2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Docking protein 2, isoform a
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
2K00A 2YS1A 3VIAA 4F7GA 3FSSA 2BCJA 2P0FA 2KCJA 3TVVA 4HB2B 3ODOA 4IFSA 4GMVA 3SYXA 2YSZA 1WVHA 2Y8FA 1FOEA 3FEHA 2N23A 1U27A 3WYFB 1ISNA 5LONB 4HAUB 2DLWA 2I5CA 5C6RA 3FM8C 1MAIA 3F0WA 2D10A 1Y19B 1IRSA 1DDWA 4MK0A 3CXBB 1ZSQA 2LKOA 4HB4B 2ROVA 1W1GA 2QKLA 1BAKA 2YF0A 1SHCA 1AQCA 2MFQA 4YONA 4HAYB 3WA0A 1SGHA 3MPXA 3N7CA 1U5FA 4DX8A 2D9XA 1RJ2A 1J0WA 2I1KA 2RUKB 2H7DA 4K17A 1BTKA 3RCPA 2GS0A 2M38A 4PNKA 3U7DA 1X11A 2ELAA 1GC6A 2W2XD 2YT1A 4K81A 4GPTB 5FI1A 4HAVB 1MK7B 1TXDA 2Z0QA 1EVHA 2EC1A 1ZC3B 1P5TA 2EMSA 1Z87A 3OANA 3ODXA 1NI2A 3D8FA 3QBVB 1NTYA 3DXDA 2OTXA 1P3RA 2DA0A 2UZRA 1UPRA 1KZGA 1QQGA 4NY0A 4YL8A 3KZ1A 5C5BA 4KHAA 4B6HA 4HDOA 4HHVA 5CLQB 1XCGA 3KRXA 1XD4A 3IVFA 5J3QA 4F7UP 1QC6A 3ML4A 5L81A 2IFSA 2GCLA 1EGXA 1H4RA 1E5WA 1I7AA 4WSFA 4A6HA 2HTHB 2NZ8B 3HW2B 1WGUA 2VSZA 2D4QA 5GOWB 1OQNA 5HE2A 1XKEA 1OY2A 2MWNB 2Y7BA 3BJIA 4Z2MB 2W2WA 3NSUA 4EJNA 1XX0A 2I1JA 3TFMA 3V5WA 4Z2NA 4MY6A 2OQBA 2ROZB 2LYDA 3SV1A 1U5EA 2CRFA 2UVMA 2V76A 2IYBA 1DROA 5JLJB 5DHFB 2COAA 3PG7A 4ZRIA 1V5PA 2ELBA 2ZPYA 2YS5A 4HAXB 4KHBB 3ULCA 4GMXB 2RGNB 1DDMA 2CODA 2R0DA 3A98B 2DTCA 2NMBA 5JHHA 4HAZB 3PEGA 2DKQA 1W1DA 1PLSA 3QWMA 1X05A 1FHWA 3CIKA 4CHJA 4A6FA 1FGZA 2M14A 3LJUX 4TKNA 5D3XA 5D3VA 5C79A 1U29A 2MDXA 4K2PA 2N0YA 2FJLA 5D3YA 4K2OA 4ZRJA 4H8SA 1WI1A 4IOYX 3KRWA 1MIZB 3ZVRA 2R09A 1TQZA 1V89A 5C5BB 2DYQA 3HK0A 5HE1A 5HE0A 1RRPB 3KSYA 2LOZA 4HAWB 1X86A 3GYOA 1M7RA 3MDBC 4NSWA 2YS3A 4TYZA 3PVLA 4KVGB 1GG3A 2GCJA 2D9WA 3ODWA 1UPQA 1U2BA 4A6KA 2ADZA 1EF1A 2AEHA 3PZDA 1WJ1A 2YVCA 2AL6A 1LB1A 4C0AA 2UZSA 3O96A 2LULA 2CY5A 2DX5A 1DBHA 5JP4A 4DXAB 1BTNA 3TCAA 3AU4A 5FI0A 2DN6A 3G9WA 2LG1A 1Y5OA 1ZVRA 1N3HA 5KQ4A 4HDQA 2D9ZA 3A8PA 2KGXB 1WGQA 2RSGA 1KI1B 1TJ6A 1V5MA 1FB8A 1K5DB 2P0DA 1XR0B 5D27A 3D8DA 2VKIA 2EMTA 2DKPA 3BINA 1FHXA 2D2QA 1U5GA 2RVBB 1FGYA 3TW1A 3U8ZA 2DX1A 5DH9B 5J3YA 1V5UA 1V88A 1M7EA 2YT0A 1AWEA 2P8VA 5KCVA 4GN1A 2H7EA 5D3WA 1P6SA 2CAYA 5CLLB 2K2JA 1ZC4B 3UZTA 1UNQA 4HATB 1K5GB 4EMOA 1NU2A 2J59M 1GC7A 5KQ1A 4WJ7A 1W1HA 3HQCA 4L6EA 1OMWA 4CYEA 2E2XA 1XODA 1PFJA 1X1FA 1KZ7A 1MIXA 4F7HA 3KY9A 2D9YA 3ULBA 1WJMA 2D11A 3PP2A 5DI9B 1FHOA 3QIJA 4WVFB 4A5KA 4DX90 1WG7A 2D9VA 2LOXA 3GYPA 4XWXA 4KAXB 5J3TA 2K2UA 1V61A 2Z0PA 2DHJA 3M1IB 3PSCA 3DXCA 1FAOA 3DXEA 2QKMA 4DBBA 1MK9B 3VOQA 1MPHA 4ZRKA 3SUZA 2DHKA 1DYNA 2MKRA 1ZM0A 4PQ0A 5EFXA 2KUPA 1EAZA 3P7ZA 5DHAB 1BWNA 4Y94A 2Z0OA 2L1CA 3AJ4A 2XQNM 3X23A 3ZDTA 3PVWA 4GXBA 2W2XC 4BBKA 4HB0B 4EKUA 2Y8GA 2L2IA 5DIFB 4KHOA 3SO6A 1I2HA 1MKEA 1UNPA 4CHMA 3TO1A 2DYNA 2JP2A 1Q67A 4D0NB 2COFA 5HE3A 1DDVA 4MT7A 1PMSA 3F5RA 1NTVA 3PVUA 4IAPA 1UNRA 2J0JA 1H10A 2COCA 3T06A 5C16A 2CY4A 1J19A 5LOPB 2DHIA 4HB3B 5JHGA 2GJYA 2Q13A 2J0MA 2RLOA 2J0KA 1X1GA 2EJ8A 2X18A 2HE7A 4A6FB 3SNHA 3A8QA 1B55A 1U5DA 4P7IA 3AU5A 3P6AA 2P0HA 2PZ1A 2RNRB 2YRYA 2G35A 2I5FA 2VRWB 4GZUA 1UEFA 1LW3A 3D8EA 2DFKA
chains in the Genus database with same CATH superfamily
2K00A 3OHMB 2YS1A 3VIAA 4F7GA 3FSSA 2K49A 2BCJA 2P0FA 3FVCA 2KCJA 4QJ3B 3TVVA 4HB2B 3ODOA 4IFSA 5I2MA 4GMVA 3SYXA 2YSZA 1WVHA 2Y8FA 1FOEA 2K8EA 3FEHA 2N23A 1U27A 3WYFB 1ISNA 5LONB 4HAUB 2DLWA 2I5CA 5C6RA 3FM8C 1MAIA 3F0WA 2D10A 1Y19B 1IRSA 1DDWA 4MK0A 3CXBB 1ZSQA 2LKOA 4HB4B 2ROVA 1W1GA 2QKLA 1BAKA 2YF0A 1SHCA 1AQCA 2MFQA 4YONA 3A58A 4HAYB 3WA0A 1SGHA 3MPXA 3N7CA 1U5FA 4DX8A 2ZKMX 2D9XA 1RJ2A 1J0WA 2I1KA 2RUKB 2H7DA 1MI1A 4K17A 4D6WA 1BTKA 3RCPA 2Z13A 2GS0A 2M38A 4PNKA 3U7DA 1X11A 2ELAA 1GC6A 2W2XD 2YT1A 4K81A 4GPTB 5FI1A 4HAVB 1MK7B 1TXDA 4OT1A 2Z0QA 1EVHA 2EC1A 2RRFA 1ZC3B 3NWFA 1P5TA 2Z59A 2EMSA 1Z87A 3OANA 3ODXA 1NI2A 3D8FA 3QBVB 1NTYA 2KIEA 3DXDA 2OTXA 1P3RA 2DA0A 2UZRA 1UPRA 3NWAA 1KZGA 1QQGA 4NY0A 4YL8A 3KZ1A 5C5BA 4KHAA 4B6HA 4HDOA 4HHVA 5CLQB 1XCGA 3KRXA 1XD4A 3IVFA 5J3QA 4F7UP 1QC6A 5M4YB 3ML4A 5L81A 2IFSA 2GCLA 1EGXA 4HSIA 1H4RA 1E5WA 2Z14A 1I7AA 4WSFA 4A6HA 2HTHB 2NZ8B 3HW2B 1T77A 1WGUA 2VSZA 2D4QA 5GOWB 1OQNA 5HE2A 1XKEA 1OY2A 2MWNB 2Y7BA 3BJIA 4Z2MB 2W2WA 3NSUA 4EJNA 1XX0A 2I1JA 3TFMA 3V5WA 4Z2NA 4MY6A 2OQBA 2KR0A 2ROZB 2LYDA 3SV1A 1U5EA 2CRFA 2UVMA 2V76A 2IYBA 1DROA 5I2SA 5JLJB 5DHFB 2COAA 3PG7A 4ZRIA 1V5PA 2ELBA 2ZPYA 2YS5A 4HAXB 4KHBB 3ULCA 4GMXB 2RGNB 1DDMA 2CODA 2R0DA 3A98B 2DTCA 2R2YA 2NMBA 5JHHA 4HAZB 3PEGA 2DKQA 1W1DA 1PLSA 3QWMA 1ZYIA 1X05A 1FHWA 3CIKA 4CHJA 4A6FA 4CSQA 1FGZA 2M14A 3LJUX 4TKNA 5D3XA 5D3VA 5C79A 1U29A 2MDXA 4K2PA 2N0YA 2FJLA 5D3YA 4K2OA 4ZRJA 4H8SA 1WI1A 4IOYX 3KRWA 1MIZB 3ZVRA 2R09A 1TQZA 1V89A 5C5BB 2DYQA 2NBVA 3HK0A 5HE1A 5HE0A 1RRPB 2YT2A 3KSYA 2LOZA 3B77A 4HAWB 1X86A 3GYOA 1M7RA 3MDBC 4NSWA 2YS3A 4TYZA 3PVLA 4KVGB 1GG3A 2GCJA 4L1RA 2D9WA 3ODWA 1UPQA 1U2BA 4KHBA 4A6KA 2ADZA 3DCXA 1EF1A 2AEHA 3PZDA 4GOUA 1WJ1A 2YVCA 4DIXA 2AL6A 1LB1A 4C0AA 2UZSA 3O96A 2FJUB 2LULA 2CY5A 2DX5A 1DBHA 5JP4A 4DXAB 1BTNA 3TCAA 3AU4A 5FI0A 2DN6A 3G9WA 2LG1A 1Y5OA 1ZVRA 1N3HA 5KQ4A 4HDQA 2D9ZA 3A8PA 3HSAA 2KGXB 1WGQA 2RSGA 1KI1B 1TJ6A 1V5MA 1FB8A 2KIGA 1K5DB 2P0DA 1XR0B 5D27A 3D8DA 2VKIA 2EMTA 2DKPA 3BINA 1FHXA 2D2QA 3U12A 1U5GA 2RVBB 1FGYA 3TW1A 3U8ZA 2DX1A 5DH9B 5J3YA 1V5UA 1V88A 1M7EA 2YT0A 1AWEA 2Z4DA 2P8VA 5KCVA 4GN1A 2H7EA 5D3WA 1P6SA 2CAYA 5CLLB 2K2JA 1ZC4B 3UZTA 1UNQA 4HATB 1K5GB 4EMOA 1NU2A 2J59M 1GC7A 3NW8A 5KQ1A 4WJ7A 1W1HA 3HQCA 4L6EA 1OMWA 4CYEA 2E2XA 1XODA 1PFJA 1X1FA 1KZ7A 1MIXA 4F7HA 5LG4B 3KY9A 2D9YA 3ULBA 1WJMA 2D11A 3PP2A 5DI9B 1FHOA 3QIJA 4WVFB 4A5KA 4DX90 1WG7A 2D9VA 2LOXA 3GYPA 2GUMA 4XWXA 4KAXB 5J3TA 2K2UA 1V61A 2Z0PA 2DHJA 3M1IB 3PSCA 3DXCA 1FAOA 3DXEA 2QKMA 4DBBA 1MK9B 3VOQA 1MPHA 4ZRKA 3SUZA 2DHKA 1DYNA 2MKRA 1ZM0A 4PQ0A 5EFXA 2KUPA 1EAZA 3P7ZA 5DHAB 1BWNA 4Y94A 2Z0OA 2L1CA 3AJ4A 2XQNM 3X23A 3ZDTA 4OSNA 3PVWA 4GXBA 4QJ5B 2W2XC 4BBKA 4HB0B 4EKUA 4GNKB 2Y8GA 2L2IA 5DIFB 3HIEA 4KHOA 3SO6A 1I2HA 1MKEA 1UNPA 4CHMA 3TO1A 2DYNA 2JP2A 1Q67A 3NWDA 4D0NB 2COFA 5HE3A 1DDVA 4MT7A 1PMSA 3F5RA 1NTVA 3PVUA 4IAPA 1UNRA 2J0JA 1H10A 2COCA 3T06A 5C16A 2CY4A 1J19A 5LOPB 2DHIA 4HB3B 4QXAB 5JHGA 2GJYA 2Q13A 2J0MA 2RLOA 2J0KA 1X1GA 2EJ8A 2X18A 2HE7A 4A6FB 3SNHA 3A8QA 1B55A 1U5DA 4P7IA 3AU5A 3P6AA 2P0HA 2PZ1A 2KUQA 5IRSA 2RNRB 2YRYA 4QJ4B 2G35A 2I5FA 2VRWB 4GZUA 1UEFA 1LW3A 3D8EA 2DFKA
chains in the Genus database with same CATH topology
2K00A 2YS1A 3VIAA 4F7GA 3FSSA 2BCJA 2P0FA 2KCJA 3TVVA 4HB2B 3ODOA 4IFSA 4GMVA 3SYXA 2YSZA 1WVHA 2Y8FA 1FOEA 3FEHA 2N23A 1U27A 3WYFB 1ISNA 5LONB 4HAUB 2DLWA 2I5CA 5C6RA 3FM8C 1MAIA 3F0WA 2D10A 1Y19B 1IRSA 1DDWA 4MK0A 3CXBB 1ZSQA 2LKOA 4HB4B 2ROVA 1W1GA 2QKLA 1BAKA 2YF0A 1SHCA 1AQCA 2MFQA 4YONA 4HAYB 3WA0A 1SGHA 3MPXA 3N7CA 1U5FA 4DX8A 2D9XA 1RJ2A 1J0WA 2I1KA 2RUKB 2H7DA 4K17A 1BTKA 3RCPA 2GS0A 2M38A 4PNKA 3U7DA 1X11A 2ELAA 1GC6A 2W2XD 2YT1A 4K81A 4GPTB 5FI1A 4HAVB 1MK7B 1TXDA 2Z0QA 1EVHA 2EC1A 1ZC3B 1P5TA 2EMSA 1Z87A 3OANA 3ODXA 1NI2A 3D8FA 3QBVB 1NTYA 3DXDA 2OTXA 1P3RA 2DA0A 2UZRA 1UPRA 1KZGA 1QQGA 4NY0A 4YL8A 3KZ1A 5C5BA 4KHAA 4B6HA 4HDOA 4HHVA 5CLQB 1XCGA 3KRXA 1XD4A 3IVFA 5J3QA 4F7UP 1QC6A 3ML4A 5L81A 2IFSA 2GCLA 1EGXA 1H4RA 1E5WA 1I7AA 4WSFA 4A6HA 2HTHB 2NZ8B 3HW2B 1WGUA 2VSZA 2D4QA 5GOWB 1OQNA 5HE2A 1XKEA 1OY2A 2MWNB 2Y7BA 3BJIA 4Z2MB 2W2WA 3NSUA 4EJNA 1XX0A 2I1JA 3TFMA 3V5WA 4Z2NA 4MY6A 2OQBA 2ROZB 2LYDA 3SV1A 1U5EA 2CRFA 2UVMA 2V76A 2IYBA 1DROA 5JLJB 5DHFB 2COAA 3PG7A 4ZRIA 1V5PA 2ELBA 2ZPYA 2YS5A 4HAXB 4KHBB 3ULCA 4GMXB 2RGNB 1DDMA 2CODA 2R0DA 3A98B 2DTCA 2NMBA 5JHHA 4HAZB 3PEGA 2DKQA 1W1DA 1PLSA 3QWMA 1X05A 1FHWA 3CIKA 4CHJA 4A6FA 1FGZA 2M14A 3LJUX 4TKNA 5D3XA 5D3VA 5C79A 1U29A 2MDXA 4K2PA 2N0YA 2FJLA 5D3YA 4K2OA 4ZRJA 4H8SA 1WI1A 4IOYX 3KRWA 1MIZB 3ZVRA 2R09A 1TQZA 1V89A 5C5BB 2DYQA 3HK0A 5HE1A 5HE0A 1RRPB 3KSYA 2LOZA 4HAWB 1X86A 3GYOA 1M7RA 3MDBC 4NSWA 2YS3A 4TYZA 3PVLA 4KVGB 1GG3A 2GCJA 2D9WA 3ODWA 1UPQA 1U2BA 4A6KA 2ADZA 1EF1A 2AEHA 3PZDA 1WJ1A 2YVCA 2AL6A 1LB1A 4C0AA 2UZSA 3O96A 2LULA 2CY5A 2DX5A 1DBHA 5JP4A 4DXAB 1BTNA 3TCAA 3AU4A 5FI0A 2DN6A 3G9WA 2LG1A 1Y5OA 1ZVRA 1N3HA 5KQ4A 4HDQA 2D9ZA 3A8PA 2KGXB 1WGQA 2RSGA 1KI1B 1TJ6A 1V5MA 1FB8A 1K5DB 2P0DA 1XR0B 5D27A 3D8DA 2VKIA 2EMTA 2DKPA 3BINA 1FHXA 2D2QA 1U5GA 2RVBB 1FGYA 3TW1A 3U8ZA 2DX1A 5DH9B 5J3YA 1V5UA 1V88A 1M7EA 2YT0A 1AWEA 2P8VA 5KCVA 4GN1A 2H7EA 5D3WA 1P6SA 2CAYA 5CLLB 2K2JA 1ZC4B 3UZTA 1UNQA 4HATB 1K5GB 4EMOA 1NU2A 2J59M 1GC7A 5KQ1A 4WJ7A 1W1HA 3HQCA 4L6EA 1OMWA 4CYEA 2E2XA 1XODA 1PFJA 1X1FA 1KZ7A 1MIXA 4F7HA 3KY9A 2D9YA 3ULBA 1WJMA 2D11A 3PP2A 5DI9B 1FHOA 3QIJA 4WVFB 4A5KA 4DX90 1WG7A 2D9VA 2LOXA 3GYPA 4XWXA 4KAXB 5J3TA 2K2UA 1V61A 2Z0PA 2DHJA 3M1IB 3PSCA 3DXCA 1FAOA 3DXEA 2QKMA 4DBBA 1MK9B 3VOQA 1MPHA 4ZRKA 3SUZA 2DHKA 1DYNA 2MKRA 1ZM0A 4PQ0A 5EFXA 2KUPA 1EAZA 3P7ZA 5DHAB 1BWNA 4Y94A 2Z0OA 2L1CA 3AJ4A 2XQNM 3X23A 3ZDTA 3PVWA 4GXBA 2W2XC 4BBKA 4HB0B 4EKUA 2Y8GA 2L2IA 5DIFB 4KHOA 3SO6A 1I2HA 1MKEA 1UNPA 4CHMA 3TO1A 2DYNA 2JP2A 1Q67A 4D0NB 2COFA 5HE3A 1DDVA 4MT7A 1PMSA 3F5RA 1NTVA 3PVUA 4IAPA 1UNRA 2J0JA 1H10A 2COCA 3T06A 5C16A 2CY4A 1J19A 5LOPB 2DHIA 4HB3B 5JHGA 2GJYA 2Q13A 2J0MA 2RLOA 2J0KA 1X1GA 2EJ8A 2X18A 2HE7A 4A6FB 3SNHA 3A8QA 1B55A 1U5DA 4P7IA 3AU5A 3P6AA 2P0HA 2PZ1A 2RNRB 2YRYA 2G35A 2I5FA 2VRWB 4GZUA 1UEFA 1LW3A 3D8EA 2DFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K00 A;  2YS1 A;  3VIA A;  4F7G A;  3FSS A;  2BCJ A;  2P0F A;  2KCJ A;  3TVV A;  4HB2 B;  3ODO A;  4IFS A;  4GMV A;  3SYX A;  2YSZ A;  1WVH A;  2Y8F A;  1FOE A;  3FEH A;  2N23 A;  1U27 A;  3WYF B;  1ISN A;  5LON B;  4HAU B;  2DLW A;  2I5C A;  5C6R A;  3FM8 C;  1MAI A;  3F0W A;  2D10 A;  1Y19 B;  1IRS A;  1DDW A;  4MK0 A;  3CXB B;  1ZSQ A;  2LKO A;  4HB4 B;  2ROV A;  1W1G A;  2QKL A;  1BAK A;  2YF0 A;  1SHC A;  1AQC A;  2MFQ A;  4YON A;  4HAY B;  3WA0 A;  1SGH A;  3MPX A;  3N7C A;  1U5F A;  4DX8 A;  2D9X A;  1RJ2 A;  1J0W A;  2I1K A;  2RUK B;  2H7D A;  4K17 A;  1BTK A;  3RCP A;  2GS0 A;  2M38 A;  4PNK A;  3U7D A;  1X11 A;  2ELA A;  1GC6 A;  2W2X D;  2YT1 A;  4K81 A;  4GPT B;  5FI1 A;  4HAV B;  1MK7 B;  1TXD A;  2Z0Q A;  1EVH A;  2EC1 A;  1ZC3 B;  1P5T A;  2EMS A;  1Z87 A;  3OAN A;  3ODX A;  1NI2 A;  3D8F A;  3QBV B;  1NTY A;  3DXD A;  2OTX A;  1P3R A;  2DA0 A;  2UZR A;  1UPR A;  1KZG A;  1QQG A;  4NY0 A;  4YL8 A;  3KZ1 A;  5C5B A;  4KHA A;  4B6H A;  4HDO A;  4HHV A;  5CLQ B;  1XCG A;  3KRX A;  1XD4 A;  3IVF A;  5J3Q A;  4F7U P;  1QC6 A;  3ML4 A;  5L81 A;  2IFS A;  2GCL A;  1EGX A;  1H4R A;  1E5W A;  1I7A A;  4WSF A;  4A6H A;  2HTH B;  2NZ8 B;  3HW2 B;  1WGU A;  2VSZ A;  2D4Q A;  5GOW B;  1OQN A;  5HE2 A;  1XKE A;  1OY2 A;  2MWN B;  2Y7B A;  3BJI A;  4Z2M B;  2W2W A;  3NSU A;  4EJN A;  1XX0 A;  2I1J A;  3TFM A;  3V5W A;  4Z2N A;  4MY6 A;  2OQB A;  2ROZ B;  2LYD A;  3SV1 A;  1U5E A;  2CRF A;  2UVM A;  2V76 A;  2IYB A;  1DRO A;  5JLJ B;  5DHF B;  2COA A;  3PG7 A;  4ZRI A;  1V5P A;  2ELB A;  2ZPY A;  2YS5 A;  4HAX B;  4KHB B;  3ULC A;  4GMX B;  2RGN B;  1DDM A;  2COD A;  2R0D A;  3A98 B;  2DTC A;  2NMB A;  5JHH A;  4HAZ B;  3PEG A;  2DKQ A;  1W1D A;  1PLS A;  3QWM A;  1X05 A;  1FHW A;  3CIK A;  4CHJ A;  4A6F A;  1FGZ A;  2M14 A;  3LJU X;  4TKN A;  5D3X A;  5D3V A;  5C79 A;  1U29 A;  2MDX A;  4K2P A;  2N0Y A;  2FJL A;  5D3Y A;  4K2O A;  4ZRJ A;  4H8S A;  1WI1 A;  4IOY X;  3KRW A;  1MIZ B;  3ZVR A;  2R09 A;  1TQZ A;  1V89 A;  5C5B B;  2DYQ A;  3HK0 A;  5HE1 A;  5HE0 A;  1RRP B;  3KSY A;  2LOZ A;  4HAW B;  1X86 A;  3GYO A;  1M7R A;  3MDB C;  4NSW A;  2YS3 A;  4TYZ A;  3PVL A;  4KVG B;  1GG3 A;  2GCJ A;  2D9W A;  3ODW A;  1UPQ A;  1U2B A;  4A6K A;  2ADZ A;  1EF1 A;  2AEH A;  3PZD A;  1WJ1 A;  2YVC A;  2AL6 A;  1LB1 A;  4C0A A;  2UZS A;  3O96 A;  2LUL A;  2CY5 A;  2DX5 A;  1DBH A;  5JP4 A;  4DXA B;  1BTN A;  3TCA A;  3AU4 A;  5FI0 A;  2DN6 A;  3G9W A;  2LG1 A;  1Y5O A;  1ZVR A;  1N3H A;  5KQ4 A;  4HDQ A;  2D9Z A;  3A8P A;  2KGX B;  1WGQ A;  2RSG A;  1KI1 B;  1TJ6 A;  1V5M A;  1FB8 A;  1K5D B;  2P0D A;  1XR0 B;  5D27 A;  3D8D A;  2VKI A;  2EMT A;  2DKP A;  3BIN A;  1FHX A;  2D2Q A;  1U5G A;  2RVB B;  1FGY A;  3TW1 A;  3U8Z A;  2DX1 A;  5DH9 B;  5J3Y A;  1V5U A;  1V88 A;  1M7E A;  2YT0 A;  1AWE A;  2P8V A;  5KCV A;  4GN1 A;  2H7E A;  5D3W A;  1P6S A;  2CAY A;  5CLL B;  2K2J A;  1ZC4 B;  3UZT A;  1UNQ A;  4HAT B;  1K5G B;  4EMO A;  1NU2 A;  2J59 M;  1GC7 A;  5KQ1 A;  4WJ7 A;  1W1H A;  3HQC A;  4L6E A;  1OMW A;  4CYE A;  2E2X A;  1XOD A;  1PFJ A;  1X1F A;  1KZ7 A;  1MIX A;  4F7H A;  3KY9 A;  2D9Y A;  3ULB A;  1WJM A;  2D11 A;  3PP2 A;  5DI9 B;  1FHO A;  3QIJ A;  4WVF B;  4A5K A;  4DX9 0;  1WG7 A;  2D9V A;  2LOX A;  3GYP A;  4XWX A;  4KAX B;  5J3T A;  2K2U A;  1V61 A;  2Z0P A;  2DHJ A;  3M1I B;  3PSC A;  3DXC A;  1FAO A;  3DXE A;  2QKM A;  4DBB A;  1MK9 B;  3VOQ A;  1MPH A;  4ZRK A;  3SUZ A;  2DHK A;  1DYN A;  2MKR A;  1ZM0 A;  4PQ0 A;  5EFX A;  2KUP A;  1EAZ A;  3P7Z A;  5DHA B;  1BWN A;  4Y94 A;  2Z0O A;  2L1C A;  3AJ4 A;  2XQN M;  3X23 A;  3ZDT A;  3PVW A;  4GXB A;  2W2X C;  4BBK A;  4HB0 B;  4EKU A;  2Y8G A;  2L2I A;  5DIF B;  4KHO A;  3SO6 A;  1I2H A;  1MKE A;  1UNP A;  4CHM A;  3TO1 A;  2DYN A;  2JP2 A;  1Q67 A;  4D0N B;  2COF A;  5HE3 A;  1DDV A;  4MT7 A;  1PMS A;  3F5R A;  1NTV A;  3PVU A;  4IAP A;  1UNR A;  2J0J A;  1H10 A;  2COC A;  3T06 A;  5C16 A;  2CY4 A;  1J19 A;  5LOP B;  2DHI A;  4HB3 B;  5JHG A;  2GJY A;  2Q13 A;  2J0M A;  2RLO A;  2J0K A;  1X1G A;  2EJ8 A;  2X18 A;  2HE7 A;  4A6F B;  3SNH A;  3A8Q A;  1B55 A;  1U5D A;  4P7I A;  3AU5 A;  3P6A A;  2P0H A;  2PZ1 A;  2RNR B;  2YRY A;  2G35 A;  2I5F A;  2VRW B;  4GZU A;  1UEF A;  1LW3 A;  3D8E A;  2DFK A; 
#chains in the Genus database with same CATH topology
 2K00 A;  3OHM B;  2YS1 A;  3VIA A;  4F7G A;  3FSS A;  2K49 A;  2BCJ A;  2P0F A;  3FVC A;  2KCJ A;  4QJ3 B;  3TVV A;  4HB2 B;  3ODO A;  4IFS A;  5I2M A;  4GMV A;  3SYX A;  2YSZ A;  1WVH A;  2Y8F A;  1FOE A;  2K8E A;  3FEH A;  2N23 A;  1U27 A;  3WYF B;  1ISN A;  5LON B;  4HAU B;  2DLW A;  2I5C A;  5C6R A;  3FM8 C;  1MAI A;  3F0W A;  2D10 A;  1Y19 B;  1IRS A;  1DDW A;  4MK0 A;  3CXB B;  1ZSQ A;  2LKO A;  4HB4 B;  2ROV A;  1W1G A;  2QKL A;  1BAK A;  2YF0 A;  1SHC A;  1AQC A;  2MFQ A;  4YON A;  3A58 A;  4HAY B;  3WA0 A;  1SGH A;  3MPX A;  3N7C A;  1U5F A;  4DX8 A;  2ZKM X;  2D9X A;  1RJ2 A;  1J0W A;  2I1K A;  2RUK B;  2H7D A;  1MI1 A;  4K17 A;  4D6W A;  1BTK A;  3RCP A;  2Z13 A;  2GS0 A;  2M38 A;  4PNK A;  3U7D A;  1X11 A;  2ELA A;  1GC6 A;  2W2X D;  2YT1 A;  4K81 A;  4GPT B;  5FI1 A;  4HAV B;  1MK7 B;  1TXD A;  4OT1 A;  2Z0Q A;  1EVH A;  2EC1 A;  2RRF A;  1ZC3 B;  3NWF A;  1P5T A;  2Z59 A;  2EMS A;  1Z87 A;  3OAN A;  3ODX A;  1NI2 A;  3D8F A;  3QBV B;  1NTY A;  2KIE A;  3DXD A;  2OTX A;  1P3R A;  2DA0 A;  2UZR A;  1UPR A;  3NWA A;  1KZG A;  1QQG A;  4NY0 A;  4YL8 A;  3KZ1 A;  5C5B A;  4KHA A;  4B6H A;  4HDO A;  4HHV A;  5CLQ B;  1XCG A;  3KRX A;  1XD4 A;  3IVF A;  5J3Q A;  4F7U P;  1QC6 A;  5M4Y B;  3ML4 A;  5L81 A;  2IFS A;  2GCL A;  1EGX A;  4HSI A;  1H4R A;  1E5W A;  2Z14 A;  1I7A A;  4WSF A;  4A6H A;  2HTH B;  2NZ8 B;  3HW2 B;  1T77 A;  1WGU A;  2VSZ A;  2D4Q A;  5GOW B;  1OQN A;  5HE2 A;  1XKE A;  1OY2 A;  2MWN B;  2Y7B A;  3BJI A;  4Z2M B;  2W2W A;  3NSU A;  4EJN A;  1XX0 A;  2I1J A;  3TFM A;  3V5W A;  4Z2N A;  4MY6 A;  2OQB A;  2KR0 A;  2ROZ B;  2LYD A;  3SV1 A;  1U5E A;  2CRF A;  2UVM A;  2V76 A;  2IYB A;  1DRO A;  5I2S A;  5JLJ B;  5DHF B;  2COA A;  3PG7 A;  4ZRI A;  1V5P A;  2ELB A;  2ZPY A;  2YS5 A;  4HAX B;  4KHB B;  3ULC A;  4GMX B;  2RGN B;  1DDM A;  2COD A;  2R0D A;  3A98 B;  2DTC A;  2R2Y A;  2NMB A;  5JHH A;  4HAZ B;  3PEG A;  2DKQ A;  1W1D A;  1PLS A;  3QWM A;  1ZYI A;  1X05 A;  1FHW A;  3CIK A;  4CHJ A;  4A6F A;  4CSQ A;  1FGZ A;  2M14 A;  3LJU X;  4TKN A;  5D3X A;  5D3V A;  5C79 A;  1U29 A;  2MDX A;  4K2P A;  2N0Y A;  2FJL A;  5D3Y A;  4K2O A;  4ZRJ A;  4H8S A;  1WI1 A;  4IOY X;  3KRW A;  1MIZ B;  3ZVR A;  2R09 A;  1TQZ A;  1V89 A;  5C5B B;  2DYQ A;  2NBV A;  3HK0 A;  5HE1 A;  5HE0 A;  1RRP B;  2YT2 A;  3KSY A;  2LOZ A;  3B77 A;  4HAW B;  1X86 A;  3GYO A;  1M7R A;  3MDB C;  4NSW A;  2YS3 A;  4TYZ A;  3PVL A;  4KVG B;  1GG3 A;  2GCJ A;  4L1R A;  2D9W A;  3ODW A;  1UPQ A;  1U2B A;  4KHB A;  4A6K A;  2ADZ A;  3DCX A;  1EF1 A;  2AEH A;  3PZD A;  4GOU A;  1WJ1 A;  2YVC A;  4DIX A;  2AL6 A;  1LB1 A;  4C0A A;  2UZS A;  3O96 A;  2FJU B;  2LUL A;  2CY5 A;  2DX5 A;  1DBH A;  5JP4 A;  4DXA B;  1BTN A;  3TCA A;  3AU4 A;  5FI0 A;  2DN6 A;  3G9W A;  2LG1 A;  1Y5O A;  1ZVR A;  1N3H A;  5KQ4 A;  4HDQ A;  2D9Z A;  3A8P A;  3HSA A;  2KGX B;  1WGQ A;  2RSG A;  1KI1 B;  1TJ6 A;  1V5M A;  1FB8 A;  2KIG A;  1K5D B;  2P0D A;  1XR0 B;  5D27 A;  3D8D A;  2VKI A;  2EMT A;  2DKP A;  3BIN A;  1FHX A;  2D2Q A;  3U12 A;  1U5G A;  2RVB B;  1FGY A;  3TW1 A;  3U8Z A;  2DX1 A;  5DH9 B;  5J3Y A;  1V5U A;  1V88 A;  1M7E A;  2YT0 A;  1AWE A;  2Z4D A;  2P8V A;  5KCV A;  4GN1 A;  2H7E A;  5D3W A;  1P6S A;  2CAY A;  5CLL B;  2K2J A;  1ZC4 B;  3UZT A;  1UNQ A;  4HAT B;  1K5G B;  4EMO A;  1NU2 A;  2J59 M;  1GC7 A;  3NW8 A;  5KQ1 A;  4WJ7 A;  1W1H A;  3HQC A;  4L6E A;  1OMW A;  4CYE A;  2E2X A;  1XOD A;  1PFJ A;  1X1F A;  1KZ7 A;  1MIX A;  4F7H A;  5LG4 B;  3KY9 A;  2D9Y A;  3ULB A;  1WJM A;  2D11 A;  3PP2 A;  5DI9 B;  1FHO A;  3QIJ A;  4WVF B;  4A5K A;  4DX9 0;  1WG7 A;  2D9V A;  2LOX A;  3GYP A;  2GUM A;  4XWX A;  4KAX B;  5J3T A;  2K2U A;  1V61 A;  2Z0P A;  2DHJ A;  3M1I B;  3PSC A;  3DXC A;  1FAO A;  3DXE A;  2QKM A;  4DBB A;  1MK9 B;  3VOQ A;  1MPH A;  4ZRK A;  3SUZ A;  2DHK A;  1DYN A;  2MKR A;  1ZM0 A;  4PQ0 A;  5EFX A;  2KUP A;  1EAZ A;  3P7Z A;  5DHA B;  1BWN A;  4Y94 A;  2Z0O A;  2L1C A;  3AJ4 A;  2XQN M;  3X23 A;  3ZDT A;  4OSN A;  3PVW A;  4GXB A;  4QJ5 B;  2W2X C;  4BBK A;  4HB0 B;  4EKU A;  4GNK B;  2Y8G A;  2L2I A;  5DIF B;  3HIE A;  4KHO A;  3SO6 A;  1I2H A;  1MKE A;  1UNP A;  4CHM A;  3TO1 A;  2DYN A;  2JP2 A;  1Q67 A;  3NWD A;  4D0N B;  2COF A;  5HE3 A;  1DDV A;  4MT7 A;  1PMS A;  3F5R A;  1NTV A;  3PVU A;  4IAP A;  1UNR A;  2J0J A;  1H10 A;  2COC A;  3T06 A;  5C16 A;  2CY4 A;  1J19 A;  5LOP B;  2DHI A;  4HB3 B;  4QXA B;  5JHG A;  2GJY A;  2Q13 A;  2J0M A;  2RLO A;  2J0K A;  1X1G A;  2EJ8 A;  2X18 A;  2HE7 A;  4A6F B;  3SNH A;  3A8Q A;  1B55 A;  1U5D A;  4P7I A;  3AU5 A;  3P6A A;  2P0H A;  2PZ1 A;  2KUQ A;  5IRS A;  2RNR B;  2YRY A;  4QJ4 B;  2G35 A;  2I5F A;  2VRW B;  4GZU A;  1UEF A;  1LW3 A;  3D8E A;  2DFK A; 
#chains in the Genus database with same CATH homology
 2K00 A;  2YS1 A;  3VIA A;  4F7G A;  3FSS A;  2BCJ A;  2P0F A;  2KCJ A;  3TVV A;  4HB2 B;  3ODO A;  4IFS A;  4GMV A;  3SYX A;  2YSZ A;  1WVH A;  2Y8F A;  1FOE A;  3FEH A;  2N23 A;  1U27 A;  3WYF B;  1ISN A;  5LON B;  4HAU B;  2DLW A;  2I5C A;  5C6R A;  3FM8 C;  1MAI A;  3F0W A;  2D10 A;  1Y19 B;  1IRS A;  1DDW A;  4MK0 A;  3CXB B;  1ZSQ A;  2LKO A;  4HB4 B;  2ROV A;  1W1G A;  2QKL A;  1BAK A;  2YF0 A;  1SHC A;  1AQC A;  2MFQ A;  4YON A;  4HAY B;  3WA0 A;  1SGH A;  3MPX A;  3N7C A;  1U5F A;  4DX8 A;  2D9X A;  1RJ2 A;  1J0W A;  2I1K A;  2RUK B;  2H7D A;  4K17 A;  1BTK A;  3RCP A;  2GS0 A;  2M38 A;  4PNK A;  3U7D A;  1X11 A;  2ELA A;  1GC6 A;  2W2X D;  2YT1 A;  4K81 A;  4GPT B;  5FI1 A;  4HAV B;  1MK7 B;  1TXD A;  2Z0Q A;  1EVH A;  2EC1 A;  1ZC3 B;  1P5T A;  2EMS A;  1Z87 A;  3OAN A;  3ODX A;  1NI2 A;  3D8F A;  3QBV B;  1NTY A;  3DXD A;  2OTX A;  1P3R A;  2DA0 A;  2UZR A;  1UPR A;  1KZG A;  1QQG A;  4NY0 A;  4YL8 A;  3KZ1 A;  5C5B A;  4KHA A;  4B6H A;  4HDO A;  4HHV A;  5CLQ B;  1XCG A;  3KRX A;  1XD4 A;  3IVF A;  5J3Q A;  4F7U P;  1QC6 A;  3ML4 A;  5L81 A;  2IFS A;  2GCL A;  1EGX A;  1H4R A;  1E5W A;  1I7A A;  4WSF A;  4A6H A;  2HTH B;  2NZ8 B;  3HW2 B;  1WGU A;  2VSZ A;  2D4Q A;  5GOW B;  1OQN A;  5HE2 A;  1XKE A;  1OY2 A;  2MWN B;  2Y7B A;  3BJI A;  4Z2M B;  2W2W A;  3NSU A;  4EJN A;  1XX0 A;  2I1J A;  3TFM A;  3V5W A;  4Z2N A;  4MY6 A;  2OQB A;  2ROZ B;  2LYD A;  3SV1 A;  1U5E A;  2CRF A;  2UVM A;  2V76 A;  2IYB A;  1DRO A;  5JLJ B;  5DHF B;  2COA A;  3PG7 A;  4ZRI A;  1V5P A;  2ELB A;  2ZPY A;  2YS5 A;  4HAX B;  4KHB B;  3ULC A;  4GMX B;  2RGN B;  1DDM A;  2COD A;  2R0D A;  3A98 B;  2DTC A;  2NMB A;  5JHH A;  4HAZ B;  3PEG A;  2DKQ A;  1W1D A;  1PLS A;  3QWM A;  1X05 A;  1FHW A;  3CIK A;  4CHJ A;  4A6F A;  1FGZ A;  2M14 A;  3LJU X;  4TKN A;  5D3X A;  5D3V A;  5C79 A;  1U29 A;  2MDX A;  4K2P A;  2N0Y A;  2FJL A;  5D3Y A;  4K2O A;  4ZRJ A;  4H8S A;  1WI1 A;  4IOY X;  3KRW A;  1MIZ B;  3ZVR A;  2R09 A;  1TQZ A;  1V89 A;  5C5B B;  2DYQ A;  3HK0 A;  5HE1 A;  5HE0 A;  1RRP B;  3KSY A;  2LOZ A;  4HAW B;  1X86 A;  3GYO A;  1M7R A;  3MDB C;  4NSW A;  2YS3 A;  4TYZ A;  3PVL A;  4KVG B;  1GG3 A;  2GCJ A;  2D9W A;  3ODW A;  1UPQ A;  1U2B A;  4A6K A;  2ADZ A;  1EF1 A;  2AEH A;  3PZD A;  1WJ1 A;  2YVC A;  2AL6 A;  1LB1 A;  4C0A A;  2UZS A;  3O96 A;  2LUL A;  2CY5 A;  2DX5 A;  1DBH A;  5JP4 A;  4DXA B;  1BTN A;  3TCA A;  3AU4 A;  5FI0 A;  2DN6 A;  3G9W A;  2LG1 A;  1Y5O A;  1ZVR A;  1N3H A;  5KQ4 A;  4HDQ A;  2D9Z A;  3A8P A;  2KGX B;  1WGQ A;  2RSG A;  1KI1 B;  1TJ6 A;  1V5M A;  1FB8 A;  1K5D B;  2P0D A;  1XR0 B;  5D27 A;  3D8D A;  2VKI A;  2EMT A;  2DKP A;  3BIN A;  1FHX A;  2D2Q A;  1U5G A;  2RVB B;  1FGY A;  3TW1 A;  3U8Z A;  2DX1 A;  5DH9 B;  5J3Y A;  1V5U A;  1V88 A;  1M7E A;  2YT0 A;  1AWE A;  2P8V A;  5KCV A;  4GN1 A;  2H7E A;  5D3W A;  1P6S A;  2CAY A;  5CLL B;  2K2J A;  1ZC4 B;  3UZT A;  1UNQ A;  4HAT B;  1K5G B;  4EMO A;  1NU2 A;  2J59 M;  1GC7 A;  5KQ1 A;  4WJ7 A;  1W1H A;  3HQC A;  4L6E A;  1OMW A;  4CYE A;  2E2X A;  1XOD A;  1PFJ A;  1X1F A;  1KZ7 A;  1MIX A;  4F7H A;  3KY9 A;  2D9Y A;  3ULB A;  1WJM A;  2D11 A;  3PP2 A;  5DI9 B;  1FHO A;  3QIJ A;  4WVF B;  4A5K A;  4DX9 0;  1WG7 A;  2D9V A;  2LOX A;  3GYP A;  4XWX A;  4KAX B;  5J3T A;  2K2U A;  1V61 A;  2Z0P A;  2DHJ A;  3M1I B;  3PSC A;  3DXC A;  1FAO A;  3DXE A;  2QKM A;  4DBB A;  1MK9 B;  3VOQ A;  1MPH A;  4ZRK A;  3SUZ A;  2DHK A;  1DYN A;  2MKR A;  1ZM0 A;  4PQ0 A;  5EFX A;  2KUP A;  1EAZ A;  3P7Z A;  5DHA B;  1BWN A;  4Y94 A;  2Z0O A;  2L1C A;  3AJ4 A;  2XQN M;  3X23 A;  3ZDT A;  3PVW A;  4GXB A;  2W2X C;  4BBK A;  4HB0 B;  4EKU A;  2Y8G A;  2L2I A;  5DIF B;  4KHO A;  3SO6 A;  1I2H A;  1MKE A;  1UNP A;  4CHM A;  3TO1 A;  2DYN A;  2JP2 A;  1Q67 A;  4D0N B;  2COF A;  5HE3 A;  1DDV A;  4MT7 A;  1PMS A;  3F5R A;  1NTV A;  3PVU A;  4IAP A;  1UNR A;  2J0J A;  1H10 A;  2COC A;  3T06 A;  5C16 A;  2CY4 A;  1J19 A;  5LOP B;  2DHI A;  4HB3 B;  5JHG A;  2GJY A;  2Q13 A;  2J0M A;  2RLO A;  2J0K A;  1X1G A;  2EJ8 A;  2X18 A;  2HE7 A;  4A6F B;  3SNH A;  3A8Q A;  1B55 A;  1U5D A;  4P7I A;  3AU5 A;  3P6A A;  2P0H A;  2PZ1 A;  2RNR B;  2YRY A;  2G35 A;  2I5F A;  2VRW B;  4GZU A;  1UEF A;  1LW3 A;  3D8E A;  2DFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...