2DLWA

Solution structure of the irs domain of human docking protein 2, isoform a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 2, isoform a
publication title Solution structure of the IRS domain of human docking protein 2, isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dlwA00
1V61A 1MIXA 2Z0OA 4XWXA 2D11A 2D9XA 1H10A 4CHJA 2DYQA 1XR0B 4F7HA 1ZVRA 5C16A 2QKMA 5DI9B 4GZUA 5KCVA 2AL6A 2D9ZA 3FSSA 1BTNA 4NY0A 2YS1A 2I1KA 4HATB 2YT0A 3F0WA 1MK7B 2GS0A 4EJNA 2UVMA 1X11A 4HDOA 3DXEA 2RUKB 2LKOA 3QWMA 5DHFB 2KCJA 1FAOA 1U5FA 3QBVB 3ML4A 2I5FA 1MK9B 1DDWA 1TQZA 5D27A 4F7UP 2K2JA 1M7RA 5FI1A 2H7EA 4HAZB 3P6AA 4WJ7A 5DIFB 3CXBB 4HDQA 1V88A 1Q67A 2DFKA 2COAA 5DHAB 2P0HA 4WSFA 5C5BA 3SO6A 1IRSA 2MKRA 2DX1A 3D8FA 3SV1A 4F7GA 5JHHA 3PZDA 1I2HA 3VIAA 1FB8A 4HB0B 1GC7A 5HE3A 1XCGA 2DLWA 4D0NB 3PVUA 2R0DA 3PEGA 4PQ0A 3IVFA 3DXDA 5J3TA 3NSUA 4HAUB 4KAXB 5GOWB 1KI1B 4DXAB 4A6HA 3KZ1A 2VKIA 2Y7BA 2EMSA 1I7AA 3QIJA 3D8EA 3OANA 4HB4B 4YONA 1K5DB 3UZTA 1XD4A 2RGNB 2NMBA 2W2WA 1NU2A 1WGQA 1LW3A 4DX90 3KRXA 1WJ1A 4MT7A 4DX8A 2FJLA 2G35A 3KSYA 4TYZA 3SUZA 2E2XA 2EMTA 4GMVA 2J0KA 3ULCA 4WVFB 2CODA 1FOEA 4IAPA 2X18A 1W1DA 2EJ8A 1ZC4B 2N23A 3U7DA 2HTHB 1FGYA 5FI0A 1KZ7A 2DN6A 4BBKA 1TJ6A 4PNKA 3TO1A 5C79A 2NZ8B 2P8VA 4P7IA 3WA0A 3MPXA 2AEHA 5HE0A 4K81A 3A8PA 1K5GB 4GN1A 2P0DA 3ZVRA 2IYBA 4ZRKA 2YRYA 2DA0A 5DH9B 1U27A 1AQCA 1UEFA 1P6SA 1V5MA 4KHAA 3BINA 1DBHA 2YF0A 3F5RA 3CIKA 2COFA 2LULA 2J0MA 2CAYA 2IFSA 3DXCA 4B6HA 2GCJA 2GCLA 2QKLA 1X1GA 2ADZA 1FHWA 2LOXA 3T06A 1GC6A 4HB3B 3U8ZA 2OQBA 4A5KA 1U2BA 2YVCA 2ZPYA 2UZSA 1EVHA 2H7DA 1FGZA 4GMXB 2RSGA 2W2XC 1PFJA 2ELBA 2LYDA 2UZRA 3AJ4A 1UPQA 1H4RA 2RLOA 1MAIA 4IOYX 2HE7A 1X86A 1DDVA 1Z87A 1U5EA 2DHJA 2J59M 4KHOA 4KVGB 2CY5A 1OQNA 2DYNA 3N7CA 1XX0A 3G9WA 3TW1A 1W1HA 3GYPA 3PSCA 1Y5OA 5HE1A 2K00A 1E5WA 1J0WA 2N0YA 5KQ4A 2LG1A 2M14A 1WI1A 3A98B 1EGXA 1U5DA 3ODOA 2Z0QA 1GG3A 3WYFB 2MDXA 2OTXA 5D3YA 3AU5A 1ISNA 1XODA 1DYNA 3LJUX 3KRWA 1NTVA 3TVVA 3SYXA 2LOZA 1EAZA 3O96A 2EC1A 4A6FB 1B55A 3MDBC 5HE2A 2RVBB 2Y8GA 5KQ1A 4CYEA 4HB2B 1FHOA 5JP4A 1U5GA 5D3VA 2YSZA 1BWNA 1NI2A 4K2OA 2V76A 4HHVA 2KUPA 1PLSA 1V5UA 5JLJB 1DDMA 2VRWB 1TXDA 2M38A 3ODWA 4Y94A 1P5TA 2YT1A 2D4QA 2XQNM 4Z2MB 4NSWA 4MY6A 1QC6A 2DX5A 2R09A 4L6EA 2DHIA 4MK0A 2CRFA 4TKNA 1MIZB 1AWEA 5D3XA 3X23A 4YL8A 3TFMA 1FHXA 3PVLA 1UPRA 2L1CA 2COCA 5L81A 2ROVA 1V5PA 4H8SA 2GJYA 2DTCA 2Z0PA 4KHBB 5LOPB 2DKPA 1OY2A 4HAXB 4K2PA 1ZSQA 1X05A 4C0AA 1BAKA 4EMOA 1WGUA 1Y19B 5LONB 1RJ2A 1SGHA 4GXBA 3ZDTA 4K17A 1UNRA 2YS5A 1MPHA 2D10A 2PZ1A 2DHKA 3SNHA 4GPTB 1ZM0A 1KZGA 2YS3A 5J3YA 3A8QA 3VOQA 2W2XD 3M1IB 3TCAA 3ULBA 5CLLB 3PG7A 4A6KA 2MFQA 1U29A 2JP2A 1UNPA 2BCJA 3D8DA 3PVWA 4HAYB 3HQCA 5C5BB 4CHMA 2DKQA 4HAVB 2D9YA 1BTKA 4EKUA 2D9VA 1PMSA 1LB1A 4ZRIA 3ODXA 5D3WA 1M7EA 1UNQA 3PP2A 2J0JA 2Q13A 2D2QA 3HK0A 1V89A 4DBBA 2ELAA 2ROZB 4IFSA 2CY4A 1XKEA 1ZC3B 1P3RA 1OMWA 1EF1A 2VSZA 1RRPB 5C6RA 2P0FA 3KY9A 2Y8FA 4A6FA 5J3QA 2RNRB 2KGXB 3BJIA 3AU4A 2I5CA 1MKEA 1WJMA 2I1JA 1WG7A 3GYOA 3V5WA 3FM8C 2L2IA 4Z2NA 3P7ZA 5JHGA 1J19A 5EFXA 1DROA 1WVHA 2D9WA 3HW2B 4ZRJA 4HAWB 1N3HA 1NTYA 3RCPA 1W1GA 5CLQB 2K2UA 1QQGA 1SHCA 2MWNB 3FEHA 1X1FA
chains in the Genus database with same CATH superfamily
1V61A 1MIXA 2Z0OA 4XWXA 2D11A 2D9XA 2K49A 1H10A 4CHJA 2DYQA 1XR0B 4F7HA 1ZVRA 5C16A 2QKMA 5DI9B 4GZUA 5KCVA 2AL6A 2D9ZA 3FSSA 1BTNA 4NY0A 2YS1A 2I1KA 4HATB 4CSQA 2YT0A 3F0WA 4KHBA 1MK7B 2GS0A 4EJNA 2UVMA 1X11A 4GOUA 4HDOA 3DXEA 2RUKB 2LKOA 3QWMA 5DHFB 2KCJA 1FAOA 1U5FA 4OT1A 3QBVB 3ML4A 2I5FA 1MK9B 1DDWA 3HIEA 1TQZA 5D27A 4F7UP 2K2JA 1M7RA 5FI1A 2H7EA 4HAZB 3P6AA 4WJ7A 5DIFB 2KR0A 3CXBB 2R2YA 4HDQA 1V88A 1Q67A 2DFKA 2COAA 4QJ5B 5DHAB 2P0HA 4WSFA 5C5BA 3SO6A 1IRSA 2MKRA 2DX1A 3D8FA 3SV1A 4F7GA 5JHHA 3PZDA 1I2HA 3VIAA 1FB8A 4HB0B 1GC7A 5HE3A 1XCGA 2DLWA 3U12A 4D0NB 3PVUA 2R0DA 3PEGA 2NBVA 4PQ0A 3IVFA 3DXDA 5J3TA 3NSUA 4HAUB 4KAXB 5GOWB 1KI1B 4DXAB 4A6HA 3KZ1A 2VKIA 2Y7BA 2EMSA 1I7AA 3QIJA 3D8EA 3OANA 3B77A 4HB4B 4YONA 1K5DB 3UZTA 1XD4A 2RGNB 2NMBA 2W2WA 1NU2A 1WGQA 1LW3A 4DX90 3KRXA 1WJ1A 4MT7A 4DX8A 2FJLA 2G35A 3KSYA 4TYZA 3SUZA 2E2XA 2EMTA 4GMVA 2J0KA 3ULCA 4WVFB 2CODA 4D6WA 1FOEA 4IAPA 2X18A 1W1DA 2EJ8A 1ZC4B 2N23A 3U7DA 2HTHB 1FGYA 5FI0A 1KZ7A 2DN6A 4BBKA 1TJ6A 4PNKA 3TO1A 5C79A 5LG4B 2NZ8B 2P8VA 4P7IA 3WA0A 3MPXA 2AEHA 5HE0A 4K81A 3A8PA 1K5GB 3FVCA 4GN1A 2P0DA 3ZVRA 2IYBA 4ZRKA 2YRYA 2DA0A 5DH9B 1U27A 1AQCA 1UEFA 1P6SA 1V5MA 4KHAA 3BINA 1DBHA 4L1RA 2YF0A 3F5RA 3CIKA 2COFA 2LULA 2J0MA 5IRSA 2CAYA 2IFSA 3DXCA 4B6HA 2Z59A 2GCJA 2GCLA 2QKLA 1X1GA 2ADZA 1FHWA 2LOXA 2KIEA 3T06A 1GC6A 4HB3B 3U8ZA 2OQBA 4A5KA 1U2BA 2YVCA 2ZPYA 3HSAA 5I2MA 2UZSA 2FJUB 1EVHA 2H7DA 1FGZA 4GMXB 2RSGA 2W2XC 1PFJA 2ELBA 2LYDA 2UZRA 3AJ4A 1UPQA 1H4RA 2RLOA 1MAIA 4IOYX 2HE7A 1X86A 1DDVA 1Z87A 1U5EA 2DHJA 2J59M 4KHOA 4KVGB 1T77A 3NW8A 2CY5A 1OQNA 2DYNA 3N7CA 1XX0A 3G9WA 3TW1A 1W1HA 3GYPA 3NWFA 3PSCA 1Y5OA 4GNKB 5HE1A 2K00A 1E5WA 1J0WA 2N0YA 5KQ4A 2LG1A 2M14A 1WI1A 3A98B 1EGXA 1U5DA 3ODOA 2Z0QA 1GG3A 3WYFB 2MDXA 2OTXA 5D3YA 3AU5A 1ISNA 1XODA 1DYNA 3LJUX 3KRWA 1NTVA 3TVVA 3SYXA 2K8EA 2Z14A 2LOZA 1EAZA 3O96A 2EC1A 4A6FB 5M4YB 1B55A 3MDBC 5HE2A 2RVBB 2Y8GA 5KQ1A 4CYEA 4HB2B 1FHOA 5JP4A 1U5GA 5D3VA 2YSZA 1BWNA 1NI2A 4K2OA 2V76A 2RRFA 4HHVA 2KUPA 2GUMA 1PLSA 1V5UA 5JLJB 1DDMA 2VRWB 1TXDA 2M38A 3ODWA 4Y94A 1P5TA 2YT1A 2D4QA 2XQNM 3A58A 4Z2MB 4NSWA 4HSIA 1ZYIA 4MY6A 1QC6A 2DX5A 2R09A 4L6EA 2DHIA 4MK0A 2CRFA 4TKNA 1MIZB 3OHMB 1AWEA 5D3XA 3X23A 4YL8A 3TFMA 1FHXA 3PVLA 3DCXA 1UPRA 2L1CA 2COCA 4QXAB 5L81A 2ROVA 1V5PA 4H8SA 2GJYA 3NWDA 2DTCA 2Z0PA 1MI1A 4KHBB 5LOPB 2DKPA 1OY2A 4HAXB 4K2PA 1ZSQA 4QJ3B 1X05A 4C0AA 1BAKA 4EMOA 2KUQA 1WGUA 1Y19B 5LONB 1RJ2A 2YT2A 1SGHA 4GXBA 3ZDTA 4K17A 1UNRA 2YS5A 1MPHA 2D10A 2PZ1A 2DHKA 3SNHA 4QJ4B 4GPTB 1ZM0A 1KZGA 2YS3A 5J3YA 3A8QA 2Z4DA 3VOQA 2W2XD 3M1IB 3TCAA 3ULBA 5CLLB 3PG7A 4A6KA 2MFQA 1U29A 2JP2A 1UNPA 2BCJA 2Z13A 3D8DA 3PVWA 4HAYB 3HQCA 5C5BB 4CHMA 2DKQA 4HAVB 2D9YA 1BTKA 5I2SA 4EKUA 2D9VA 1PMSA 1LB1A 4ZRIA 3ODXA 5D3WA 1M7EA 1UNQA 3PP2A 2J0JA 2Q13A 2D2QA 3HK0A 1V89A 4DBBA 2ELAA 2ROZB 4IFSA 2CY4A 4OSNA 1XKEA 4DIXA 2ZKMX 1ZC3B 1P3RA 1OMWA 1EF1A 2VSZA 1RRPB 5C6RA 2P0FA 3KY9A 2Y8FA 4A6FA 5J3QA 2RNRB 2KGXB 3BJIA 3AU4A 2I5CA 1MKEA 2KIGA 1WJMA 2I1JA 1WG7A 3GYOA 3V5WA 3FM8C 2L2IA 4Z2NA 3P7ZA 5JHGA 1J19A 5EFXA 1DROA 1WVHA 2D9WA 3HW2B 4ZRJA 4HAWB 1N3HA 1NTYA 3RCPA 1W1GA 3NWAA 5CLQB 2K2UA 1QQGA 1SHCA 2MWNB 3FEHA 1X1FA
chains in the Genus database with same CATH topology
1V61A 1MIXA 2Z0OA 4XWXA 2D11A 2D9XA 1H10A 4CHJA 2DYQA 1XR0B 4F7HA 1ZVRA 5C16A 2QKMA 5DI9B 4GZUA 5KCVA 2AL6A 2D9ZA 3FSSA 1BTNA 4NY0A 2YS1A 2I1KA 4HATB 2YT0A 3F0WA 1MK7B 2GS0A 4EJNA 2UVMA 1X11A 4HDOA 3DXEA 2RUKB 2LKOA 3QWMA 5DHFB 2KCJA 1FAOA 1U5FA 3QBVB 3ML4A 2I5FA 1MK9B 1DDWA 1TQZA 5D27A 4F7UP 2K2JA 1M7RA 5FI1A 2H7EA 4HAZB 3P6AA 4WJ7A 5DIFB 3CXBB 4HDQA 1V88A 1Q67A 2DFKA 2COAA 5DHAB 2P0HA 4WSFA 5C5BA 3SO6A 1IRSA 2MKRA 2DX1A 3D8FA 3SV1A 4F7GA 5JHHA 3PZDA 1I2HA 3VIAA 1FB8A 4HB0B 1GC7A 5HE3A 1XCGA 2DLWA 4D0NB 3PVUA 2R0DA 3PEGA 4PQ0A 3IVFA 3DXDA 5J3TA 3NSUA 4HAUB 4KAXB 5GOWB 1KI1B 4DXAB 4A6HA 3KZ1A 2VKIA 2Y7BA 2EMSA 1I7AA 3QIJA 3D8EA 3OANA 4HB4B 4YONA 1K5DB 3UZTA 1XD4A 2RGNB 2NMBA 2W2WA 1NU2A 1WGQA 1LW3A 4DX90 3KRXA 1WJ1A 4MT7A 4DX8A 2FJLA 2G35A 3KSYA 4TYZA 3SUZA 2E2XA 2EMTA 4GMVA 2J0KA 3ULCA 4WVFB 2CODA 1FOEA 4IAPA 2X18A 1W1DA 2EJ8A 1ZC4B 2N23A 3U7DA 2HTHB 1FGYA 5FI0A 1KZ7A 2DN6A 4BBKA 1TJ6A 4PNKA 3TO1A 5C79A 2NZ8B 2P8VA 4P7IA 3WA0A 3MPXA 2AEHA 5HE0A 4K81A 3A8PA 1K5GB 4GN1A 2P0DA 3ZVRA 2IYBA 4ZRKA 2YRYA 2DA0A 5DH9B 1U27A 1AQCA 1UEFA 1P6SA 1V5MA 4KHAA 3BINA 1DBHA 2YF0A 3F5RA 3CIKA 2COFA 2LULA 2J0MA 2CAYA 2IFSA 3DXCA 4B6HA 2GCJA 2GCLA 2QKLA 1X1GA 2ADZA 1FHWA 2LOXA 3T06A 1GC6A 4HB3B 3U8ZA 2OQBA 4A5KA 1U2BA 2YVCA 2ZPYA 2UZSA 1EVHA 2H7DA 1FGZA 4GMXB 2RSGA 2W2XC 1PFJA 2ELBA 2LYDA 2UZRA 3AJ4A 1UPQA 1H4RA 2RLOA 1MAIA 4IOYX 2HE7A 1X86A 1DDVA 1Z87A 1U5EA 2DHJA 2J59M 4KHOA 4KVGB 2CY5A 1OQNA 2DYNA 3N7CA 1XX0A 3G9WA 3TW1A 1W1HA 3GYPA 3PSCA 1Y5OA 5HE1A 2K00A 1E5WA 1J0WA 2N0YA 5KQ4A 2LG1A 2M14A 1WI1A 3A98B 1EGXA 1U5DA 3ODOA 2Z0QA 1GG3A 3WYFB 2MDXA 2OTXA 5D3YA 3AU5A 1ISNA 1XODA 1DYNA 3LJUX 3KRWA 1NTVA 3TVVA 3SYXA 2LOZA 1EAZA 3O96A 2EC1A 4A6FB 1B55A 3MDBC 5HE2A 2RVBB 2Y8GA 5KQ1A 4CYEA 4HB2B 1FHOA 5JP4A 1U5GA 5D3VA 2YSZA 1BWNA 1NI2A 4K2OA 2V76A 4HHVA 2KUPA 1PLSA 1V5UA 5JLJB 1DDMA 2VRWB 1TXDA 2M38A 3ODWA 4Y94A 1P5TA 2YT1A 2D4QA 2XQNM 4Z2MB 4NSWA 4MY6A 1QC6A 2DX5A 2R09A 4L6EA 2DHIA 4MK0A 2CRFA 4TKNA 1MIZB 1AWEA 5D3XA 3X23A 4YL8A 3TFMA 1FHXA 3PVLA 1UPRA 2L1CA 2COCA 5L81A 2ROVA 1V5PA 4H8SA 2GJYA 2DTCA 2Z0PA 4KHBB 5LOPB 2DKPA 1OY2A 4HAXB 4K2PA 1ZSQA 1X05A 4C0AA 1BAKA 4EMOA 1WGUA 1Y19B 5LONB 1RJ2A 1SGHA 4GXBA 3ZDTA 4K17A 1UNRA 2YS5A 1MPHA 2D10A 2PZ1A 2DHKA 3SNHA 4GPTB 1ZM0A 1KZGA 2YS3A 5J3YA 3A8QA 3VOQA 2W2XD 3M1IB 3TCAA 3ULBA 5CLLB 3PG7A 4A6KA 2MFQA 1U29A 2JP2A 1UNPA 2BCJA 3D8DA 3PVWA 4HAYB 3HQCA 5C5BB 4CHMA 2DKQA 4HAVB 2D9YA 1BTKA 4EKUA 2D9VA 1PMSA 1LB1A 4ZRIA 3ODXA 5D3WA 1M7EA 1UNQA 3PP2A 2J0JA 2Q13A 2D2QA 3HK0A 1V89A 4DBBA 2ELAA 2ROZB 4IFSA 2CY4A 1XKEA 1ZC3B 1P3RA 1OMWA 1EF1A 2VSZA 1RRPB 5C6RA 2P0FA 3KY9A 2Y8FA 4A6FA 5J3QA 2RNRB 2KGXB 3BJIA 3AU4A 2I5CA 1MKEA 1WJMA 2I1JA 1WG7A 3GYOA 3V5WA 3FM8C 2L2IA 4Z2NA 3P7ZA 5JHGA 1J19A 5EFXA 1DROA 1WVHA 2D9WA 3HW2B 4ZRJA 4HAWB 1N3HA 1NTYA 3RCPA 1W1GA 5CLQB 2K2UA 1QQGA 1SHCA 2MWNB 3FEHA 1X1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V61 A;  1MIX A;  2Z0O A;  4XWX A;  2D11 A;  2D9X A;  1H10 A;  4CHJ A;  2DYQ A;  1XR0 B;  4F7H A;  1ZVR A;  5C16 A;  2QKM A;  5DI9 B;  4GZU A;  5KCV A;  2AL6 A;  2D9Z A;  3FSS A;  1BTN A;  4NY0 A;  2YS1 A;  2I1K A;  4HAT B;  2YT0 A;  3F0W A;  1MK7 B;  2GS0 A;  4EJN A;  2UVM A;  1X11 A;  4HDO A;  3DXE A;  2RUK B;  2LKO A;  3QWM A;  5DHF B;  2KCJ A;  1FAO A;  1U5F A;  3QBV B;  3ML4 A;  2I5F A;  1MK9 B;  1DDW A;  1TQZ A;  5D27 A;  4F7U P;  2K2J A;  1M7R A;  5FI1 A;  2H7E A;  4HAZ B;  3P6A A;  4WJ7 A;  5DIF B;  3CXB B;  4HDQ A;  1V88 A;  1Q67 A;  2DFK A;  2COA A;  5DHA B;  2P0H A;  4WSF A;  5C5B A;  3SO6 A;  1IRS A;  2MKR A;  2DX1 A;  3D8F A;  3SV1 A;  4F7G A;  5JHH A;  3PZD A;  1I2H A;  3VIA A;  1FB8 A;  4HB0 B;  1GC7 A;  5HE3 A;  1XCG A;  2DLW A;  4D0N B;  3PVU A;  2R0D A;  3PEG A;  4PQ0 A;  3IVF A;  3DXD A;  5J3T A;  3NSU A;  4HAU B;  4KAX B;  5GOW B;  1KI1 B;  4DXA B;  4A6H A;  3KZ1 A;  2VKI A;  2Y7B A;  2EMS A;  1I7A A;  3QIJ A;  3D8E A;  3OAN A;  4HB4 B;  4YON A;  1K5D B;  3UZT A;  1XD4 A;  2RGN B;  2NMB A;  2W2W A;  1NU2 A;  1WGQ A;  1LW3 A;  4DX9 0;  3KRX A;  1WJ1 A;  4MT7 A;  4DX8 A;  2FJL A;  2G35 A;  3KSY A;  4TYZ A;  3SUZ A;  2E2X A;  2EMT A;  4GMV A;  2J0K A;  3ULC A;  4WVF B;  2COD A;  1FOE A;  4IAP A;  2X18 A;  1W1D A;  2EJ8 A;  1ZC4 B;  2N23 A;  3U7D A;  2HTH B;  1FGY A;  5FI0 A;  1KZ7 A;  2DN6 A;  4BBK A;  1TJ6 A;  4PNK A;  3TO1 A;  5C79 A;  2NZ8 B;  2P8V A;  4P7I A;  3WA0 A;  3MPX A;  2AEH A;  5HE0 A;  4K81 A;  3A8P A;  1K5G B;  4GN1 A;  2P0D A;  3ZVR A;  2IYB A;  4ZRK A;  2YRY A;  2DA0 A;  5DH9 B;  1U27 A;  1AQC A;  1UEF A;  1P6S A;  1V5M A;  4KHA A;  3BIN A;  1DBH A;  2YF0 A;  3F5R A;  3CIK A;  2COF A;  2LUL A;  2J0M A;  2CAY A;  2IFS A;  3DXC A;  4B6H A;  2GCJ A;  2GCL A;  2QKL A;  1X1G A;  2ADZ A;  1FHW A;  2LOX A;  3T06 A;  1GC6 A;  4HB3 B;  3U8Z A;  2OQB A;  4A5K A;  1U2B A;  2YVC A;  2ZPY A;  2UZS A;  1EVH A;  2H7D A;  1FGZ A;  4GMX B;  2RSG A;  2W2X C;  1PFJ A;  2ELB A;  2LYD A;  2UZR A;  3AJ4 A;  1UPQ A;  1H4R A;  2RLO A;  1MAI A;  4IOY X;  2HE7 A;  1X86 A;  1DDV A;  1Z87 A;  1U5E A;  2DHJ A;  2J59 M;  4KHO A;  4KVG B;  2CY5 A;  1OQN A;  2DYN A;  3N7C A;  1XX0 A;  3G9W A;  3TW1 A;  1W1H A;  3GYP A;  3PSC A;  1Y5O A;  5HE1 A;  2K00 A;  1E5W A;  1J0W A;  2N0Y A;  5KQ4 A;  2LG1 A;  2M14 A;  1WI1 A;  3A98 B;  1EGX A;  1U5D A;  3ODO A;  2Z0Q A;  1GG3 A;  3WYF B;  2MDX A;  2OTX A;  5D3Y A;  3AU5 A;  1ISN A;  1XOD A;  1DYN A;  3LJU X;  3KRW A;  1NTV A;  3TVV A;  3SYX A;  2LOZ A;  1EAZ A;  3O96 A;  2EC1 A;  4A6F B;  1B55 A;  3MDB C;  5HE2 A;  2RVB B;  2Y8G A;  5KQ1 A;  4CYE A;  4HB2 B;  1FHO A;  5JP4 A;  1U5G A;  5D3V A;  2YSZ A;  1BWN A;  1NI2 A;  4K2O A;  2V76 A;  4HHV A;  2KUP A;  1PLS A;  1V5U A;  5JLJ B;  1DDM A;  2VRW B;  1TXD A;  2M38 A;  3ODW A;  4Y94 A;  1P5T A;  2YT1 A;  2D4Q A;  2XQN M;  4Z2M B;  4NSW A;  4MY6 A;  1QC6 A;  2DX5 A;  2R09 A;  4L6E A;  2DHI A;  4MK0 A;  2CRF A;  4TKN A;  1MIZ B;  1AWE A;  5D3X A;  3X23 A;  4YL8 A;  3TFM A;  1FHX A;  3PVL A;  1UPR A;  2L1C A;  2COC A;  5L81 A;  2ROV A;  1V5P A;  4H8S A;  2GJY A;  2DTC A;  2Z0P A;  4KHB B;  5LOP B;  2DKP A;  1OY2 A;  4HAX B;  4K2P A;  1ZSQ A;  1X05 A;  4C0A A;  1BAK A;  4EMO A;  1WGU A;  1Y19 B;  5LON B;  1RJ2 A;  1SGH A;  4GXB A;  3ZDT A;  4K17 A;  1UNR A;  2YS5 A;  1MPH A;  2D10 A;  2PZ1 A;  2DHK A;  3SNH A;  4GPT B;  1ZM0 A;  1KZG A;  2YS3 A;  5J3Y A;  3A8Q A;  3VOQ A;  2W2X D;  3M1I B;  3TCA A;  3ULB A;  5CLL B;  3PG7 A;  4A6K A;  2MFQ A;  1U29 A;  2JP2 A;  1UNP A;  2BCJ A;  3D8D A;  3PVW A;  4HAY B;  3HQC A;  5C5B B;  4CHM A;  2DKQ A;  4HAV B;  2D9Y A;  1BTK A;  4EKU A;  2D9V A;  1PMS A;  1LB1 A;  4ZRI A;  3ODX A;  5D3W A;  1M7E A;  1UNQ A;  3PP2 A;  2J0J A;  2Q13 A;  2D2Q A;  3HK0 A;  1V89 A;  4DBB A;  2ELA A;  2ROZ B;  4IFS A;  2CY4 A;  1XKE A;  1ZC3 B;  1P3R A;  1OMW A;  1EF1 A;  2VSZ A;  1RRP B;  5C6R A;  2P0F A;  3KY9 A;  2Y8F A;  4A6F A;  5J3Q A;  2RNR B;  2KGX B;  3BJI A;  3AU4 A;  2I5C A;  1MKE A;  1WJM A;  2I1J A;  1WG7 A;  3GYO A;  3V5W A;  3FM8 C;  2L2I A;  4Z2N A;  3P7Z A;  5JHG A;  1J19 A;  5EFX A;  1DRO A;  1WVH A;  2D9W A;  3HW2 B;  4ZRJ A;  4HAW B;  1N3H A;  1NTY A;  3RCP A;  1W1G A;  5CLQ B;  2K2U A;  1QQG A;  1SHC A;  2MWN B;  3FEH A;  1X1F A; 
#chains in the Genus database with same CATH topology
 1V61 A;  1MIX A;  2Z0O A;  4XWX A;  2D11 A;  2D9X A;  2K49 A;  1H10 A;  4CHJ A;  2DYQ A;  1XR0 B;  4F7H A;  1ZVR A;  5C16 A;  2QKM A;  5DI9 B;  4GZU A;  5KCV A;  2AL6 A;  2D9Z A;  3FSS A;  1BTN A;  4NY0 A;  2YS1 A;  2I1K A;  4HAT B;  4CSQ A;  2YT0 A;  3F0W A;  4KHB A;  1MK7 B;  2GS0 A;  4EJN A;  2UVM A;  1X11 A;  4GOU A;  4HDO A;  3DXE A;  2RUK B;  2LKO A;  3QWM A;  5DHF B;  2KCJ A;  1FAO A;  1U5F A;  4OT1 A;  3QBV B;  3ML4 A;  2I5F A;  1MK9 B;  1DDW A;  3HIE A;  1TQZ A;  5D27 A;  4F7U P;  2K2J A;  1M7R A;  5FI1 A;  2H7E A;  4HAZ B;  3P6A A;  4WJ7 A;  5DIF B;  2KR0 A;  3CXB B;  2R2Y A;  4HDQ A;  1V88 A;  1Q67 A;  2DFK A;  2COA A;  4QJ5 B;  5DHA B;  2P0H A;  4WSF A;  5C5B A;  3SO6 A;  1IRS A;  2MKR A;  2DX1 A;  3D8F A;  3SV1 A;  4F7G A;  5JHH A;  3PZD A;  1I2H A;  3VIA A;  1FB8 A;  4HB0 B;  1GC7 A;  5HE3 A;  1XCG A;  2DLW A;  3U12 A;  4D0N B;  3PVU A;  2R0D A;  3PEG A;  2NBV A;  4PQ0 A;  3IVF A;  3DXD A;  5J3T A;  3NSU A;  4HAU B;  4KAX B;  5GOW B;  1KI1 B;  4DXA B;  4A6H A;  3KZ1 A;  2VKI A;  2Y7B A;  2EMS A;  1I7A A;  3QIJ A;  3D8E A;  3OAN A;  3B77 A;  4HB4 B;  4YON A;  1K5D B;  3UZT A;  1XD4 A;  2RGN B;  2NMB A;  2W2W A;  1NU2 A;  1WGQ A;  1LW3 A;  4DX9 0;  3KRX A;  1WJ1 A;  4MT7 A;  4DX8 A;  2FJL A;  2G35 A;  3KSY A;  4TYZ A;  3SUZ A;  2E2X A;  2EMT A;  4GMV A;  2J0K A;  3ULC A;  4WVF B;  2COD A;  4D6W A;  1FOE A;  4IAP A;  2X18 A;  1W1D A;  2EJ8 A;  1ZC4 B;  2N23 A;  3U7D A;  2HTH B;  1FGY A;  5FI0 A;  1KZ7 A;  2DN6 A;  4BBK A;  1TJ6 A;  4PNK A;  3TO1 A;  5C79 A;  5LG4 B;  2NZ8 B;  2P8V A;  4P7I A;  3WA0 A;  3MPX A;  2AEH A;  5HE0 A;  4K81 A;  3A8P A;  1K5G B;  3FVC A;  4GN1 A;  2P0D A;  3ZVR A;  2IYB A;  4ZRK A;  2YRY A;  2DA0 A;  5DH9 B;  1U27 A;  1AQC A;  1UEF A;  1P6S A;  1V5M A;  4KHA A;  3BIN A;  1DBH A;  4L1R A;  2YF0 A;  3F5R A;  3CIK A;  2COF A;  2LUL A;  2J0M A;  5IRS A;  2CAY A;  2IFS A;  3DXC A;  4B6H A;  2Z59 A;  2GCJ A;  2GCL A;  2QKL A;  1X1G A;  2ADZ A;  1FHW A;  2LOX A;  2KIE A;  3T06 A;  1GC6 A;  4HB3 B;  3U8Z A;  2OQB A;  4A5K A;  1U2B A;  2YVC A;  2ZPY A;  3HSA A;  5I2M A;  2UZS A;  2FJU B;  1EVH A;  2H7D A;  1FGZ A;  4GMX B;  2RSG A;  2W2X C;  1PFJ A;  2ELB A;  2LYD A;  2UZR A;  3AJ4 A;  1UPQ A;  1H4R A;  2RLO A;  1MAI A;  4IOY X;  2HE7 A;  1X86 A;  1DDV A;  1Z87 A;  1U5E A;  2DHJ A;  2J59 M;  4KHO A;  4KVG B;  1T77 A;  3NW8 A;  2CY5 A;  1OQN A;  2DYN A;  3N7C A;  1XX0 A;  3G9W A;  3TW1 A;  1W1H A;  3GYP A;  3NWF A;  3PSC A;  1Y5O A;  4GNK B;  5HE1 A;  2K00 A;  1E5W A;  1J0W A;  2N0Y A;  5KQ4 A;  2LG1 A;  2M14 A;  1WI1 A;  3A98 B;  1EGX A;  1U5D A;  3ODO A;  2Z0Q A;  1GG3 A;  3WYF B;  2MDX A;  2OTX A;  5D3Y A;  3AU5 A;  1ISN A;  1XOD A;  1DYN A;  3LJU X;  3KRW A;  1NTV A;  3TVV A;  3SYX A;  2K8E A;  2Z14 A;  2LOZ A;  1EAZ A;  3O96 A;  2EC1 A;  4A6F B;  5M4Y B;  1B55 A;  3MDB C;  5HE2 A;  2RVB B;  2Y8G A;  5KQ1 A;  4CYE A;  4HB2 B;  1FHO A;  5JP4 A;  1U5G A;  5D3V A;  2YSZ A;  1BWN A;  1NI2 A;  4K2O A;  2V76 A;  2RRF A;  4HHV A;  2KUP A;  2GUM A;  1PLS A;  1V5U A;  5JLJ B;  1DDM A;  2VRW B;  1TXD A;  2M38 A;  3ODW A;  4Y94 A;  1P5T A;  2YT1 A;  2D4Q A;  2XQN M;  3A58 A;  4Z2M B;  4NSW A;  4HSI A;  1ZYI A;  4MY6 A;  1QC6 A;  2DX5 A;  2R09 A;  4L6E A;  2DHI A;  4MK0 A;  2CRF A;  4TKN A;  1MIZ B;  3OHM B;  1AWE A;  5D3X A;  3X23 A;  4YL8 A;  3TFM A;  1FHX A;  3PVL A;  3DCX A;  1UPR A;  2L1C A;  2COC A;  4QXA B;  5L81 A;  2ROV A;  1V5P A;  4H8S A;  2GJY A;  3NWD A;  2DTC A;  2Z0P A;  1MI1 A;  4KHB B;  5LOP B;  2DKP A;  1OY2 A;  4HAX B;  4K2P A;  1ZSQ A;  4QJ3 B;  1X05 A;  4C0A A;  1BAK A;  4EMO A;  2KUQ A;  1WGU A;  1Y19 B;  5LON B;  1RJ2 A;  2YT2 A;  1SGH A;  4GXB A;  3ZDT A;  4K17 A;  1UNR A;  2YS5 A;  1MPH A;  2D10 A;  2PZ1 A;  2DHK A;  3SNH A;  4QJ4 B;  4GPT B;  1ZM0 A;  1KZG A;  2YS3 A;  5J3Y A;  3A8Q A;  2Z4D A;  3VOQ A;  2W2X D;  3M1I B;  3TCA A;  3ULB A;  5CLL B;  3PG7 A;  4A6K A;  2MFQ A;  1U29 A;  2JP2 A;  1UNP A;  2BCJ A;  2Z13 A;  3D8D A;  3PVW A;  4HAY B;  3HQC A;  5C5B B;  4CHM A;  2DKQ A;  4HAV B;  2D9Y A;  1BTK A;  5I2S A;  4EKU A;  2D9V A;  1PMS A;  1LB1 A;  4ZRI A;  3ODX A;  5D3W A;  1M7E A;  1UNQ A;  3PP2 A;  2J0J A;  2Q13 A;  2D2Q A;  3HK0 A;  1V89 A;  4DBB A;  2ELA A;  2ROZ B;  4IFS A;  2CY4 A;  4OSN A;  1XKE A;  4DIX A;  2ZKM X;  1ZC3 B;  1P3R A;  1OMW A;  1EF1 A;  2VSZ A;  1RRP B;  5C6R A;  2P0F A;  3KY9 A;  2Y8F A;  4A6F A;  5J3Q A;  2RNR B;  2KGX B;  3BJI A;  3AU4 A;  2I5C A;  1MKE A;  2KIG A;  1WJM A;  2I1J A;  1WG7 A;  3GYO A;  3V5W A;  3FM8 C;  2L2I A;  4Z2N A;  3P7Z A;  5JHG A;  1J19 A;  5EFX A;  1DRO A;  1WVH A;  2D9W A;  3HW2 B;  4ZRJ A;  4HAW B;  1N3H A;  1NTY A;  3RCP A;  1W1G A;  3NWA A;  5CLQ B;  2K2U A;  1QQG A;  1SHC A;  2MWN B;  3FEH A;  1X1F A; 
#chains in the Genus database with same CATH homology
 1V61 A;  1MIX A;  2Z0O A;  4XWX A;  2D11 A;  2D9X A;  1H10 A;  4CHJ A;  2DYQ A;  1XR0 B;  4F7H A;  1ZVR A;  5C16 A;  2QKM A;  5DI9 B;  4GZU A;  5KCV A;  2AL6 A;  2D9Z A;  3FSS A;  1BTN A;  4NY0 A;  2YS1 A;  2I1K A;  4HAT B;  2YT0 A;  3F0W A;  1MK7 B;  2GS0 A;  4EJN A;  2UVM A;  1X11 A;  4HDO A;  3DXE A;  2RUK B;  2LKO A;  3QWM A;  5DHF B;  2KCJ A;  1FAO A;  1U5F A;  3QBV B;  3ML4 A;  2I5F A;  1MK9 B;  1DDW A;  1TQZ A;  5D27 A;  4F7U P;  2K2J A;  1M7R A;  5FI1 A;  2H7E A;  4HAZ B;  3P6A A;  4WJ7 A;  5DIF B;  3CXB B;  4HDQ A;  1V88 A;  1Q67 A;  2DFK A;  2COA A;  5DHA B;  2P0H A;  4WSF A;  5C5B A;  3SO6 A;  1IRS A;  2MKR A;  2DX1 A;  3D8F A;  3SV1 A;  4F7G A;  5JHH A;  3PZD A;  1I2H A;  3VIA A;  1FB8 A;  4HB0 B;  1GC7 A;  5HE3 A;  1XCG A;  2DLW A;  4D0N B;  3PVU A;  2R0D A;  3PEG A;  4PQ0 A;  3IVF A;  3DXD A;  5J3T A;  3NSU A;  4HAU B;  4KAX B;  5GOW B;  1KI1 B;  4DXA B;  4A6H A;  3KZ1 A;  2VKI A;  2Y7B A;  2EMS A;  1I7A A;  3QIJ A;  3D8E A;  3OAN A;  4HB4 B;  4YON A;  1K5D B;  3UZT A;  1XD4 A;  2RGN B;  2NMB A;  2W2W A;  1NU2 A;  1WGQ A;  1LW3 A;  4DX9 0;  3KRX A;  1WJ1 A;  4MT7 A;  4DX8 A;  2FJL A;  2G35 A;  3KSY A;  4TYZ A;  3SUZ A;  2E2X A;  2EMT A;  4GMV A;  2J0K A;  3ULC A;  4WVF B;  2COD A;  1FOE A;  4IAP A;  2X18 A;  1W1D A;  2EJ8 A;  1ZC4 B;  2N23 A;  3U7D A;  2HTH B;  1FGY A;  5FI0 A;  1KZ7 A;  2DN6 A;  4BBK A;  1TJ6 A;  4PNK A;  3TO1 A;  5C79 A;  2NZ8 B;  2P8V A;  4P7I A;  3WA0 A;  3MPX A;  2AEH A;  5HE0 A;  4K81 A;  3A8P A;  1K5G B;  4GN1 A;  2P0D A;  3ZVR A;  2IYB A;  4ZRK A;  2YRY A;  2DA0 A;  5DH9 B;  1U27 A;  1AQC A;  1UEF A;  1P6S A;  1V5M A;  4KHA A;  3BIN A;  1DBH A;  2YF0 A;  3F5R A;  3CIK A;  2COF A;  2LUL A;  2J0M A;  2CAY A;  2IFS A;  3DXC A;  4B6H A;  2GCJ A;  2GCL A;  2QKL A;  1X1G A;  2ADZ A;  1FHW A;  2LOX A;  3T06 A;  1GC6 A;  4HB3 B;  3U8Z A;  2OQB A;  4A5K A;  1U2B A;  2YVC A;  2ZPY A;  2UZS A;  1EVH A;  2H7D A;  1FGZ A;  4GMX B;  2RSG A;  2W2X C;  1PFJ A;  2ELB A;  2LYD A;  2UZR A;  3AJ4 A;  1UPQ A;  1H4R A;  2RLO A;  1MAI A;  4IOY X;  2HE7 A;  1X86 A;  1DDV A;  1Z87 A;  1U5E A;  2DHJ A;  2J59 M;  4KHO A;  4KVG B;  2CY5 A;  1OQN A;  2DYN A;  3N7C A;  1XX0 A;  3G9W A;  3TW1 A;  1W1H A;  3GYP A;  3PSC A;  1Y5O A;  5HE1 A;  2K00 A;  1E5W A;  1J0W A;  2N0Y A;  5KQ4 A;  2LG1 A;  2M14 A;  1WI1 A;  3A98 B;  1EGX A;  1U5D A;  3ODO A;  2Z0Q A;  1GG3 A;  3WYF B;  2MDX A;  2OTX A;  5D3Y A;  3AU5 A;  1ISN A;  1XOD A;  1DYN A;  3LJU X;  3KRW A;  1NTV A;  3TVV A;  3SYX A;  2LOZ A;  1EAZ A;  3O96 A;  2EC1 A;  4A6F B;  1B55 A;  3MDB C;  5HE2 A;  2RVB B;  2Y8G A;  5KQ1 A;  4CYE A;  4HB2 B;  1FHO A;  5JP4 A;  1U5G A;  5D3V A;  2YSZ A;  1BWN A;  1NI2 A;  4K2O A;  2V76 A;  4HHV A;  2KUP A;  1PLS A;  1V5U A;  5JLJ B;  1DDM A;  2VRW B;  1TXD A;  2M38 A;  3ODW A;  4Y94 A;  1P5T A;  2YT1 A;  2D4Q A;  2XQN M;  4Z2M B;  4NSW A;  4MY6 A;  1QC6 A;  2DX5 A;  2R09 A;  4L6E A;  2DHI A;  4MK0 A;  2CRF A;  4TKN A;  1MIZ B;  1AWE A;  5D3X A;  3X23 A;  4YL8 A;  3TFM A;  1FHX A;  3PVL A;  1UPR A;  2L1C A;  2COC A;  5L81 A;  2ROV A;  1V5P A;  4H8S A;  2GJY A;  2DTC A;  2Z0P A;  4KHB B;  5LOP B;  2DKP A;  1OY2 A;  4HAX B;  4K2P A;  1ZSQ A;  1X05 A;  4C0A A;  1BAK A;  4EMO A;  1WGU A;  1Y19 B;  5LON B;  1RJ2 A;  1SGH A;  4GXB A;  3ZDT A;  4K17 A;  1UNR A;  2YS5 A;  1MPH A;  2D10 A;  2PZ1 A;  2DHK A;  3SNH A;  4GPT B;  1ZM0 A;  1KZG A;  2YS3 A;  5J3Y A;  3A8Q A;  3VOQ A;  2W2X D;  3M1I B;  3TCA A;  3ULB A;  5CLL B;  3PG7 A;  4A6K A;  2MFQ A;  1U29 A;  2JP2 A;  1UNP A;  2BCJ A;  3D8D A;  3PVW A;  4HAY B;  3HQC A;  5C5B B;  4CHM A;  2DKQ A;  4HAV B;  2D9Y A;  1BTK A;  4EKU A;  2D9V A;  1PMS A;  1LB1 A;  4ZRI A;  3ODX A;  5D3W A;  1M7E A;  1UNQ A;  3PP2 A;  2J0J A;  2Q13 A;  2D2Q A;  3HK0 A;  1V89 A;  4DBB A;  2ELA A;  2ROZ B;  4IFS A;  2CY4 A;  1XKE A;  1ZC3 B;  1P3R A;  1OMW A;  1EF1 A;  2VSZ A;  1RRP B;  5C6R A;  2P0F A;  3KY9 A;  2Y8F A;  4A6F A;  5J3Q A;  2RNR B;  2KGX B;  3BJI A;  3AU4 A;  2I5C A;  1MKE A;  1WJM A;  2I1J A;  1WG7 A;  3GYO A;  3V5W A;  3FM8 C;  2L2I A;  4Z2N A;  3P7Z A;  5JHG A;  1J19 A;  5EFX A;  1DRO A;  1WVH A;  2D9W A;  3HW2 B;  4ZRJ A;  4HAW B;  1N3H A;  1NTY A;  3RCP A;  1W1G A;  5CLQ B;  2K2U A;  1QQG A;  1SHC A;  2MWN B;  3FEH A;  1X1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...