A 2P8VA 3F5RA 2DX1A 2UVMA 5FI0A 2L2IA 1I2HA 2EMSA 1XCGA 2DKPA 4DXAB 4HAZB 3ODXA 2E2XA 5DH9B 2D9XA 5C5BA 1PFJA 3KZ1A 1EF1A 4WJ7A 1WGQA 2DA0A 3MDBC 1U5EA 4HATB 1MK7B 3ZVRA 1WVHA 1P3RA 3HQCA 1FOEA 2YS3A 2DX5A 4HB0B 2K2UA 1XR0B 4A6KA 1WI1A 5D27A 4WSFA 1P5TA 4GMXB 1MIZB 4D0NB 2M14A 2I5CA 5KQ1A 5JHHA 2W2WA 1W1HA 3PEGA 2RGNB 2BCJA 2ROZB 4B6HA 5LONB 4KVGB 3QIJA 2VRWB 2D4QA 1GC7A 3ODOA 1ZSQA 1ISNA 4HB3B 1EVHA 1UNPA 1WG7A 1NTVA 3PSCA 4YL8A 2P0HA 4K2PA 2COAA 1MKEA 1Y19B 2I5FA 3QWMA 2K00A 3RCPA 1OY2A 1UNRA 2LOZA 2ROVA 1Q67A 1XD4A 1E5WA 2NZ8B 4EMOA 3P6AA 4HDQA 3GYPA 3V5WA 1ZC4B 2Z0PA 4DBBA 2VSZA 1V5UA 2RUKB 2GCLA 1X86A 4GXBA 4YONA 1IRSA 5D3WA 5JP4A 2GCJA 2OQBA 4CHJA 2CY5A 3PVWA 4HAYB 1K5GB 3LJUX 2DHJA 5J3YA 2AL6A 3M1IB 5D3VA 1M7EA 4H8SA 2D2QA 1U29A 1W1GA 4A6FA 2DHKA 2J0KA 3ZDTA 2CRFA 4C0AA 1RJ2A 4IOYX 2H7DA 3PP2A 1DBHA 4HAVB 2DTCA 1M7RA 2W2XD 1V88A 2D9VA 3OANA 1DDMA 2ADZA 1KZGA 1V5PA 1KI1B 1H10A 5JLJB 4MT7A 2NMBA 4HB4B 5D3YA 2DLWA 4HDOA 2Y7BA 4ZRIA 1FHOA 3PG7A 4NY0A 3DXEA 5LOPB 2DYQA 4NSWA 1FGYA 1AWEA 1U2BA 3A8QA 4WVFB 2Q13A 4L6EA 3SV1A 3SO6A 1TJ6A 4BBKA 3U7DA 2YVCA 2CAYA 2XQNM 3UZTA 1X11A 2EJ8A 1MPHA 4HAWB 2R0DA 3P7ZA 4K2OA 2FJLA 1ZC3B 2MWNB 4GMVA 1OQNA 2D11A 1BWNA 4F7UP 3TW1A 5HE1A 2UZSA 5JHGA 4Y94A 1N3HA 5EFXA 2COFA 3T06A 3TCAA 1WJ1A 3GYOA 4F7GA 1WJMA 4DX90 2IYBA 2HE7A 1FGZA 4F7HA 1XODA 3ULBA 1BTKA 5D3XA 1OMWA 1GC6A 5DHAB 1ZM0A 2QKMA 1FB8A 2IFSA 1NU2A 1J0WA 3KSYA 1FHXA 5J3QA 1MIXA 2Y8FA 2LULA 2MDXA 3TO1A 1X1GA 3HW2B 4XWXA 3N7CA 2KGXB 1U27A 2N23A 2R09A 2RLOA 1UNQA 5KCVA 4EJNA 1XKEA 2L1CA 5C79A 2P0FA 3ODWA 2YSZA 5HE0A 3NSUA 5C16A 1BTNA 3A98B 2COCA 5HE2A 2KCJA 2YT0A 3WYFB 4HAUB 1Z87A 2Z0QA 2RSGA 5DHFB 2W2XC 5C5BB 1UPRA 2ZPYA 5J3TA 2G35A 2D9YA 2YRYA 1BAKA 2H7EA 1U5FA 1B55A 3G9WA 1DDWA 2J0JA 1RRPB 3FSSA 2YT1A 5FI1A 3DXCA 1AQCA 5L81A 4K17A 3DXDA 1KZ7A 2D9WA 3WA0A 4P7IA 2EMTA 2LG1A 2OTXA 3FM8C 4Z2NA 1WGUA 2CY4A 2YS5A 1H4RA 1QQGA 2RNRB 3CXBB 4A5KA 1SHCA 5HE3A 1UPQA 2KUPA 4HHVA 5KQ4A 4GN1A 4GZUA 4KHBB 4A6HA 3FEHA 2PZ1A 2V76A 1LB1A 3MPXA 2D9ZA 1TQZA 3AU4A 3X23A 2Y8GA 4GPTB 5C6RA 4K81A 4MK0A 4IAPA 1FAOA 4CYEA 1DYNA 3D8FA 1ZVRA 4EKUA 1K5DB 3D8DA 3U8ZA 1DROA 4KHOA 3KRWA 4HB2B 2LYDA 2ELAA 2K2JA 4MY6A 2ELBA 2X18A 1EAZA 3A8PA 3PZDA 5DI9B 4PNKA 1QC6A 5GOWB 5CLLB 1NTYA 3ULCA 3PVLA 1MAIA 1MK9B 3BJIA 1SGHA 4PQ0A 1I7AA 2DN6A 3AJ4A 2I1KA 2DFKA 2UZRA 3CIKA 2EC1A 1PMSA 1TXDA 3VIAA 4DX8A 1U5GA 2YF0A 1FHWA 1V89A 3ML4A 3F0WA 2Z0OA 3VOQA 5CLQB
chains in the Genus database with same CATH superfamily
3SNHA 3QBVB 1XX0A 1J19A 3TVVA 4A6FB 2HTHB 3KRXA 5DIFB 2P0DA 2J59M 2AEHA 2GJYA 3SUZA 2D10A 2YS1A 1GG3A 3AU5A 3SYXA 2LOXA 2DKQA 1X1FA 2DHIA 1W1DA 3IVFA 1U5DA 1UEFA 1Y5OA 2M38A 2MFQA 1LW3A 2QKLA 3HK0A 2MKRA 2VKIA 3BINA 2RVBB 1EGXA 3O96A 3HIEA 2J0MA 2GS0A 2N0YA 3D8EA 3PVUA 1X05A 2CODA 3TFMA 3A58A 2GUMA 3KY9A 1DDVA 2DYNA 1MI1A 1V5MA 4IFSA 4Z2MB 2I1JA 3OHMB 4HAXB 4TYZA 4ZRJA 1PLSA 4GNKB 4ZRKA 4CHMA 4TKNA 2JP2A 1V61A 1P6SA 2LKOA 4KHAA 4KAXB 3NWDA 1NI2A 2P8VA 3F5RA 2DX1A 2UVMA 5FI0A 2L2IA 1I2HA 2EMSA 1XCGA 2DKPA 2K8EA 4DXAB 4HAZB 3ODXA 2E2XA 5DH9B 2D9XA 5C5BA 1PFJA 3KZ1A 5LG4B 1EF1A 2YT2A 4WJ7A 1WGQA 2DA0A 3MDBC 1U5EA 4HATB 1MK7B 3ZVRA 1WVHA 1P3RA 3HQCA 1FOEA 2YS3A 2DX5A 4HB0B 2K2UA 1XR0B 4A6KA 1WI1A 5D27A 4WSFA 3U12A 2R2YA 1P5TA 4GMXB 1MIZB 4D0NB 2M14A 2I5CA 5KQ1A 5JHHA 2W2WA 1W1HA 3PEGA 2RGNB 2BCJA 2ROZB 4B6HA 5LONB 2Z59A 4KVGB 3QIJA 4KHBA 2VRWB 2D4QA 1GC7A 3ODOA 1ZSQA 1ISNA 4HB3B 1EVHA 1UNPA 1WG7A 1NTVA 3PSCA 4YL8A 2P0HA 4K2PA 2COAA 1MKEA 1ZYIA 1Y19B 2I5FA 3QWMA 2K00A 3RCPA 1OY2A 1UNRA 2LOZA 2ROVA 1Q67A 1XD4A 1E5WA 2NZ8B 4EMOA 3P6AA 4HDQA 3GYPA 3V5WA 1ZC4B 2Z0PA 4DBBA 2VSZA 1V5UA 4GOUA 2RUKB 2GCLA 1X86A 4GXBA 4YONA 1IRSA 5D3WA 4OSNA 5JP4A 2GCJA 2OQBA 4CHJA 2CY5A 3PVWA 4HAYB 5IRSA 1K5GB 2Z13A 3LJUX 2DHJA 2KUQA 5J3YA 2AL6A 3M1IB 2Z14A 5D3VA 1M7EA 3NW8A 4H8SA 2D2QA 1U29A 1W1GA 4A6FA 2DHKA 2J0KA 3ZDTA 2CRFA 4C0AA 1RJ2A 4IOYX 2H7DA 3PP2A 1DBHA 4HAVB 2DTCA 3NWFA 1M7RA 2W2XD 1V88A 2D9VA 3OANA 1DDMA 2ADZA 1KZGA 1V5PA 3FVCA 1KI1B 1H10A 5JLJB 4MT7A 2NMBA 4HB4B 5D3YA 2DLWA 4HDOA 2Y7BA 4OT1A 4ZRIA 1FHOA 3PG7A 4NY0A 3DXEA 5LOPB 2DYQA 4NSWA 1FGYA 1AWEA 1U2BA 3A8QA 4WVFB 2Q13A 4L6EA 3SV1A 3SO6A 1TJ6A 4BBKA 3U7DA 3NWAA 2YVCA 2CAYA 2XQNM 3UZTA 1X11A 2EJ8A 1MPHA 4HAWB 2R0DA 3P7ZA 4K2OA 2FJLA 1ZC3B 1T77A 2MWNB 4GMVA 1OQNA 2D11A 1BWNA 2KIEA 4F7UP 3TW1A 5HE1A 2UZSA 5JHGA 4Y94A 3HSAA 1N3HA 5EFXA 2FJUB 2COFA 3T06A 3TCAA 1WJ1A 3GYOA 4F7GA 1WJMA 4DX90 2IYBA 2Z4DA 2HE7A 1FGZA 4F7HA 1XODA 3ULBA 1BTKA 5D3XA 1OMWA 1GC6A 5DHAB 1ZM0A 2QKMA 1FB8A 2IFSA 1NU2A 1J0WA 3KSYA 1FHXA 5J3QA 1MIXA 2Y8FA 2LULA 2MDXA 3TO1A 1X1GA 5I2SA 3HW2B 4XWXA 3N7CA 2KGXB 1U27A 2N23A 2RLOA 2R09A 1UNQA 5KCVA 4EJNA 1XKEA 2L1CA 5C79A 2P0FA 2ZKMX 3ODWA 4HSIA 2YSZA 5HE0A 4L1RA 3NSUA 5C16A 1BTNA 3A98B 2COCA 5HE2A 2KCJA 2YT0A 3WYFB 4HAUB 1Z87A 2Z0QA 2RSGA 5DHFB 2W2XC 4QXAB 5C5BB 1UPRA 2ZPYA 5J3TA 2G35A 2D9YA 2YRYA 1BAKA 2H7EA 1U5FA 1B55A 3G9WA 5M4YB 1DDWA 2J0JA 4QJ4B 4CSQA 1RRPB 3FSSA 2YT1A 5FI1A 3DXCA 1AQCA 5L81A 4K17A 4QJ5B 3DXDA 1KZ7A 2D9WA 3WA0A 3DCXA 4P7IA 2EMTA 2LG1A 2OTXA 3FM8C 4Z2NA 1WGUA 2CY4A 2YS5A 1H4RA 1QQGA 2RNRB 3CXBB 4A5KA 1SHCA 5HE3A 1UPQA 2KUPA 4HHVA 5KQ4A 4GN1A 4GZUA 4KHBB 4A6HA 3FEHA 2PZ1A 2V76A 1LB1A 3MPXA 2D9ZA 1TQZA 3AU4A 3X23A 2Y8GA 4GPTB 5C6RA 4K81A 4MK0A 5I2MA 4IAPA 4DIXA 2NBVA 4D6WA 2K49A 1FAOA 4QJ3B 4CYEA 1DYNA 3D8FA 1ZVRA 4EKUA 3D8DA 1K5DB 2RRFA 3U8ZA 1DROA 4KHOA 3KRWA 4HB2B 2LYDA 2ELAA 2K2JA 4MY6A 2ELBA 2X18A 1EAZA 3A8PA 3PZDA 5DI9B 4PNKA 3B77A 1QC6A 5GOWB 5CLLB 1NTYA 3ULCA 3BJIA 1MAIA 1MK9B 3PVLA 1SGHA 4PQ0A 1I7AA 2DN6A 3AJ4A 2KIGA 2I1KA 2DFKA 2UZRA 3CIKA 2EC1A 1PMSA 1TXDA 3VIAA 4DX8A 2KR0A 1U5GA 2YF0A 1FHWA 1V89A 3ML4A 3F0WA 2Z0OA 3VOQA 5CLQB
chains in the Genus database with same CATH topology
3SNHA 3QBVB 1XX0A 1J19A 3TVVA 4A6FB 2HTHB 3KRXA 5DIFB 2P0DA 2J59M 2AEHA 2GJYA 3SUZA 2D10A 2YS1A 1GG3A 3AU5A 3SYXA 2LOXA 2DKQA 1X1FA 2DHIA 1W1DA 3IVFA 1U5DA 1UEFA 1Y5OA 2M38A 2MFQA 1LW3A 2QKLA 3HK0A 2MKRA 2VKIA 3BINA 2RVBB 1EGXA 3O96A 2J0MA 2GS0A 2N0YA 3D8EA 3PVUA 1X05A 2CODA 3TFMA 3KY9A 1DDVA 2DYNA 1V5MA 4IFSA 4Z2MB 2I1JA 4HAXB 4TYZA 4ZRJA 1PLSA 4ZRKA 4CHMA 4TKNA 2JP2A 1V61A 1P6SA 2LKOA 4KHAA 4KAXB 1NI2A 2P8VA 3F5RA 2DX1A 2UVMA 5FI0A 2L2IA 1I2HA 2EMSA 1XCGA 2DKPA 4DXAB 4HAZB 3ODXA 2E2XA 5DH9B 2D9XA 5C5BA 1PFJA 3KZ1A 1EF1A 4WJ7A 1WGQA 2DA0A 3MDBC 1U5EA 4HATB 1MK7B 3ZVRA 1WVHA 1P3RA 3HQCA 1FOEA 2YS3A 2DX5A 4HB0B 2K2UA 1XR0B 4A6KA 1WI1A 5D27A 4WSFA 1P5TA 4GMXB 1MIZB 4D0NB 2M14A 2I5CA 5KQ1A 5JHHA 2W2WA 1W1HA 3PEGA 2RGNB 2BCJA 2ROZB 4B6HA 5LONB 4KVGB 3QIJA 2VRWB 2D4QA 1GC7A 3ODOA 1ZSQA 1ISNA 4HB3B 1EVHA 1UNPA 1WG7A 1NTVA 3PSCA 4YL8A 2P0HA 4K2PA 2COAA 1MKEA 1Y19B 2I5FA 3QWMA 2K00A 3RCPA 1OY2A 1UNRA 2LOZA 2ROVA 1Q67A 1XD4A 1E5WA 2NZ8B 4EMOA 3P6AA 4HDQA 3GYPA 3V5WA 1ZC4B 2Z0PA 4DBBA 2VSZA 1V5UA 2RUKB 2GCLA 1X86A 4GXBA 4YONA 1IRSA 5D3WA 5JP4A 2GCJA 2OQBA 4CHJA 2CY5A 3PVWA 4HAYB 1K5GB 3LJUX 2DHJA 5J3YA 2AL6A 3M1IB 5D3VA 1M7EA 4H8SA 2D2QA 1U29A 1W1GA 4A6FA 2DHKA 2J0KA 3ZDTA 2CRFA 4C0AA 1RJ2A 4IOYX 2H7DA 3PP2A 1DBHA 4HAVB 2DTCA 1M7RA 2W2XD 1V88A 2D9VA 3OANA 1DDMA 2ADZA 1KZGA 1V5PA 1KI1B 1H10A 5JLJB 4MT7A 2NMBA 4HB4B 5D3YA 2DLWA 4HDOA 2Y7BA 4ZRIA 1FHOA 3PG7A 4NY0A 3DXEA 5LOPB 2DYQA 4NSWA 1FGYA 1AWEA 1U2BA 3A8QA 4WVFB 2Q13A 4L6EA 3SV1A 3SO6A 1TJ6A 4BBKA 3U7DA 2YVCA 2CAYA 2XQNM 3UZTA 1X11A 2EJ8A 1MPHA 4HAWB 2R0DA 3P7ZA 4K2OA 2FJLA 1ZC3B 2MWNB 4GMVA 1OQNA 2D11A 1BWNA 4F7UP 3TW1A 5HE1A 2UZSA 5JHGA 4Y94A 1N3HA 5EFXA 2COFA 3T06A 3TCAA 1WJ1A 3GYOA 4F7GA 1WJMA 4DX90 2IYBA 2HE7A 1FGZA 4F7HA 1XODA 3ULBA 1BTKA 5D3XA 1OMWA 1GC6A 5DHAB 1ZM0A 2QKMA 1FB8A 2IFSA 1NU2A 1J0WA 3KSYA 1FHXA 5J3QA 1MIXA 2Y8FA 2LULA 2MDXA 3TO1A 1X1GA 3HW2B 4XWXA 3N7CA 2KGXB 1U27A 2N23A 2R09A 2RLOA 1UNQA 5KCVA 4EJNA 1XKEA 2L1CA 5C79A 2P0FA 3ODWA 2YSZA 5HE0A 3NSUA 5C16A 1BTNA 3A98B 2COCA 5HE2A 2KCJA 2YT0A 3WYFB 4HAUB 1Z87A 2Z0QA 2RSGA 5DHFB 2W2XC 5C5BB 1UPRA 2ZPYA 5J3TA 2G35A 2D9YA 2YRYA 1BAKA 2H7EA 1U5FA 1B55A 3G9WA 1DDWA 2J0JA 1RRPB 3FSSA 2YT1A 5FI1A 3DXCA 1AQCA 5L81A 4K17A 3DXDA 1KZ7A 2D9WA 3WA0A 4P7IA 2EMTA 2LG1A 2OTXA 3FM8C 4Z2NA 1WGUA 2CY4A 2YS5A 1H4RA 1QQGA 2RNRB 3CXBB 4A5KA 1SHCA 5HE3A 1UPQA 2KUPA 4HHVA 5KQ4A 4GN1A 4GZUA 4KHBB 4A6HA 3FEHA 2PZ1A 2V76A 1LB1A 3MPXA 2D9ZA 1TQZA 3AU4A 3X23A 2Y8GA 4GPTB 5C6RA 4K81A 4MK0A 4IAPA 1FAOA 4CYEA 1DYNA 3D8FA 1ZVRA 4EKUA 1K5DB 3D8DA 3U8ZA 1DROA 4KHOA 3KRWA 4HB2B 2LYDA 2ELAA 2K2JA 4MY6A 2ELBA 2X18A 1EAZA 3A8PA 3PZDA 5DI9B 4PNKA 1QC6A 5GOWB 5CLLB 1NTYA 3ULCA 3PVLA 1MAIA 1MK9B 3BJIA 1SGHA 4PQ0A 1I7AA 2DN6A 3AJ4A 2I1KA 2DFKA 2UZRA 3CIKA 2EC1A 1PMSA 1TXDA 3VIAA 4DX8A 1U5GA 2YF0A 1FHWA 1V89A 3ML4A 3F0WA 2Z0OA 3VOQA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNH A;  3QBV B;  1XX0 A;  1J19 A;  3TVV A;  4A6F B;  2HTH B;  3KRX A;  5DIF B;  2P0D A;  2J59 M;  2AEH A;  2GJY A;  3SUZ A;  2D10 A;  2YS1 A;  1GG3 A;  3AU5 A;  3SYX A;  2LOX A;  2DKQ A;  1X1F A;  2DHI A;  1W1D A;  3IVF A;  1U5D A;  1UEF A;  1Y5O A;  2M38 A;  2MFQ A;  1LW3 A;  2QKL A;  3HK0 A;  2MKR A;  2VKI A;  3BIN A;  2RVB B;  1EGX A;  3O96 A;  2J0M A;  2GS0 A;  2N0Y A;  3D8E A;  3PVU A;  1X05 A;  2COD A;  3TFM A;  3KY9 A;  1DDV A;  2DYN A;  1V5M A;  4IFS A;  4Z2M B;  2I1J A;  4HAX B;  4TYZ A;  4ZRJ A;  1PLS A;  4ZRK A;  4CHM A;  4TKN A;  2JP2 A;  1V61 A;  1P6S A;  2LKO A;  4KHA A;  4KAX B;  1NI2 A;  2P8V A;  3F5R A;  2DX1 A;  2UVM A;  5FI0 A;  2L2I A;  1I2H A;  2EMS A;  1XCG A;  2DKP A;  4DXA B;  4HAZ B;  3ODX A;  2E2X A;  5DH9 B;  2D9X A;  5C5B A;  1PFJ A;  3KZ1 A;  1EF1 A;  4WJ7 A;  1WGQ A;  2DA0 A;  3MDB C;  1U5E A;  4HAT B;  1MK7 B;  3ZVR A;  1WVH A;  1P3R A;  3HQC A;  1FOE A;  2YS3 A;  2DX5 A;  4HB0 B;  2K2U A;  1XR0 B;  4A6K A;  1WI1 A;  5D27 A;  4WSF A;  1P5T A;  4GMX B;  1MIZ B;  4D0N B;  2M14 A;  2I5C A;  5KQ1 A;  5JHH A;  2W2W A;  1W1H A;  3PEG A;  2RGN B;  2BCJ A;  2ROZ B;  4B6H A;  5LON B;  4KVG B;  3QIJ A;  2VRW B;  2D4Q A;  1GC7 A;  3ODO A;  1ZSQ A;  1ISN A;  4HB3 B;  1EVH A;  1UNP A;  1WG7 A;  1NTV A;  3PSC A;  4YL8 A;  2P0H A;  4K2P A;  2COA A;  1MKE A;  1Y19 B;  2I5F A;  3QWM A;  2K00 A;  3RCP A;  1OY2 A;  1UNR A;  2LOZ A;  2ROV A;  1Q67 A;  1XD4 A;  1E5W A;  2NZ8 B;  4EMO A;  3P6A A;  4HDQ A;  3GYP A;  3V5W A;  1ZC4 B;  2Z0P A;  4DBB A;  2VSZ A;  1V5U A;  2RUK B;  2GCL A;  1X86 A;  4GXB A;  4YON A;  1IRS A;  5D3W A;  5JP4 A;  2GCJ A;  2OQB A;  4CHJ A;  2CY5 A;  3PVW A;  4HAY B;  1K5G B;  3LJU X;  2DHJ A;  5J3Y A;  2AL6 A;  3M1I B;  5D3V A;  1M7E A;  4H8S A;  2D2Q A;  1U29 A;  1W1G A;  4A6F A;  2DHK A;  2J0K A;  3ZDT A;  2CRF A;  4C0A A;  1RJ2 A;  4IOY X;  2H7D A;  3PP2 A;  1DBH A;  4HAV B;  2DTC A;  1M7R A;  2W2X D;  1V88 A;  2D9V A;  3OAN A;  1DDM A;  2ADZ A;  1KZG A;  1V5P A;  1KI1 B;  1H10 A;  5JLJ B;  4MT7 A;  2NMB A;  4HB4 B;  5D3Y A;  2DLW A;  4HDO A;  2Y7B A;  4ZRI A;  1FHO A;  3PG7 A;  4NY0 A;  3DXE A;  5LOP B;  2DYQ A;  4NSW A;  1FGY A;  1AWE A;  1U2B A;  3A8Q A;  4WVF B;  2Q13 A;  4L6E A;  3SV1 A;  3SO6 A;  1TJ6 A;  4BBK A;  3U7D A;  2YVC A;  2CAY A;  2XQN M;  3UZT A;  1X11 A;  2EJ8 A;  1MPH A;  4HAW B;  2R0D A;  3P7Z A;  4K2O A;  2FJL A;  1ZC3 B;  2MWN B;  4GMV A;  1OQN A;  2D11 A;  1BWN A;  4F7U P;  3TW1 A;  5HE1 A;  2UZS A;  5JHG A;  4Y94 A;  1N3H A;  5EFX A;  2COF A;  3T06 A;  3TCA A;  1WJ1 A;  3GYO A;  4F7G A;  1WJM A;  4DX9 0;  2IYB A;  2HE7 A;  1FGZ A;  4F7H A;  1XOD A;  3ULB A;  1BTK A;  5D3X A;  1OMW A;  1GC6 A;  5DHA B;  1ZM0 A;  2QKM A;  1FB8 A;  2IFS A;  1NU2 A;  1J0W A;  3KSY A;  1FHX A;  5J3Q A;  1MIX A;  2Y8F A;  2LUL A;  2MDX A;  3TO1 A;  1X1G A;  3HW2 B;  4XWX A;  3N7C A;  2KGX B;  1U27 A;  2N23 A;  2R09 A;  2RLO A;  1UNQ A;  5KCV A;  4EJN A;  1XKE A;  2L1C A;  5C79 A;  2P0F A;  3ODW A;  2YSZ A;  5HE0 A;  3NSU A;  5C16 A;  1BTN A;  3A98 B;  2COC A;  5HE2 A;  2KCJ A;  2YT0 A;  3WYF B;  4HAU B;  1Z87 A;  2Z0Q A;  2RSG A;  5DHF B;  2W2X C;  5C5B B;  1UPR A;  2ZPY A;  5J3T A;  2G35 A;  2D9Y A;  2YRY A;  1BAK A;  2H7E A;  1U5F A;  1B55 A;  3G9W A;  1DDW A;  2J0J A;  1RRP B;  3FSS A;  2YT1 A;  5FI1 A;  3DXC A;  1AQC A;  5L81 A;  4K17 A;  3DXD A;  1KZ7 A;  2D9W A;  3WA0 A;  4P7I A;  2EMT A;  2LG1 A;  2OTX A;  3FM8 C;  4Z2N A;  1WGU A;  2CY4 A;  2YS5 A;  1H4R A;  1QQG A;  2RNR B;  3CXB B;  4A5K A;  1SHC A;  5HE3 A;  1UPQ A;  2KUP A;  4HHV A;  5KQ4 A;  4GN1 A;  4GZU A;  4KHB B;  4A6H A;  3FEH A;  2PZ1 A;  2V76 A;  1LB1 A;  3MPX A;  2D9Z A;  1TQZ A;  3AU4 A;  3X23 A;  2Y8G A;  4GPT B;  5C6R A;  4K81 A;  4MK0 A;  4IAP A;  1FAO A;  4CYE A;  1DYN A;  3D8F A;  1ZVR A;  4EKU A;  1K5D B;  3D8D A;  3U8Z A;  1DRO A;  4KHO A;  3KRW A;  4HB2 B;  2LYD A;  2ELA A;  2K2J A;  4MY6 A;  2ELB A;  2X18 A;  1EAZ A;  3A8P A;  3PZD A;  5DI9 B;  4PNK A;  1QC6 A;  5GOW B;  5CLL B;  1NTY A;  3ULC A;  3PVL A;  1MAI A;  1MK9 B;  3BJI A;  1SGH A;  4PQ0 A;  1I7A A;  2DN6 A;  3AJ4 A;  2I1K A;  2DFK A;  2UZR A;  3CIK A;  2EC1 A;  1PMS A;  1TXD A;  3VIA A;  4DX8 A;  1U5G A;  2YF0 A;  1FHW A;  1V89 A;  3ML4 A;  3F0W A;  2Z0O A;  3VOQ A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 3SNH A;  3QBV B;  1XX0 A;  1J19 A;  3TVV A;  4A6F B;  2HTH B;  3KRX A;  5DIF B;  2P0D A;  2J59 M;  2AEH A;  2GJY A;  3SUZ A;  2D10 A;  2YS1 A;  1GG3 A;  3AU5 A;  3SYX A;  2LOX A;  2DKQ A;  1X1F A;  2DHI A;  1W1D A;  3IVF A;  1U5D A;  1UEF A;  1Y5O A;  2M38 A;  2MFQ A;  1LW3 A;  2QKL A;  3HK0 A;  2MKR A;  2VKI A;  3BIN A;  2RVB B;  1EGX A;  3O96 A;  3HIE A;  2J0M A;  2GS0 A;  2N0Y A;  3D8E A;  3PVU A;  1X05 A;  2COD A;  3TFM A;  3A58 A;  2GUM A;  3KY9 A;  1DDV A;  2DYN A;  1MI1 A;  1V5M A;  4IFS A;  4Z2M B;  2I1J A;  3OHM B;  4HAX B;  4TYZ A;  4ZRJ A;  1PLS A;  4GNK B;  4ZRK A;  4CHM A;  4TKN A;  2JP2 A;  1V61 A;  1P6S A;  2LKO A;  4KHA A;  4KAX B;  3NWD A;  1NI2 A;  2P8V A;  3F5R A;  2DX1 A;  2UVM A;  5FI0 A;  2L2I A;  1I2H A;  2EMS A;  1XCG A;  2DKP A;  2K8E A;  4DXA B;  4HAZ B;  3ODX A;  2E2X A;  5DH9 B;  2D9X A;  5C5B A;  1PFJ A;  3KZ1 A;  5LG4 B;  1EF1 A;  2YT2 A;  4WJ7 A;  1WGQ A;  2DA0 A;  3MDB C;  1U5E A;  4HAT B;  1MK7 B;  3ZVR A;  1WVH A;  1P3R A;  3HQC A;  1FOE A;  2YS3 A;  2DX5 A;  4HB0 B;  2K2U A;  1XR0 B;  4A6K A;  1WI1 A;  5D27 A;  4WSF A;  3U12 A;  2R2Y A;  1P5T A;  4GMX B;  1MIZ B;  4D0N B;  2M14 A;  2I5C A;  5KQ1 A;  5JHH A;  2W2W A;  1W1H A;  3PEG A;  2RGN B;  2BCJ A;  2ROZ B;  4B6H A;  5LON B;  2Z59 A;  4KVG B;  3QIJ A;  4KHB A;  2VRW B;  2D4Q A;  1GC7 A;  3ODO A;  1ZSQ A;  1ISN A;  4HB3 B;  1EVH A;  1UNP A;  1WG7 A;  1NTV A;  3PSC A;  4YL8 A;  2P0H A;  4K2P A;  2COA A;  1MKE A;  1ZYI A;  1Y19 B;  2I5F A;  3QWM A;  2K00 A;  3RCP A;  1OY2 A;  1UNR A;  2LOZ A;  2ROV A;  1Q67 A;  1XD4 A;  1E5W A;  2NZ8 B;  4EMO A;  3P6A A;  4HDQ A;  3GYP A;  3V5W A;  1ZC4 B;  2Z0P A;  4DBB A;  2VSZ A;  1V5U A;  4GOU A;  2RUK B;  2GCL A;  1X86 A;  4GXB A;  4YON A;  1IRS A;  5D3W A;  4OSN A;  5JP4 A;  2GCJ A;  2OQB A;  4CHJ A;  2CY5 A;  3PVW A;  4HAY B;  5IRS A;  1K5G B;  2Z13 A;  3LJU X;  2DHJ A;  2KUQ A;  5J3Y A;  2AL6 A;  3M1I B;  2Z14 A;  5D3V A;  1M7E A;  3NW8 A;  4H8S A;  2D2Q A;  1U29 A;  1W1G A;  4A6F A;  2DHK A;  2J0K A;  3ZDT A;  2CRF A;  4C0A A;  1RJ2 A;  4IOY X;  2H7D A;  3PP2 A;  1DBH A;  4HAV B;  2DTC A;  3NWF A;  1M7R A;  2W2X D;  1V88 A;  2D9V A;  3OAN A;  1DDM A;  2ADZ A;  1KZG A;  1V5P A;  3FVC A;  1KI1 B;  1H10 A;  5JLJ B;  4MT7 A;  2NMB A;  4HB4 B;  5D3Y A;  2DLW A;  4HDO A;  2Y7B A;  4OT1 A;  4ZRI A;  1FHO A;  3PG7 A;  4NY0 A;  3DXE A;  5LOP B;  2DYQ A;  4NSW A;  1FGY A;  1AWE A;  1U2B A;  3A8Q A;  4WVF B;  2Q13 A;  4L6E A;  3SV1 A;  3SO6 A;  1TJ6 A;  4BBK A;  3U7D A;  3NWA A;  2YVC A;  2CAY A;  2XQN M;  3UZT A;  1X11 A;  2EJ8 A;  1MPH A;  4HAW B;  2R0D A;  3P7Z A;  4K2O A;  2FJL A;  1ZC3 B;  1T77 A;  2MWN B;  4GMV A;  1OQN A;  2D11 A;  1BWN A;  2KIE A;  4F7U P;  3TW1 A;  5HE1 A;  2UZS A;  5JHG A;  4Y94 A;  3HSA A;  1N3H A;  5EFX A;  2FJU B;  2COF A;  3T06 A;  3TCA A;  1WJ1 A;  3GYO A;  4F7G A;  1WJM A;  4DX9 0;  2IYB A;  2Z4D A;  2HE7 A;  1FGZ A;  4F7H A;  1XOD A;  3ULB A;  1BTK A;  5D3X A;  1OMW A;  1GC6 A;  5DHA B;  1ZM0 A;  2QKM A;  1FB8 A;  2IFS A;  1NU2 A;  1J0W A;  3KSY A;  1FHX A;  5J3Q A;  1MIX A;  2Y8F A;  2LUL A;  2MDX A;  3TO1 A;  1X1G A;  5I2S A;  3HW2 B;  4XWX A;  3N7C A;  2KGX B;  1U27 A;  2N23 A;  2RLO A;  2R09 A;  1UNQ A;  5KCV A;  4EJN A;  1XKE A;  2L1C A;  5C79 A;  2P0F A;  2ZKM X;  3ODW A;  4HSI A;  2YSZ A;  5HE0 A;  4L1R A;  3NSU A;  5C16 A;  1BTN A;  3A98 B;  2COC A;  5HE2 A;  2KCJ A;  2YT0 A;  3WYF B;  4HAU B;  1Z87 A;  2Z0Q A;  2RSG A;  5DHF B;  2W2X C;  4QXA B;  5C5B B;  1UPR A;  2ZPY A;  5J3T A;  2G35 A;  2D9Y A;  2YRY A;  1BAK A;  2H7E A;  1U5F A;  1B55 A;  3G9W A;  5M4Y B;  1DDW A;  2J0J A;  4QJ4 B;  4CSQ A;  1RRP B;  3FSS A;  2YT1 A;  5FI1 A;  3DXC A;  1AQC A;  5L81 A;  4K17 A;  4QJ5 B;  3DXD A;  1KZ7 A;  2D9W A;  3WA0 A;  3DCX A;  4P7I A;  2EMT A;  2LG1 A;  2OTX A;  3FM8 C;  4Z2N A;  1WGU A;  2CY4 A;  2YS5 A;  1H4R A;  1QQG A;  2RNR B;  3CXB B;  4A5K A;  1SHC A;  5HE3 A;  1UPQ A;  2KUP A;  4HHV A;  5KQ4 A;  4GN1 A;  4GZU A;  4KHB B;  4A6H A;  3FEH A;  2PZ1 A;  2V76 A;  1LB1 A;  3MPX A;  2D9Z A;  1TQZ A;  3AU4 A;  3X23 A;  2Y8G A;  4GPT B;  5C6R A;  4K81 A;  4MK0 A;  5I2M A;  4IAP A;  4DIX A;  2NBV A;  4D6W A;  2K49 A;  1FAO A;  4QJ3 B;  4CYE A;  1DYN A;  3D8F A;  1ZVR A;  4EKU A;  3D8D A;  1K5D B;  2RRF A;  3U8Z A;  1DRO A;  4KHO A;  3KRW A;  4HB2 B;  2LYD A;  2ELA A;  2K2J A;  4MY6 A;  2ELB A;  2X18 A;  1EAZ A;  3A8P A;  3PZD A;  5DI9 B;  4PNK A;  3B77 A;  1QC6 A;  5GOW B;  5CLL B;  1NTY A;  3ULC A;  3BJI A;  1MAI A;  1MK9 B;  3PVL A;  1SGH A;  4PQ0 A;  1I7A A;  2DN6 A;  3AJ4 A;  2KIG A;  2I1K A;  2DFK A;  2UZR A;  3CIK A;  2EC1 A;  1PMS A;  1TXD A;  3VIA A;  4DX8 A;  2KR0 A;  1U5G A;  2YF0 A;  1FHW A;  1V89 A;  3ML4 A;  3F0W A;  2Z0O A;  3VOQ A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 3SNH A;  3QBV B;  1XX0 A;  1J19 A;  3TVV A;  4A6F B;  2HTH B;  3KRX A;  5DIF B;  2P0D A;  2J59 M;  2AEH A;  2GJY A;  3SUZ A;  2D10 A;  2YS1 A;  1GG3 A;  3AU5 A;  3SYX A;  2LOX A;  2DKQ A;  1X1F A;  2DHI A;  1W1D A;  3IVF A;  1U5D A;  1UEF A;  1Y5O A;  2M38 A;  2MFQ A;  1LW3 A;  2QKL A;  3HK0 A;  2MKR A;  2VKI A;  3BIN A;  2RVB B;  1EGX A;  3O96 A;  2J0M A;  2GS0 A;  2N0Y A;  3D8E A;  3PVU A;  1X05 A;  2COD A;  3TFM A;  3KY9 A;  1DDV A;  2DYN A;  1V5M A;  4IFS A;  4Z2M B;  2I1J A;  4HAX B;  4TYZ A;  4ZRJ A;  1PLS A;  4ZRK A;  4CHM A;  4TKN A;  2JP2 A;  1V61 A;  1P6S A;  2LKO A;  4KHA A;  4KAX B;  1NI2 A;  2P8V A;  3F5R A;  2DX1 A;  2UVM A;  5FI0 A;  2L2I A;  1I2H A;  2EMS A;  1XCG A;  2DKP A;  4DXA B;  4HAZ B;  3ODX A;  2E2X A;  5DH9 B;  2D9X A;  5C5B A;  1PFJ A;  3KZ1 A;  1EF1 A;  4WJ7 A;  1WGQ A;  2DA0 A;  3MDB C;  1U5E A;  4HAT B;  1MK7 B;  3ZVR A;  1WVH A;  1P3R A;  3HQC A;  1FOE A;  2YS3 A;  2DX5 A;  4HB0 B;  2K2U A;  1XR0 B;  4A6K A;  1WI1 A;  5D27 A;  4WSF A;  1P5T A;  4GMX B;  1MIZ B;  4D0N B;  2M14 A;  2I5C A;  5KQ1 A;  5JHH A;  2W2W A;  1W1H A;  3PEG A;  2RGN B;  2BCJ A;  2ROZ B;  4B6H A;  5LON B;  4KVG B;  3QIJ A;  2VRW B;  2D4Q A;  1GC7 A;  3ODO A;  1ZSQ A;  1ISN A;  4HB3 B;  1EVH A;  1UNP A;  1WG7 A;  1NTV A;  3PSC A;  4YL8 A;  2P0H A;  4K2P A;  2COA A;  1MKE A;  1Y19 B;  2I5F A;  3QWM A;  2K00 A;  3RCP A;  1OY2 A;  1UNR A;  2LOZ A;  2ROV A;  1Q67 A;  1XD4 A;  1E5W A;  2NZ8 B;  4EMO A;  3P6A A;  4HDQ A;  3GYP A;  3V5W A;  1ZC4 B;  2Z0P A;  4DBB A;  2VSZ A;  1V5U A;  2RUK B;  2GCL A;  1X86 A;  4GXB A;  4YON A;  1IRS A;  5D3W A;  5JP4 A;  2GCJ A;  2OQB A;  4CHJ A;  2CY5 A;  3PVW A;  4HAY B;  1K5G B;  3LJU X;  2DHJ A;  5J3Y A;  2AL6 A;  3M1I B;  5D3V A;  1M7E A;  4H8S A;  2D2Q A;  1U29 A;  1W1G A;  4A6F A;  2DHK A;  2J0K A;  3ZDT A;  2CRF A;  4C0A A;  1RJ2 A;  4IOY X;  2H7D A;  3PP2 A;  1DBH A;  4HAV B;  2DTC A;  1M7R A;  2W2X D;  1V88 A;  2D9V A;  3OAN A;  1DDM A;  2ADZ A;  1KZG A;  1V5P A;  1KI1 B;  1H10 A;  5JLJ B;  4MT7 A;  2NMB A;  4HB4 B;  5D3Y A;  2DLW A;  4HDO A;  2Y7B A;  4ZRI A;  1FHO A;  3PG7 A;  4NY0 A;  3DXE A;  5LOP B;  2DYQ A;  4NSW A;  1FGY A;  1AWE A;  1U2B A;  3A8Q A;  4WVF B;  2Q13 A;  4L6E A;  3SV1 A;  3SO6 A;  1TJ6 A;  4BBK A;  3U7D A;  2YVC A;  2CAY A;  2XQN M;  3UZT A;  1X11 A;  2EJ8 A;  1MPH A;  4HAW B;  2R0D A;  3P7Z A;  4K2O A;  2FJL A;  1ZC3 B;  2MWN B;  4GMV A;  1OQN A;  2D11 A;  1BWN A;  4F7U P;  3TW1 A;  5HE1 A;  2UZS A;  5JHG A;  4Y94 A;  1N3H A;  5EFX A;  2COF A;  3T06 A;  3TCA A;  1WJ1 A;  3GYO A;  4F7G A;  1WJM A;  4DX9 0;  2IYB A;  2HE7 A;  1FGZ A;  4F7H A;  1XOD A;  3ULB A;  1BTK A;  5D3X A;  1OMW A;  1GC6 A;  5DHA B;  1ZM0 A;  2QKM A;  1FB8 A;  2IFS A;  1NU2 A;  1J0W A;  3KSY A;  1FHX A;  5J3Q A;  1MIX A;  2Y8F A;  2LUL A;  2MDX A;  3TO1 A;  1X1G A;  3HW2 B;  4XWX A;  3N7C A;  2KGX B;  1U27 A;  2N23 A;  2R09 A;  2RLO A;  1UNQ A;  5KCV A;  4EJN A;  1XKE A;  2L1C A;  5C79 A;  2P0F A;  3ODW A;  2YSZ A;  5HE0 A;  3NSU A;  5C16 A;  1BTN A;  3A98 B;  2COC A;  5HE2 A;  2KCJ A;  2YT0 A;  3WYF B;  4HAU B;  1Z87 A;  2Z0Q A;  2RSG A;  5DHF B;  2W2X C;  5C5B B;  1UPR A;  2ZPY A;  5J3T A;  2G35 A;  2D9Y A;  2YRY A;  1BAK A;  2H7E A;  1U5F A;  1B55 A;  3G9W A;  1DDW A;  2J0J A;  1RRP B;  3FSS A;  2YT1 A;  5FI1 A;  3DXC A;  1AQC A;  5L81 A;  4K17 A;  3DXD A;  1KZ7 A;  2D9W A;  3WA0 A;  4P7I A;  2EMT A;  2LG1 A;  2OTX A;  3FM8 C;  4Z2N A;  1WGU A;  2CY4 A;  2YS5 A;  1H4R A;  1QQG A;  2RNR B;  3CXB B;  4A5K A;  1SHC A;  5HE3 A;  1UPQ A;  2KUP A;  4HHV A;  5KQ4 A;  4GN1 A;  4GZU A;  4KHB B;  4A6H A;  3FEH A;  2PZ1 A;  2V76 A;  1LB1 A;  3MPX A;  2D9Z A;  1TQZ A;  3AU4 A;  3X23 A;  2Y8G A;  4GPT B;  5C6R A;  4K81 A;  4MK0 A;  4IAP A;  1FAO A;  4CYE A;  1DYN A;  3D8F A;  1ZVR A;  4EKU A;  1K5D B;  3D8D A;  3U8Z A;  1DRO A;  4KHO A;  3KRW A;  4HB2 B;  2LYD A;  2ELA A;  2K2J A;  4MY6 A;  2ELB A;  2X18 A;  1EAZ A;  3A8P A;  3PZD A;  5DI9 B;  4PNK A;  1QC6 A;  5GOW B;  5CLL B;  1NTY A;  3ULC A;  3PVL A;  1MAI A;  1MK9 B;  3BJI A;  1SGH A;  4PQ0 A;  1I7A A;  2DN6 A;  3AJ4 A;  2I1K A;  2DFK A;  2UZR A;  3CIK A;  2EC1 A;  1PMS A;  1TXD A;  3VIA A;  4DX8 A;  1U5G A;  2YF0 A;  1FHW A;  1V89 A;  3ML4 A;  3F0W A;  2Z0O A;  3VOQ A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...