2MWNB

Talin-f3 / riam n-terminal peptide complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/signaling protein
total genus 11
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mwnB00
4HB3B 4K81A 1AQCA 5L81A 2VSZA 1MIXA 1WI1A 4EKUA 1J19A 3OANA 1SGHA 1PFJA 3AJ4A 3PG7A 5D27A 2LOZA 2P0HA 2L2IA 1DDWA 3F0WA 2KGXB 2KCJA 3PVUA 2YS5A 1EGXA 5FI1A 1FB8A 2QKLA 1P5TA 2EMTA 2ELAA 2GS0A 2YT0A 3IVFA 5GOWB 2YSZA 2ROVA 4HAUB 3SUZA 2M14A 3QIJA 2DYNA 4HAVB 2MFQA 3D8EA 4YL8A 2H7EA 3UZTA 1X86A 1I2HA 2D9YA 1M7RA 2HE7A 1UNPA 3U8ZA 3KSYA 5D3YA 1U5FA 2UZSA 4K17A 3VIAA 5JLJB 4HB4B 2NZ8B 3P7ZA 3TVVA 4EMOA 2D9VA 1DROA 1DBHA 1NTVA 2R0DA 3QBVB 3TCAA 4A6KA 1X1GA 3ODWA 5DIFB 3KRXA 2H7DA 1U29A 2UZRA 2DHJA 4Z2NA 2BCJA 1U5GA 4P7IA 4CHJA 4KVGB 3HK0A 3P6AA 3CXBB 1UNRA 5HE1A 2W2WA 5HE0A 2I5CA 5DHFB 1V88A 2FJLA 4IFSA 3WYFB 1W1GA 5KQ1A 5KQ4A 2CY4A 2J0MA 2OTXA 3F5RA 1WJMA 2YF0A 2M38A 1TJ6A 1X11A 3A8QA 4XWXA 2MKRA 3ZVRA 2P8VA 4BBKA 1V5PA 2J59M 1V5UA 5DHAB 1X05A 1FGYA 3TW1A 1NI2A 3A8PA 2CRFA 2RVBB 1SHCA 1RJ2A 2AEHA 1H10A 2CAYA 4K2PA 3GYOA 5JHHA 4MT7A 2I1JA 2RGNB 1XODA 1H4RA 4MY6A 2YVCA 2DHKA 1P6SA 1ISNA 2LULA 2P0DA 1MK7B 4F7HA 2EC1A 4PQ0A 5D3XA 1W1DA 1W1HA 3BJIA 2D2QA 4EJNA 1WGQA 3X23A 3V5WA 1NTYA 2DKQA 1FHXA 5DH9B 3RCPA 1U5EA 4HB0B 2DX1A 2D9ZA 4HAYB 5CLQB 2W2XC 2Z0OA 4DXAB 2COAA 2YT1A 1XCGA 4GPTB 3FEHA 4HAZB 2GJYA 3SNHA 1X1FA 2EMSA 1KZ7A 1WVHA 2ELBA 1U2BA 1XKEA 2OQBA 4KHAA 3CIKA 3DXCA 5D3VA 4MK0A 1K5GB 1WG7A 4GZUA 1OMWA 4ZRKA 3AU5A 2N23A 2RUKB 2V76A 4KHOA 3MPXA 3O96A 2P0FA 1RRPB 2VRWB 2X18A 3ML4A 4IOYX 1MPHA 2I1KA 4HAXB 5KCVA 2W2XD 2ROZB 3PVLA 1M7EA 1E5WA 1UPQA 3KRWA 1FHWA 4HDOA 1DDVA 2DN6A 2AL6A 4GMVA 2LYDA 2LOXA 2IFSA 5C5BA 5LOPB 4C0AA 2KUPA 2COFA 2MDXA 2D10A 2K2UA 2DFKA 2D4QA 3A98B 2ADZA 2DA0A 2XQNM 1UPRA 1PMSA 2K2JA 1ZM0A 2LKOA 1PLSA 4NY0A 2RLOA 2L1CA 3LJUX 2NMBA 1MAIA 2Z0QA 3AU4A 4HAWB 4WJ7A 2YRYA 3N7CA 2Y8GA 1K5DB 3MDBC 3D8FA 1FOEA 4D0NB 3PSCA 2J0JA 3PP2A 5C79A 1QQGA 1NU2A 3VOQA 3U7DA 3DXEA 2LG1A 3ULCA 1FAOA 1TXDA 4HHVA 2Q13A 1EF1A 1GC7A 1V89A 2GCLA 1FHOA 1EAZA 1GG3A 3KY9A 3HQCA 5HE2A 3SYXA 4H8SA 4KHBB 3M1IB 3WA0A 2COCA 1U27A 2N0YA 4HATB 1AWEA 5C16A 2UVMA 4HDQA 2DHIA 4A6FA 1ZVRA 3PVWA 1LW3A 4TKNA 2D9XA 2E2XA 2DTCA 5J3YA 3D8DA 2DLWA 4IAPA 2CODA 4GMXB 5C6RA 1OQNA 4GXBA 1TQZA 2PZ1A 4ZRJA 2JP2A 4HB2B 3FSSA 2QKMA 3HW2B 4A6HA 3ODOA 1LB1A 3ULBA 2IYBA 4F7GA 1MKEA 3NSUA 1XR0B 4Z2MB 3SV1A 5C5BB 4GN1A 4KAXB 1OY2A 2Z0PA 2HTHB 3TFMA 3FM8C 2DX5A 5DI9B 4TYZA 1V61A 2J0KA 2ZPYA 1V5MA 1Q67A 1WGUA 1GC6A 4WVFB 1DYNA 4DBBA 3QWMA 5JHGA 2K00A 2R09A 3ODXA 2Y8FA 1I7AA 5D3WA 1ZC4B 4DX90 2I5FA 3G9WA 1KZGA 4YONA 4A5KA 1MK9B 1IRSA 3BINA 1B55A 4ZRIA 5J3QA 2G35A 4F7UP 5LONB 1N3HA 1BTKA 4PNKA 5FI0A 1Z87A 1EVHA 1Y19B 2GCJA 4K2OA 4CHMA 1UNQA 3PEGA 1ZC3B 2YS3A 1BAKA 5J3TA 2YS1A 1U5DA 2DKPA 3KZ1A 2RSGA 1MIZB 1QC6A 3DXDA 2DYQA 1UEFA 3T06A 4WSFA 1XX0A 2CY5A 2MWNB 1BTNA 4NSWA 5JP4A 2Y7BA 2VKIA 4A6FB 2EJ8A 2RNRB 1J0WA 3GYPA 4L6EA 2D11A 1KI1B 3TO1A 3SO6A 1P3RA 3PZDA 5EFXA 3ZDTA 4B6HA 1ZSQA 4DX8A 4Y94A 5HE3A 1FGZA 1XD4A 1Y5OA 5CLLB 2D9WA 1BWNA 1DDMA 1WJ1A 4CYEA
chains in the Genus database with same CATH superfamily
4HB3B 4K81A 1AQCA 2Z59A 5L81A 2VSZA 1MIXA 1WI1A 4EKUA 1J19A 3OANA 1ZYIA 2NBVA 1SGHA 1PFJA 3AJ4A 3PG7A 5D27A 2LOZA 2P0HA 2L2IA 1DDWA 3F0WA 4OT1A 2KGXB 2KCJA 3PVUA 2YS5A 1EGXA 5FI1A 1FB8A 2QKLA 1P5TA 2EMTA 2ELAA 2GS0A 2KIEA 2YT0A 3IVFA 5GOWB 2YSZA 2ROVA 4HAUB 3SUZA 2Z14A 2M14A 3QIJA 2DYNA 2K49A 4HAVB 1T77A 2MFQA 3D8EA 4YL8A 2H7EA 3UZTA 2KIGA 2YT2A 1X86A 1I2HA 2D9YA 1M7RA 2HE7A 1UNPA 3U8ZA 3KSYA 5D3YA 1U5FA 2UZSA 4K17A 2ZKMX 3VIAA 5JLJB 4HB4B 2NZ8B 3P7ZA 3TVVA 4EMOA 2D9VA 1DROA 1DBHA 1NTVA 2R0DA 4L1RA 3QBVB 3TCAA 4A6KA 1X1GA 2KR0A 3ODWA 5DIFB 3KRXA 2H7DA 4QXAB 1U29A 2UZRA 2DHJA 4Z2NA 2BCJA 1U5GA 4P7IA 4CHJA 4KVGB 3HK0A 3P6AA 3CXBB 1UNRA 5LG4B 5HE1A 2W2WA 5HE0A 2I5CA 5DHFB 1V88A 2FJLA 4IFSA 3WYFB 1W1GA 5KQ1A 5KQ4A 2CY4A 2J0MA 2OTXA 3F5RA 1WJMA 2YF0A 2M38A 1TJ6A 1MI1A 1X11A 3A8QA 4XWXA 2MKRA 3ZVRA 2P8VA 4BBKA 1V5PA 2J59M 1V5UA 5DHAB 1X05A 1FGYA 3TW1A 1NI2A 3NWFA 3A8PA 4GOUA 2CRFA 2RVBB 1SHCA 1RJ2A 2AEHA 1H10A 2CAYA 4K2PA 3GYOA 5JHHA 4MT7A 2I1JA 2RGNB 4QJ4B 1XODA 1H4RA 4MY6A 2YVCA 2DHKA 1P6SA 1ISNA 2LULA 2P0DA 1MK7B 3HSAA 4F7HA 2EC1A 4PQ0A 5D3XA 1W1DA 1W1HA 3BJIA 2D2QA 4EJNA 1WGQA 3X23A 3V5WA 1NTYA 2DKQA 1FHXA 5DH9B 3RCPA 1U5EA 4HB0B 2DX1A 2D9ZA 4HAYB 5CLQB 2W2XC 2Z0OA 4HSIA 4DXAB 2COAA 4KHBA 2YT1A 1XCGA 4GPTB 3FEHA 4HAZB 2GJYA 3SNHA 1X1FA 2EMSA 1KZ7A 3HIEA 1WVHA 2ELBA 1U2BA 1XKEA 2OQBA 4KHAA 3CIKA 3DXCA 5D3VA 4MK0A 1K5GB 1WG7A 4GZUA 4QJ3B 1OMWA 4ZRKA 5I2MA 3AU5A 2N23A 2RUKB 2V76A 4KHOA 3MPXA 3O96A 2P0FA 1RRPB 2VRWB 2X18A 3ML4A 4IOYX 1MPHA 2I1KA 4HAXB 5KCVA 2W2XD 2ROZB 3PVLA 1M7EA 1E5WA 1UPQA 3KRWA 1FHWA 4HDOA 1DDVA 2DN6A 2AL6A 4GMVA 3NW8A 2LYDA 2LOXA 2IFSA 5C5BA 5LOPB 4C0AA 2KUPA 2COFA 2MDXA 2D10A 2K2UA 2DFKA 5I2SA 2D4QA 3A98B 2ADZA 2DA0A 2XQNM 3A58A 1UPRA 1PMSA 2K2JA 1ZM0A 2LKOA 1PLSA 4NY0A 2RLOA 3OHMB 2L1CA 3LJUX 2NMBA 2R2YA 1MAIA 2Z0QA 3AU4A 4HAWB 4WJ7A 2YRYA 3N7CA 2Y8GA 1K5DB 2FJUB 3MDBC 3D8FA 1FOEA 4D0NB 3PSCA 2J0JA 3PP2A 5C79A 1QQGA 2RRFA 1NU2A 3VOQA 3U7DA 3DXEA 2LG1A 3ULCA 1FAOA 1TXDA 5IRSA 4HHVA 2Q13A 1EF1A 1GC7A 1V89A 2GCLA 2K8EA 3NWAA 1FHOA 1EAZA 1GG3A 3KY9A 3HQCA 5HE2A 3SYXA 4H8SA 4KHBB 3M1IB 3WA0A 4GNKB 2COCA 1U27A 2N0YA 4HATB 1AWEA 5C16A 2UVMA 4HDQA 2DHIA 4A6FA 1ZVRA 4CSQA 2GUMA 3PVWA 1LW3A 4TKNA 2D9XA 2E2XA 2DTCA 5J3YA 3D8DA 2DLWA 4IAPA 2CODA 4GMXB 2Z4DA 5C6RA 1OQNA 4GXBA 1TQZA 2PZ1A 4ZRJA 2JP2A 4HB2B 3FSSA 2QKMA 3HW2B 4A6HA 2Z13A 3ODOA 5M4YB 1LB1A 3ULBA 2IYBA 4F7GA 1MKEA 3NSUA 4DIXA 1XR0B 4Z2MB 3SV1A 5C5BB 4GN1A 4KAXB 1OY2A 2Z0PA 2HTHB 3TFMA 3FM8C 2DX5A 5DI9B 4TYZA 1V61A 2J0KA 2ZPYA 3NWDA 1V5MA 1Q67A 4OSNA 3DCXA 1WGUA 1GC6A 4WVFB 1DYNA 4DBBA 3QWMA 5JHGA 2K00A 2R09A 3ODXA 2Y8FA 1I7AA 5D3WA 1ZC4B 2KUQA 4DX90 2I5FA 3G9WA 1KZGA 4YONA 4A5KA 1MK9B 1IRSA 3BINA 1B55A 4ZRIA 5J3QA 2G35A 4F7UP 5LONB 1N3HA 1BTKA 3FVCA 4PNKA 5FI0A 1Z87A 1EVHA 1Y19B 2GCJA 4K2OA 4CHMA 1UNQA 3PEGA 1ZC3B 2YS3A 1BAKA 5J3TA 2YS1A 1U5DA 2DKPA 3KZ1A 2RSGA 1MIZB 1QC6A 3DXDA 2DYQA 1UEFA 3T06A 4WSFA 1XX0A 2CY5A 2MWNB 3U12A 1BTNA 4NSWA 5JP4A 2Y7BA 2VKIA 4A6FB 2EJ8A 2RNRB 1J0WA 3GYPA 4L6EA 2D11A 1KI1B 4QJ5B 3TO1A 3B77A 3SO6A 4D6WA 1P3RA 3PZDA 5EFXA 3ZDTA 4B6HA 1ZSQA 4DX8A 4Y94A 5HE3A 1FGZA 1XD4A 1Y5OA 5CLLB 2D9WA 1BWNA 1DDMA 1WJ1A 4CYEA
chains in the Genus database with same CATH topology
4HB3B 4K81A 1AQCA 5L81A 2VSZA 1MIXA 1WI1A 4EKUA 1J19A 3OANA 1SGHA 1PFJA 3AJ4A 3PG7A 5D27A 2LOZA 2P0HA 2L2IA 1DDWA 3F0WA 2KGXB 2KCJA 3PVUA 2YS5A 1EGXA 5FI1A 1FB8A 2QKLA 1P5TA 2EMTA 2ELAA 2GS0A 2YT0A 3IVFA 5GOWB 2YSZA 2ROVA 4HAUB 3SUZA 2M14A 3QIJA 2DYNA 4HAVB 2MFQA 3D8EA 4YL8A 2H7EA 3UZTA 1X86A 1I2HA 2D9YA 1M7RA 2HE7A 1UNPA 3U8ZA 3KSYA 5D3YA 1U5FA 2UZSA 4K17A 3VIAA 5JLJB 4HB4B 2NZ8B 3P7ZA 3TVVA 4EMOA 2D9VA 1DROA 1DBHA 1NTVA 2R0DA 3QBVB 3TCAA 4A6KA 1X1GA 3ODWA 5DIFB 3KRXA 2H7DA 1U29A 2UZRA 2DHJA 4Z2NA 2BCJA 1U5GA 4P7IA 4CHJA 4KVGB 3HK0A 3P6AA 3CXBB 1UNRA 5HE1A 2W2WA 5HE0A 2I5CA 5DHFB 1V88A 2FJLA 4IFSA 3WYFB 1W1GA 5KQ1A 5KQ4A 2CY4A 2J0MA 2OTXA 3F5RA 1WJMA 2YF0A 2M38A 1TJ6A 1X11A 3A8QA 4XWXA 2MKRA 3ZVRA 2P8VA 4BBKA 1V5PA 2J59M 1V5UA 5DHAB 1X05A 1FGYA 3TW1A 1NI2A 3A8PA 2CRFA 2RVBB 1SHCA 1RJ2A 2AEHA 1H10A 2CAYA 4K2PA 3GYOA 5JHHA 4MT7A 2I1JA 2RGNB 1XODA 1H4RA 4MY6A 2YVCA 2DHKA 1P6SA 1ISNA 2LULA 2P0DA 1MK7B 4F7HA 2EC1A 4PQ0A 5D3XA 1W1DA 1W1HA 3BJIA 2D2QA 4EJNA 1WGQA 3X23A 3V5WA 1NTYA 2DKQA 1FHXA 5DH9B 3RCPA 1U5EA 4HB0B 2DX1A 2D9ZA 4HAYB 5CLQB 2W2XC 2Z0OA 4DXAB 2COAA 2YT1A 1XCGA 4GPTB 3FEHA 4HAZB 2GJYA 3SNHA 1X1FA 2EMSA 1KZ7A 1WVHA 2ELBA 1U2BA 1XKEA 2OQBA 4KHAA 3CIKA 3DXCA 5D3VA 4MK0A 1K5GB 1WG7A 4GZUA 1OMWA 4ZRKA 3AU5A 2N23A 2RUKB 2V76A 4KHOA 3MPXA 3O96A 2P0FA 1RRPB 2VRWB 2X18A 3ML4A 4IOYX 1MPHA 2I1KA 4HAXB 5KCVA 2W2XD 2ROZB 3PVLA 1M7EA 1E5WA 1UPQA 3KRWA 1FHWA 4HDOA 1DDVA 2DN6A 2AL6A 4GMVA 2LYDA 2LOXA 2IFSA 5C5BA 5LOPB 4C0AA 2KUPA 2COFA 2MDXA 2D10A 2K2UA 2DFKA 2D4QA 3A98B 2ADZA 2DA0A 2XQNM 1UPRA 1PMSA 2K2JA 1ZM0A 2LKOA 1PLSA 4NY0A 2RLOA 2L1CA 3LJUX 2NMBA 1MAIA 2Z0QA 3AU4A 4HAWB 4WJ7A 2YRYA 3N7CA 2Y8GA 1K5DB 3MDBC 3D8FA 1FOEA 4D0NB 3PSCA 2J0JA 3PP2A 5C79A 1QQGA 1NU2A 3VOQA 3U7DA 3DXEA 2LG1A 3ULCA 1FAOA 1TXDA 4HHVA 2Q13A 1EF1A 1GC7A 1V89A 2GCLA 1FHOA 1EAZA 1GG3A 3KY9A 3HQCA 5HE2A 3SYXA 4H8SA 4KHBB 3M1IB 3WA0A 2COCA 1U27A 2N0YA 4HATB 1AWEA 5C16A 2UVMA 4HDQA 2DHIA 4A6FA 1ZVRA 3PVWA 1LW3A 4TKNA 2D9XA 2E2XA 2DTCA 5J3YA 3D8DA 2DLWA 4IAPA 2CODA 4GMXB 5C6RA 1OQNA 4GXBA 1TQZA 2PZ1A 4ZRJA 2JP2A 4HB2B 3FSSA 2QKMA 3HW2B 4A6HA 3ODOA 1LB1A 3ULBA 2IYBA 4F7GA 1MKEA 3NSUA 1XR0B 4Z2MB 3SV1A 5C5BB 4GN1A 4KAXB 1OY2A 2Z0PA 2HTHB 3TFMA 3FM8C 2DX5A 5DI9B 4TYZA 1V61A 2J0KA 2ZPYA 1V5MA 1Q67A 1WGUA 1GC6A 4WVFB 1DYNA 4DBBA 3QWMA 5JHGA 2K00A 2R09A 3ODXA 2Y8FA 1I7AA 5D3WA 1ZC4B 4DX90 2I5FA 3G9WA 1KZGA 4YONA 4A5KA 1MK9B 1IRSA 3BINA 1B55A 4ZRIA 5J3QA 2G35A 4F7UP 5LONB 1N3HA 1BTKA 4PNKA 5FI0A 1Z87A 1EVHA 1Y19B 2GCJA 4K2OA 4CHMA 1UNQA 3PEGA 1ZC3B 2YS3A 1BAKA 5J3TA 2YS1A 1U5DA 2DKPA 3KZ1A 2RSGA 1MIZB 1QC6A 3DXDA 2DYQA 1UEFA 3T06A 4WSFA 1XX0A 2CY5A 2MWNB 1BTNA 4NSWA 5JP4A 2Y7BA 2VKIA 4A6FB 2EJ8A 2RNRB 1J0WA 3GYPA 4L6EA 2D11A 1KI1B 3TO1A 3SO6A 1P3RA 3PZDA 5EFXA 3ZDTA 4B6HA 1ZSQA 4DX8A 4Y94A 5HE3A 1FGZA 1XD4A 1Y5OA 5CLLB 2D9WA 1BWNA 1DDMA 1WJ1A 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB3 B;  4K81 A;  1AQC A;  5L81 A;  2VSZ A;  1MIX A;  1WI1 A;  4EKU A;  1J19 A;  3OAN A;  1SGH A;  1PFJ A;  3AJ4 A;  3PG7 A;  5D27 A;  2LOZ A;  2P0H A;  2L2I A;  1DDW A;  3F0W A;  2KGX B;  2KCJ A;  3PVU A;  2YS5 A;  1EGX A;  5FI1 A;  1FB8 A;  2QKL A;  1P5T A;  2EMT A;  2ELA A;  2GS0 A;  2YT0 A;  3IVF A;  5GOW B;  2YSZ A;  2ROV A;  4HAU B;  3SUZ A;  2M14 A;  3QIJ A;  2DYN A;  4HAV B;  2MFQ A;  3D8E A;  4YL8 A;  2H7E A;  3UZT A;  1X86 A;  1I2H A;  2D9Y A;  1M7R A;  2HE7 A;  1UNP A;  3U8Z A;  3KSY A;  5D3Y A;  1U5F A;  2UZS A;  4K17 A;  3VIA A;  5JLJ B;  4HB4 B;  2NZ8 B;  3P7Z A;  3TVV A;  4EMO A;  2D9V A;  1DRO A;  1DBH A;  1NTV A;  2R0D A;  3QBV B;  3TCA A;  4A6K A;  1X1G A;  3ODW A;  5DIF B;  3KRX A;  2H7D A;  1U29 A;  2UZR A;  2DHJ A;  4Z2N A;  2BCJ A;  1U5G A;  4P7I A;  4CHJ A;  4KVG B;  3HK0 A;  3P6A A;  3CXB B;  1UNR A;  5HE1 A;  2W2W A;  5HE0 A;  2I5C A;  5DHF B;  1V88 A;  2FJL A;  4IFS A;  3WYF B;  1W1G A;  5KQ1 A;  5KQ4 A;  2CY4 A;  2J0M A;  2OTX A;  3F5R A;  1WJM A;  2YF0 A;  2M38 A;  1TJ6 A;  1X11 A;  3A8Q A;  4XWX A;  2MKR A;  3ZVR A;  2P8V A;  4BBK A;  1V5P A;  2J59 M;  1V5U A;  5DHA B;  1X05 A;  1FGY A;  3TW1 A;  1NI2 A;  3A8P A;  2CRF A;  2RVB B;  1SHC A;  1RJ2 A;  2AEH A;  1H10 A;  2CAY A;  4K2P A;  3GYO A;  5JHH A;  4MT7 A;  2I1J A;  2RGN B;  1XOD A;  1H4R A;  4MY6 A;  2YVC A;  2DHK A;  1P6S A;  1ISN A;  2LUL A;  2P0D A;  1MK7 B;  4F7H A;  2EC1 A;  4PQ0 A;  5D3X A;  1W1D A;  1W1H A;  3BJI A;  2D2Q A;  4EJN A;  1WGQ A;  3X23 A;  3V5W A;  1NTY A;  2DKQ A;  1FHX A;  5DH9 B;  3RCP A;  1U5E A;  4HB0 B;  2DX1 A;  2D9Z A;  4HAY B;  5CLQ B;  2W2X C;  2Z0O A;  4DXA B;  2COA A;  2YT1 A;  1XCG A;  4GPT B;  3FEH A;  4HAZ B;  2GJY A;  3SNH A;  1X1F A;  2EMS A;  1KZ7 A;  1WVH A;  2ELB A;  1U2B A;  1XKE A;  2OQB A;  4KHA A;  3CIK A;  3DXC A;  5D3V A;  4MK0 A;  1K5G B;  1WG7 A;  4GZU A;  1OMW A;  4ZRK A;  3AU5 A;  2N23 A;  2RUK B;  2V76 A;  4KHO A;  3MPX A;  3O96 A;  2P0F A;  1RRP B;  2VRW B;  2X18 A;  3ML4 A;  4IOY X;  1MPH A;  2I1K A;  4HAX B;  5KCV A;  2W2X D;  2ROZ B;  3PVL A;  1M7E A;  1E5W A;  1UPQ A;  3KRW A;  1FHW A;  4HDO A;  1DDV A;  2DN6 A;  2AL6 A;  4GMV A;  2LYD A;  2LOX A;  2IFS A;  5C5B A;  5LOP B;  4C0A A;  2KUP A;  2COF A;  2MDX A;  2D10 A;  2K2U A;  2DFK A;  2D4Q A;  3A98 B;  2ADZ A;  2DA0 A;  2XQN M;  1UPR A;  1PMS A;  2K2J A;  1ZM0 A;  2LKO A;  1PLS A;  4NY0 A;  2RLO A;  2L1C A;  3LJU X;  2NMB A;  1MAI A;  2Z0Q A;  3AU4 A;  4HAW B;  4WJ7 A;  2YRY A;  3N7C A;  2Y8G A;  1K5D B;  3MDB C;  3D8F A;  1FOE A;  4D0N B;  3PSC A;  2J0J A;  3PP2 A;  5C79 A;  1QQG A;  1NU2 A;  3VOQ A;  3U7D A;  3DXE A;  2LG1 A;  3ULC A;  1FAO A;  1TXD A;  4HHV A;  2Q13 A;  1EF1 A;  1GC7 A;  1V89 A;  2GCL A;  1FHO A;  1EAZ A;  1GG3 A;  3KY9 A;  3HQC A;  5HE2 A;  3SYX A;  4H8S A;  4KHB B;  3M1I B;  3WA0 A;  2COC A;  1U27 A;  2N0Y A;  4HAT B;  1AWE A;  5C16 A;  2UVM A;  4HDQ A;  2DHI A;  4A6F A;  1ZVR A;  3PVW A;  1LW3 A;  4TKN A;  2D9X A;  2E2X A;  2DTC A;  5J3Y A;  3D8D A;  2DLW A;  4IAP A;  2COD A;  4GMX B;  5C6R A;  1OQN A;  4GXB A;  1TQZ A;  2PZ1 A;  4ZRJ A;  2JP2 A;  4HB2 B;  3FSS A;  2QKM A;  3HW2 B;  4A6H A;  3ODO A;  1LB1 A;  3ULB A;  2IYB A;  4F7G A;  1MKE A;  3NSU A;  1XR0 B;  4Z2M B;  3SV1 A;  5C5B B;  4GN1 A;  4KAX B;  1OY2 A;  2Z0P A;  2HTH B;  3TFM A;  3FM8 C;  2DX5 A;  5DI9 B;  4TYZ A;  1V61 A;  2J0K A;  2ZPY A;  1V5M A;  1Q67 A;  1WGU A;  1GC6 A;  4WVF B;  1DYN A;  4DBB A;  3QWM A;  5JHG A;  2K00 A;  2R09 A;  3ODX A;  2Y8F A;  1I7A A;  5D3W A;  1ZC4 B;  4DX9 0;  2I5F A;  3G9W A;  1KZG A;  4YON A;  4A5K A;  1MK9 B;  1IRS A;  3BIN A;  1B55 A;  4ZRI A;  5J3Q A;  2G35 A;  4F7U P;  5LON B;  1N3H A;  1BTK A;  4PNK A;  5FI0 A;  1Z87 A;  1EVH A;  1Y19 B;  2GCJ A;  4K2O A;  4CHM A;  1UNQ A;  3PEG A;  1ZC3 B;  2YS3 A;  1BAK A;  5J3T A;  2YS1 A;  1U5D A;  2DKP A;  3KZ1 A;  2RSG A;  1MIZ B;  1QC6 A;  3DXD A;  2DYQ A;  1UEF A;  3T06 A;  4WSF A;  1XX0 A;  2CY5 A;  2MWN B;  1BTN A;  4NSW A;  5JP4 A;  2Y7B A;  2VKI A;  4A6F B;  2EJ8 A;  2RNR B;  1J0W A;  3GYP A;  4L6E A;  2D11 A;  1KI1 B;  3TO1 A;  3SO6 A;  1P3R A;  3PZD A;  5EFX A;  3ZDT A;  4B6H A;  1ZSQ A;  4DX8 A;  4Y94 A;  5HE3 A;  1FGZ A;  1XD4 A;  1Y5O A;  5CLL B;  2D9W A;  1BWN A;  1DDM A;  1WJ1 A;  4CYE A; 
#chains in the Genus database with same CATH topology
 4HB3 B;  4K81 A;  1AQC A;  2Z59 A;  5L81 A;  2VSZ A;  1MIX A;  1WI1 A;  4EKU A;  1J19 A;  3OAN A;  1ZYI A;  2NBV A;  1SGH A;  1PFJ A;  3AJ4 A;  3PG7 A;  5D27 A;  2LOZ A;  2P0H A;  2L2I A;  1DDW A;  3F0W A;  4OT1 A;  2KGX B;  2KCJ A;  3PVU A;  2YS5 A;  1EGX A;  5FI1 A;  1FB8 A;  2QKL A;  1P5T A;  2EMT A;  2ELA A;  2GS0 A;  2KIE A;  2YT0 A;  3IVF A;  5GOW B;  2YSZ A;  2ROV A;  4HAU B;  3SUZ A;  2Z14 A;  2M14 A;  3QIJ A;  2DYN A;  2K49 A;  4HAV B;  1T77 A;  2MFQ A;  3D8E A;  4YL8 A;  2H7E A;  3UZT A;  2KIG A;  2YT2 A;  1X86 A;  1I2H A;  2D9Y A;  1M7R A;  2HE7 A;  1UNP A;  3U8Z A;  3KSY A;  5D3Y A;  1U5F A;  2UZS A;  4K17 A;  2ZKM X;  3VIA A;  5JLJ B;  4HB4 B;  2NZ8 B;  3P7Z A;  3TVV A;  4EMO A;  2D9V A;  1DRO A;  1DBH A;  1NTV A;  2R0D A;  4L1R A;  3QBV B;  3TCA A;  4A6K A;  1X1G A;  2KR0 A;  3ODW A;  5DIF B;  3KRX A;  2H7D A;  4QXA B;  1U29 A;  2UZR A;  2DHJ A;  4Z2N A;  2BCJ A;  1U5G A;  4P7I A;  4CHJ A;  4KVG B;  3HK0 A;  3P6A A;  3CXB B;  1UNR A;  5LG4 B;  5HE1 A;  2W2W A;  5HE0 A;  2I5C A;  5DHF B;  1V88 A;  2FJL A;  4IFS A;  3WYF B;  1W1G A;  5KQ1 A;  5KQ4 A;  2CY4 A;  2J0M A;  2OTX A;  3F5R A;  1WJM A;  2YF0 A;  2M38 A;  1TJ6 A;  1MI1 A;  1X11 A;  3A8Q A;  4XWX A;  2MKR A;  3ZVR A;  2P8V A;  4BBK A;  1V5P A;  2J59 M;  1V5U A;  5DHA B;  1X05 A;  1FGY A;  3TW1 A;  1NI2 A;  3NWF A;  3A8P A;  4GOU A;  2CRF A;  2RVB B;  1SHC A;  1RJ2 A;  2AEH A;  1H10 A;  2CAY A;  4K2P A;  3GYO A;  5JHH A;  4MT7 A;  2I1J A;  2RGN B;  4QJ4 B;  1XOD A;  1H4R A;  4MY6 A;  2YVC A;  2DHK A;  1P6S A;  1ISN A;  2LUL A;  2P0D A;  1MK7 B;  3HSA A;  4F7H A;  2EC1 A;  4PQ0 A;  5D3X A;  1W1D A;  1W1H A;  3BJI A;  2D2Q A;  4EJN A;  1WGQ A;  3X23 A;  3V5W A;  1NTY A;  2DKQ A;  1FHX A;  5DH9 B;  3RCP A;  1U5E A;  4HB0 B;  2DX1 A;  2D9Z A;  4HAY B;  5CLQ B;  2W2X C;  2Z0O A;  4HSI A;  4DXA B;  2COA A;  4KHB A;  2YT1 A;  1XCG A;  4GPT B;  3FEH A;  4HAZ B;  2GJY A;  3SNH A;  1X1F A;  2EMS A;  1KZ7 A;  3HIE A;  1WVH A;  2ELB A;  1U2B A;  1XKE A;  2OQB A;  4KHA A;  3CIK A;  3DXC A;  5D3V A;  4MK0 A;  1K5G B;  1WG7 A;  4GZU A;  4QJ3 B;  1OMW A;  4ZRK A;  5I2M A;  3AU5 A;  2N23 A;  2RUK B;  2V76 A;  4KHO A;  3MPX A;  3O96 A;  2P0F A;  1RRP B;  2VRW B;  2X18 A;  3ML4 A;  4IOY X;  1MPH A;  2I1K A;  4HAX B;  5KCV A;  2W2X D;  2ROZ B;  3PVL A;  1M7E A;  1E5W A;  1UPQ A;  3KRW A;  1FHW A;  4HDO A;  1DDV A;  2DN6 A;  2AL6 A;  4GMV A;  3NW8 A;  2LYD A;  2LOX A;  2IFS A;  5C5B A;  5LOP B;  4C0A A;  2KUP A;  2COF A;  2MDX A;  2D10 A;  2K2U A;  2DFK A;  5I2S A;  2D4Q A;  3A98 B;  2ADZ A;  2DA0 A;  2XQN M;  3A58 A;  1UPR A;  1PMS A;  2K2J A;  1ZM0 A;  2LKO A;  1PLS A;  4NY0 A;  2RLO A;  3OHM B;  2L1C A;  3LJU X;  2NMB A;  2R2Y A;  1MAI A;  2Z0Q A;  3AU4 A;  4HAW B;  4WJ7 A;  2YRY A;  3N7C A;  2Y8G A;  1K5D B;  2FJU B;  3MDB C;  3D8F A;  1FOE A;  4D0N B;  3PSC A;  2J0J A;  3PP2 A;  5C79 A;  1QQG A;  2RRF A;  1NU2 A;  3VOQ A;  3U7D A;  3DXE A;  2LG1 A;  3ULC A;  1FAO A;  1TXD A;  5IRS A;  4HHV A;  2Q13 A;  1EF1 A;  1GC7 A;  1V89 A;  2GCL A;  2K8E A;  3NWA A;  1FHO A;  1EAZ A;  1GG3 A;  3KY9 A;  3HQC A;  5HE2 A;  3SYX A;  4H8S A;  4KHB B;  3M1I B;  3WA0 A;  4GNK B;  2COC A;  1U27 A;  2N0Y A;  4HAT B;  1AWE A;  5C16 A;  2UVM A;  4HDQ A;  2DHI A;  4A6F A;  1ZVR A;  4CSQ A;  2GUM A;  3PVW A;  1LW3 A;  4TKN A;  2D9X A;  2E2X A;  2DTC A;  5J3Y A;  3D8D A;  2DLW A;  4IAP A;  2COD A;  4GMX B;  2Z4D A;  5C6R A;  1OQN A;  4GXB A;  1TQZ A;  2PZ1 A;  4ZRJ A;  2JP2 A;  4HB2 B;  3FSS A;  2QKM A;  3HW2 B;  4A6H A;  2Z13 A;  3ODO A;  5M4Y B;  1LB1 A;  3ULB A;  2IYB A;  4F7G A;  1MKE A;  3NSU A;  4DIX A;  1XR0 B;  4Z2M B;  3SV1 A;  5C5B B;  4GN1 A;  4KAX B;  1OY2 A;  2Z0P A;  2HTH B;  3TFM A;  3FM8 C;  2DX5 A;  5DI9 B;  4TYZ A;  1V61 A;  2J0K A;  2ZPY A;  3NWD A;  1V5M A;  1Q67 A;  4OSN A;  3DCX A;  1WGU A;  1GC6 A;  4WVF B;  1DYN A;  4DBB A;  3QWM A;  5JHG A;  2K00 A;  2R09 A;  3ODX A;  2Y8F A;  1I7A A;  5D3W A;  1ZC4 B;  2KUQ A;  4DX9 0;  2I5F A;  3G9W A;  1KZG A;  4YON A;  4A5K A;  1MK9 B;  1IRS A;  3BIN A;  1B55 A;  4ZRI A;  5J3Q A;  2G35 A;  4F7U P;  5LON B;  1N3H A;  1BTK A;  3FVC A;  4PNK A;  5FI0 A;  1Z87 A;  1EVH A;  1Y19 B;  2GCJ A;  4K2O A;  4CHM A;  1UNQ A;  3PEG A;  1ZC3 B;  2YS3 A;  1BAK A;  5J3T A;  2YS1 A;  1U5D A;  2DKP A;  3KZ1 A;  2RSG A;  1MIZ B;  1QC6 A;  3DXD A;  2DYQ A;  1UEF A;  3T06 A;  4WSF A;  1XX0 A;  2CY5 A;  2MWN B;  3U12 A;  1BTN A;  4NSW A;  5JP4 A;  2Y7B A;  2VKI A;  4A6F B;  2EJ8 A;  2RNR B;  1J0W A;  3GYP A;  4L6E A;  2D11 A;  1KI1 B;  4QJ5 B;  3TO1 A;  3B77 A;  3SO6 A;  4D6W A;  1P3R A;  3PZD A;  5EFX A;  3ZDT A;  4B6H A;  1ZSQ A;  4DX8 A;  4Y94 A;  5HE3 A;  1FGZ A;  1XD4 A;  1Y5O A;  5CLL B;  2D9W A;  1BWN A;  1DDM A;  1WJ1 A;  4CYE A; 
#chains in the Genus database with same CATH homology
 4HB3 B;  4K81 A;  1AQC A;  5L81 A;  2VSZ A;  1MIX A;  1WI1 A;  4EKU A;  1J19 A;  3OAN A;  1SGH A;  1PFJ A;  3AJ4 A;  3PG7 A;  5D27 A;  2LOZ A;  2P0H A;  2L2I A;  1DDW A;  3F0W A;  2KGX B;  2KCJ A;  3PVU A;  2YS5 A;  1EGX A;  5FI1 A;  1FB8 A;  2QKL A;  1P5T A;  2EMT A;  2ELA A;  2GS0 A;  2YT0 A;  3IVF A;  5GOW B;  2YSZ A;  2ROV A;  4HAU B;  3SUZ A;  2M14 A;  3QIJ A;  2DYN A;  4HAV B;  2MFQ A;  3D8E A;  4YL8 A;  2H7E A;  3UZT A;  1X86 A;  1I2H A;  2D9Y A;  1M7R A;  2HE7 A;  1UNP A;  3U8Z A;  3KSY A;  5D3Y A;  1U5F A;  2UZS A;  4K17 A;  3VIA A;  5JLJ B;  4HB4 B;  2NZ8 B;  3P7Z A;  3TVV A;  4EMO A;  2D9V A;  1DRO A;  1DBH A;  1NTV A;  2R0D A;  3QBV B;  3TCA A;  4A6K A;  1X1G A;  3ODW A;  5DIF B;  3KRX A;  2H7D A;  1U29 A;  2UZR A;  2DHJ A;  4Z2N A;  2BCJ A;  1U5G A;  4P7I A;  4CHJ A;  4KVG B;  3HK0 A;  3P6A A;  3CXB B;  1UNR A;  5HE1 A;  2W2W A;  5HE0 A;  2I5C A;  5DHF B;  1V88 A;  2FJL A;  4IFS A;  3WYF B;  1W1G A;  5KQ1 A;  5KQ4 A;  2CY4 A;  2J0M A;  2OTX A;  3F5R A;  1WJM A;  2YF0 A;  2M38 A;  1TJ6 A;  1X11 A;  3A8Q A;  4XWX A;  2MKR A;  3ZVR A;  2P8V A;  4BBK A;  1V5P A;  2J59 M;  1V5U A;  5DHA B;  1X05 A;  1FGY A;  3TW1 A;  1NI2 A;  3A8P A;  2CRF A;  2RVB B;  1SHC A;  1RJ2 A;  2AEH A;  1H10 A;  2CAY A;  4K2P A;  3GYO A;  5JHH A;  4MT7 A;  2I1J A;  2RGN B;  1XOD A;  1H4R A;  4MY6 A;  2YVC A;  2DHK A;  1P6S A;  1ISN A;  2LUL A;  2P0D A;  1MK7 B;  4F7H A;  2EC1 A;  4PQ0 A;  5D3X A;  1W1D A;  1W1H A;  3BJI A;  2D2Q A;  4EJN A;  1WGQ A;  3X23 A;  3V5W A;  1NTY A;  2DKQ A;  1FHX A;  5DH9 B;  3RCP A;  1U5E A;  4HB0 B;  2DX1 A;  2D9Z A;  4HAY B;  5CLQ B;  2W2X C;  2Z0O A;  4DXA B;  2COA A;  2YT1 A;  1XCG A;  4GPT B;  3FEH A;  4HAZ B;  2GJY A;  3SNH A;  1X1F A;  2EMS A;  1KZ7 A;  1WVH A;  2ELB A;  1U2B A;  1XKE A;  2OQB A;  4KHA A;  3CIK A;  3DXC A;  5D3V A;  4MK0 A;  1K5G B;  1WG7 A;  4GZU A;  1OMW A;  4ZRK A;  3AU5 A;  2N23 A;  2RUK B;  2V76 A;  4KHO A;  3MPX A;  3O96 A;  2P0F A;  1RRP B;  2VRW B;  2X18 A;  3ML4 A;  4IOY X;  1MPH A;  2I1K A;  4HAX B;  5KCV A;  2W2X D;  2ROZ B;  3PVL A;  1M7E A;  1E5W A;  1UPQ A;  3KRW A;  1FHW A;  4HDO A;  1DDV A;  2DN6 A;  2AL6 A;  4GMV A;  2LYD A;  2LOX A;  2IFS A;  5C5B A;  5LOP B;  4C0A A;  2KUP A;  2COF A;  2MDX A;  2D10 A;  2K2U A;  2DFK A;  2D4Q A;  3A98 B;  2ADZ A;  2DA0 A;  2XQN M;  1UPR A;  1PMS A;  2K2J A;  1ZM0 A;  2LKO A;  1PLS A;  4NY0 A;  2RLO A;  2L1C A;  3LJU X;  2NMB A;  1MAI A;  2Z0Q A;  3AU4 A;  4HAW B;  4WJ7 A;  2YRY A;  3N7C A;  2Y8G A;  1K5D B;  3MDB C;  3D8F A;  1FOE A;  4D0N B;  3PSC A;  2J0J A;  3PP2 A;  5C79 A;  1QQG A;  1NU2 A;  3VOQ A;  3U7D A;  3DXE A;  2LG1 A;  3ULC A;  1FAO A;  1TXD A;  4HHV A;  2Q13 A;  1EF1 A;  1GC7 A;  1V89 A;  2GCL A;  1FHO A;  1EAZ A;  1GG3 A;  3KY9 A;  3HQC A;  5HE2 A;  3SYX A;  4H8S A;  4KHB B;  3M1I B;  3WA0 A;  2COC A;  1U27 A;  2N0Y A;  4HAT B;  1AWE A;  5C16 A;  2UVM A;  4HDQ A;  2DHI A;  4A6F A;  1ZVR A;  3PVW A;  1LW3 A;  4TKN A;  2D9X A;  2E2X A;  2DTC A;  5J3Y A;  3D8D A;  2DLW A;  4IAP A;  2COD A;  4GMX B;  5C6R A;  1OQN A;  4GXB A;  1TQZ A;  2PZ1 A;  4ZRJ A;  2JP2 A;  4HB2 B;  3FSS A;  2QKM A;  3HW2 B;  4A6H A;  3ODO A;  1LB1 A;  3ULB A;  2IYB A;  4F7G A;  1MKE A;  3NSU A;  1XR0 B;  4Z2M B;  3SV1 A;  5C5B B;  4GN1 A;  4KAX B;  1OY2 A;  2Z0P A;  2HTH B;  3TFM A;  3FM8 C;  2DX5 A;  5DI9 B;  4TYZ A;  1V61 A;  2J0K A;  2ZPY A;  1V5M A;  1Q67 A;  1WGU A;  1GC6 A;  4WVF B;  1DYN A;  4DBB A;  3QWM A;  5JHG A;  2K00 A;  2R09 A;  3ODX A;  2Y8F A;  1I7A A;  5D3W A;  1ZC4 B;  4DX9 0;  2I5F A;  3G9W A;  1KZG A;  4YON A;  4A5K A;  1MK9 B;  1IRS A;  3BIN A;  1B55 A;  4ZRI A;  5J3Q A;  2G35 A;  4F7U P;  5LON B;  1N3H A;  1BTK A;  4PNK A;  5FI0 A;  1Z87 A;  1EVH A;  1Y19 B;  2GCJ A;  4K2O A;  4CHM A;  1UNQ A;  3PEG A;  1ZC3 B;  2YS3 A;  1BAK A;  5J3T A;  2YS1 A;  1U5D A;  2DKP A;  3KZ1 A;  2RSG A;  1MIZ B;  1QC6 A;  3DXD A;  2DYQ A;  1UEF A;  3T06 A;  4WSF A;  1XX0 A;  2CY5 A;  2MWN B;  1BTN A;  4NSW A;  5JP4 A;  2Y7B A;  2VKI A;  4A6F B;  2EJ8 A;  2RNR B;  1J0W A;  3GYP A;  4L6E A;  2D11 A;  1KI1 B;  3TO1 A;  3SO6 A;  1P3R A;  3PZD A;  5EFX A;  3ZDT A;  4B6H A;  1ZSQ A;  4DX8 A;  4Y94 A;  5HE3 A;  1FGZ A;  1XD4 A;  1Y5O A;  5CLL B;  2D9W A;  1BWN A;  1DDM A;  1WJ1 A;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...