2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Docking protein 2, isoform a
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
2V76A 1Y5OA 3PZDA 1U5GA 2G35A 3M1IB 1DDMA 2COCA 5EFXA 2DHIA 1NI2A 4HAXB 1IRSA 4D0NB 2ELAA 3PP2A 1SGHA 4KVGB 2LG1A 2DHKA 1WJ1A 5KQ4A 2ZPYA 2DYQA 4YL8A 2I1KA 3KRWA 1ZM0A 3NSUA 3SUZA 5FI1A 5C5BB 3ODXA 2COFA 4K2PA 2HE7A 3TFMA 2Y7BA 1PFJA 2ADZA 1V61A 1Z87A 2Z0QA 2GS0A 3N7CA 1AQCA 2P8VA 1X1FA 4HAYB 1U2BA 1SHCA 1LW3A 2MWNB 2AL6A 3PVWA 3ML4A 3LJUX 1WJMA 2EMTA 4HAUB 2D2QA 2D9WA 3A8PA 4Y94A 2CODA 3F5RA 1FAOA 1MK9B 5DIFB 3ULCA 3F0WA 3MDBC 5D3VA 3A8QA 2DX1A 1H4RA 3D8DA 4CHMA 1KI1B 1XODA 2M14A 2DA0A 1FGYA 2MFQA 1TXDA 5D27A 2DLWA 3FM8C 1RJ2A 1U5DA 4PQ0A 1NTYA 1P6SA 1FB8A 3MPXA 2W2XD 1XX0A 3FEHA 1W1HA 2Y8FA 2LKOA 3SO6A 5JHGA 1WVHA 1QQGA 2H7EA 2LOZA 2CAYA 3PSCA 1GG3A 4DX8A 3DXCA 1W1DA 2RUKB 2GCLA 2XQNM 4KHAA 2IFSA 5JHHA 1W1GA 1ZVRA 1I7AA 4Z2MB 2ELBA 3QIJA 4DXAB 1DROA 4GN1A 1MIXA 2KCJA 2GJYA 5D3WA 3VOQA 2VKIA 2H7DA 4EJNA 2YSZA 4BBKA 4NSWA 5L81A 2D4QA 1KZGA 2Z0OA 1RRPB 3ULBA 2LOXA 1QC6A 5C6RA 3V5WA 1UPQA 2DTCA 4DBBA 4TYZA 3TCAA 3BJIA 4CHJA 2ROVA 4IAPA 5KQ1A 1ZSQA 1KZ7A 1LB1A 5DHAB 3CXBB 4F7GA 1P5TA 2D10A 4KHOA 3CIKA 4ZRIA 1BTNA 4ZRJA 2GCJA 4C0AA 1U5FA 2P0DA 3ODOA 1XCGA 3HK0A 2YRYA 2DX5A 2HTHB 4TKNA 4HAWB 5CLQB 4Z2NA 3PVLA 2I5CA 2YF0A 3DXEA 5DH9B 4NY0A 2UZSA 4IFSA 3DXDA 1MK7B 3D8FA 1DYNA 3GYPA 4HDQA 2N0YA 3RCPA 1ZC4B 1U5EA 2UVMA 4K2OA 1V89A 5JLJB 4WSFA 2P0HA 2JP2A 3SYXA 2X18A 4F7UP 2R0DA 1H10A 1UEFA 3U8ZA 1BWNA 1DDWA 5C16A 1PLSA 2FJLA 3AU5A 1M7RA 4PNKA 1P3RA 1NTVA 2RSGA 2KGXB 3KRXA 3KZ1A 2MDXA 3BINA 3G9WA 4KHBB 2M38A 1FGZA 2K2UA 2AEHA 3P6AA 3HQCA 3OANA 1DBHA 1K5GB 4HAZB 5DI9B 2W2XC 2J59M 4MY6A 4K81A 1X05A 3WA0A 2BCJA 1ISNA 1E5WA 1X11A 4A5KA 5KCVA 2YS3A 1XD4A 2CY5A 4HB2B 4MK0A 3TW1A 1V88A 3AJ4A 4F7HA 4HB3B 1X1GA 1NU2A 4GZUA 2YT0A 2QKMA 4GMVA 2Y8GA 1PMSA 2E2XA 1TJ6A 2CRFA 1FOEA 3VIAA 4WJ7A 5HE1A 2J0JA 1ZC3B 5GOWB 2NZ8B 2D9XA 1BAKA 1OY2A 2OQBA 2RGNB 1BTKA 4HB0B 1EVHA 1V5UA 2DFKA 5D3YA 3IVFA 5LOPB 1Q67A 2DYNA 5C5BA 5J3QA 5C79A 1FHXA 2IYBA 1WGUA 1TQZA 3TVVA 4K17A 4A6KA 1Y19B 1UNPA 3GYOA 4A6FB 4HAVB 5J3TA 2DHJA 5HE0A 2LULA 2D11A 1DDVA 1U29A 1V5PA 2UZRA 4MT7A 1UNRA 2RVBB 1XKEA 4ZRKA 5J3YA 1EAZA 3X23A 4KAXB 4HDOA 3SV1A 1J0WA 3O96A 2J0MA 4IOYX 1OMWA 2W2WA 2OTXA 2VRWB 4H8SA 3KY9A 2D9VA 2NMBA 3ZVRA 1J19A 3T06A 1GC6A 1B55A 2EJ8A 5CLLB 1I2HA 2K00A 1OQNA 5FI0A 2L1CA 3QBVB 4EKUA 3ODWA 3KSYA 2YS1A 3A98B 3AU4A 3P7ZA 3U7DA 2L2IA 3SNHA 3PVUA 4DX90 3PG7A 3QWMA 1WI1A 2I5FA 3HW2B 4HB4B 1V5MA 1UNQA 2I1JA 1WGQA 2N23A 2P0FA 2YT1A 1XR0B 2DKQA 5D3XA 1FHOA 1UPRA 4L6EA 4GMXB 1M7EA 4XWXA 2KUPA 2D9YA 2RLOA 2LYDA 3ZDTA 2YVCA 1N3HA 1MPHA 1X86A 2D9ZA 4CYEA 2CY4A 1MAIA 1FHWA 1U27A 4A6HA 2EC1A 4B6HA 4WVFB 1GC7A 2MKRA 2Z0PA 2EMSA 2PZ1A 2QKLA 2VSZA 1AWEA 4GPTB 4P7IA 5HE2A 2R09A 1MKEA 2YS5A 5DHFB 1EF1A 4GXBA 3WYFB 3UZTA 4EMOA 5LONB 4A6FA 3PEGA 1WG7A 2Q13A 3D8EA 2RNRB 4HHVA 4YONA 3TO1A 3FSSA 1MIZB 2DKPA 2K2JA 4HATB 2DN6A 2J0KA 2ROZB 5HE3A 1K5DB 2COAA 5JP4A 1EGXA
chains in the Genus database with same CATH superfamily
2V76A 1Y5OA 3PZDA 1U5GA 2G35A 3M1IB 1DDMA 2COCA 5EFXA 2DHIA 1NI2A 3NWAA 4HAXB 1IRSA 4D0NB 2ELAA 3PP2A 1SGHA 4KVGB 5M4YB 2LG1A 4QXAB 2DHKA 2ZKMX 1WJ1A 5KQ4A 2Z14A 4D6WA 2ZPYA 2DYQA 4YL8A 2I1KA 3KRWA 1ZM0A 3NSUA 3SUZA 5FI1A 5C5BB 3ODXA 2COFA 4K2PA 4HSIA 2HE7A 3TFMA 2Y7BA 1PFJA 2ADZA 3NWFA 1V61A 1Z87A 2Z0QA 2GS0A 3N7CA 1AQCA 2P8VA 1X1FA 4HAYB 1U2BA 1SHCA 1LW3A 2MWNB 2AL6A 3PVWA 2K49A 2YT2A 3B77A 3ML4A 3LJUX 1WJMA 2EMTA 4GOUA 4HAUB 2D2QA 2D9WA 3A8PA 4Y94A 2CODA 3F5RA 1FAOA 1MK9B 5DIFB 3ULCA 3F0WA 3MDBC 5D3VA 3A8QA 2DX1A 1H4RA 3D8DA 4CHMA 1KI1B 1XODA 2M14A 2DA0A 1ZYIA 5IRSA 1FGYA 2MFQA 1TXDA 5D27A 2DLWA 3FM8C 1RJ2A 1U5DA 4PQ0A 1NTYA 1P6SA 1FB8A 3MPXA 2W2XD 1XX0A 3FEHA 1W1HA 2Y8FA 2LKOA 3SO6A 5JHGA 1WVHA 1QQGA 2H7EA 2LOZA 2CAYA 3PSCA 1GG3A 4DX8A 3DXCA 3U12A 1W1DA 2RUKB 1T77A 2GCLA 2XQNM 4L1RA 4KHAA 2KIEA 2IFSA 3HSAA 5JHHA 1W1GA 1ZVRA 1I7AA 3OHMB 4Z2MB 2ELBA 3QIJA 4DXAB 1DROA 4GN1A 1MIXA 2KCJA 2GJYA 5D3WA 4DIXA 3VOQA 2VKIA 2H7DA 2GUMA 4EJNA 2YSZA 4BBKA 4NSWA 5L81A 2D4QA 1KZGA 2Z0OA 1RRPB 3ULBA 2LOXA 1QC6A 2KIGA 5C6RA 3V5WA 1UPQA 2DTCA 4DBBA 4TYZA 3TCAA 3BJIA 4CHJA 2ROVA 4IAPA 5KQ1A 1ZSQA 1KZ7A 1LB1A 5DHAB 3CXBB 4F7GA 1P5TA 2D10A 4KHOA 3CIKA 4ZRIA 1BTNA 4ZRJA 2GCJA 4C0AA 1U5FA 2P0DA 3ODOA 4CSQA 3NWDA 1XCGA 3HK0A 2YRYA 2DX5A 2Z59A 2HTHB 5LG4B 4TKNA 4HAWB 2KR0A 5CLQB 1MI1A 4Z2NA 3PVLA 2I5CA 2YF0A 3DXEA 5DH9B 4NY0A 2UZSA 4IFSA 3DXDA 1EGXA 1MK7B 3D8FA 1DYNA 3GYPA 4HDQA 2N0YA 3RCPA 1ZC4B 1U5EA 3HIEA 2UVMA 4K2OA 1V89A 5JLJB 4WSFA 2P0HA 2JP2A 3SYXA 2X18A 4F7UP 2R0DA 1H10A 1UEFA 3U8ZA 1BWNA 1DDWA 5C16A 1PLSA 2FJLA 3AU5A 1M7RA 4PNKA 3NW8A 1P3RA 1NTVA 2RSGA 2KGXB 3KRXA 3KZ1A 2MDXA 3BINA 3G9WA 4KHBB 2M38A 1FGZA 2K2UA 2AEHA 2KUQA 3P6AA 3HQCA 3OANA 3DCXA 1DBHA 1K5GB 4HAZB 5DI9B 2W2XC 2J59M 2K8EA 4MY6A 4K81A 1X05A 3WA0A 2BCJA 1ISNA 1E5WA 1X11A 4A5KA 5KCVA 2RRFA 2YS3A 1XD4A 2CY5A 4HB2B 4MK0A 3TW1A 1V88A 3A58A 3AJ4A 2NBVA 4F7HA 4HB3B 1X1GA 1NU2A 4GZUA 2YT0A 2QKMA 2FJUB 4GMVA 2Y8GA 1PMSA 2E2XA 1TJ6A 2CRFA 1FOEA 3VIAA 4WJ7A 5HE1A 2J0JA 1ZC3B 5GOWB 2NZ8B 2D9XA 1BAKA 1OY2A 2OQBA 2RGNB 1BTKA 4HB0B 1EVHA 1V5UA 2DFKA 5D3YA 3IVFA 5LOPB 1Q67A 2DYNA 5C5BA 5J3QA 5C79A 1FHXA 2IYBA 1WGUA 1TQZA 3TVVA 4K17A 4A6KA 1Y19B 1UNPA 3GYOA 4A6FB 4OT1A 4HAVB 5J3TA 2DHJA 5HE0A 2LULA 2D11A 1DDVA 1U29A 1V5PA 2UZRA 4MT7A 1UNRA 2RVBB 1XKEA 4ZRKA 5J3YA 1EAZA 5I2MA 3X23A 4KAXB 4HDOA 3SV1A 1J0WA 3O96A 2J0MA 4IOYX 1OMWA 2W2WA 2OTXA 2VRWB 4H8SA 3KY9A 2D9VA 2NMBA 3ZVRA 1J19A 3T06A 1GC6A 1B55A 2EJ8A 5CLLB 1I2HA 2K00A 1OQNA 5FI0A 2L1CA 5I2SA 3QBVB 4KHBA 4EKUA 3ODWA 3KSYA 2YS1A 3A98B 3AU4A 3P7ZA 3U7DA 4GNKB 2L2IA 3SNHA 3PVUA 4DX90 3PG7A 3QWMA 1WI1A 2I5FA 3HW2B 4HB4B 1V5MA 1UNQA 4OSNA 2I1JA 1WGQA 2N23A 2P0FA 2YT1A 1XR0B 2DKQA 2Z13A 5D3XA 1FHOA 1UPRA 4L6EA 4GMXB 1M7EA 4XWXA 2KUPA 2D9YA 2RLOA 2LYDA 3ZDTA 2YVCA 1N3HA 1MPHA 1X86A 2D9ZA 4CYEA 2CY4A 1MAIA 1U27A 1FHWA 4A6HA 2EC1A 4B6HA 4WVFB 1GC7A 2MKRA 2Z0PA 2EMSA 2PZ1A 2QKLA 2VSZA 4QJ3B 4GPTB 1AWEA 4QJ4B 4P7IA 5HE2A 2R09A 1MKEA 2YS5A 5DHFB 1EF1A 4GXBA 3WYFB 3UZTA 3FVCA 4EMOA 4QJ5B 5LONB 4A6FA 1WG7A 2Q13A 3PEGA 3D8EA 2RNRB 4HHVA 4YONA 3TO1A 3FSSA 1MIZB 2DKPA 2K2JA 2Z4DA 4HATB 2DN6A 2J0KA 2ROZB 5HE3A 1K5DB 2COAA 5JP4A 2R2YA
chains in the Genus database with same CATH topology
2V76A 1Y5OA 3PZDA 1U5GA 2G35A 3M1IB 1DDMA 2COCA 5EFXA 2DHIA 1NI2A 4HAXB 1IRSA 4D0NB 2ELAA 3PP2A 1SGHA 4KVGB 2LG1A 2DHKA 1WJ1A 5KQ4A 2ZPYA 2DYQA 4YL8A 2I1KA 3KRWA 1ZM0A 3NSUA 3SUZA 5FI1A 5C5BB 3ODXA 2COFA 4K2PA 2HE7A 3TFMA 2Y7BA 1PFJA 2ADZA 1V61A 1Z87A 2Z0QA 2GS0A 3N7CA 1AQCA 2P8VA 1X1FA 4HAYB 1U2BA 1SHCA 1LW3A 2MWNB 2AL6A 3PVWA 3ML4A 3LJUX 1WJMA 2EMTA 4HAUB 2D2QA 2D9WA 3A8PA 4Y94A 2CODA 3F5RA 1FAOA 1MK9B 5DIFB 3ULCA 3F0WA 3MDBC 5D3VA 3A8QA 2DX1A 1H4RA 3D8DA 4CHMA 1KI1B 1XODA 2M14A 2DA0A 1FGYA 2MFQA 1TXDA 5D27A 2DLWA 3FM8C 1RJ2A 1U5DA 4PQ0A 1NTYA 1P6SA 1FB8A 3MPXA 2W2XD 1XX0A 3FEHA 1W1HA 2Y8FA 2LKOA 3SO6A 5JHGA 1WVHA 1QQGA 2H7EA 2LOZA 2CAYA 3PSCA 1GG3A 4DX8A 3DXCA 1W1DA 2RUKB 2GCLA 2XQNM 4KHAA 2IFSA 5JHHA 1W1GA 1ZVRA 1I7AA 4Z2MB 2ELBA 3QIJA 4DXAB 1DROA 4GN1A 1MIXA 2KCJA 2GJYA 5D3WA 3VOQA 2VKIA 2H7DA 4EJNA 2YSZA 4BBKA 4NSWA 5L81A 2D4QA 1KZGA 2Z0OA 1RRPB 3ULBA 2LOXA 1QC6A 5C6RA 3V5WA 1UPQA 2DTCA 4DBBA 4TYZA 3TCAA 3BJIA 4CHJA 2ROVA 4IAPA 5KQ1A 1ZSQA 1KZ7A 1LB1A 5DHAB 3CXBB 4F7GA 1P5TA 2D10A 4KHOA 3CIKA 4ZRIA 1BTNA 4ZRJA 2GCJA 4C0AA 1U5FA 2P0DA 3ODOA 1XCGA 3HK0A 2YRYA 2DX5A 2HTHB 4TKNA 4HAWB 5CLQB 4Z2NA 3PVLA 2I5CA 2YF0A 3DXEA 5DH9B 4NY0A 2UZSA 4IFSA 3DXDA 1MK7B 3D8FA 1DYNA 3GYPA 4HDQA 2N0YA 3RCPA 1ZC4B 1U5EA 2UVMA 4K2OA 1V89A 5JLJB 4WSFA 2P0HA 2JP2A 3SYXA 2X18A 4F7UP 2R0DA 1H10A 1UEFA 3U8ZA 1BWNA 1DDWA 5C16A 1PLSA 2FJLA 3AU5A 1M7RA 4PNKA 1P3RA 1NTVA 2RSGA 2KGXB 3KRXA 3KZ1A 2MDXA 3BINA 3G9WA 4KHBB 2M38A 1FGZA 2K2UA 2AEHA 3P6AA 3HQCA 3OANA 1DBHA 1K5GB 4HAZB 5DI9B 2W2XC 2J59M 4MY6A 4K81A 1X05A 3WA0A 2BCJA 1ISNA 1E5WA 1X11A 4A5KA 5KCVA 2YS3A 1XD4A 2CY5A 4HB2B 4MK0A 3TW1A 1V88A 3AJ4A 4F7HA 4HB3B 1X1GA 1NU2A 4GZUA 2YT0A 2QKMA 4GMVA 2Y8GA 1PMSA 2E2XA 1TJ6A 2CRFA 1FOEA 3VIAA 4WJ7A 5HE1A 2J0JA 1ZC3B 5GOWB 2NZ8B 2D9XA 1BAKA 1OY2A 2OQBA 2RGNB 1BTKA 4HB0B 1EVHA 1V5UA 2DFKA 5D3YA 3IVFA 5LOPB 1Q67A 2DYNA 5C5BA 5J3QA 5C79A 1FHXA 2IYBA 1WGUA 1TQZA 3TVVA 4K17A 4A6KA 1Y19B 1UNPA 3GYOA 4A6FB 4HAVB 5J3TA 2DHJA 5HE0A 2LULA 2D11A 1DDVA 1U29A 1V5PA 2UZRA 4MT7A 1UNRA 2RVBB 1XKEA 4ZRKA 5J3YA 1EAZA 3X23A 4KAXB 4HDOA 3SV1A 1J0WA 3O96A 2J0MA 4IOYX 1OMWA 2W2WA 2OTXA 2VRWB 4H8SA 3KY9A 2D9VA 2NMBA 3ZVRA 1J19A 3T06A 1GC6A 1B55A 2EJ8A 5CLLB 1I2HA 2K00A 1OQNA 5FI0A 2L1CA 3QBVB 4EKUA 3ODWA 3KSYA 2YS1A 3A98B 3AU4A 3P7ZA 3U7DA 2L2IA 3SNHA 3PVUA 4DX90 3PG7A 3QWMA 1WI1A 2I5FA 3HW2B 4HB4B 1V5MA 1UNQA 2I1JA 1WGQA 2N23A 2P0FA 2YT1A 1XR0B 2DKQA 5D3XA 1FHOA 1UPRA 4L6EA 4GMXB 1M7EA 4XWXA 2KUPA 2D9YA 2RLOA 2LYDA 3ZDTA 2YVCA 1N3HA 1MPHA 1X86A 2D9ZA 4CYEA 2CY4A 1MAIA 1FHWA 1U27A 4A6HA 2EC1A 4B6HA 4WVFB 1GC7A 2MKRA 2Z0PA 2EMSA 2PZ1A 2QKLA 2VSZA 1AWEA 4GPTB 4P7IA 5HE2A 2R09A 1MKEA 2YS5A 5DHFB 1EF1A 4GXBA 3WYFB 3UZTA 4EMOA 5LONB 4A6FA 3PEGA 1WG7A 2Q13A 3D8EA 2RNRB 4HHVA 4YONA 3TO1A 3FSSA 1MIZB 2DKPA 2K2JA 4HATB 2DN6A 2J0KA 2ROZB 5HE3A 1K5DB 2COAA 5JP4A 1EGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V76 A;  1Y5O A;  3PZD A;  1U5G A;  2G35 A;  3M1I B;  1DDM A;  2COC A;  5EFX A;  2DHI A;  1NI2 A;  4HAX B;  1IRS A;  4D0N B;  2ELA A;  3PP2 A;  1SGH A;  4KVG B;  2LG1 A;  2DHK A;  1WJ1 A;  5KQ4 A;  2ZPY A;  2DYQ A;  4YL8 A;  2I1K A;  3KRW A;  1ZM0 A;  3NSU A;  3SUZ A;  5FI1 A;  5C5B B;  3ODX A;  2COF A;  4K2P A;  2HE7 A;  3TFM A;  2Y7B A;  1PFJ A;  2ADZ A;  1V61 A;  1Z87 A;  2Z0Q A;  2GS0 A;  3N7C A;  1AQC A;  2P8V A;  1X1F A;  4HAY B;  1U2B A;  1SHC A;  1LW3 A;  2MWN B;  2AL6 A;  3PVW A;  3ML4 A;  3LJU X;  1WJM A;  2EMT A;  4HAU B;  2D2Q A;  2D9W A;  3A8P A;  4Y94 A;  2COD A;  3F5R A;  1FAO A;  1MK9 B;  5DIF B;  3ULC A;  3F0W A;  3MDB C;  5D3V A;  3A8Q A;  2DX1 A;  1H4R A;  3D8D A;  4CHM A;  1KI1 B;  1XOD A;  2M14 A;  2DA0 A;  1FGY A;  2MFQ A;  1TXD A;  5D27 A;  2DLW A;  3FM8 C;  1RJ2 A;  1U5D A;  4PQ0 A;  1NTY A;  1P6S A;  1FB8 A;  3MPX A;  2W2X D;  1XX0 A;  3FEH A;  1W1H A;  2Y8F A;  2LKO A;  3SO6 A;  5JHG A;  1WVH A;  1QQG A;  2H7E A;  2LOZ A;  2CAY A;  3PSC A;  1GG3 A;  4DX8 A;  3DXC A;  1W1D A;  2RUK B;  2GCL A;  2XQN M;  4KHA A;  2IFS A;  5JHH A;  1W1G A;  1ZVR A;  1I7A A;  4Z2M B;  2ELB A;  3QIJ A;  4DXA B;  1DRO A;  4GN1 A;  1MIX A;  2KCJ A;  2GJY A;  5D3W A;  3VOQ A;  2VKI A;  2H7D A;  4EJN A;  2YSZ A;  4BBK A;  4NSW A;  5L81 A;  2D4Q A;  1KZG A;  2Z0O A;  1RRP B;  3ULB A;  2LOX A;  1QC6 A;  5C6R A;  3V5W A;  1UPQ A;  2DTC A;  4DBB A;  4TYZ A;  3TCA A;  3BJI A;  4CHJ A;  2ROV A;  4IAP A;  5KQ1 A;  1ZSQ A;  1KZ7 A;  1LB1 A;  5DHA B;  3CXB B;  4F7G A;  1P5T A;  2D10 A;  4KHO A;  3CIK A;  4ZRI A;  1BTN A;  4ZRJ A;  2GCJ A;  4C0A A;  1U5F A;  2P0D A;  3ODO A;  1XCG A;  3HK0 A;  2YRY A;  2DX5 A;  2HTH B;  4TKN A;  4HAW B;  5CLQ B;  4Z2N A;  3PVL A;  2I5C A;  2YF0 A;  3DXE A;  5DH9 B;  4NY0 A;  2UZS A;  4IFS A;  3DXD A;  1MK7 B;  3D8F A;  1DYN A;  3GYP A;  4HDQ A;  2N0Y A;  3RCP A;  1ZC4 B;  1U5E A;  2UVM A;  4K2O A;  1V89 A;  5JLJ B;  4WSF A;  2P0H A;  2JP2 A;  3SYX A;  2X18 A;  4F7U P;  2R0D A;  1H10 A;  1UEF A;  3U8Z A;  1BWN A;  1DDW A;  5C16 A;  1PLS A;  2FJL A;  3AU5 A;  1M7R A;  4PNK A;  1P3R A;  1NTV A;  2RSG A;  2KGX B;  3KRX A;  3KZ1 A;  2MDX A;  3BIN A;  3G9W A;  4KHB B;  2M38 A;  1FGZ A;  2K2U A;  2AEH A;  3P6A A;  3HQC A;  3OAN A;  1DBH A;  1K5G B;  4HAZ B;  5DI9 B;  2W2X C;  2J59 M;  4MY6 A;  4K81 A;  1X05 A;  3WA0 A;  2BCJ A;  1ISN A;  1E5W A;  1X11 A;  4A5K A;  5KCV A;  2YS3 A;  1XD4 A;  2CY5 A;  4HB2 B;  4MK0 A;  3TW1 A;  1V88 A;  3AJ4 A;  4F7H A;  4HB3 B;  1X1G A;  1NU2 A;  4GZU A;  2YT0 A;  2QKM A;  4GMV A;  2Y8G A;  1PMS A;  2E2X A;  1TJ6 A;  2CRF A;  1FOE A;  3VIA A;  4WJ7 A;  5HE1 A;  2J0J A;  1ZC3 B;  5GOW B;  2NZ8 B;  2D9X A;  1BAK A;  1OY2 A;  2OQB A;  2RGN B;  1BTK A;  4HB0 B;  1EVH A;  1V5U A;  2DFK A;  5D3Y A;  3IVF A;  5LOP B;  1Q67 A;  2DYN A;  5C5B A;  5J3Q A;  5C79 A;  1FHX A;  2IYB A;  1WGU A;  1TQZ A;  3TVV A;  4K17 A;  4A6K A;  1Y19 B;  1UNP A;  3GYO A;  4A6F B;  4HAV B;  5J3T A;  2DHJ A;  5HE0 A;  2LUL A;  2D11 A;  1DDV A;  1U29 A;  1V5P A;  2UZR A;  4MT7 A;  1UNR A;  2RVB B;  1XKE A;  4ZRK A;  5J3Y A;  1EAZ A;  3X23 A;  4KAX B;  4HDO A;  3SV1 A;  1J0W A;  3O96 A;  2J0M A;  4IOY X;  1OMW A;  2W2W A;  2OTX A;  2VRW B;  4H8S A;  3KY9 A;  2D9V A;  2NMB A;  3ZVR A;  1J19 A;  3T06 A;  1GC6 A;  1B55 A;  2EJ8 A;  5CLL B;  1I2H A;  2K00 A;  1OQN A;  5FI0 A;  2L1C A;  3QBV B;  4EKU A;  3ODW A;  3KSY A;  2YS1 A;  3A98 B;  3AU4 A;  3P7Z A;  3U7D A;  2L2I A;  3SNH A;  3PVU A;  4DX9 0;  3PG7 A;  3QWM A;  1WI1 A;  2I5F A;  3HW2 B;  4HB4 B;  1V5M A;  1UNQ A;  2I1J A;  1WGQ A;  2N23 A;  2P0F A;  2YT1 A;  1XR0 B;  2DKQ A;  5D3X A;  1FHO A;  1UPR A;  4L6E A;  4GMX B;  1M7E A;  4XWX A;  2KUP A;  2D9Y A;  2RLO A;  2LYD A;  3ZDT A;  2YVC A;  1N3H A;  1MPH A;  1X86 A;  2D9Z A;  4CYE A;  2CY4 A;  1MAI A;  1FHW A;  1U27 A;  4A6H A;  2EC1 A;  4B6H A;  4WVF B;  1GC7 A;  2MKR A;  2Z0P A;  2EMS A;  2PZ1 A;  2QKL A;  2VSZ A;  1AWE A;  4GPT B;  4P7I A;  5HE2 A;  2R09 A;  1MKE A;  2YS5 A;  5DHF B;  1EF1 A;  4GXB A;  3WYF B;  3UZT A;  4EMO A;  5LON B;  4A6F A;  3PEG A;  1WG7 A;  2Q13 A;  3D8E A;  2RNR B;  4HHV A;  4YON A;  3TO1 A;  3FSS A;  1MIZ B;  2DKP A;  2K2J A;  4HAT B;  2DN6 A;  2J0K A;  2ROZ B;  5HE3 A;  1K5D B;  2COA A;  5JP4 A;  1EGX A; 
#chains in the Genus database with same CATH topology
 2V76 A;  1Y5O A;  3PZD A;  1U5G A;  2G35 A;  3M1I B;  1DDM A;  2COC A;  5EFX A;  2DHI A;  1NI2 A;  3NWA A;  4HAX B;  1IRS A;  4D0N B;  2ELA A;  3PP2 A;  1SGH A;  4KVG B;  5M4Y B;  2LG1 A;  4QXA B;  2DHK A;  2ZKM X;  1WJ1 A;  5KQ4 A;  2Z14 A;  4D6W A;  2ZPY A;  2DYQ A;  4YL8 A;  2I1K A;  3KRW A;  1ZM0 A;  3NSU A;  3SUZ A;  5FI1 A;  5C5B B;  3ODX A;  2COF A;  4K2P A;  4HSI A;  2HE7 A;  3TFM A;  2Y7B A;  1PFJ A;  2ADZ A;  3NWF A;  1V61 A;  1Z87 A;  2Z0Q A;  2GS0 A;  3N7C A;  1AQC A;  2P8V A;  1X1F A;  4HAY B;  1U2B A;  1SHC A;  1LW3 A;  2MWN B;  2AL6 A;  3PVW A;  2K49 A;  2YT2 A;  3B77 A;  3ML4 A;  3LJU X;  1WJM A;  2EMT A;  4GOU A;  4HAU B;  2D2Q A;  2D9W A;  3A8P A;  4Y94 A;  2COD A;  3F5R A;  1FAO A;  1MK9 B;  5DIF B;  3ULC A;  3F0W A;  3MDB C;  5D3V A;  3A8Q A;  2DX1 A;  1H4R A;  3D8D A;  4CHM A;  1KI1 B;  1XOD A;  2M14 A;  2DA0 A;  1ZYI A;  5IRS A;  1FGY A;  2MFQ A;  1TXD A;  5D27 A;  2DLW A;  3FM8 C;  1RJ2 A;  1U5D A;  4PQ0 A;  1NTY A;  1P6S A;  1FB8 A;  3MPX A;  2W2X D;  1XX0 A;  3FEH A;  1W1H A;  2Y8F A;  2LKO A;  3SO6 A;  5JHG A;  1WVH A;  1QQG A;  2H7E A;  2LOZ A;  2CAY A;  3PSC A;  1GG3 A;  4DX8 A;  3DXC A;  3U12 A;  1W1D A;  2RUK B;  1T77 A;  2GCL A;  2XQN M;  4L1R A;  4KHA A;  2KIE A;  2IFS A;  3HSA A;  5JHH A;  1W1G A;  1ZVR A;  1I7A A;  3OHM B;  4Z2M B;  2ELB A;  3QIJ A;  4DXA B;  1DRO A;  4GN1 A;  1MIX A;  2KCJ A;  2GJY A;  5D3W A;  4DIX A;  3VOQ A;  2VKI A;  2H7D A;  2GUM A;  4EJN A;  2YSZ A;  4BBK A;  4NSW A;  5L81 A;  2D4Q A;  1KZG A;  2Z0O A;  1RRP B;  3ULB A;  2LOX A;  1QC6 A;  2KIG A;  5C6R A;  3V5W A;  1UPQ A;  2DTC A;  4DBB A;  4TYZ A;  3TCA A;  3BJI A;  4CHJ A;  2ROV A;  4IAP A;  5KQ1 A;  1ZSQ A;  1KZ7 A;  1LB1 A;  5DHA B;  3CXB B;  4F7G A;  1P5T A;  2D10 A;  4KHO A;  3CIK A;  4ZRI A;  1BTN A;  4ZRJ A;  2GCJ A;  4C0A A;  1U5F A;  2P0D A;  3ODO A;  4CSQ A;  3NWD A;  1XCG A;  3HK0 A;  2YRY A;  2DX5 A;  2Z59 A;  2HTH B;  5LG4 B;  4TKN A;  4HAW B;  2KR0 A;  5CLQ B;  1MI1 A;  4Z2N A;  3PVL A;  2I5C A;  2YF0 A;  3DXE A;  5DH9 B;  4NY0 A;  2UZS A;  4IFS A;  3DXD A;  1EGX A;  1MK7 B;  3D8F A;  1DYN A;  3GYP A;  4HDQ A;  2N0Y A;  3RCP A;  1ZC4 B;  1U5E A;  3HIE A;  2UVM A;  4K2O A;  1V89 A;  5JLJ B;  4WSF A;  2P0H A;  2JP2 A;  3SYX A;  2X18 A;  4F7U P;  2R0D A;  1H10 A;  1UEF A;  3U8Z A;  1BWN A;  1DDW A;  5C16 A;  1PLS A;  2FJL A;  3AU5 A;  1M7R A;  4PNK A;  3NW8 A;  1P3R A;  1NTV A;  2RSG A;  2KGX B;  3KRX A;  3KZ1 A;  2MDX A;  3BIN A;  3G9W A;  4KHB B;  2M38 A;  1FGZ A;  2K2U A;  2AEH A;  2KUQ A;  3P6A A;  3HQC A;  3OAN A;  3DCX A;  1DBH A;  1K5G B;  4HAZ B;  5DI9 B;  2W2X C;  2J59 M;  2K8E A;  4MY6 A;  4K81 A;  1X05 A;  3WA0 A;  2BCJ A;  1ISN A;  1E5W A;  1X11 A;  4A5K A;  5KCV A;  2RRF A;  2YS3 A;  1XD4 A;  2CY5 A;  4HB2 B;  4MK0 A;  3TW1 A;  1V88 A;  3A58 A;  3AJ4 A;  2NBV A;  4F7H A;  4HB3 B;  1X1G A;  1NU2 A;  4GZU A;  2YT0 A;  2QKM A;  2FJU B;  4GMV A;  2Y8G A;  1PMS A;  2E2X A;  1TJ6 A;  2CRF A;  1FOE A;  3VIA A;  4WJ7 A;  5HE1 A;  2J0J A;  1ZC3 B;  5GOW B;  2NZ8 B;  2D9X A;  1BAK A;  1OY2 A;  2OQB A;  2RGN B;  1BTK A;  4HB0 B;  1EVH A;  1V5U A;  2DFK A;  5D3Y A;  3IVF A;  5LOP B;  1Q67 A;  2DYN A;  5C5B A;  5J3Q A;  5C79 A;  1FHX A;  2IYB A;  1WGU A;  1TQZ A;  3TVV A;  4K17 A;  4A6K A;  1Y19 B;  1UNP A;  3GYO A;  4A6F B;  4OT1 A;  4HAV B;  5J3T A;  2DHJ A;  5HE0 A;  2LUL A;  2D11 A;  1DDV A;  1U29 A;  1V5P A;  2UZR A;  4MT7 A;  1UNR A;  2RVB B;  1XKE A;  4ZRK A;  5J3Y A;  1EAZ A;  5I2M A;  3X23 A;  4KAX B;  4HDO A;  3SV1 A;  1J0W A;  3O96 A;  2J0M A;  4IOY X;  1OMW A;  2W2W A;  2OTX A;  2VRW B;  4H8S A;  3KY9 A;  2D9V A;  2NMB A;  3ZVR A;  1J19 A;  3T06 A;  1GC6 A;  1B55 A;  2EJ8 A;  5CLL B;  1I2H A;  2K00 A;  1OQN A;  5FI0 A;  2L1C A;  5I2S A;  3QBV B;  4KHB A;  4EKU A;  3ODW A;  3KSY A;  2YS1 A;  3A98 B;  3AU4 A;  3P7Z A;  3U7D A;  4GNK B;  2L2I A;  3SNH A;  3PVU A;  4DX9 0;  3PG7 A;  3QWM A;  1WI1 A;  2I5F A;  3HW2 B;  4HB4 B;  1V5M A;  1UNQ A;  4OSN A;  2I1J A;  1WGQ A;  2N23 A;  2P0F A;  2YT1 A;  1XR0 B;  2DKQ A;  2Z13 A;  5D3X A;  1FHO A;  1UPR A;  4L6E A;  4GMX B;  1M7E A;  4XWX A;  2KUP A;  2D9Y A;  2RLO A;  2LYD A;  3ZDT A;  2YVC A;  1N3H A;  1MPH A;  1X86 A;  2D9Z A;  4CYE A;  2CY4 A;  1MAI A;  1U27 A;  1FHW A;  4A6H A;  2EC1 A;  4B6H A;  4WVF B;  1GC7 A;  2MKR A;  2Z0P A;  2EMS A;  2PZ1 A;  2QKL A;  2VSZ A;  4QJ3 B;  4GPT B;  1AWE A;  4QJ4 B;  4P7I A;  5HE2 A;  2R09 A;  1MKE A;  2YS5 A;  5DHF B;  1EF1 A;  4GXB A;  3WYF B;  3UZT A;  3FVC A;  4EMO A;  4QJ5 B;  5LON B;  4A6F A;  1WG7 A;  2Q13 A;  3PEG A;  3D8E A;  2RNR B;  4HHV A;  4YON A;  3TO1 A;  3FSS A;  1MIZ B;  2DKP A;  2K2J A;  2Z4D A;  4HAT B;  2DN6 A;  2J0K A;  2ROZ B;  5HE3 A;  1K5D B;  2COA A;  5JP4 A;  2R2Y A; 
#chains in the Genus database with same CATH homology
 2V76 A;  1Y5O A;  3PZD A;  1U5G A;  2G35 A;  3M1I B;  1DDM A;  2COC A;  5EFX A;  2DHI A;  1NI2 A;  4HAX B;  1IRS A;  4D0N B;  2ELA A;  3PP2 A;  1SGH A;  4KVG B;  2LG1 A;  2DHK A;  1WJ1 A;  5KQ4 A;  2ZPY A;  2DYQ A;  4YL8 A;  2I1K A;  3KRW A;  1ZM0 A;  3NSU A;  3SUZ A;  5FI1 A;  5C5B B;  3ODX A;  2COF A;  4K2P A;  2HE7 A;  3TFM A;  2Y7B A;  1PFJ A;  2ADZ A;  1V61 A;  1Z87 A;  2Z0Q A;  2GS0 A;  3N7C A;  1AQC A;  2P8V A;  1X1F A;  4HAY B;  1U2B A;  1SHC A;  1LW3 A;  2MWN B;  2AL6 A;  3PVW A;  3ML4 A;  3LJU X;  1WJM A;  2EMT A;  4HAU B;  2D2Q A;  2D9W A;  3A8P A;  4Y94 A;  2COD A;  3F5R A;  1FAO A;  1MK9 B;  5DIF B;  3ULC A;  3F0W A;  3MDB C;  5D3V A;  3A8Q A;  2DX1 A;  1H4R A;  3D8D A;  4CHM A;  1KI1 B;  1XOD A;  2M14 A;  2DA0 A;  1FGY A;  2MFQ A;  1TXD A;  5D27 A;  2DLW A;  3FM8 C;  1RJ2 A;  1U5D A;  4PQ0 A;  1NTY A;  1P6S A;  1FB8 A;  3MPX A;  2W2X D;  1XX0 A;  3FEH A;  1W1H A;  2Y8F A;  2LKO A;  3SO6 A;  5JHG A;  1WVH A;  1QQG A;  2H7E A;  2LOZ A;  2CAY A;  3PSC A;  1GG3 A;  4DX8 A;  3DXC A;  1W1D A;  2RUK B;  2GCL A;  2XQN M;  4KHA A;  2IFS A;  5JHH A;  1W1G A;  1ZVR A;  1I7A A;  4Z2M B;  2ELB A;  3QIJ A;  4DXA B;  1DRO A;  4GN1 A;  1MIX A;  2KCJ A;  2GJY A;  5D3W A;  3VOQ A;  2VKI A;  2H7D A;  4EJN A;  2YSZ A;  4BBK A;  4NSW A;  5L81 A;  2D4Q A;  1KZG A;  2Z0O A;  1RRP B;  3ULB A;  2LOX A;  1QC6 A;  5C6R A;  3V5W A;  1UPQ A;  2DTC A;  4DBB A;  4TYZ A;  3TCA A;  3BJI A;  4CHJ A;  2ROV A;  4IAP A;  5KQ1 A;  1ZSQ A;  1KZ7 A;  1LB1 A;  5DHA B;  3CXB B;  4F7G A;  1P5T A;  2D10 A;  4KHO A;  3CIK A;  4ZRI A;  1BTN A;  4ZRJ A;  2GCJ A;  4C0A A;  1U5F A;  2P0D A;  3ODO A;  1XCG A;  3HK0 A;  2YRY A;  2DX5 A;  2HTH B;  4TKN A;  4HAW B;  5CLQ B;  4Z2N A;  3PVL A;  2I5C A;  2YF0 A;  3DXE A;  5DH9 B;  4NY0 A;  2UZS A;  4IFS A;  3DXD A;  1MK7 B;  3D8F A;  1DYN A;  3GYP A;  4HDQ A;  2N0Y A;  3RCP A;  1ZC4 B;  1U5E A;  2UVM A;  4K2O A;  1V89 A;  5JLJ B;  4WSF A;  2P0H A;  2JP2 A;  3SYX A;  2X18 A;  4F7U P;  2R0D A;  1H10 A;  1UEF A;  3U8Z A;  1BWN A;  1DDW A;  5C16 A;  1PLS A;  2FJL A;  3AU5 A;  1M7R A;  4PNK A;  1P3R A;  1NTV A;  2RSG A;  2KGX B;  3KRX A;  3KZ1 A;  2MDX A;  3BIN A;  3G9W A;  4KHB B;  2M38 A;  1FGZ A;  2K2U A;  2AEH A;  3P6A A;  3HQC A;  3OAN A;  1DBH A;  1K5G B;  4HAZ B;  5DI9 B;  2W2X C;  2J59 M;  4MY6 A;  4K81 A;  1X05 A;  3WA0 A;  2BCJ A;  1ISN A;  1E5W A;  1X11 A;  4A5K A;  5KCV A;  2YS3 A;  1XD4 A;  2CY5 A;  4HB2 B;  4MK0 A;  3TW1 A;  1V88 A;  3AJ4 A;  4F7H A;  4HB3 B;  1X1G A;  1NU2 A;  4GZU A;  2YT0 A;  2QKM A;  4GMV A;  2Y8G A;  1PMS A;  2E2X A;  1TJ6 A;  2CRF A;  1FOE A;  3VIA A;  4WJ7 A;  5HE1 A;  2J0J A;  1ZC3 B;  5GOW B;  2NZ8 B;  2D9X A;  1BAK A;  1OY2 A;  2OQB A;  2RGN B;  1BTK A;  4HB0 B;  1EVH A;  1V5U A;  2DFK A;  5D3Y A;  3IVF A;  5LOP B;  1Q67 A;  2DYN A;  5C5B A;  5J3Q A;  5C79 A;  1FHX A;  2IYB A;  1WGU A;  1TQZ A;  3TVV A;  4K17 A;  4A6K A;  1Y19 B;  1UNP A;  3GYO A;  4A6F B;  4HAV B;  5J3T A;  2DHJ A;  5HE0 A;  2LUL A;  2D11 A;  1DDV A;  1U29 A;  1V5P A;  2UZR A;  4MT7 A;  1UNR A;  2RVB B;  1XKE A;  4ZRK A;  5J3Y A;  1EAZ A;  3X23 A;  4KAX B;  4HDO A;  3SV1 A;  1J0W A;  3O96 A;  2J0M A;  4IOY X;  1OMW A;  2W2W A;  2OTX A;  2VRW B;  4H8S A;  3KY9 A;  2D9V A;  2NMB A;  3ZVR A;  1J19 A;  3T06 A;  1GC6 A;  1B55 A;  2EJ8 A;  5CLL B;  1I2H A;  2K00 A;  1OQN A;  5FI0 A;  2L1C A;  3QBV B;  4EKU A;  3ODW A;  3KSY A;  2YS1 A;  3A98 B;  3AU4 A;  3P7Z A;  3U7D A;  2L2I A;  3SNH A;  3PVU A;  4DX9 0;  3PG7 A;  3QWM A;  1WI1 A;  2I5F A;  3HW2 B;  4HB4 B;  1V5M A;  1UNQ A;  2I1J A;  1WGQ A;  2N23 A;  2P0F A;  2YT1 A;  1XR0 B;  2DKQ A;  5D3X A;  1FHO A;  1UPR A;  4L6E A;  4GMX B;  1M7E A;  4XWX A;  2KUP A;  2D9Y A;  2RLO A;  2LYD A;  3ZDT A;  2YVC A;  1N3H A;  1MPH A;  1X86 A;  2D9Z A;  4CYE A;  2CY4 A;  1MAI A;  1FHW A;  1U27 A;  4A6H A;  2EC1 A;  4B6H A;  4WVF B;  1GC7 A;  2MKR A;  2Z0P A;  2EMS A;  2PZ1 A;  2QKL A;  2VSZ A;  1AWE A;  4GPT B;  4P7I A;  5HE2 A;  2R09 A;  1MKE A;  2YS5 A;  5DHF B;  1EF1 A;  4GXB A;  3WYF B;  3UZT A;  4EMO A;  5LON B;  4A6F A;  3PEG A;  1WG7 A;  2Q13 A;  3D8E A;  2RNR B;  4HHV A;  4YON A;  3TO1 A;  3FSS A;  1MIZ B;  2DKP A;  2K2J A;  4HAT B;  2DN6 A;  2J0K A;  2ROZ B;  5HE3 A;  1K5D B;  2COA A;  5JP4 A;  1EGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...