2MWNB

Talin-f3 / riam n-terminal peptide complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/signaling protein
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
total genus 11
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mwnB00
2DHJA 2D10A 4GMVA 4KAXB 3P6AA 4HB3B 4ZRIA 2D4QA 4KHOA 4K17A 5KQ1A 5D3XA 4K81A 4A6KA 2E2XA 3AU5A 4PQ0A 2D9YA 2DKPA 2ELAA 4B6HA 4KHBB 1EVHA 1ISNA 1X86A 1X11A 3BJIA 3TVVA 4F7HA 2YVCA 1AQCA 1DBHA 2RUKB 4DX8A 1U5FA 2FJLA 2V76A 3SUZA 2CY5A 4CHJA 1XCGA 2P0DA 4HAXB 3DXCA 5DI9B 1WGUA 2HE7A 1XKEA 2Y8GA 1P5TA 1MAIA 1UNQA 4HAWB 1M7RA 1ZM0A 1GC7A 2IFSA 1W1DA 3PG7A 1EAZA 2DX5A 3ULCA 1X1GA 4WVFB 2NMBA 2I1KA 1B55A 1NI2A 4PNKA 2YS1A 1ZSQA 2P0FA 3SYXA 2LKOA 3NSUA 2ROZB 2KCJA 3F5RA 2CY4A 3HW2B 1AWEA 3RCPA 1U5EA 2D9WA 1X05A 2IYBA 5DIFB 5HE2A 2YF0A 2GCJA 5D3YA 2P0HA 2L1CA 2H7DA 2YRYA 2D9XA 3QWMA 3FM8C 2OTXA 5JLJB 2X18A 1BAKA 3ZVRA 2D2QA 2MKRA 3UZTA 3LJUX 3IVFA 1Y19B 5D3VA 4Z2MB 1UPQA 2ZPYA 2N0YA 5KQ4A 4Y94A 2DX1A 1U5GA 2YS3A 1MIZB 4HDOA 2UZRA 1V5UA 2YT0A 1MKEA 2VSZA 1DDWA 3KY9A 2EJ8A 1U27A 4A6FA 1ZC3B 3X23A 4HAYB 1MIXA 1WJ1A 5J3QA 4IAPA 4H8SA 5C5BB 1Y5OA 3WA0A 2ADZA 2DA0A 4EKUA 2Y8FA 3PVWA 5HE3A 1NTVA 1NU2A 2J0MA 4EMOA 1WVHA 2BCJA 2D11A 2DHKA 4Z2NA 1GG3A 2Z0QA 1UNPA 3PEGA 3TW1A 4DX90 5JP4A 2UZSA 4TYZA 3ODOA 3O96A 1UEFA 1ZVRA 3GYOA 3KRWA 1LW3A 1FGZA 2RGNB 5J3TA 4ZRKA 3OANA 4MK0A 1V61A 2W2WA 4IOYX 1EGXA 5L81A 1LB1A 3U8ZA 1FHOA 4GXBA 2ELBA 5J3YA 2CAYA 3SO6A 5DHFB 5C16A 1UNRA 1P3RA 2MWNB 2R09A 3VOQA 4KVGB 3F0WA 4P7IA 5HE1A 3DXDA 5DH9B 2R0DA 3PP2A 1MPHA 4F7UP 2K00A 1I7AA 1BTKA 5EFXA 2COFA 1OQNA 1XX0A 1RRPB 3PZDA 4TKNA 3PVUA 3SNHA 1J0WA 4NY0A 2DLWA 1X1FA 2H7EA 1FHXA 1KI1B 1KZ7A 1DDVA 3A98B 2AL6A 2DTCA 2VRWB 2Z0OA 2DKQA 2J0KA 2Q13A 1W1HA 5D3WA 2D9ZA 5CLLB 1FHWA 2AEHA 1PLSA 2RLOA 5C5BA 1FOEA 1BWNA 2VKIA 3HQCA 1FGYA 3TO1A 4KHAA 4WJ7A 1ZC4B 1IRSA 3A8QA 4HATB 5JHGA 4WSFA 1V88A 1WGQA 1QQGA 3T06A 1I2HA 1U5DA 2LOXA 5CLQB 3CIKA 4XWXA 1V89A 2RSGA 4IFSA 4ZRJA 2GS0A 4HAZB 3N7CA 4NSWA 2Z0PA 4YL8A 1PMSA 5GOWB 1OMWA 1TJ6A 2GJYA 5LONB 3SV1A 2DYQA 2J59M 1TXDA 1TQZA 3CXBB 1WI1A 3FEHA 4DXAB 2XQNM 3U7DA 3ULBA 4C0AA 2CODA 4HB4B 4HB2B 2YT1A 1WG7A 3GYPA 3QBVB 2JP2A 3A8PA 1V5MA 3PSCA 1XR0B 1XD4A 2HTHB 4CHMA 2YSZA 3ODWA 4HAUB 1FAOA 2W2XD 2W2XC 1SGHA 2QKMA 2Y7BA 2UVMA 2COCA 2I5FA 3M1IB 4MY6A 1W1GA 4EJNA 1NTYA 2EC1A 4CYEA 4K2PA 1SHCA 1MK9B 2G35A 5DHAB 3G9WA 1EF1A 4GN1A 2LYDA 3ODXA 1Z87A 1RJ2A 1K5DB 1UPRA 2EMTA 2ROVA 4DBBA 5D27A 1H4RA 3HK0A 1V5PA 4BBKA 2LULA 3KSYA 3P7ZA 4L6EA 2P8VA 1GC6A 2DN6A 4F7GA 2D9VA 3ML4A 5FI0A 5JHHA 3ZDTA 1U2BA 4HHVA 2RVBB 1U29A 2YS5A 5HE0A 2L2IA 1OY2A 3PVLA 2DFKA 3MPXA 2K2JA 4A6FB 4GMXB 2M38A 1P6SA 2M14A 1Q67A 2I1JA 2PZ1A 2DHIA 3KZ1A 1N3HA 3MDBC 4K2OA 4D0NB 3AJ4A 2N23A 2K2UA 2CRFA 2QKLA 5C6RA 5FI1A 3AU4A 4GPTB 3TFMA 3V5WA 1K5GB 2KUPA 3D8EA 4A6HA 2OQBA 2NZ8B 2DYNA 1BTNA 2MFQA 1DYNA 3FSSA 2J0JA 3TCAA 1FB8A 1XODA 1M7EA 2KGXB 3D8DA 1WJMA 2MDXA 5LOPB 2LOZA 4HB0B 4MT7A 4GZUA 3VIAA 1DDMA 1J19A 3QIJA 2RNRB 1PFJA 5C79A 1H10A 3DXEA 2I5CA 3KRXA 3BINA 4A5KA 2LG1A 1QC6A 2COAA 4YONA 1MK7B 1KZGA 3D8FA 1E5WA 3WYFB 4HAVB 2GCLA 2EMSA 5KCVA 4HDQA 1DROA
chains in the Genus database with same CATH superfamily
2DHJA 2D10A 4GMVA 4KAXB 5I2MA 3P6AA 4HB3B 4ZRIA 2D4QA 4KHOA 4GOUA 4K17A 5KQ1A 5D3XA 4K81A 4A6KA 2E2XA 4OSNA 3AU5A 4QJ4B 4PQ0A 2D9YA 2DKPA 2ELAA 4B6HA 4KHBB 1EVHA 1ISNA 1X86A 1X11A 3BJIA 3TVVA 4F7HA 2YVCA 1AQCA 1DBHA 2RUKB 4DX8A 1U5FA 2FJLA 2V76A 3SUZA 2CY5A 4CHJA 2Z59A 1XCGA 2P0DA 4HAXB 3DXCA 5DI9B 1WGUA 5I2SA 2HE7A 1XKEA 2Y8GA 1P5TA 1MAIA 1UNQA 3FVCA 3U12A 4HAWB 4QJ5B 1M7RA 1ZM0A 1GC7A 2IFSA 1W1DA 3PG7A 1EAZA 2DX5A 3ULCA 1X1GA 4WVFB 2NMBA 2I1KA 1B55A 1NI2A 2FJUB 4PNKA 2YS1A 1ZSQA 2P0FA 3SYXA 2LKOA 3NSUA 2ROZB 2KCJA 3F5RA 2CY4A 3HW2B 1AWEA 3RCPA 1U5EA 2D9WA 1X05A 2IYBA 4KHBA 5DIFB 5HE2A 2YF0A 2GCJA 5D3YA 2P0HA 2L1CA 2H7DA 2YRYA 2D9XA 3QWMA 3FM8C 2OTXA 5JLJB 2X18A 1BAKA 3ZVRA 2D2QA 2MKRA 3UZTA 3LJUX 3IVFA 1Y19B 5D3VA 4Z2MB 1UPQA 2ZPYA 2N0YA 5KQ4A 4Y94A 2DX1A 1U5GA 2YS3A 1MIZB 4HDOA 2UZRA 1V5UA 2YT0A 2YT2A 1MKEA 2VSZA 1DDWA 3KY9A 2EJ8A 1U27A 4A6FA 1ZC3B 3X23A 4HAYB 1MIXA 1WJ1A 5J3QA 4D6WA 4IAPA 4H8SA 5C5BB 1Y5OA 3WA0A 2ADZA 2DA0A 4EKUA 2Y8FA 3PVWA 5HE3A 1NTVA 1NU2A 2J0MA 4EMOA 1WVHA 2BCJA 2D11A 2DHKA 4Z2NA 1GG3A 2Z0QA 1UNPA 2K8EA 3PEGA 3TW1A 3DCXA 4DX90 5JP4A 2UZSA 3OHMB 4TYZA 3ODOA 3B77A 1UEFA 3O96A 1ZVRA 3GYOA 3KRWA 1LW3A 1FGZA 2RGNB 5J3TA 4ZRKA 3OANA 4MK0A 5IRSA 1V61A 2W2WA 4IOYX 1EGXA 5L81A 1LB1A 3U8ZA 1FHOA 4GXBA 2ELBA 5J3YA 2CAYA 3SO6A 5DHFB 5C16A 1UNRA 2GUMA 1P3RA 2MWNB 2R09A 3VOQA 4KVGB 3F0WA 4P7IA 5HE1A 3DXDA 3NW8A 5DH9B 2R0DA 3PP2A 1MPHA 4F7UP 2K00A 1I7AA 1BTKA 2KIEA 5EFXA 2COFA 1OQNA 1XX0A 1RRPB 3PZDA 4TKNA 3PVUA 3SNHA 1J0WA 4NY0A 2KUQA 2DLWA 1X1FA 2H7EA 1FHXA 1KI1B 1KZ7A 2R2YA 3A58A 1DDVA 4HSIA 3A98B 2AL6A 2DTCA 2VRWB 2Z0OA 2DKQA 2J0KA 2Q13A 1W1HA 5D3WA 2D9ZA 5CLLB 1FHWA 2AEHA 1PLSA 2RLOA 5C5BA 1FOEA 1BWNA 2VKIA 3HQCA 1FGYA 2NBVA 3TO1A 4KHAA 4WJ7A 1ZC4B 1IRSA 3A8QA 4HATB 5JHGA 4WSFA 1V88A 1WGQA 1QQGA 3T06A 1I2HA 1U5DA 2LOXA 5CLQB 3CIKA 4XWXA 1V89A 2RSGA 4IFSA 4ZRJA 2GS0A 3N7CA 3NWFA 4HAZB 4L1RA 4NSWA 2Z0PA 3NWAA 4YL8A 1PMSA 5GOWB 1OMWA 2ZKMX 4QXAB 1TJ6A 2GJYA 5LONB 3SV1A 2DYQA 4OT1A 2J59M 1TXDA 1TQZA 3HSAA 3CXBB 4GNKB 5LG4B 1WI1A 3FEHA 4DXAB 1MI1A 2XQNM 3U7DA 3ULBA 4C0AA 2CODA 4HB4B 4HB2B 2YT1A 1WG7A 3GYPA 3QBVB 2JP2A 3A8PA 1V5MA 3PSCA 1XR0B 2K49A 1XD4A 2HTHB 4CHMA 2YSZA 3ODWA 4HAUB 1FAOA 2W2XD 2W2XC 4QJ3B 1SGHA 2QKMA 2Y7BA 2UVMA 2COCA 2I5FA 3M1IB 4MY6A 1W1GA 4EJNA 1NTYA 2EC1A 4CYEA 4K2PA 1T77A 2Z4DA 1SHCA 1MK9B 2G35A 5DHAB 3G9WA 1EF1A 4GN1A 2LYDA 3ODXA 1Z87A 1RJ2A 1K5DB 1UPRA 2EMTA 2ROVA 4DBBA 5D27A 1H4RA 3HK0A 1V5PA 4BBKA 2LULA 3KSYA 3P7ZA 4L6EA 2P8VA 1GC6A 2DN6A 4F7GA 2D9VA 3ML4A 5FI0A 2Z14A 3HIEA 5JHHA 3ZDTA 1U2BA 4HHVA 2RVBB 1U29A 1ZYIA 2YS5A 5HE0A 2L2IA 3NWDA 1OY2A 2RRFA 3PVLA 2DFKA 3MPXA 2Z13A 2K2JA 4A6FB 4GMXB 2M38A 1P6SA 2M14A 1Q67A 2I1JA 2PZ1A 2DHIA 3KZ1A 1N3HA 3MDBC 4K2OA 4D0NB 3AJ4A 2N23A 2K2UA 2CRFA 2QKLA 5C6RA 4DIXA 5FI1A 3AU4A 4GPTB 2KR0A 3TFMA 3V5WA 1K5GB 2KUPA 3D8EA 4A6HA 2OQBA 2KIGA 2NZ8B 2DYNA 1BTNA 2MFQA 1DYNA 3FSSA 2J0JA 3TCAA 5M4YB 1FB8A 1XODA 1M7EA 2KGXB 3D8DA 1WJMA 2MDXA 5LOPB 2LOZA 4HB0B 4MT7A 4GZUA 3VIAA 1DDMA 1J19A 3QIJA 2RNRB 1PFJA 4CSQA 5C79A 1H10A 3DXEA 2I5CA 3KRXA 3BINA 4A5KA 2LG1A 1QC6A 2COAA 4YONA 1MK7B 1KZGA 3D8FA 1E5WA 3WYFB 4HAVB 2GCLA 2EMSA 5KCVA 4HDQA 1DROA
chains in the Genus database with same CATH topology
2DHJA 2D10A 4GMVA 4KAXB 3P6AA 4HB3B 4ZRIA 2D4QA 4KHOA 4K17A 5KQ1A 5D3XA 4K81A 4A6KA 2E2XA 3AU5A 4PQ0A 2D9YA 2DKPA 2ELAA 4B6HA 4KHBB 1EVHA 1ISNA 1X86A 1X11A 3BJIA 3TVVA 4F7HA 2YVCA 1AQCA 1DBHA 2RUKB 4DX8A 1U5FA 2FJLA 2V76A 3SUZA 2CY5A 4CHJA 1XCGA 2P0DA 4HAXB 3DXCA 5DI9B 1WGUA 2HE7A 1XKEA 2Y8GA 1P5TA 1MAIA 1UNQA 4HAWB 1M7RA 1ZM0A 1GC7A 2IFSA 1W1DA 3PG7A 1EAZA 2DX5A 3ULCA 1X1GA 4WVFB 2NMBA 2I1KA 1B55A 1NI2A 4PNKA 2YS1A 1ZSQA 2P0FA 3SYXA 2LKOA 3NSUA 2ROZB 2KCJA 3F5RA 2CY4A 3HW2B 1AWEA 3RCPA 1U5EA 2D9WA 1X05A 2IYBA 5DIFB 5HE2A 2YF0A 2GCJA 5D3YA 2P0HA 2L1CA 2H7DA 2YRYA 2D9XA 3QWMA 3FM8C 2OTXA 5JLJB 2X18A 1BAKA 3ZVRA 2D2QA 2MKRA 3UZTA 3LJUX 3IVFA 1Y19B 5D3VA 4Z2MB 1UPQA 2ZPYA 2N0YA 5KQ4A 4Y94A 2DX1A 1U5GA 2YS3A 1MIZB 4HDOA 2UZRA 1V5UA 2YT0A 1MKEA 2VSZA 1DDWA 3KY9A 2EJ8A 1U27A 4A6FA 1ZC3B 3X23A 4HAYB 1MIXA 1WJ1A 5J3QA 4IAPA 4H8SA 5C5BB 1Y5OA 3WA0A 2ADZA 2DA0A 4EKUA 2Y8FA 3PVWA 5HE3A 1NTVA 1NU2A 2J0MA 4EMOA 1WVHA 2BCJA 2D11A 2DHKA 4Z2NA 1GG3A 2Z0QA 1UNPA 3PEGA 3TW1A 4DX90 5JP4A 2UZSA 4TYZA 3ODOA 3O96A 1UEFA 1ZVRA 3GYOA 3KRWA 1LW3A 1FGZA 2RGNB 5J3TA 4ZRKA 3OANA 4MK0A 1V61A 2W2WA 4IOYX 1EGXA 5L81A 1LB1A 3U8ZA 1FHOA 4GXBA 2ELBA 5J3YA 2CAYA 3SO6A 5DHFB 5C16A 1UNRA 1P3RA 2MWNB 2R09A 3VOQA 4KVGB 3F0WA 4P7IA 5HE1A 3DXDA 5DH9B 2R0DA 3PP2A 1MPHA 4F7UP 2K00A 1I7AA 1BTKA 5EFXA 2COFA 1OQNA 1XX0A 1RRPB 3PZDA 4TKNA 3PVUA 3SNHA 1J0WA 4NY0A 2DLWA 1X1FA 2H7EA 1FHXA 1KI1B 1KZ7A 1DDVA 3A98B 2AL6A 2DTCA 2VRWB 2Z0OA 2DKQA 2J0KA 2Q13A 1W1HA 5D3WA 2D9ZA 5CLLB 1FHWA 2AEHA 1PLSA 2RLOA 5C5BA 1FOEA 1BWNA 2VKIA 3HQCA 1FGYA 3TO1A 4KHAA 4WJ7A 1ZC4B 1IRSA 3A8QA 4HATB 5JHGA 4WSFA 1V88A 1WGQA 1QQGA 3T06A 1I2HA 1U5DA 2LOXA 5CLQB 3CIKA 4XWXA 1V89A 2RSGA 4IFSA 4ZRJA 2GS0A 4HAZB 3N7CA 4NSWA 2Z0PA 4YL8A 1PMSA 5GOWB 1OMWA 1TJ6A 2GJYA 5LONB 3SV1A 2DYQA 2J59M 1TXDA 1TQZA 3CXBB 1WI1A 3FEHA 4DXAB 2XQNM 3U7DA 3ULBA 4C0AA 2CODA 4HB4B 4HB2B 2YT1A 1WG7A 3GYPA 3QBVB 2JP2A 3A8PA 1V5MA 3PSCA 1XR0B 1XD4A 2HTHB 4CHMA 2YSZA 3ODWA 4HAUB 1FAOA 2W2XD 2W2XC 1SGHA 2QKMA 2Y7BA 2UVMA 2COCA 2I5FA 3M1IB 4MY6A 1W1GA 4EJNA 1NTYA 2EC1A 4CYEA 4K2PA 1SHCA 1MK9B 2G35A 5DHAB 3G9WA 1EF1A 4GN1A 2LYDA 3ODXA 1Z87A 1RJ2A 1K5DB 1UPRA 2EMTA 2ROVA 4DBBA 5D27A 1H4RA 3HK0A 1V5PA 4BBKA 2LULA 3KSYA 3P7ZA 4L6EA 2P8VA 1GC6A 2DN6A 4F7GA 2D9VA 3ML4A 5FI0A 5JHHA 3ZDTA 1U2BA 4HHVA 2RVBB 1U29A 2YS5A 5HE0A 2L2IA 1OY2A 3PVLA 2DFKA 3MPXA 2K2JA 4A6FB 4GMXB 2M38A 1P6SA 2M14A 1Q67A 2I1JA 2PZ1A 2DHIA 3KZ1A 1N3HA 3MDBC 4K2OA 4D0NB 3AJ4A 2N23A 2K2UA 2CRFA 2QKLA 5C6RA 5FI1A 3AU4A 4GPTB 3TFMA 3V5WA 1K5GB 2KUPA 3D8EA 4A6HA 2OQBA 2NZ8B 2DYNA 1BTNA 2MFQA 1DYNA 3FSSA 2J0JA 3TCAA 1FB8A 1XODA 1M7EA 2KGXB 3D8DA 1WJMA 2MDXA 5LOPB 2LOZA 4HB0B 4MT7A 4GZUA 3VIAA 1DDMA 1J19A 3QIJA 2RNRB 1PFJA 5C79A 1H10A 3DXEA 2I5CA 3KRXA 3BINA 4A5KA 2LG1A 1QC6A 2COAA 4YONA 1MK7B 1KZGA 3D8FA 1E5WA 3WYFB 4HAVB 2GCLA 2EMSA 5KCVA 4HDQA 1DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHJ A;  2D10 A;  4GMV A;  4KAX B;  3P6A A;  4HB3 B;  4ZRI A;  2D4Q A;  4KHO A;  4K17 A;  5KQ1 A;  5D3X A;  4K81 A;  4A6K A;  2E2X A;  3AU5 A;  4PQ0 A;  2D9Y A;  2DKP A;  2ELA A;  4B6H A;  4KHB B;  1EVH A;  1ISN A;  1X86 A;  1X11 A;  3BJI A;  3TVV A;  4F7H A;  2YVC A;  1AQC A;  1DBH A;  2RUK B;  4DX8 A;  1U5F A;  2FJL A;  2V76 A;  3SUZ A;  2CY5 A;  4CHJ A;  1XCG A;  2P0D A;  4HAX B;  3DXC A;  5DI9 B;  1WGU A;  2HE7 A;  1XKE A;  2Y8G A;  1P5T A;  1MAI A;  1UNQ A;  4HAW B;  1M7R A;  1ZM0 A;  1GC7 A;  2IFS A;  1W1D A;  3PG7 A;  1EAZ A;  2DX5 A;  3ULC A;  1X1G A;  4WVF B;  2NMB A;  2I1K A;  1B55 A;  1NI2 A;  4PNK A;  2YS1 A;  1ZSQ A;  2P0F A;  3SYX A;  2LKO A;  3NSU A;  2ROZ B;  2KCJ A;  3F5R A;  2CY4 A;  3HW2 B;  1AWE A;  3RCP A;  1U5E A;  2D9W A;  1X05 A;  2IYB A;  5DIF B;  5HE2 A;  2YF0 A;  2GCJ A;  5D3Y A;  2P0H A;  2L1C A;  2H7D A;  2YRY A;  2D9X A;  3QWM A;  3FM8 C;  2OTX A;  5JLJ B;  2X18 A;  1BAK A;  3ZVR A;  2D2Q A;  2MKR A;  3UZT A;  3LJU X;  3IVF A;  1Y19 B;  5D3V A;  4Z2M B;  1UPQ A;  2ZPY A;  2N0Y A;  5KQ4 A;  4Y94 A;  2DX1 A;  1U5G A;  2YS3 A;  1MIZ B;  4HDO A;  2UZR A;  1V5U A;  2YT0 A;  1MKE A;  2VSZ A;  1DDW A;  3KY9 A;  2EJ8 A;  1U27 A;  4A6F A;  1ZC3 B;  3X23 A;  4HAY B;  1MIX A;  1WJ1 A;  5J3Q A;  4IAP A;  4H8S A;  5C5B B;  1Y5O A;  3WA0 A;  2ADZ A;  2DA0 A;  4EKU A;  2Y8F A;  3PVW A;  5HE3 A;  1NTV A;  1NU2 A;  2J0M A;  4EMO A;  1WVH A;  2BCJ A;  2D11 A;  2DHK A;  4Z2N A;  1GG3 A;  2Z0Q A;  1UNP A;  3PEG A;  3TW1 A;  4DX9 0;  5JP4 A;  2UZS A;  4TYZ A;  3ODO A;  3O96 A;  1UEF A;  1ZVR A;  3GYO A;  3KRW A;  1LW3 A;  1FGZ A;  2RGN B;  5J3T A;  4ZRK A;  3OAN A;  4MK0 A;  1V61 A;  2W2W A;  4IOY X;  1EGX A;  5L81 A;  1LB1 A;  3U8Z A;  1FHO A;  4GXB A;  2ELB A;  5J3Y A;  2CAY A;  3SO6 A;  5DHF B;  5C16 A;  1UNR A;  1P3R A;  2MWN B;  2R09 A;  3VOQ A;  4KVG B;  3F0W A;  4P7I A;  5HE1 A;  3DXD A;  5DH9 B;  2R0D A;  3PP2 A;  1MPH A;  4F7U P;  2K00 A;  1I7A A;  1BTK A;  5EFX A;  2COF A;  1OQN A;  1XX0 A;  1RRP B;  3PZD A;  4TKN A;  3PVU A;  3SNH A;  1J0W A;  4NY0 A;  2DLW A;  1X1F A;  2H7E A;  1FHX A;  1KI1 B;  1KZ7 A;  1DDV A;  3A98 B;  2AL6 A;  2DTC A;  2VRW B;  2Z0O A;  2DKQ A;  2J0K A;  2Q13 A;  1W1H A;  5D3W A;  2D9Z A;  5CLL B;  1FHW A;  2AEH A;  1PLS A;  2RLO A;  5C5B A;  1FOE A;  1BWN A;  2VKI A;  3HQC A;  1FGY A;  3TO1 A;  4KHA A;  4WJ7 A;  1ZC4 B;  1IRS A;  3A8Q A;  4HAT B;  5JHG A;  4WSF A;  1V88 A;  1WGQ A;  1QQG A;  3T06 A;  1I2H A;  1U5D A;  2LOX A;  5CLQ B;  3CIK A;  4XWX A;  1V89 A;  2RSG A;  4IFS A;  4ZRJ A;  2GS0 A;  4HAZ B;  3N7C A;  4NSW A;  2Z0P A;  4YL8 A;  1PMS A;  5GOW B;  1OMW A;  1TJ6 A;  2GJY A;  5LON B;  3SV1 A;  2DYQ A;  2J59 M;  1TXD A;  1TQZ A;  3CXB B;  1WI1 A;  3FEH A;  4DXA B;  2XQN M;  3U7D A;  3ULB A;  4C0A A;  2COD A;  4HB4 B;  4HB2 B;  2YT1 A;  1WG7 A;  3GYP A;  3QBV B;  2JP2 A;  3A8P A;  1V5M A;  3PSC A;  1XR0 B;  1XD4 A;  2HTH B;  4CHM A;  2YSZ A;  3ODW A;  4HAU B;  1FAO A;  2W2X D;  2W2X C;  1SGH A;  2QKM A;  2Y7B A;  2UVM A;  2COC A;  2I5F A;  3M1I B;  4MY6 A;  1W1G A;  4EJN A;  1NTY A;  2EC1 A;  4CYE A;  4K2P A;  1SHC A;  1MK9 B;  2G35 A;  5DHA B;  3G9W A;  1EF1 A;  4GN1 A;  2LYD A;  3ODX A;  1Z87 A;  1RJ2 A;  1K5D B;  1UPR A;  2EMT A;  2ROV A;  4DBB A;  5D27 A;  1H4R A;  3HK0 A;  1V5P A;  4BBK A;  2LUL A;  3KSY A;  3P7Z A;  4L6E A;  2P8V A;  1GC6 A;  2DN6 A;  4F7G A;  2D9V A;  3ML4 A;  5FI0 A;  5JHH A;  3ZDT A;  1U2B A;  4HHV A;  2RVB B;  1U29 A;  2YS5 A;  5HE0 A;  2L2I A;  1OY2 A;  3PVL A;  2DFK A;  3MPX A;  2K2J A;  4A6F B;  4GMX B;  2M38 A;  1P6S A;  2M14 A;  1Q67 A;  2I1J A;  2PZ1 A;  2DHI A;  3KZ1 A;  1N3H A;  3MDB C;  4K2O A;  4D0N B;  3AJ4 A;  2N23 A;  2K2U A;  2CRF A;  2QKL A;  5C6R A;  5FI1 A;  3AU4 A;  4GPT B;  3TFM A;  3V5W A;  1K5G B;  2KUP A;  3D8E A;  4A6H A;  2OQB A;  2NZ8 B;  2DYN A;  1BTN A;  2MFQ A;  1DYN A;  3FSS A;  2J0J A;  3TCA A;  1FB8 A;  1XOD A;  1M7E A;  2KGX B;  3D8D A;  1WJM A;  2MDX A;  5LOP B;  2LOZ A;  4HB0 B;  4MT7 A;  4GZU A;  3VIA A;  1DDM A;  1J19 A;  3QIJ A;  2RNR B;  1PFJ A;  5C79 A;  1H10 A;  3DXE A;  2I5C A;  3KRX A;  3BIN A;  4A5K A;  2LG1 A;  1QC6 A;  2COA A;  4YON A;  1MK7 B;  1KZG A;  3D8F A;  1E5W A;  3WYF B;  4HAV B;  2GCL A;  2EMS A;  5KCV A;  4HDQ A;  1DRO A; 
#chains in the Genus database with same CATH topology
 2DHJ A;  2D10 A;  4GMV A;  4KAX B;  5I2M A;  3P6A A;  4HB3 B;  4ZRI A;  2D4Q A;  4KHO A;  4GOU A;  4K17 A;  5KQ1 A;  5D3X A;  4K81 A;  4A6K A;  2E2X A;  4OSN A;  3AU5 A;  4QJ4 B;  4PQ0 A;  2D9Y A;  2DKP A;  2ELA A;  4B6H A;  4KHB B;  1EVH A;  1ISN A;  1X86 A;  1X11 A;  3BJI A;  3TVV A;  4F7H A;  2YVC A;  1AQC A;  1DBH A;  2RUK B;  4DX8 A;  1U5F A;  2FJL A;  2V76 A;  3SUZ A;  2CY5 A;  4CHJ A;  2Z59 A;  1XCG A;  2P0D A;  4HAX B;  3DXC A;  5DI9 B;  1WGU A;  5I2S A;  2HE7 A;  1XKE A;  2Y8G A;  1P5T A;  1MAI A;  1UNQ A;  3FVC A;  3U12 A;  4HAW B;  4QJ5 B;  1M7R A;  1ZM0 A;  1GC7 A;  2IFS A;  1W1D A;  3PG7 A;  1EAZ A;  2DX5 A;  3ULC A;  1X1G A;  4WVF B;  2NMB A;  2I1K A;  1B55 A;  1NI2 A;  2FJU B;  4PNK A;  2YS1 A;  1ZSQ A;  2P0F A;  3SYX A;  2LKO A;  3NSU A;  2ROZ B;  2KCJ A;  3F5R A;  2CY4 A;  3HW2 B;  1AWE A;  3RCP A;  1U5E A;  2D9W A;  1X05 A;  2IYB A;  4KHB A;  5DIF B;  5HE2 A;  2YF0 A;  2GCJ A;  5D3Y A;  2P0H A;  2L1C A;  2H7D A;  2YRY A;  2D9X A;  3QWM A;  3FM8 C;  2OTX A;  5JLJ B;  2X18 A;  1BAK A;  3ZVR A;  2D2Q A;  2MKR A;  3UZT A;  3LJU X;  3IVF A;  1Y19 B;  5D3V A;  4Z2M B;  1UPQ A;  2ZPY A;  2N0Y A;  5KQ4 A;  4Y94 A;  2DX1 A;  1U5G A;  2YS3 A;  1MIZ B;  4HDO A;  2UZR A;  1V5U A;  2YT0 A;  2YT2 A;  1MKE A;  2VSZ A;  1DDW A;  3KY9 A;  2EJ8 A;  1U27 A;  4A6F A;  1ZC3 B;  3X23 A;  4HAY B;  1MIX A;  1WJ1 A;  5J3Q A;  4D6W A;  4IAP A;  4H8S A;  5C5B B;  1Y5O A;  3WA0 A;  2ADZ A;  2DA0 A;  4EKU A;  2Y8F A;  3PVW A;  5HE3 A;  1NTV A;  1NU2 A;  2J0M A;  4EMO A;  1WVH A;  2BCJ A;  2D11 A;  2DHK A;  4Z2N A;  1GG3 A;  2Z0Q A;  1UNP A;  2K8E A;  3PEG A;  3TW1 A;  3DCX A;  4DX9 0;  5JP4 A;  2UZS A;  3OHM B;  4TYZ A;  3ODO A;  3B77 A;  1UEF A;  3O96 A;  1ZVR A;  3GYO A;  3KRW A;  1LW3 A;  1FGZ A;  2RGN B;  5J3T A;  4ZRK A;  3OAN A;  4MK0 A;  5IRS A;  1V61 A;  2W2W A;  4IOY X;  1EGX A;  5L81 A;  1LB1 A;  3U8Z A;  1FHO A;  4GXB A;  2ELB A;  5J3Y A;  2CAY A;  3SO6 A;  5DHF B;  5C16 A;  1UNR A;  2GUM A;  1P3R A;  2MWN B;  2R09 A;  3VOQ A;  4KVG B;  3F0W A;  4P7I A;  5HE1 A;  3DXD A;  3NW8 A;  5DH9 B;  2R0D A;  3PP2 A;  1MPH A;  4F7U P;  2K00 A;  1I7A A;  1BTK A;  2KIE A;  5EFX A;  2COF A;  1OQN A;  1XX0 A;  1RRP B;  3PZD A;  4TKN A;  3PVU A;  3SNH A;  1J0W A;  4NY0 A;  2KUQ A;  2DLW A;  1X1F A;  2H7E A;  1FHX A;  1KI1 B;  1KZ7 A;  2R2Y A;  3A58 A;  1DDV A;  4HSI A;  3A98 B;  2AL6 A;  2DTC A;  2VRW B;  2Z0O A;  2DKQ A;  2J0K A;  2Q13 A;  1W1H A;  5D3W A;  2D9Z A;  5CLL B;  1FHW A;  2AEH A;  1PLS A;  2RLO A;  5C5B A;  1FOE A;  1BWN A;  2VKI A;  3HQC A;  1FGY A;  2NBV A;  3TO1 A;  4KHA A;  4WJ7 A;  1ZC4 B;  1IRS A;  3A8Q A;  4HAT B;  5JHG A;  4WSF A;  1V88 A;  1WGQ A;  1QQG A;  3T06 A;  1I2H A;  1U5D A;  2LOX A;  5CLQ B;  3CIK A;  4XWX A;  1V89 A;  2RSG A;  4IFS A;  4ZRJ A;  2GS0 A;  3N7C A;  3NWF A;  4HAZ B;  4L1R A;  4NSW A;  2Z0P A;  3NWA A;  4YL8 A;  1PMS A;  5GOW B;  1OMW A;  2ZKM X;  4QXA B;  1TJ6 A;  2GJY A;  5LON B;  3SV1 A;  2DYQ A;  4OT1 A;  2J59 M;  1TXD A;  1TQZ A;  3HSA A;  3CXB B;  4GNK B;  5LG4 B;  1WI1 A;  3FEH A;  4DXA B;  1MI1 A;  2XQN M;  3U7D A;  3ULB A;  4C0A A;  2COD A;  4HB4 B;  4HB2 B;  2YT1 A;  1WG7 A;  3GYP A;  3QBV B;  2JP2 A;  3A8P A;  1V5M A;  3PSC A;  1XR0 B;  2K49 A;  1XD4 A;  2HTH B;  4CHM A;  2YSZ A;  3ODW A;  4HAU B;  1FAO A;  2W2X D;  2W2X C;  4QJ3 B;  1SGH A;  2QKM A;  2Y7B A;  2UVM A;  2COC A;  2I5F A;  3M1I B;  4MY6 A;  1W1G A;  4EJN A;  1NTY A;  2EC1 A;  4CYE A;  4K2P A;  1T77 A;  2Z4D A;  1SHC A;  1MK9 B;  2G35 A;  5DHA B;  3G9W A;  1EF1 A;  4GN1 A;  2LYD A;  3ODX A;  1Z87 A;  1RJ2 A;  1K5D B;  1UPR A;  2EMT A;  2ROV A;  4DBB A;  5D27 A;  1H4R A;  3HK0 A;  1V5P A;  4BBK A;  2LUL A;  3KSY A;  3P7Z A;  4L6E A;  2P8V A;  1GC6 A;  2DN6 A;  4F7G A;  2D9V A;  3ML4 A;  5FI0 A;  2Z14 A;  3HIE A;  5JHH A;  3ZDT A;  1U2B A;  4HHV A;  2RVB B;  1U29 A;  1ZYI A;  2YS5 A;  5HE0 A;  2L2I A;  3NWD A;  1OY2 A;  2RRF A;  3PVL A;  2DFK A;  3MPX A;  2Z13 A;  2K2J A;  4A6F B;  4GMX B;  2M38 A;  1P6S A;  2M14 A;  1Q67 A;  2I1J A;  2PZ1 A;  2DHI A;  3KZ1 A;  1N3H A;  3MDB C;  4K2O A;  4D0N B;  3AJ4 A;  2N23 A;  2K2U A;  2CRF A;  2QKL A;  5C6R A;  4DIX A;  5FI1 A;  3AU4 A;  4GPT B;  2KR0 A;  3TFM A;  3V5W A;  1K5G B;  2KUP A;  3D8E A;  4A6H A;  2OQB A;  2KIG A;  2NZ8 B;  2DYN A;  1BTN A;  2MFQ A;  1DYN A;  3FSS A;  2J0J A;  3TCA A;  5M4Y B;  1FB8 A;  1XOD A;  1M7E A;  2KGX B;  3D8D A;  1WJM A;  2MDX A;  5LOP B;  2LOZ A;  4HB0 B;  4MT7 A;  4GZU A;  3VIA A;  1DDM A;  1J19 A;  3QIJ A;  2RNR B;  1PFJ A;  4CSQ A;  5C79 A;  1H10 A;  3DXE A;  2I5C A;  3KRX A;  3BIN A;  4A5K A;  2LG1 A;  1QC6 A;  2COA A;  4YON A;  1MK7 B;  1KZG A;  3D8F A;  1E5W A;  3WYF B;  4HAV B;  2GCL A;  2EMS A;  5KCV A;  4HDQ A;  1DRO A; 
#chains in the Genus database with same CATH homology
 2DHJ A;  2D10 A;  4GMV A;  4KAX B;  3P6A A;  4HB3 B;  4ZRI A;  2D4Q A;  4KHO A;  4K17 A;  5KQ1 A;  5D3X A;  4K81 A;  4A6K A;  2E2X A;  3AU5 A;  4PQ0 A;  2D9Y A;  2DKP A;  2ELA A;  4B6H A;  4KHB B;  1EVH A;  1ISN A;  1X86 A;  1X11 A;  3BJI A;  3TVV A;  4F7H A;  2YVC A;  1AQC A;  1DBH A;  2RUK B;  4DX8 A;  1U5F A;  2FJL A;  2V76 A;  3SUZ A;  2CY5 A;  4CHJ A;  1XCG A;  2P0D A;  4HAX B;  3DXC A;  5DI9 B;  1WGU A;  2HE7 A;  1XKE A;  2Y8G A;  1P5T A;  1MAI A;  1UNQ A;  4HAW B;  1M7R A;  1ZM0 A;  1GC7 A;  2IFS A;  1W1D A;  3PG7 A;  1EAZ A;  2DX5 A;  3ULC A;  1X1G A;  4WVF B;  2NMB A;  2I1K A;  1B55 A;  1NI2 A;  4PNK A;  2YS1 A;  1ZSQ A;  2P0F A;  3SYX A;  2LKO A;  3NSU A;  2ROZ B;  2KCJ A;  3F5R A;  2CY4 A;  3HW2 B;  1AWE A;  3RCP A;  1U5E A;  2D9W A;  1X05 A;  2IYB A;  5DIF B;  5HE2 A;  2YF0 A;  2GCJ A;  5D3Y A;  2P0H A;  2L1C A;  2H7D A;  2YRY A;  2D9X A;  3QWM A;  3FM8 C;  2OTX A;  5JLJ B;  2X18 A;  1BAK A;  3ZVR A;  2D2Q A;  2MKR A;  3UZT A;  3LJU X;  3IVF A;  1Y19 B;  5D3V A;  4Z2M B;  1UPQ A;  2ZPY A;  2N0Y A;  5KQ4 A;  4Y94 A;  2DX1 A;  1U5G A;  2YS3 A;  1MIZ B;  4HDO A;  2UZR A;  1V5U A;  2YT0 A;  1MKE A;  2VSZ A;  1DDW A;  3KY9 A;  2EJ8 A;  1U27 A;  4A6F A;  1ZC3 B;  3X23 A;  4HAY B;  1MIX A;  1WJ1 A;  5J3Q A;  4IAP A;  4H8S A;  5C5B B;  1Y5O A;  3WA0 A;  2ADZ A;  2DA0 A;  4EKU A;  2Y8F A;  3PVW A;  5HE3 A;  1NTV A;  1NU2 A;  2J0M A;  4EMO A;  1WVH A;  2BCJ A;  2D11 A;  2DHK A;  4Z2N A;  1GG3 A;  2Z0Q A;  1UNP A;  3PEG A;  3TW1 A;  4DX9 0;  5JP4 A;  2UZS A;  4TYZ A;  3ODO A;  3O96 A;  1UEF A;  1ZVR A;  3GYO A;  3KRW A;  1LW3 A;  1FGZ A;  2RGN B;  5J3T A;  4ZRK A;  3OAN A;  4MK0 A;  1V61 A;  2W2W A;  4IOY X;  1EGX A;  5L81 A;  1LB1 A;  3U8Z A;  1FHO A;  4GXB A;  2ELB A;  5J3Y A;  2CAY A;  3SO6 A;  5DHF B;  5C16 A;  1UNR A;  1P3R A;  2MWN B;  2R09 A;  3VOQ A;  4KVG B;  3F0W A;  4P7I A;  5HE1 A;  3DXD A;  5DH9 B;  2R0D A;  3PP2 A;  1MPH A;  4F7U P;  2K00 A;  1I7A A;  1BTK A;  5EFX A;  2COF A;  1OQN A;  1XX0 A;  1RRP B;  3PZD A;  4TKN A;  3PVU A;  3SNH A;  1J0W A;  4NY0 A;  2DLW A;  1X1F A;  2H7E A;  1FHX A;  1KI1 B;  1KZ7 A;  1DDV A;  3A98 B;  2AL6 A;  2DTC A;  2VRW B;  2Z0O A;  2DKQ A;  2J0K A;  2Q13 A;  1W1H A;  5D3W A;  2D9Z A;  5CLL B;  1FHW A;  2AEH A;  1PLS A;  2RLO A;  5C5B A;  1FOE A;  1BWN A;  2VKI A;  3HQC A;  1FGY A;  3TO1 A;  4KHA A;  4WJ7 A;  1ZC4 B;  1IRS A;  3A8Q A;  4HAT B;  5JHG A;  4WSF A;  1V88 A;  1WGQ A;  1QQG A;  3T06 A;  1I2H A;  1U5D A;  2LOX A;  5CLQ B;  3CIK A;  4XWX A;  1V89 A;  2RSG A;  4IFS A;  4ZRJ A;  2GS0 A;  4HAZ B;  3N7C A;  4NSW A;  2Z0P A;  4YL8 A;  1PMS A;  5GOW B;  1OMW A;  1TJ6 A;  2GJY A;  5LON B;  3SV1 A;  2DYQ A;  2J59 M;  1TXD A;  1TQZ A;  3CXB B;  1WI1 A;  3FEH A;  4DXA B;  2XQN M;  3U7D A;  3ULB A;  4C0A A;  2COD A;  4HB4 B;  4HB2 B;  2YT1 A;  1WG7 A;  3GYP A;  3QBV B;  2JP2 A;  3A8P A;  1V5M A;  3PSC A;  1XR0 B;  1XD4 A;  2HTH B;  4CHM A;  2YSZ A;  3ODW A;  4HAU B;  1FAO A;  2W2X D;  2W2X C;  1SGH A;  2QKM A;  2Y7B A;  2UVM A;  2COC A;  2I5F A;  3M1I B;  4MY6 A;  1W1G A;  4EJN A;  1NTY A;  2EC1 A;  4CYE A;  4K2P A;  1SHC A;  1MK9 B;  2G35 A;  5DHA B;  3G9W A;  1EF1 A;  4GN1 A;  2LYD A;  3ODX A;  1Z87 A;  1RJ2 A;  1K5D B;  1UPR A;  2EMT A;  2ROV A;  4DBB A;  5D27 A;  1H4R A;  3HK0 A;  1V5P A;  4BBK A;  2LUL A;  3KSY A;  3P7Z A;  4L6E A;  2P8V A;  1GC6 A;  2DN6 A;  4F7G A;  2D9V A;  3ML4 A;  5FI0 A;  5JHH A;  3ZDT A;  1U2B A;  4HHV A;  2RVB B;  1U29 A;  2YS5 A;  5HE0 A;  2L2I A;  1OY2 A;  3PVL A;  2DFK A;  3MPX A;  2K2J A;  4A6F B;  4GMX B;  2M38 A;  1P6S A;  2M14 A;  1Q67 A;  2I1J A;  2PZ1 A;  2DHI A;  3KZ1 A;  1N3H A;  3MDB C;  4K2O A;  4D0N B;  3AJ4 A;  2N23 A;  2K2U A;  2CRF A;  2QKL A;  5C6R A;  5FI1 A;  3AU4 A;  4GPT B;  3TFM A;  3V5W A;  1K5G B;  2KUP A;  3D8E A;  4A6H A;  2OQB A;  2NZ8 B;  2DYN A;  1BTN A;  2MFQ A;  1DYN A;  3FSS A;  2J0J A;  3TCA A;  1FB8 A;  1XOD A;  1M7E A;  2KGX B;  3D8D A;  1WJM A;  2MDX A;  5LOP B;  2LOZ A;  4HB0 B;  4MT7 A;  4GZU A;  3VIA A;  1DDM A;  1J19 A;  3QIJ A;  2RNR B;  1PFJ A;  5C79 A;  1H10 A;  3DXE A;  2I5C A;  3KRX A;  3BIN A;  4A5K A;  2LG1 A;  1QC6 A;  2COA A;  4YON A;  1MK7 B;  1KZG A;  3D8F A;  1E5W A;  3WYF B;  4HAV B;  2GCL A;  2EMS A;  5KCV A;  4HDQ A;  1DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...