2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Docking protein 2, isoform a
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
4D0NB 2GS0A 2W2XD 2L2IA 3MDBC 3OANA 3VOQA 1DROA 2Q13A 1E5WA 2J0JA 2N23A 5DI9B 4DBBA 2X18A 3U7DA 3IVFA 2FJLA 4A6FB 3D8DA 1V88A 3QWMA 5DHAB 1I7AA 2GCLA 5JHGA 4KAXB 4TYZA 1MK7B 1DDVA 2IFSA 4K2OA 3G9WA 4HAXB 1FGYA 1ZC3B 1Y5OA 2K2UA 2Z0PA 3LJUX 3ODXA 2MWNB 1WGQA 1XODA 4KHBB 1NTYA 4F7HA 4F7GA 1K5DB 5KQ4A 1W1HA 4IFSA 1EVHA 2D2QA 3GYOA 2LYDA 4H8SA 2ZPYA 2I1KA 2Y7BA 1XD4A 1WI1A 1RRPB 2DHIA 5GOWB 1EF1A 2ROVA 3A8QA 5D3WA 3TVVA 5FI1A 2J0KA 5C79A 5DH9B 1OY2A 2MDXA 3KRXA 2YS5A 2E2XA 2IYBA 3D8FA 3SO6A 3KZ1A 5L81A 1J19A 3SUZA 1DDMA 1ISNA 2DA0A 1Q67A 3F5RA 1P5TA 2LOXA 1SHCA 4A6FA 2YF0A 2V76A 3QBVB 2CODA 4NY0A 2R09A 2K2JA 1U5EA 1M7RA 1U5FA 2AL6A 3N7CA 4Y94A 2RNRB 4K81A 3NSUA 1UNQA 1P3RA 4L6EA 4K17A 1U5GA 2HE7A 5J3YA 1NTVA 5EFXA 3TW1A 3D8EA 4ZRKA 2EMSA 3PVUA 4HB3B 4GZUA 2M14A 2Y8GA 3SNHA 3BINA 2CY4A 5D3XA 2P8VA 1I2HA 3AU5A 2UVMA 4GN1A 2OQBA 1IRSA 4IOYX 3ZVRA 2Z0QA 1UPQA 4IAPA 5CLLB 1MAIA 2DX1A 5FI0A 4CHMA 2J0MA 2R0DA 2H7DA 3GYPA 4HAZB 4YL8A 3FEHA 5KQ1A 2G35A 3UZTA 4HATB 3AJ4A 2ELAA 4HHVA 1X1GA 3TO1A 1BAKA 1UNRA 1N3HA 3SYXA 3WYFB 2YS1A 2DX5A 5C6RA 5JLJB 4HB4B 3V5WA 1KI1B 4PNKA 3DXEA 2H7EA 3TCAA 3HW2B 1MIXA 2Y8FA 4WJ7A 4TKNA 1FAOA 1XR0B 4CYEA 4P7IA 4HB0B 2DHKA 3PZDA 4GMXB 3DXDA 3PVLA 1PLSA 5C16A 1FHXA 1P6SA 2D9XA 1EGXA 3RCPA 5LONB 2DLWA 4CHJA 3FM8C 3ML4A 1TJ6A 5CLQB 2CY5A 2I5FA 1WGUA 5HE0A 2MFQA 2ADZA 1OMWA 4NSWA 2J59M 2LOZA 1NU2A 1UPRA 1J0WA 3QIJA 3ODOA 1H4RA 1PFJA 2I5CA 2DHJA 3ODWA 2LG1A 5C5BA 4HB2B 2EMTA 4YONA 4XWXA 1BWNA 1MPHA 2RLOA 4WSFA 3WA0A 1Y19B 3ZDTA 1ZM0A 1NI2A 1W1DA 4Z2NA 1BTNA 1Z87A 1SGHA 4KHOA 2QKMA 1MK9B 1TXDA 2YS3A 1DYNA 3MPXA 3BJIA 3PG7A 3SV1A 3T06A 2YT0A 2JP2A 1FHOA 2DYQA 1GC7A 2K00A 1X1FA 2KGXB 4BBKA 1U27A 2EC1A 4EMOA 2D10A 2VRWB 4B6HA 1V89A 1H10A 2COFA 1ZVRA 2DKPA 4HDQA 3ULCA 4MK0A 1OQNA 3F0WA 2M38A 1GC6A 1TQZA 1KZ7A 2DN6A 2N0YA 4MT7A 2D11A 4EJNA 5J3QA 4GMVA 1XCGA 4DX90 4A6KA 4A6HA 2Z0OA 3VIAA 3A8PA 5HE1A 3M1IB 1LB1A 2D4QA 2YVCA 2CRFA 4Z2MB 1QQGA 3CIKA 4GPTB 2NMBA 1UEFA 2P0HA 5HE3A 5C5BB 2P0FA 4HAUB 4DX8A 5D3VA 2GCJA 3AU4A 3PVWA 2DTCA 1AQCA 2KUPA 5HE2A 1U2BA 1U29A 1XKEA 1KZGA 2D9VA 5DIFB 1MKEA 3P6AA 2OTXA 2D9YA 5J3TA 2UZRA 3PEGA 2QKLA 2P0DA 1X05A 4HAWB 1FOEA 1X11A 2LULA 2AEHA 2VKIA 2ROZB 5D27A 3KSYA 4A5KA 5KCVA 2D9ZA 2L1CA 3PP2A 3CXBB 5JHHA 3O96A 1UNPA 2ELBA 4MY6A 2YRYA 1X86A 1B55A 2D9WA 1XX0A 3P7ZA 1AWEA 4K2PA 1BTKA 3X23A 4C0AA 3TFMA 3HK0A 1V61A 1FB8A 2DFKA 3A98B 4EKUA 4HDOA 1WG7A 2GJYA 2KCJA 2I1JA 3KRWA 1EAZA 2RUKB 2W2WA 1V5MA 2UZSA 2PZ1A 1M7EA 1ZC4B 1DDWA 4DXAB 1FGZA 2HTHB 4F7UP 2YSZA 5LOPB 2CAYA 2RVBB 1V5UA 1K5GB 3KY9A 2COCA 3PSCA 1QC6A 4ZRIA 5DHFB 1GG3A 1WJ1A 2YT1A 4KVGB 2EJ8A 1MIZB 3HQCA 4KHAA 3U8ZA 2XQNM 4PQ0A 2COAA 2RGNB 1ZSQA 2NZ8B 2DKQA 2DYNA 2MKRA 5D3YA 3DXCA 1WVHA 3FSSA 2LKOA 1WJMA 2BCJA 1DBHA 2RSGA 4GXBA 2VSZA 1LW3A 1PMSA 4ZRJA 3ULBA 4WVFB 1U5DA 1V5PA 5JP4A 2W2XC 4HAVB 1W1GA 4HAYB 1FHWA 1RJ2A
chains in the Genus database with same CATH superfamily
4D0NB 2GS0A 2W2XD 2L2IA 3MDBC 3OANA 2YT2A 3VOQA 1DROA 2Q13A 1E5WA 2J0JA 2N23A 5DI9B 4DBBA 2X18A 3U7DA 3IVFA 2FJLA 4A6FB 3D8DA 3NWDA 1V88A 3QWMA 5DHAB 1I7AA 2GCLA 2Z59A 5JHGA 4KAXB 4TYZA 1MK7B 1DDVA 2IFSA 4K2OA 3G9WA 4HAXB 1FGYA 1ZC3B 1Y5OA 2K2UA 2Z0PA 3LJUX 3ODXA 3NWAA 2MWNB 1WGQA 4GNKB 1XODA 4KHBB 1NTYA 4F7HA 4F7GA 1K5DB 5KQ4A 1W1HA 4IFSA 4QJ5B 1EVHA 2D2QA 3GYOA 2LYDA 4H8SA 2ZPYA 2I1KA 2Y7BA 1XD4A 1WI1A 1RRPB 2DHIA 5GOWB 1EF1A 2ROVA 3A8QA 5D3WA 3TVVA 5FI1A 2J0KA 5C79A 5DH9B 1OY2A 2MDXA 5I2SA 3KRXA 2YS5A 2E2XA 2IYBA 3D8FA 3SO6A 3KZ1A 5L81A 1J19A 3SUZA 1DDMA 1ISNA 2DA0A 1Q67A 2ZKMX 3F5RA 1P5TA 2LOXA 1SHCA 4A6FA 2YF0A 2Z13A 2V76A 3QBVB 2CODA 2Z4DA 4NY0A 2R09A 2K2JA 1U5EA 1M7RA 1U5FA 2AL6A 3N7CA 4Y94A 2RNRB 4K81A 3NSUA 1UNQA 1P3RA 4L6EA 4K17A 1U5GA 2HE7A 5J3YA 1NTVA 5EFXA 3TW1A 3D8EA 4ZRKA 2EMSA 3PVUA 5LG4B 4HB3B 4GZUA 2M14A 2Y8GA 3SNHA 3BINA 2CY4A 5D3XA 2P8VA 1I2HA 3AU5A 2UVMA 4GN1A 2OQBA 1IRSA 2KR0A 4IOYX 3ZVRA 2Z0QA 1UPQA 4DIXA 4IAPA 5CLLB 1MAIA 2DX1A 5FI0A 4CHMA 2J0MA 2R0DA 2H7DA 3GYPA 4HAZB 4YL8A 3FEHA 5KQ1A 2G35A 3UZTA 4HATB 3AJ4A 2ELAA 4HHVA 1X1GA 3TO1A 1T77A 1BAKA 1UNRA 3HIEA 1N3HA 3SYXA 3WYFB 2YS1A 2DX5A 5C6RA 5JLJB 4HB4B 3V5WA 1KI1B 4PNKA 3DXEA 2H7EA 3TCAA 3HW2B 1MIXA 2Y8FA 4WJ7A 4TKNA 1FAOA 1XR0B 4CYEA 4P7IA 4HB0B 2DHKA 3PZDA 4GMXB 3DXDA 3PVLA 1PLSA 5C16A 1FHXA 1P6SA 2D9XA 1EGXA 3RCPA 2NBVA 5I2MA 5LONB 2DLWA 4CHJA 3FM8C 3ML4A 1TJ6A 4OSNA 2CY5A 2I5FA 5CLQB 1WGUA 4GOUA 5HE0A 2MFQA 2R2YA 2ADZA 5IRSA 1OMWA 3FVCA 4NSWA 2J59M 2LOZA 1NU2A 1UPRA 1J0WA 3QIJA 3ODOA 1H4RA 1PFJA 2RRFA 1MI1A 2I5CA 2DHJA 3ODWA 2LG1A 5C5BA 4HB2B 2EMTA 4YONA 4XWXA 1BWNA 4QJ3B 1MPHA 2RLOA 4WSFA 4KHBA 1Y19B 3WA0A 3ZDTA 1ZM0A 1NI2A 1W1DA 4Z2NA 1BTNA 1Z87A 2KIEA 1SGHA 4KHOA 2QKMA 1MK9B 1TXDA 2YS3A 1DYNA 3MPXA 3BJIA 3PG7A 3SV1A 3T06A 2YT0A 2JP2A 1FHOA 2DYQA 1GC7A 2K00A 3A58A 1X1FA 2KGXB 2K49A 4BBKA 1U27A 2EC1A 4EMOA 2D10A 2VRWB 4B6HA 1V89A 1H10A 2COFA 1ZVRA 2DKPA 4HDQA 3ULCA 4MK0A 2K8EA 5M4YB 1OQNA 3F0WA 2M38A 2FJUB 1GC6A 1TQZA 1KZ7A 2DN6A 2N0YA 4MT7A 2D11A 4EJNA 5J3QA 4GMVA 1XCGA 4DX90 4A6KA 4A6HA 2Z0OA 3VIAA 3A8PA 5HE1A 3M1IB 1LB1A 1ZYIA 2D4QA 2KIGA 2YVCA 2CRFA 4Z2MB 1QQGA 3CIKA 4GPTB 2NMBA 1UEFA 2P0HA 5HE3A 5C5BB 2P0FA 4HAUB 4DX8A 5D3VA 2GCJA 3AU4A 3U12A 3PVWA 2DTCA 1AQCA 2KUPA 5HE2A 4QXAB 1U2BA 1U29A 1XKEA 1KZGA 2D9VA 5DIFB 1MKEA 3P6AA 2OTXA 4HSIA 2D9YA 5J3TA 3OHMB 2UZRA 3PEGA 2QKLA 2KUQA 2P0DA 1X05A 1FOEA 1X11A 4HAWB 2LULA 2AEHA 2VKIA 2ROZB 5D27A 3KSYA 4A5KA 5KCVA 2D9ZA 2L1CA 3PP2A 3CXBB 5JHHA 3O96A 1UNPA 2ELBA 4MY6A 2YRYA 1X86A 1B55A 2D9WA 1XX0A 3P7ZA 1AWEA 4K2PA 1BTKA 3X23A 4C0AA 4CSQA 3TFMA 3HK0A 1V61A 1FB8A 4D6WA 2DFKA 3A98B 4EKUA 2GUMA 4HDOA 1WG7A 3NW8A 2GJYA 2KCJA 2I1JA 3KRWA 1EAZA 2RUKB 2W2WA 1V5MA 2UZSA 2PZ1A 3B77A 3NWFA 1M7EA 1ZC4B 1DDWA 4DXAB 4OT1A 4QJ4B 1FGZA 2HTHB 2Z14A 4F7UP 2YSZA 5LOPB 2CAYA 2RVBB 1V5UA 1K5GB 3KY9A 2COCA 3PSCA 3DCXA 1QC6A 4ZRIA 5DHFB 1GG3A 1WJ1A 2YT1A 4KVGB 2EJ8A 1MIZB 3HQCA 4KHAA 3U8ZA 3HSAA 2XQNM 4PQ0A 2COAA 2RGNB 1ZSQA 2NZ8B 2DKQA 2DYNA 2MKRA 5D3YA 3DXCA 1WVHA 3FSSA 4L1RA 2LKOA 1WJMA 2BCJA 1DBHA 2RSGA 4GXBA 2VSZA 1LW3A 1PMSA 4ZRJA 3ULBA 4WVFB 1U5DA 1V5PA 5JP4A 2W2XC 4HAVB 1W1GA 4HAYB 1FHWA 1RJ2A
chains in the Genus database with same CATH topology
4D0NB 2GS0A 2W2XD 2L2IA 3MDBC 3OANA 3VOQA 1DROA 2Q13A 1E5WA 2J0JA 2N23A 5DI9B 4DBBA 2X18A 3U7DA 3IVFA 2FJLA 4A6FB 3D8DA 1V88A 3QWMA 5DHAB 1I7AA 2GCLA 5JHGA 4KAXB 4TYZA 1MK7B 1DDVA 2IFSA 4K2OA 3G9WA 4HAXB 1FGYA 1ZC3B 1Y5OA 2K2UA 2Z0PA 3LJUX 3ODXA 2MWNB 1WGQA 1XODA 4KHBB 1NTYA 4F7HA 4F7GA 1K5DB 5KQ4A 1W1HA 4IFSA 1EVHA 2D2QA 3GYOA 2LYDA 4H8SA 2ZPYA 2I1KA 2Y7BA 1XD4A 1WI1A 1RRPB 2DHIA 5GOWB 1EF1A 2ROVA 3A8QA 5D3WA 3TVVA 5FI1A 2J0KA 5C79A 5DH9B 1OY2A 2MDXA 3KRXA 2YS5A 2E2XA 2IYBA 3D8FA 3SO6A 3KZ1A 5L81A 1J19A 3SUZA 1DDMA 1ISNA 2DA0A 1Q67A 3F5RA 1P5TA 2LOXA 1SHCA 4A6FA 2YF0A 2V76A 3QBVB 2CODA 4NY0A 2R09A 2K2JA 1U5EA 1M7RA 1U5FA 2AL6A 3N7CA 4Y94A 2RNRB 4K81A 3NSUA 1UNQA 1P3RA 4L6EA 4K17A 1U5GA 2HE7A 5J3YA 1NTVA 5EFXA 3TW1A 3D8EA 4ZRKA 2EMSA 3PVUA 4HB3B 4GZUA 2M14A 2Y8GA 3SNHA 3BINA 2CY4A 5D3XA 2P8VA 1I2HA 3AU5A 2UVMA 4GN1A 2OQBA 1IRSA 4IOYX 3ZVRA 2Z0QA 1UPQA 4IAPA 5CLLB 1MAIA 2DX1A 5FI0A 4CHMA 2J0MA 2R0DA 2H7DA 3GYPA 4HAZB 4YL8A 3FEHA 5KQ1A 2G35A 3UZTA 4HATB 3AJ4A 2ELAA 4HHVA 1X1GA 3TO1A 1BAKA 1UNRA 1N3HA 3SYXA 3WYFB 2YS1A 2DX5A 5C6RA 5JLJB 4HB4B 3V5WA 1KI1B 4PNKA 3DXEA 2H7EA 3TCAA 3HW2B 1MIXA 2Y8FA 4WJ7A 4TKNA 1FAOA 1XR0B 4CYEA 4P7IA 4HB0B 2DHKA 3PZDA 4GMXB 3DXDA 3PVLA 1PLSA 5C16A 1FHXA 1P6SA 2D9XA 1EGXA 3RCPA 5LONB 2DLWA 4CHJA 3FM8C 3ML4A 1TJ6A 5CLQB 2CY5A 2I5FA 1WGUA 5HE0A 2MFQA 2ADZA 1OMWA 4NSWA 2J59M 2LOZA 1NU2A 1UPRA 1J0WA 3QIJA 3ODOA 1H4RA 1PFJA 2I5CA 2DHJA 3ODWA 2LG1A 5C5BA 4HB2B 2EMTA 4YONA 4XWXA 1BWNA 1MPHA 2RLOA 4WSFA 3WA0A 1Y19B 3ZDTA 1ZM0A 1NI2A 1W1DA 4Z2NA 1BTNA 1Z87A 1SGHA 4KHOA 2QKMA 1MK9B 1TXDA 2YS3A 1DYNA 3MPXA 3BJIA 3PG7A 3SV1A 3T06A 2YT0A 2JP2A 1FHOA 2DYQA 1GC7A 2K00A 1X1FA 2KGXB 4BBKA 1U27A 2EC1A 4EMOA 2D10A 2VRWB 4B6HA 1V89A 1H10A 2COFA 1ZVRA 2DKPA 4HDQA 3ULCA 4MK0A 1OQNA 3F0WA 2M38A 1GC6A 1TQZA 1KZ7A 2DN6A 2N0YA 4MT7A 2D11A 4EJNA 5J3QA 4GMVA 1XCGA 4DX90 4A6KA 4A6HA 2Z0OA 3VIAA 3A8PA 5HE1A 3M1IB 1LB1A 2D4QA 2YVCA 2CRFA 4Z2MB 1QQGA 3CIKA 4GPTB 2NMBA 1UEFA 2P0HA 5HE3A 5C5BB 2P0FA 4HAUB 4DX8A 5D3VA 2GCJA 3AU4A 3PVWA 2DTCA 1AQCA 2KUPA 5HE2A 1U2BA 1U29A 1XKEA 1KZGA 2D9VA 5DIFB 1MKEA 3P6AA 2OTXA 2D9YA 5J3TA 2UZRA 3PEGA 2QKLA 2P0DA 1X05A 4HAWB 1FOEA 1X11A 2LULA 2AEHA 2VKIA 2ROZB 5D27A 3KSYA 4A5KA 5KCVA 2D9ZA 2L1CA 3PP2A 3CXBB 5JHHA 3O96A 1UNPA 2ELBA 4MY6A 2YRYA 1X86A 1B55A 2D9WA 1XX0A 3P7ZA 1AWEA 4K2PA 1BTKA 3X23A 4C0AA 3TFMA 3HK0A 1V61A 1FB8A 2DFKA 3A98B 4EKUA 4HDOA 1WG7A 2GJYA 2KCJA 2I1JA 3KRWA 1EAZA 2RUKB 2W2WA 1V5MA 2UZSA 2PZ1A 1M7EA 1ZC4B 1DDWA 4DXAB 1FGZA 2HTHB 4F7UP 2YSZA 5LOPB 2CAYA 2RVBB 1V5UA 1K5GB 3KY9A 2COCA 3PSCA 1QC6A 4ZRIA 5DHFB 1GG3A 1WJ1A 2YT1A 4KVGB 2EJ8A 1MIZB 3HQCA 4KHAA 3U8ZA 2XQNM 4PQ0A 2COAA 2RGNB 1ZSQA 2NZ8B 2DKQA 2DYNA 2MKRA 5D3YA 3DXCA 1WVHA 3FSSA 2LKOA 1WJMA 2BCJA 1DBHA 2RSGA 4GXBA 2VSZA 1LW3A 1PMSA 4ZRJA 3ULBA 4WVFB 1U5DA 1V5PA 5JP4A 2W2XC 4HAVB 1W1GA 4HAYB 1FHWA 1RJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0N B;  2GS0 A;  2W2X D;  2L2I A;  3MDB C;  3OAN A;  3VOQ A;  1DRO A;  2Q13 A;  1E5W A;  2J0J A;  2N23 A;  5DI9 B;  4DBB A;  2X18 A;  3U7D A;  3IVF A;  2FJL A;  4A6F B;  3D8D A;  1V88 A;  3QWM A;  5DHA B;  1I7A A;  2GCL A;  5JHG A;  4KAX B;  4TYZ A;  1MK7 B;  1DDV A;  2IFS A;  4K2O A;  3G9W A;  4HAX B;  1FGY A;  1ZC3 B;  1Y5O A;  2K2U A;  2Z0P A;  3LJU X;  3ODX A;  2MWN B;  1WGQ A;  1XOD A;  4KHB B;  1NTY A;  4F7H A;  4F7G A;  1K5D B;  5KQ4 A;  1W1H A;  4IFS A;  1EVH A;  2D2Q A;  3GYO A;  2LYD A;  4H8S A;  2ZPY A;  2I1K A;  2Y7B A;  1XD4 A;  1WI1 A;  1RRP B;  2DHI A;  5GOW B;  1EF1 A;  2ROV A;  3A8Q A;  5D3W A;  3TVV A;  5FI1 A;  2J0K A;  5C79 A;  5DH9 B;  1OY2 A;  2MDX A;  3KRX A;  2YS5 A;  2E2X A;  2IYB A;  3D8F A;  3SO6 A;  3KZ1 A;  5L81 A;  1J19 A;  3SUZ A;  1DDM A;  1ISN A;  2DA0 A;  1Q67 A;  3F5R A;  1P5T A;  2LOX A;  1SHC A;  4A6F A;  2YF0 A;  2V76 A;  3QBV B;  2COD A;  4NY0 A;  2R09 A;  2K2J A;  1U5E A;  1M7R A;  1U5F A;  2AL6 A;  3N7C A;  4Y94 A;  2RNR B;  4K81 A;  3NSU A;  1UNQ A;  1P3R A;  4L6E A;  4K17 A;  1U5G A;  2HE7 A;  5J3Y A;  1NTV A;  5EFX A;  3TW1 A;  3D8E A;  4ZRK A;  2EMS A;  3PVU A;  4HB3 B;  4GZU A;  2M14 A;  2Y8G A;  3SNH A;  3BIN A;  2CY4 A;  5D3X A;  2P8V A;  1I2H A;  3AU5 A;  2UVM A;  4GN1 A;  2OQB A;  1IRS A;  4IOY X;  3ZVR A;  2Z0Q A;  1UPQ A;  4IAP A;  5CLL B;  1MAI A;  2DX1 A;  5FI0 A;  4CHM A;  2J0M A;  2R0D A;  2H7D A;  3GYP A;  4HAZ B;  4YL8 A;  3FEH A;  5KQ1 A;  2G35 A;  3UZT A;  4HAT B;  3AJ4 A;  2ELA A;  4HHV A;  1X1G A;  3TO1 A;  1BAK A;  1UNR A;  1N3H A;  3SYX A;  3WYF B;  2YS1 A;  2DX5 A;  5C6R A;  5JLJ B;  4HB4 B;  3V5W A;  1KI1 B;  4PNK A;  3DXE A;  2H7E A;  3TCA A;  3HW2 B;  1MIX A;  2Y8F A;  4WJ7 A;  4TKN A;  1FAO A;  1XR0 B;  4CYE A;  4P7I A;  4HB0 B;  2DHK A;  3PZD A;  4GMX B;  3DXD A;  3PVL A;  1PLS A;  5C16 A;  1FHX A;  1P6S A;  2D9X A;  1EGX A;  3RCP A;  5LON B;  2DLW A;  4CHJ A;  3FM8 C;  3ML4 A;  1TJ6 A;  5CLQ B;  2CY5 A;  2I5F A;  1WGU A;  5HE0 A;  2MFQ A;  2ADZ A;  1OMW A;  4NSW A;  2J59 M;  2LOZ A;  1NU2 A;  1UPR A;  1J0W A;  3QIJ A;  3ODO A;  1H4R A;  1PFJ A;  2I5C A;  2DHJ A;  3ODW A;  2LG1 A;  5C5B A;  4HB2 B;  2EMT A;  4YON A;  4XWX A;  1BWN A;  1MPH A;  2RLO A;  4WSF A;  3WA0 A;  1Y19 B;  3ZDT A;  1ZM0 A;  1NI2 A;  1W1D A;  4Z2N A;  1BTN A;  1Z87 A;  1SGH A;  4KHO A;  2QKM A;  1MK9 B;  1TXD A;  2YS3 A;  1DYN A;  3MPX A;  3BJI A;  3PG7 A;  3SV1 A;  3T06 A;  2YT0 A;  2JP2 A;  1FHO A;  2DYQ A;  1GC7 A;  2K00 A;  1X1F A;  2KGX B;  4BBK A;  1U27 A;  2EC1 A;  4EMO A;  2D10 A;  2VRW B;  4B6H A;  1V89 A;  1H10 A;  2COF A;  1ZVR A;  2DKP A;  4HDQ A;  3ULC A;  4MK0 A;  1OQN A;  3F0W A;  2M38 A;  1GC6 A;  1TQZ A;  1KZ7 A;  2DN6 A;  2N0Y A;  4MT7 A;  2D11 A;  4EJN A;  5J3Q A;  4GMV A;  1XCG A;  4DX9 0;  4A6K A;  4A6H A;  2Z0O A;  3VIA A;  3A8P A;  5HE1 A;  3M1I B;  1LB1 A;  2D4Q A;  2YVC A;  2CRF A;  4Z2M B;  1QQG A;  3CIK A;  4GPT B;  2NMB A;  1UEF A;  2P0H A;  5HE3 A;  5C5B B;  2P0F A;  4HAU B;  4DX8 A;  5D3V A;  2GCJ A;  3AU4 A;  3PVW A;  2DTC A;  1AQC A;  2KUP A;  5HE2 A;  1U2B A;  1U29 A;  1XKE A;  1KZG A;  2D9V A;  5DIF B;  1MKE A;  3P6A A;  2OTX A;  2D9Y A;  5J3T A;  2UZR A;  3PEG A;  2QKL A;  2P0D A;  1X05 A;  4HAW B;  1FOE A;  1X11 A;  2LUL A;  2AEH A;  2VKI A;  2ROZ B;  5D27 A;  3KSY A;  4A5K A;  5KCV A;  2D9Z A;  2L1C A;  3PP2 A;  3CXB B;  5JHH A;  3O96 A;  1UNP A;  2ELB A;  4MY6 A;  2YRY A;  1X86 A;  1B55 A;  2D9W A;  1XX0 A;  3P7Z A;  1AWE A;  4K2P A;  1BTK A;  3X23 A;  4C0A A;  3TFM A;  3HK0 A;  1V61 A;  1FB8 A;  2DFK A;  3A98 B;  4EKU A;  4HDO A;  1WG7 A;  2GJY A;  2KCJ A;  2I1J A;  3KRW A;  1EAZ A;  2RUK B;  2W2W A;  1V5M A;  2UZS A;  2PZ1 A;  1M7E A;  1ZC4 B;  1DDW A;  4DXA B;  1FGZ A;  2HTH B;  4F7U P;  2YSZ A;  5LOP B;  2CAY A;  2RVB B;  1V5U A;  1K5G B;  3KY9 A;  2COC A;  3PSC A;  1QC6 A;  4ZRI A;  5DHF B;  1GG3 A;  1WJ1 A;  2YT1 A;  4KVG B;  2EJ8 A;  1MIZ B;  3HQC A;  4KHA A;  3U8Z A;  2XQN M;  4PQ0 A;  2COA A;  2RGN B;  1ZSQ A;  2NZ8 B;  2DKQ A;  2DYN A;  2MKR A;  5D3Y A;  3DXC A;  1WVH A;  3FSS A;  2LKO A;  1WJM A;  2BCJ A;  1DBH A;  2RSG A;  4GXB A;  2VSZ A;  1LW3 A;  1PMS A;  4ZRJ A;  3ULB A;  4WVF B;  1U5D A;  1V5P A;  5JP4 A;  2W2X C;  4HAV B;  1W1G A;  4HAY B;  1FHW A;  1RJ2 A; 
#chains in the Genus database with same CATH topology
 4D0N B;  2GS0 A;  2W2X D;  2L2I A;  3MDB C;  3OAN A;  2YT2 A;  3VOQ A;  1DRO A;  2Q13 A;  1E5W A;  2J0J A;  2N23 A;  5DI9 B;  4DBB A;  2X18 A;  3U7D A;  3IVF A;  2FJL A;  4A6F B;  3D8D A;  3NWD A;  1V88 A;  3QWM A;  5DHA B;  1I7A A;  2GCL A;  2Z59 A;  5JHG A;  4KAX B;  4TYZ A;  1MK7 B;  1DDV A;  2IFS A;  4K2O A;  3G9W A;  4HAX B;  1FGY A;  1ZC3 B;  1Y5O A;  2K2U A;  2Z0P A;  3LJU X;  3ODX A;  3NWA A;  2MWN B;  1WGQ A;  4GNK B;  1XOD A;  4KHB B;  1NTY A;  4F7H A;  4F7G A;  1K5D B;  5KQ4 A;  1W1H A;  4IFS A;  4QJ5 B;  1EVH A;  2D2Q A;  3GYO A;  2LYD A;  4H8S A;  2ZPY A;  2I1K A;  2Y7B A;  1XD4 A;  1WI1 A;  1RRP B;  2DHI A;  5GOW B;  1EF1 A;  2ROV A;  3A8Q A;  5D3W A;  3TVV A;  5FI1 A;  2J0K A;  5C79 A;  5DH9 B;  1OY2 A;  2MDX A;  5I2S A;  3KRX A;  2YS5 A;  2E2X A;  2IYB A;  3D8F A;  3SO6 A;  3KZ1 A;  5L81 A;  1J19 A;  3SUZ A;  1DDM A;  1ISN A;  2DA0 A;  1Q67 A;  2ZKM X;  3F5R A;  1P5T A;  2LOX A;  1SHC A;  4A6F A;  2YF0 A;  2Z13 A;  2V76 A;  3QBV B;  2COD A;  2Z4D A;  4NY0 A;  2R09 A;  2K2J A;  1U5E A;  1M7R A;  1U5F A;  2AL6 A;  3N7C A;  4Y94 A;  2RNR B;  4K81 A;  3NSU A;  1UNQ A;  1P3R A;  4L6E A;  4K17 A;  1U5G A;  2HE7 A;  5J3Y A;  1NTV A;  5EFX A;  3TW1 A;  3D8E A;  4ZRK A;  2EMS A;  3PVU A;  5LG4 B;  4HB3 B;  4GZU A;  2M14 A;  2Y8G A;  3SNH A;  3BIN A;  2CY4 A;  5D3X A;  2P8V A;  1I2H A;  3AU5 A;  2UVM A;  4GN1 A;  2OQB A;  1IRS A;  2KR0 A;  4IOY X;  3ZVR A;  2Z0Q A;  1UPQ A;  4DIX A;  4IAP A;  5CLL B;  1MAI A;  2DX1 A;  5FI0 A;  4CHM A;  2J0M A;  2R0D A;  2H7D A;  3GYP A;  4HAZ B;  4YL8 A;  3FEH A;  5KQ1 A;  2G35 A;  3UZT A;  4HAT B;  3AJ4 A;  2ELA A;  4HHV A;  1X1G A;  3TO1 A;  1T77 A;  1BAK A;  1UNR A;  3HIE A;  1N3H A;  3SYX A;  3WYF B;  2YS1 A;  2DX5 A;  5C6R A;  5JLJ B;  4HB4 B;  3V5W A;  1KI1 B;  4PNK A;  3DXE A;  2H7E A;  3TCA A;  3HW2 B;  1MIX A;  2Y8F A;  4WJ7 A;  4TKN A;  1FAO A;  1XR0 B;  4CYE A;  4P7I A;  4HB0 B;  2DHK A;  3PZD A;  4GMX B;  3DXD A;  3PVL A;  1PLS A;  5C16 A;  1FHX A;  1P6S A;  2D9X A;  1EGX A;  3RCP A;  2NBV A;  5I2M A;  5LON B;  2DLW A;  4CHJ A;  3FM8 C;  3ML4 A;  1TJ6 A;  4OSN A;  2CY5 A;  2I5F A;  5CLQ B;  1WGU A;  4GOU A;  5HE0 A;  2MFQ A;  2R2Y A;  2ADZ A;  5IRS A;  1OMW A;  3FVC A;  4NSW A;  2J59 M;  2LOZ A;  1NU2 A;  1UPR A;  1J0W A;  3QIJ A;  3ODO A;  1H4R A;  1PFJ A;  2RRF A;  1MI1 A;  2I5C A;  2DHJ A;  3ODW A;  2LG1 A;  5C5B A;  4HB2 B;  2EMT A;  4YON A;  4XWX A;  1BWN A;  4QJ3 B;  1MPH A;  2RLO A;  4WSF A;  4KHB A;  1Y19 B;  3WA0 A;  3ZDT A;  1ZM0 A;  1NI2 A;  1W1D A;  4Z2N A;  1BTN A;  1Z87 A;  2KIE A;  1SGH A;  4KHO A;  2QKM A;  1MK9 B;  1TXD A;  2YS3 A;  1DYN A;  3MPX A;  3BJI A;  3PG7 A;  3SV1 A;  3T06 A;  2YT0 A;  2JP2 A;  1FHO A;  2DYQ A;  1GC7 A;  2K00 A;  3A58 A;  1X1F A;  2KGX B;  2K49 A;  4BBK A;  1U27 A;  2EC1 A;  4EMO A;  2D10 A;  2VRW B;  4B6H A;  1V89 A;  1H10 A;  2COF A;  1ZVR A;  2DKP A;  4HDQ A;  3ULC A;  4MK0 A;  2K8E A;  5M4Y B;  1OQN A;  3F0W A;  2M38 A;  2FJU B;  1GC6 A;  1TQZ A;  1KZ7 A;  2DN6 A;  2N0Y A;  4MT7 A;  2D11 A;  4EJN A;  5J3Q A;  4GMV A;  1XCG A;  4DX9 0;  4A6K A;  4A6H A;  2Z0O A;  3VIA A;  3A8P A;  5HE1 A;  3M1I B;  1LB1 A;  1ZYI A;  2D4Q A;  2KIG A;  2YVC A;  2CRF A;  4Z2M B;  1QQG A;  3CIK A;  4GPT B;  2NMB A;  1UEF A;  2P0H A;  5HE3 A;  5C5B B;  2P0F A;  4HAU B;  4DX8 A;  5D3V A;  2GCJ A;  3AU4 A;  3U12 A;  3PVW A;  2DTC A;  1AQC A;  2KUP A;  5HE2 A;  4QXA B;  1U2B A;  1U29 A;  1XKE A;  1KZG A;  2D9V A;  5DIF B;  1MKE A;  3P6A A;  2OTX A;  4HSI A;  2D9Y A;  5J3T A;  3OHM B;  2UZR A;  3PEG A;  2QKL A;  2KUQ A;  2P0D A;  1X05 A;  1FOE A;  1X11 A;  4HAW B;  2LUL A;  2AEH A;  2VKI A;  2ROZ B;  5D27 A;  3KSY A;  4A5K A;  5KCV A;  2D9Z A;  2L1C A;  3PP2 A;  3CXB B;  5JHH A;  3O96 A;  1UNP A;  2ELB A;  4MY6 A;  2YRY A;  1X86 A;  1B55 A;  2D9W A;  1XX0 A;  3P7Z A;  1AWE A;  4K2P A;  1BTK A;  3X23 A;  4C0A A;  4CSQ A;  3TFM A;  3HK0 A;  1V61 A;  1FB8 A;  4D6W A;  2DFK A;  3A98 B;  4EKU A;  2GUM A;  4HDO A;  1WG7 A;  3NW8 A;  2GJY A;  2KCJ A;  2I1J A;  3KRW A;  1EAZ A;  2RUK B;  2W2W A;  1V5M A;  2UZS A;  2PZ1 A;  3B77 A;  3NWF A;  1M7E A;  1ZC4 B;  1DDW A;  4DXA B;  4OT1 A;  4QJ4 B;  1FGZ A;  2HTH B;  2Z14 A;  4F7U P;  2YSZ A;  5LOP B;  2CAY A;  2RVB B;  1V5U A;  1K5G B;  3KY9 A;  2COC A;  3PSC A;  3DCX A;  1QC6 A;  4ZRI A;  5DHF B;  1GG3 A;  1WJ1 A;  2YT1 A;  4KVG B;  2EJ8 A;  1MIZ B;  3HQC A;  4KHA A;  3U8Z A;  3HSA A;  2XQN M;  4PQ0 A;  2COA A;  2RGN B;  1ZSQ A;  2NZ8 B;  2DKQ A;  2DYN A;  2MKR A;  5D3Y A;  3DXC A;  1WVH A;  3FSS A;  4L1R A;  2LKO A;  1WJM A;  2BCJ A;  1DBH A;  2RSG A;  4GXB A;  2VSZ A;  1LW3 A;  1PMS A;  4ZRJ A;  3ULB A;  4WVF B;  1U5D A;  1V5P A;  5JP4 A;  2W2X C;  4HAV B;  1W1G A;  4HAY B;  1FHW A;  1RJ2 A; 
#chains in the Genus database with same CATH homology
 4D0N B;  2GS0 A;  2W2X D;  2L2I A;  3MDB C;  3OAN A;  3VOQ A;  1DRO A;  2Q13 A;  1E5W A;  2J0J A;  2N23 A;  5DI9 B;  4DBB A;  2X18 A;  3U7D A;  3IVF A;  2FJL A;  4A6F B;  3D8D A;  1V88 A;  3QWM A;  5DHA B;  1I7A A;  2GCL A;  5JHG A;  4KAX B;  4TYZ A;  1MK7 B;  1DDV A;  2IFS A;  4K2O A;  3G9W A;  4HAX B;  1FGY A;  1ZC3 B;  1Y5O A;  2K2U A;  2Z0P A;  3LJU X;  3ODX A;  2MWN B;  1WGQ A;  1XOD A;  4KHB B;  1NTY A;  4F7H A;  4F7G A;  1K5D B;  5KQ4 A;  1W1H A;  4IFS A;  1EVH A;  2D2Q A;  3GYO A;  2LYD A;  4H8S A;  2ZPY A;  2I1K A;  2Y7B A;  1XD4 A;  1WI1 A;  1RRP B;  2DHI A;  5GOW B;  1EF1 A;  2ROV A;  3A8Q A;  5D3W A;  3TVV A;  5FI1 A;  2J0K A;  5C79 A;  5DH9 B;  1OY2 A;  2MDX A;  3KRX A;  2YS5 A;  2E2X A;  2IYB A;  3D8F A;  3SO6 A;  3KZ1 A;  5L81 A;  1J19 A;  3SUZ A;  1DDM A;  1ISN A;  2DA0 A;  1Q67 A;  3F5R A;  1P5T A;  2LOX A;  1SHC A;  4A6F A;  2YF0 A;  2V76 A;  3QBV B;  2COD A;  4NY0 A;  2R09 A;  2K2J A;  1U5E A;  1M7R A;  1U5F A;  2AL6 A;  3N7C A;  4Y94 A;  2RNR B;  4K81 A;  3NSU A;  1UNQ A;  1P3R A;  4L6E A;  4K17 A;  1U5G A;  2HE7 A;  5J3Y A;  1NTV A;  5EFX A;  3TW1 A;  3D8E A;  4ZRK A;  2EMS A;  3PVU A;  4HB3 B;  4GZU A;  2M14 A;  2Y8G A;  3SNH A;  3BIN A;  2CY4 A;  5D3X A;  2P8V A;  1I2H A;  3AU5 A;  2UVM A;  4GN1 A;  2OQB A;  1IRS A;  4IOY X;  3ZVR A;  2Z0Q A;  1UPQ A;  4IAP A;  5CLL B;  1MAI A;  2DX1 A;  5FI0 A;  4CHM A;  2J0M A;  2R0D A;  2H7D A;  3GYP A;  4HAZ B;  4YL8 A;  3FEH A;  5KQ1 A;  2G35 A;  3UZT A;  4HAT B;  3AJ4 A;  2ELA A;  4HHV A;  1X1G A;  3TO1 A;  1BAK A;  1UNR A;  1N3H A;  3SYX A;  3WYF B;  2YS1 A;  2DX5 A;  5C6R A;  5JLJ B;  4HB4 B;  3V5W A;  1KI1 B;  4PNK A;  3DXE A;  2H7E A;  3TCA A;  3HW2 B;  1MIX A;  2Y8F A;  4WJ7 A;  4TKN A;  1FAO A;  1XR0 B;  4CYE A;  4P7I A;  4HB0 B;  2DHK A;  3PZD A;  4GMX B;  3DXD A;  3PVL A;  1PLS A;  5C16 A;  1FHX A;  1P6S A;  2D9X A;  1EGX A;  3RCP A;  5LON B;  2DLW A;  4CHJ A;  3FM8 C;  3ML4 A;  1TJ6 A;  5CLQ B;  2CY5 A;  2I5F A;  1WGU A;  5HE0 A;  2MFQ A;  2ADZ A;  1OMW A;  4NSW A;  2J59 M;  2LOZ A;  1NU2 A;  1UPR A;  1J0W A;  3QIJ A;  3ODO A;  1H4R A;  1PFJ A;  2I5C A;  2DHJ A;  3ODW A;  2LG1 A;  5C5B A;  4HB2 B;  2EMT A;  4YON A;  4XWX A;  1BWN A;  1MPH A;  2RLO A;  4WSF A;  3WA0 A;  1Y19 B;  3ZDT A;  1ZM0 A;  1NI2 A;  1W1D A;  4Z2N A;  1BTN A;  1Z87 A;  1SGH A;  4KHO A;  2QKM A;  1MK9 B;  1TXD A;  2YS3 A;  1DYN A;  3MPX A;  3BJI A;  3PG7 A;  3SV1 A;  3T06 A;  2YT0 A;  2JP2 A;  1FHO A;  2DYQ A;  1GC7 A;  2K00 A;  1X1F A;  2KGX B;  4BBK A;  1U27 A;  2EC1 A;  4EMO A;  2D10 A;  2VRW B;  4B6H A;  1V89 A;  1H10 A;  2COF A;  1ZVR A;  2DKP A;  4HDQ A;  3ULC A;  4MK0 A;  1OQN A;  3F0W A;  2M38 A;  1GC6 A;  1TQZ A;  1KZ7 A;  2DN6 A;  2N0Y A;  4MT7 A;  2D11 A;  4EJN A;  5J3Q A;  4GMV A;  1XCG A;  4DX9 0;  4A6K A;  4A6H A;  2Z0O A;  3VIA A;  3A8P A;  5HE1 A;  3M1I B;  1LB1 A;  2D4Q A;  2YVC A;  2CRF A;  4Z2M B;  1QQG A;  3CIK A;  4GPT B;  2NMB A;  1UEF A;  2P0H A;  5HE3 A;  5C5B B;  2P0F A;  4HAU B;  4DX8 A;  5D3V A;  2GCJ A;  3AU4 A;  3PVW A;  2DTC A;  1AQC A;  2KUP A;  5HE2 A;  1U2B A;  1U29 A;  1XKE A;  1KZG A;  2D9V A;  5DIF B;  1MKE A;  3P6A A;  2OTX A;  2D9Y A;  5J3T A;  2UZR A;  3PEG A;  2QKL A;  2P0D A;  1X05 A;  4HAW B;  1FOE A;  1X11 A;  2LUL A;  2AEH A;  2VKI A;  2ROZ B;  5D27 A;  3KSY A;  4A5K A;  5KCV A;  2D9Z A;  2L1C A;  3PP2 A;  3CXB B;  5JHH A;  3O96 A;  1UNP A;  2ELB A;  4MY6 A;  2YRY A;  1X86 A;  1B55 A;  2D9W A;  1XX0 A;  3P7Z A;  1AWE A;  4K2P A;  1BTK A;  3X23 A;  4C0A A;  3TFM A;  3HK0 A;  1V61 A;  1FB8 A;  2DFK A;  3A98 B;  4EKU A;  4HDO A;  1WG7 A;  2GJY A;  2KCJ A;  2I1J A;  3KRW A;  1EAZ A;  2RUK B;  2W2W A;  1V5M A;  2UZS A;  2PZ1 A;  1M7E A;  1ZC4 B;  1DDW A;  4DXA B;  1FGZ A;  2HTH B;  4F7U P;  2YSZ A;  5LOP B;  2CAY A;  2RVB B;  1V5U A;  1K5G B;  3KY9 A;  2COC A;  3PSC A;  1QC6 A;  4ZRI A;  5DHF B;  1GG3 A;  1WJ1 A;  2YT1 A;  4KVG B;  2EJ8 A;  1MIZ B;  3HQC A;  4KHA A;  3U8Z A;  2XQN M;  4PQ0 A;  2COA A;  2RGN B;  1ZSQ A;  2NZ8 B;  2DKQ A;  2DYN A;  2MKR A;  5D3Y A;  3DXC A;  1WVH A;  3FSS A;  2LKO A;  1WJM A;  2BCJ A;  1DBH A;  2RSG A;  4GXB A;  2VSZ A;  1LW3 A;  1PMS A;  4ZRJ A;  3ULB A;  4WVF B;  1U5D A;  1V5P A;  5JP4 A;  2W2X C;  4HAV B;  1W1G A;  4HAY B;  1FHW A;  1RJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...