2MWNB

Talin-f3 / riam n-terminal peptide complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/signaling protein
total genus 11
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mwnB00
4H8SA 5KQ1A 2G35A 1OMWA 2CY5A 4A6FA 2DHKA 2QKMA 3WA0A 3PP2A 1P6SA 1K5DB 3ODWA 1K5GB 4ZRIA 3P6AA 2UZSA 5LOPB 1KI1B 2Z0QA 5CLLB 2L1CA 1RRPB 2D9XA 1BTNA 4PQ0A 5L81A 2ELBA 1PLSA 1ZC4B 2DLWA 3TVVA 2PZ1A 3O96A 5JHGA 2CAYA 4IAPA 3CXBB 4HAWB 2DTCA 3F5RA 2VSZA 4GZUA 1FHXA 3A98B 5DI9B 2KUPA 2W2XD 4GPTB 4B6HA 3KRXA 3A8PA 4F7GA 2P0DA 4D0NB 2OTXA 4HB2B 3GYPA 4Z2MB 1U5EA 2Y8GA 2RNRB 1MAIA 2LKOA 2LOZA 2D9ZA 2IYBA 3TFMA 1MK9B 4MY6A 1FB8A 2COCA 5DHFB 2J0JA 1H10A 1FGYA 2DYNA 2YT0A 2LYDA 1EVHA 2Q13A 1XD4A 5HE2A 5HE0A 3VIAA 1TQZA 1NTVA 5D3YA 1UNPA 2OQBA 1U27A 2EC1A 3HW2B 2DN6A 2X18A 4WVFB 1ZM0A 4KAXB 1DDVA 1DROA 2VKIA 1EF1A 4KVGB 2D9WA 5GOWB 4ZRKA 1XKEA 4WJ7A 1KZGA 4DX8A 3HQCA 1V89A 4HAUB 2P8VA 3M1IB 3ODXA 4Y94A 1GC6A 3FEHA 1OY2A 1UEFA 4F7HA 2BCJA 4HDOA 1MPHA 2RVBB 3QIJA 4P7IA 2NZ8B 4K17A 2COAA 3D8DA 1AQCA 3PVUA 5FI0A 2KGXB 3SV1A 1MIZB 2KCJA 1FAOA 1DDMA 4L6EA 1UPQA 3TW1A 1DDWA 1BAKA 2W2WA 1UNRA 4HAZB 2J0MA 1I2HA 1LW3A 4ZRJA 2LULA 4EKUA 1V5MA 2I5CA 2ROVA 4GMVA 2MFQA 4CHJA 5DIFB 1P5TA 1X1FA 4TYZA 2P0HA 1W1DA 2ZPYA 4HAVB 2I5FA 1XCGA 1X1GA 1NU2A 3LJUX 2R09A 3QWMA 1I7AA 4A5KA 2EMSA 2Z0PA 4GN1A 1MIXA 5D3XA 3DXEA 3CIKA 4HAXB 1ZC3B 2P0FA 2N0YA 1IRSA 1FHWA 1V88A 2DHIA 4K81A 5HE3A 1TJ6A 3RCPA 1P3RA 4BBKA 2N23A 4YONA 4KHAA 1W1GA 2YT1A 4K2OA 5FI1A 3KSYA 3PZDA 3DXCA 1MKEA 2GCJA 2DA0A 4EJNA 1LB1A 1J0WA 4PNKA 2W2XC 3NSUA 2MKRA 1NTYA 2NMBA 3G9WA 4KHOA 3KRWA 5LONB 2L2IA 3ZDTA 1ZVRA 3FM8C 5D27A 2K2JA 4A6KA 2I1JA 1AWEA 5EFXA 1UNQA 2GS0A 1TXDA 2ELAA 1Z87A 1BTKA 2DHJA 3UZTA 3PSCA 1J19A 3SO6A 3GYOA 5J3QA 4C0AA 4CHMA 5KCVA 1UPRA 1U29A 2K2UA 2GCLA 2ROZB 4A6HA 1FHOA 4GMXB 3SNHA 5HE1A 2LG1A 3MPXA 1V5UA 4F7UP 3P7ZA 1U5GA 5DH9B 4IOYX 5D3VA 1H4RA 5KQ4A 3KZ1A 2YS1A 3BJIA 3PG7A 1SGHA 2HE7A 3F0WA 3FSSA 4DX90 2Y7BA 2AL6A 5JHHA 3OANA 3QBVB 2RSGA 2CRFA 1Y19B 1B55A 2RUKB 2K00A 4EMOA 1WG7A 3N7CA 3SYXA 3A8QA 5D3WA 2V76A 1PMSA 2D4QA 3AJ4A 2J59M 2M38A 2UVMA 4GXBA 5C79A 3PVLA 3D8EA 3HK0A 2XQNM 4TKNA 3TO1A 3U7DA 1EAZA 1GG3A 2YRYA 1U2BA 5C5BB 2R0DA 3ZVRA 4MT7A 4HDQA 2DX1A 3ULBA 4IFSA 2Z0OA 1QQGA 2H7EA 1BWNA 2D9YA 1OQNA 2D11A 1U5DA 2DKQA 1EGXA 5JP4A 3AU4A 4A6FB 5C16A 1N3HA 2RLOA 2VRWB 1GC7A 1X86A 2DYQA 4HB4B 1WJ1A 1ZSQA 2HTHB 3KY9A 3ULCA 1NI2A 2DX5A 1XR0B 4YL8A 2D10A 4NY0A 4DBBA 4XWXA 2I1KA 2IFSA 4MK0A 2LOXA 1E5WA 2H7DA 1PFJA 1DYNA 2JP2A 3ODOA 4HAYB 2MWNB 3PEGA 4KHBB 3WYFB 4CYEA 3MDBC 4HB3B 4NSWA 5CLQB 1M7RA 1SHCA 3IVFA 1FGZA 2RGNB 3AU5A 5JLJB 1FOEA 2ADZA 2D9VA 1XX0A 2E2XA 4HHVA 5C6RA 1WJMA 5J3TA 1X05A 5J3YA 3PVWA 3DXDA 2CY4A 1Y5OA 2COFA 1ISNA 2YS5A 2YSZA 2DKPA 1KZ7A 2GJYA 3SUZA 2J0KA 3D8FA 1MK7B 2EMTA 3VOQA 3T06A 1V61A 2AEHA 3TCAA 1RJ2A 3X23A 1WGUA 2D2QA 2QKLA 1W1HA 1WGQA 1WI1A 1U5FA 2M14A 4DXAB 1V5PA 4HATB 3U8ZA 2YVCA 1M7EA 2UZRA 3ML4A 1QC6A 2Y8FA 2YS3A 4Z2NA 2YF0A 5C5BA 4K2PA 3V5WA 4WSFA 1X11A 2DFKA 2FJLA 2CODA 5DHAB 4HB0B 3BINA 1XODA 2EJ8A 1Q67A 1WVHA 2MDXA 1DBHA
chains in the Genus database with same CATH superfamily
4H8SA 5KQ1A 2G35A 1OMWA 2CY5A 4A6FA 2DHKA 2Z59A 2QKMA 2Z4DA 3WA0A 3PP2A 1P6SA 1K5DB 3ODWA 1K5GB 4ZRIA 3P6AA 2UZSA 5LOPB 1KI1B 2Z0QA 5CLLB 2L1CA 1RRPB 2D9XA 4OT1A 4GOUA 1BTNA 4PQ0A 5L81A 2ELBA 1PLSA 1ZC4B 2DLWA 3TVVA 4KHBA 2PZ1A 3O96A 5JHGA 2CAYA 4IAPA 3CXBB 4HAWB 5IRSA 2DTCA 3F5RA 2VSZA 4GZUA 4QJ5B 1FHXA 3A98B 5DI9B 2KUPA 3NWDA 2W2XD 3NWAA 4GPTB 4B6HA 3KRXA 2K8EA 3A8PA 4F7GA 3OHMB 2P0DA 4D0NB 2OTXA 4HB2B 3GYPA 3HSAA 4Z2MB 2KUQA 1U5EA 2Y8GA 2RNRB 1MAIA 2LKOA 4D6WA 2LOZA 2D9ZA 2IYBA 3TFMA 1MK9B 4MY6A 1FB8A 2COCA 5DHFB 2J0JA 1H10A 2KIEA 1FGYA 2DYNA 2YT0A 2LYDA 1EVHA 2Q13A 2NBVA 1XD4A 5HE2A 2K49A 3NWFA 5HE0A 5I2MA 3VIAA 1TQZA 1NTVA 5D3YA 1UNPA 2RRFA 2OQBA 1U27A 5LG4B 2EC1A 3HW2B 2DN6A 2X18A 4WVFB 1ZM0A 2ZKMX 4KAXB 1DDVA 1DROA 2VKIA 1EF1A 4KVGB 2D9WA 5GOWB 4ZRKA 1XKEA 4WJ7A 1KZGA 4DX8A 3HQCA 3HIEA 1V89A 4HAUB 2P8VA 3M1IB 3ODXA 4Y94A 1GC6A 3FEHA 1OY2A 4L1RA 1MI1A 1UEFA 4F7HA 2BCJA 4HDOA 1MPHA 2RVBB 3QIJA 4P7IA 2NZ8B 4K17A 2COAA 3D8DA 1AQCA 3PVUA 5FI0A 2KGXB 3SV1A 1MIZB 2KCJA 1FAOA 1DDMA 4L6EA 1UPQA 3TW1A 1DDWA 1BAKA 2W2WA 1UNRA 4HAZB 2J0MA 1I2HA 1LW3A 4ZRJA 2LULA 4EKUA 1V5MA 2I5CA 2ROVA 4GMVA 2MFQA 4CHJA 5DIFB 1P5TA 1X1FA 4TYZA 1T77A 4QJ4B 2P0HA 1W1DA 2ZPYA 4HAVB 2I5FA 1XCGA 2KIGA 1X1GA 1NU2A 3LJUX 2R09A 3QWMA 1I7AA 4A5KA 2EMSA 2Z0PA 4GN1A 1MIXA 5D3XA 3DXEA 3CIKA 4HAXB 1ZC3B 2P0FA 2N0YA 1IRSA 1FHWA 1V88A 2DHIA 4K81A 5HE3A 1TJ6A 3RCPA 1P3RA 4BBKA 2N23A 4YONA 2FJUB 4KHAA 1W1GA 2YT1A 4K2OA 5FI1A 3KSYA 3PZDA 3DXCA 1MKEA 2GCJA 2DA0A 4EJNA 1LB1A 1J0WA 4PNKA 2W2XC 3NSUA 3NW8A 2MKRA 1NTYA 2NMBA 3G9WA 4KHOA 3KRWA 5LONB 2L2IA 3ZDTA 1ZVRA 3FM8C 5D27A 2K2JA 4A6KA 2Z13A 2I1JA 1AWEA 4GNKB 5EFXA 1UNQA 2GS0A 1TXDA 2ELAA 1Z87A 1BTKA 2DHJA 3UZTA 3PSCA 1J19A 3SO6A 3GYOA 5J3QA 4C0AA 4CHMA 5KCVA 1UPRA 1U29A 2K2UA 2GCLA 2ROZB 4A6HA 1FHOA 4GMXB 3SNHA 5HE1A 2LG1A 3DCXA 3MPXA 1V5UA 4F7UP 3P7ZA 1U5GA 5DH9B 4IOYX 4HSIA 5D3VA 1H4RA 5KQ4A 3KZ1A 2YS1A 3BJIA 3PG7A 1SGHA 2HE7A 3F0WA 3FSSA 4DX90 2Y7BA 2AL6A 4CSQA 5JHHA 3OANA 3QBVB 2RSGA 2CRFA 1Y19B 1B55A 2RUKB 2K00A 4EMOA 1WG7A 3N7CA 3SYXA 3A8QA 5D3WA 2V76A 1PMSA 2D4QA 3AJ4A 2J59M 2M38A 2UVMA 4GXBA 5C79A 3PVLA 3D8EA 3HK0A 2XQNM 4TKNA 3TO1A 3U7DA 4DIXA 1EAZA 1GG3A 2YRYA 1U2BA 5C5BB 2Z14A 2R0DA 4QJ3B 3ZVRA 2GUMA 4HDQA 4MT7A 2DX1A 3ULBA 4IFSA 2Z0OA 1QQGA 2H7EA 1BWNA 2D9YA 1OQNA 2D11A 1U5DA 2DKQA 1EGXA 5JP4A 3AU4A 4A6FB 5I2SA 5C16A 1N3HA 2RLOA 2R2YA 2VRWB 1GC7A 1X86A 2DYQA 4HB4B 1WJ1A 1ZSQA 2HTHB 3KY9A 3ULCA 1NI2A 2DX5A 1XR0B 4YL8A 2D10A 4NY0A 4DBBA 4XWXA 2I1KA 2IFSA 4MK0A 2LOXA 1E5WA 2H7DA 1PFJA 1DYNA 2JP2A 3ODOA 4HAYB 2MWNB 3PEGA 4KHBB 3WYFB 4CYEA 3MDBC 4HB3B 4NSWA 5CLQB 1M7RA 1SHCA 3IVFA 1FGZA 2RGNB 3AU5A 5JLJB 1FOEA 2ADZA 2D9VA 1XX0A 2E2XA 4HHVA 5C6RA 1WJMA 5J3TA 1X05A 5J3YA 3PVWA 3DXDA 2CY4A 1Y5OA 2COFA 1ISNA 5M4YB 3U12A 2YS5A 2YSZA 2DKPA 1KZ7A 2GJYA 3A58A 3SUZA 2J0KA 3D8FA 1MK7B 2EMTA 3VOQA 3T06A 1V61A 1ZYIA 2AEHA 3TCAA 1RJ2A 3X23A 1WGUA 2D2QA 2QKLA 1W1HA 1WGQA 1WI1A 1U5FA 2M14A 4DXAB 1V5PA 4HATB 3U8ZA 2YVCA 1M7EA 2UZRA 3FVCA 3ML4A 1QC6A 2KR0A 2Y8FA 2YS3A 4Z2NA 2YF0A 5C5BA 4K2PA 4QXAB 2YT2A 3V5WA 4WSFA 1X11A 2DFKA 3B77A 2FJLA 2CODA 5DHAB 4HB0B 3BINA 1XODA 4OSNA 2EJ8A 1Q67A 1WVHA 2MDXA 1DBHA
chains in the Genus database with same CATH topology
4H8SA 5KQ1A 2G35A 1OMWA 2CY5A 4A6FA 2DHKA 2QKMA 3WA0A 3PP2A 1P6SA 1K5DB 3ODWA 1K5GB 4ZRIA 3P6AA 2UZSA 5LOPB 1KI1B 2Z0QA 5CLLB 2L1CA 1RRPB 2D9XA 1BTNA 4PQ0A 5L81A 2ELBA 1PLSA 1ZC4B 2DLWA 3TVVA 2PZ1A 3O96A 5JHGA 2CAYA 4IAPA 3CXBB 4HAWB 2DTCA 3F5RA 2VSZA 4GZUA 1FHXA 3A98B 5DI9B 2KUPA 2W2XD 4GPTB 4B6HA 3KRXA 3A8PA 4F7GA 2P0DA 4D0NB 2OTXA 4HB2B 3GYPA 4Z2MB 1U5EA 2Y8GA 2RNRB 1MAIA 2LKOA 2LOZA 2D9ZA 2IYBA 3TFMA 1MK9B 4MY6A 1FB8A 2COCA 5DHFB 2J0JA 1H10A 1FGYA 2DYNA 2YT0A 2LYDA 1EVHA 2Q13A 1XD4A 5HE2A 5HE0A 3VIAA 1TQZA 1NTVA 5D3YA 1UNPA 2OQBA 1U27A 2EC1A 3HW2B 2DN6A 2X18A 4WVFB 1ZM0A 4KAXB 1DDVA 1DROA 2VKIA 1EF1A 4KVGB 2D9WA 5GOWB 4ZRKA 1XKEA 4WJ7A 1KZGA 4DX8A 3HQCA 1V89A 4HAUB 2P8VA 3M1IB 3ODXA 4Y94A 1GC6A 3FEHA 1OY2A 1UEFA 4F7HA 2BCJA 4HDOA 1MPHA 2RVBB 3QIJA 4P7IA 2NZ8B 4K17A 2COAA 3D8DA 1AQCA 3PVUA 5FI0A 2KGXB 3SV1A 1MIZB 2KCJA 1FAOA 1DDMA 4L6EA 1UPQA 3TW1A 1DDWA 1BAKA 2W2WA 1UNRA 4HAZB 2J0MA 1I2HA 1LW3A 4ZRJA 2LULA 4EKUA 1V5MA 2I5CA 2ROVA 4GMVA 2MFQA 4CHJA 5DIFB 1P5TA 1X1FA 4TYZA 2P0HA 1W1DA 2ZPYA 4HAVB 2I5FA 1XCGA 1X1GA 1NU2A 3LJUX 2R09A 3QWMA 1I7AA 4A5KA 2EMSA 2Z0PA 4GN1A 1MIXA 5D3XA 3DXEA 3CIKA 4HAXB 1ZC3B 2P0FA 2N0YA 1IRSA 1FHWA 1V88A 2DHIA 4K81A 5HE3A 1TJ6A 3RCPA 1P3RA 4BBKA 2N23A 4YONA 4KHAA 1W1GA 2YT1A 4K2OA 5FI1A 3KSYA 3PZDA 3DXCA 1MKEA 2GCJA 2DA0A 4EJNA 1LB1A 1J0WA 4PNKA 2W2XC 3NSUA 2MKRA 1NTYA 2NMBA 3G9WA 4KHOA 3KRWA 5LONB 2L2IA 3ZDTA 1ZVRA 3FM8C 5D27A 2K2JA 4A6KA 2I1JA 1AWEA 5EFXA 1UNQA 2GS0A 1TXDA 2ELAA 1Z87A 1BTKA 2DHJA 3UZTA 3PSCA 1J19A 3SO6A 3GYOA 5J3QA 4C0AA 4CHMA 5KCVA 1UPRA 1U29A 2K2UA 2GCLA 2ROZB 4A6HA 1FHOA 4GMXB 3SNHA 5HE1A 2LG1A 3MPXA 1V5UA 4F7UP 3P7ZA 1U5GA 5DH9B 4IOYX 5D3VA 1H4RA 5KQ4A 3KZ1A 2YS1A 3BJIA 3PG7A 1SGHA 2HE7A 3F0WA 3FSSA 4DX90 2Y7BA 2AL6A 5JHHA 3OANA 3QBVB 2RSGA 2CRFA 1Y19B 1B55A 2RUKB 2K00A 4EMOA 1WG7A 3N7CA 3SYXA 3A8QA 5D3WA 2V76A 1PMSA 2D4QA 3AJ4A 2J59M 2M38A 2UVMA 4GXBA 5C79A 3PVLA 3D8EA 3HK0A 2XQNM 4TKNA 3TO1A 3U7DA 1EAZA 1GG3A 2YRYA 1U2BA 5C5BB 2R0DA 3ZVRA 4MT7A 4HDQA 2DX1A 3ULBA 4IFSA 2Z0OA 1QQGA 2H7EA 1BWNA 2D9YA 1OQNA 2D11A 1U5DA 2DKQA 1EGXA 5JP4A 3AU4A 4A6FB 5C16A 1N3HA 2RLOA 2VRWB 1GC7A 1X86A 2DYQA 4HB4B 1WJ1A 1ZSQA 2HTHB 3KY9A 3ULCA 1NI2A 2DX5A 1XR0B 4YL8A 2D10A 4NY0A 4DBBA 4XWXA 2I1KA 2IFSA 4MK0A 2LOXA 1E5WA 2H7DA 1PFJA 1DYNA 2JP2A 3ODOA 4HAYB 2MWNB 3PEGA 4KHBB 3WYFB 4CYEA 3MDBC 4HB3B 4NSWA 5CLQB 1M7RA 1SHCA 3IVFA 1FGZA 2RGNB 3AU5A 5JLJB 1FOEA 2ADZA 2D9VA 1XX0A 2E2XA 4HHVA 5C6RA 1WJMA 5J3TA 1X05A 5J3YA 3PVWA 3DXDA 2CY4A 1Y5OA 2COFA 1ISNA 2YS5A 2YSZA 2DKPA 1KZ7A 2GJYA 3SUZA 2J0KA 3D8FA 1MK7B 2EMTA 3VOQA 3T06A 1V61A 2AEHA 3TCAA 1RJ2A 3X23A 1WGUA 2D2QA 2QKLA 1W1HA 1WGQA 1WI1A 1U5FA 2M14A 4DXAB 1V5PA 4HATB 3U8ZA 2YVCA 1M7EA 2UZRA 3ML4A 1QC6A 2Y8FA 2YS3A 4Z2NA 2YF0A 5C5BA 4K2PA 3V5WA 4WSFA 1X11A 2DFKA 2FJLA 2CODA 5DHAB 4HB0B 3BINA 1XODA 2EJ8A 1Q67A 1WVHA 2MDXA 1DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8S A;  5KQ1 A;  2G35 A;  1OMW A;  2CY5 A;  4A6F A;  2DHK A;  2QKM A;  3WA0 A;  3PP2 A;  1P6S A;  1K5D B;  3ODW A;  1K5G B;  4ZRI A;  3P6A A;  2UZS A;  5LOP B;  1KI1 B;  2Z0Q A;  5CLL B;  2L1C A;  1RRP B;  2D9X A;  1BTN A;  4PQ0 A;  5L81 A;  2ELB A;  1PLS A;  1ZC4 B;  2DLW A;  3TVV A;  2PZ1 A;  3O96 A;  5JHG A;  2CAY A;  4IAP A;  3CXB B;  4HAW B;  2DTC A;  3F5R A;  2VSZ A;  4GZU A;  1FHX A;  3A98 B;  5DI9 B;  2KUP A;  2W2X D;  4GPT B;  4B6H A;  3KRX A;  3A8P A;  4F7G A;  2P0D A;  4D0N B;  2OTX A;  4HB2 B;  3GYP A;  4Z2M B;  1U5E A;  2Y8G A;  2RNR B;  1MAI A;  2LKO A;  2LOZ A;  2D9Z A;  2IYB A;  3TFM A;  1MK9 B;  4MY6 A;  1FB8 A;  2COC A;  5DHF B;  2J0J A;  1H10 A;  1FGY A;  2DYN A;  2YT0 A;  2LYD A;  1EVH A;  2Q13 A;  1XD4 A;  5HE2 A;  5HE0 A;  3VIA A;  1TQZ A;  1NTV A;  5D3Y A;  1UNP A;  2OQB A;  1U27 A;  2EC1 A;  3HW2 B;  2DN6 A;  2X18 A;  4WVF B;  1ZM0 A;  4KAX B;  1DDV A;  1DRO A;  2VKI A;  1EF1 A;  4KVG B;  2D9W A;  5GOW B;  4ZRK A;  1XKE A;  4WJ7 A;  1KZG A;  4DX8 A;  3HQC A;  1V89 A;  4HAU B;  2P8V A;  3M1I B;  3ODX A;  4Y94 A;  1GC6 A;  3FEH A;  1OY2 A;  1UEF A;  4F7H A;  2BCJ A;  4HDO A;  1MPH A;  2RVB B;  3QIJ A;  4P7I A;  2NZ8 B;  4K17 A;  2COA A;  3D8D A;  1AQC A;  3PVU A;  5FI0 A;  2KGX B;  3SV1 A;  1MIZ B;  2KCJ A;  1FAO A;  1DDM A;  4L6E A;  1UPQ A;  3TW1 A;  1DDW A;  1BAK A;  2W2W A;  1UNR A;  4HAZ B;  2J0M A;  1I2H A;  1LW3 A;  4ZRJ A;  2LUL A;  4EKU A;  1V5M A;  2I5C A;  2ROV A;  4GMV A;  2MFQ A;  4CHJ A;  5DIF B;  1P5T A;  1X1F A;  4TYZ A;  2P0H A;  1W1D A;  2ZPY A;  4HAV B;  2I5F A;  1XCG A;  1X1G A;  1NU2 A;  3LJU X;  2R09 A;  3QWM A;  1I7A A;  4A5K A;  2EMS A;  2Z0P A;  4GN1 A;  1MIX A;  5D3X A;  3DXE A;  3CIK A;  4HAX B;  1ZC3 B;  2P0F A;  2N0Y A;  1IRS A;  1FHW A;  1V88 A;  2DHI A;  4K81 A;  5HE3 A;  1TJ6 A;  3RCP A;  1P3R A;  4BBK A;  2N23 A;  4YON A;  4KHA A;  1W1G A;  2YT1 A;  4K2O A;  5FI1 A;  3KSY A;  3PZD A;  3DXC A;  1MKE A;  2GCJ A;  2DA0 A;  4EJN A;  1LB1 A;  1J0W A;  4PNK A;  2W2X C;  3NSU A;  2MKR A;  1NTY A;  2NMB A;  3G9W A;  4KHO A;  3KRW A;  5LON B;  2L2I A;  3ZDT A;  1ZVR A;  3FM8 C;  5D27 A;  2K2J A;  4A6K A;  2I1J A;  1AWE A;  5EFX A;  1UNQ A;  2GS0 A;  1TXD A;  2ELA A;  1Z87 A;  1BTK A;  2DHJ A;  3UZT A;  3PSC A;  1J19 A;  3SO6 A;  3GYO A;  5J3Q A;  4C0A A;  4CHM A;  5KCV A;  1UPR A;  1U29 A;  2K2U A;  2GCL A;  2ROZ B;  4A6H A;  1FHO A;  4GMX B;  3SNH A;  5HE1 A;  2LG1 A;  3MPX A;  1V5U A;  4F7U P;  3P7Z A;  1U5G A;  5DH9 B;  4IOY X;  5D3V A;  1H4R A;  5KQ4 A;  3KZ1 A;  2YS1 A;  3BJI A;  3PG7 A;  1SGH A;  2HE7 A;  3F0W A;  3FSS A;  4DX9 0;  2Y7B A;  2AL6 A;  5JHH A;  3OAN A;  3QBV B;  2RSG A;  2CRF A;  1Y19 B;  1B55 A;  2RUK B;  2K00 A;  4EMO A;  1WG7 A;  3N7C A;  3SYX A;  3A8Q A;  5D3W A;  2V76 A;  1PMS A;  2D4Q A;  3AJ4 A;  2J59 M;  2M38 A;  2UVM A;  4GXB A;  5C79 A;  3PVL A;  3D8E A;  3HK0 A;  2XQN M;  4TKN A;  3TO1 A;  3U7D A;  1EAZ A;  1GG3 A;  2YRY A;  1U2B A;  5C5B B;  2R0D A;  3ZVR A;  4MT7 A;  4HDQ A;  2DX1 A;  3ULB A;  4IFS A;  2Z0O A;  1QQG A;  2H7E A;  1BWN A;  2D9Y A;  1OQN A;  2D11 A;  1U5D A;  2DKQ A;  1EGX A;  5JP4 A;  3AU4 A;  4A6F B;  5C16 A;  1N3H A;  2RLO A;  2VRW B;  1GC7 A;  1X86 A;  2DYQ A;  4HB4 B;  1WJ1 A;  1ZSQ A;  2HTH B;  3KY9 A;  3ULC A;  1NI2 A;  2DX5 A;  1XR0 B;  4YL8 A;  2D10 A;  4NY0 A;  4DBB A;  4XWX A;  2I1K A;  2IFS A;  4MK0 A;  2LOX A;  1E5W A;  2H7D A;  1PFJ A;  1DYN A;  2JP2 A;  3ODO A;  4HAY B;  2MWN B;  3PEG A;  4KHB B;  3WYF B;  4CYE A;  3MDB C;  4HB3 B;  4NSW A;  5CLQ B;  1M7R A;  1SHC A;  3IVF A;  1FGZ A;  2RGN B;  3AU5 A;  5JLJ B;  1FOE A;  2ADZ A;  2D9V A;  1XX0 A;  2E2X A;  4HHV A;  5C6R A;  1WJM A;  5J3T A;  1X05 A;  5J3Y A;  3PVW A;  3DXD A;  2CY4 A;  1Y5O A;  2COF A;  1ISN A;  2YS5 A;  2YSZ A;  2DKP A;  1KZ7 A;  2GJY A;  3SUZ A;  2J0K A;  3D8F A;  1MK7 B;  2EMT A;  3VOQ A;  3T06 A;  1V61 A;  2AEH A;  3TCA A;  1RJ2 A;  3X23 A;  1WGU A;  2D2Q A;  2QKL A;  1W1H A;  1WGQ A;  1WI1 A;  1U5F A;  2M14 A;  4DXA B;  1V5P A;  4HAT B;  3U8Z A;  2YVC A;  1M7E A;  2UZR A;  3ML4 A;  1QC6 A;  2Y8F A;  2YS3 A;  4Z2N A;  2YF0 A;  5C5B A;  4K2P A;  3V5W A;  4WSF A;  1X11 A;  2DFK A;  2FJL A;  2COD A;  5DHA B;  4HB0 B;  3BIN A;  1XOD A;  2EJ8 A;  1Q67 A;  1WVH A;  2MDX A;  1DBH A; 
#chains in the Genus database with same CATH topology
 4H8S A;  5KQ1 A;  2G35 A;  1OMW A;  2CY5 A;  4A6F A;  2DHK A;  2Z59 A;  2QKM A;  2Z4D A;  3WA0 A;  3PP2 A;  1P6S A;  1K5D B;  3ODW A;  1K5G B;  4ZRI A;  3P6A A;  2UZS A;  5LOP B;  1KI1 B;  2Z0Q A;  5CLL B;  2L1C A;  1RRP B;  2D9X A;  4OT1 A;  4GOU A;  1BTN A;  4PQ0 A;  5L81 A;  2ELB A;  1PLS A;  1ZC4 B;  2DLW A;  3TVV A;  4KHB A;  2PZ1 A;  3O96 A;  5JHG A;  2CAY A;  4IAP A;  3CXB B;  4HAW B;  5IRS A;  2DTC A;  3F5R A;  2VSZ A;  4GZU A;  4QJ5 B;  1FHX A;  3A98 B;  5DI9 B;  2KUP A;  3NWD A;  2W2X D;  3NWA A;  4GPT B;  4B6H A;  3KRX A;  2K8E A;  3A8P A;  4F7G A;  3OHM B;  2P0D A;  4D0N B;  2OTX A;  4HB2 B;  3GYP A;  3HSA A;  4Z2M B;  2KUQ A;  1U5E A;  2Y8G A;  2RNR B;  1MAI A;  2LKO A;  4D6W A;  2LOZ A;  2D9Z A;  2IYB A;  3TFM A;  1MK9 B;  4MY6 A;  1FB8 A;  2COC A;  5DHF B;  2J0J A;  1H10 A;  2KIE A;  1FGY A;  2DYN A;  2YT0 A;  2LYD A;  1EVH A;  2Q13 A;  2NBV A;  1XD4 A;  5HE2 A;  2K49 A;  3NWF A;  5HE0 A;  5I2M A;  3VIA A;  1TQZ A;  1NTV A;  5D3Y A;  1UNP A;  2RRF A;  2OQB A;  1U27 A;  5LG4 B;  2EC1 A;  3HW2 B;  2DN6 A;  2X18 A;  4WVF B;  1ZM0 A;  2ZKM X;  4KAX B;  1DDV A;  1DRO A;  2VKI A;  1EF1 A;  4KVG B;  2D9W A;  5GOW B;  4ZRK A;  1XKE A;  4WJ7 A;  1KZG A;  4DX8 A;  3HQC A;  3HIE A;  1V89 A;  4HAU B;  2P8V A;  3M1I B;  3ODX A;  4Y94 A;  1GC6 A;  3FEH A;  1OY2 A;  4L1R A;  1MI1 A;  1UEF A;  4F7H A;  2BCJ A;  4HDO A;  1MPH A;  2RVB B;  3QIJ A;  4P7I A;  2NZ8 B;  4K17 A;  2COA A;  3D8D A;  1AQC A;  3PVU A;  5FI0 A;  2KGX B;  3SV1 A;  1MIZ B;  2KCJ A;  1FAO A;  1DDM A;  4L6E A;  1UPQ A;  3TW1 A;  1DDW A;  1BAK A;  2W2W A;  1UNR A;  4HAZ B;  2J0M A;  1I2H A;  1LW3 A;  4ZRJ A;  2LUL A;  4EKU A;  1V5M A;  2I5C A;  2ROV A;  4GMV A;  2MFQ A;  4CHJ A;  5DIF B;  1P5T A;  1X1F A;  4TYZ A;  1T77 A;  4QJ4 B;  2P0H A;  1W1D A;  2ZPY A;  4HAV B;  2I5F A;  1XCG A;  2KIG A;  1X1G A;  1NU2 A;  3LJU X;  2R09 A;  3QWM A;  1I7A A;  4A5K A;  2EMS A;  2Z0P A;  4GN1 A;  1MIX A;  5D3X A;  3DXE A;  3CIK A;  4HAX B;  1ZC3 B;  2P0F A;  2N0Y A;  1IRS A;  1FHW A;  1V88 A;  2DHI A;  4K81 A;  5HE3 A;  1TJ6 A;  3RCP A;  1P3R A;  4BBK A;  2N23 A;  4YON A;  2FJU B;  4KHA A;  1W1G A;  2YT1 A;  4K2O A;  5FI1 A;  3KSY A;  3PZD A;  3DXC A;  1MKE A;  2GCJ A;  2DA0 A;  4EJN A;  1LB1 A;  1J0W A;  4PNK A;  2W2X C;  3NSU A;  3NW8 A;  2MKR A;  1NTY A;  2NMB A;  3G9W A;  4KHO A;  3KRW A;  5LON B;  2L2I A;  3ZDT A;  1ZVR A;  3FM8 C;  5D27 A;  2K2J A;  4A6K A;  2Z13 A;  2I1J A;  1AWE A;  4GNK B;  5EFX A;  1UNQ A;  2GS0 A;  1TXD A;  2ELA A;  1Z87 A;  1BTK A;  2DHJ A;  3UZT A;  3PSC A;  1J19 A;  3SO6 A;  3GYO A;  5J3Q A;  4C0A A;  4CHM A;  5KCV A;  1UPR A;  1U29 A;  2K2U A;  2GCL A;  2ROZ B;  4A6H A;  1FHO A;  4GMX B;  3SNH A;  5HE1 A;  2LG1 A;  3DCX A;  3MPX A;  1V5U A;  4F7U P;  3P7Z A;  1U5G A;  5DH9 B;  4IOY X;  4HSI A;  5D3V A;  1H4R A;  5KQ4 A;  3KZ1 A;  2YS1 A;  3BJI A;  3PG7 A;  1SGH A;  2HE7 A;  3F0W A;  3FSS A;  4DX9 0;  2Y7B A;  2AL6 A;  4CSQ A;  5JHH A;  3OAN A;  3QBV B;  2RSG A;  2CRF A;  1Y19 B;  1B55 A;  2RUK B;  2K00 A;  4EMO A;  1WG7 A;  3N7C A;  3SYX A;  3A8Q A;  5D3W A;  2V76 A;  1PMS A;  2D4Q A;  3AJ4 A;  2J59 M;  2M38 A;  2UVM A;  4GXB A;  5C79 A;  3PVL A;  3D8E A;  3HK0 A;  2XQN M;  4TKN A;  3TO1 A;  3U7D A;  4DIX A;  1EAZ A;  1GG3 A;  2YRY A;  1U2B A;  5C5B B;  2Z14 A;  2R0D A;  4QJ3 B;  3ZVR A;  2GUM A;  4HDQ A;  4MT7 A;  2DX1 A;  3ULB A;  4IFS A;  2Z0O A;  1QQG A;  2H7E A;  1BWN A;  2D9Y A;  1OQN A;  2D11 A;  1U5D A;  2DKQ A;  1EGX A;  5JP4 A;  3AU4 A;  4A6F B;  5I2S A;  5C16 A;  1N3H A;  2RLO A;  2R2Y A;  2VRW B;  1GC7 A;  1X86 A;  2DYQ A;  4HB4 B;  1WJ1 A;  1ZSQ A;  2HTH B;  3KY9 A;  3ULC A;  1NI2 A;  2DX5 A;  1XR0 B;  4YL8 A;  2D10 A;  4NY0 A;  4DBB A;  4XWX A;  2I1K A;  2IFS A;  4MK0 A;  2LOX A;  1E5W A;  2H7D A;  1PFJ A;  1DYN A;  2JP2 A;  3ODO A;  4HAY B;  2MWN B;  3PEG A;  4KHB B;  3WYF B;  4CYE A;  3MDB C;  4HB3 B;  4NSW A;  5CLQ B;  1M7R A;  1SHC A;  3IVF A;  1FGZ A;  2RGN B;  3AU5 A;  5JLJ B;  1FOE A;  2ADZ A;  2D9V A;  1XX0 A;  2E2X A;  4HHV A;  5C6R A;  1WJM A;  5J3T A;  1X05 A;  5J3Y A;  3PVW A;  3DXD A;  2CY4 A;  1Y5O A;  2COF A;  1ISN A;  5M4Y B;  3U12 A;  2YS5 A;  2YSZ A;  2DKP A;  1KZ7 A;  2GJY A;  3A58 A;  3SUZ A;  2J0K A;  3D8F A;  1MK7 B;  2EMT A;  3VOQ A;  3T06 A;  1V61 A;  1ZYI A;  2AEH A;  3TCA A;  1RJ2 A;  3X23 A;  1WGU A;  2D2Q A;  2QKL A;  1W1H A;  1WGQ A;  1WI1 A;  1U5F A;  2M14 A;  4DXA B;  1V5P A;  4HAT B;  3U8Z A;  2YVC A;  1M7E A;  2UZR A;  3FVC A;  3ML4 A;  1QC6 A;  2KR0 A;  2Y8F A;  2YS3 A;  4Z2N A;  2YF0 A;  5C5B A;  4K2P A;  4QXA B;  2YT2 A;  3V5W A;  4WSF A;  1X11 A;  2DFK A;  3B77 A;  2FJL A;  2COD A;  5DHA B;  4HB0 B;  3BIN A;  1XOD A;  4OSN A;  2EJ8 A;  1Q67 A;  1WVH A;  2MDX A;  1DBH A; 
#chains in the Genus database with same CATH homology
 4H8S A;  5KQ1 A;  2G35 A;  1OMW A;  2CY5 A;  4A6F A;  2DHK A;  2QKM A;  3WA0 A;  3PP2 A;  1P6S A;  1K5D B;  3ODW A;  1K5G B;  4ZRI A;  3P6A A;  2UZS A;  5LOP B;  1KI1 B;  2Z0Q A;  5CLL B;  2L1C A;  1RRP B;  2D9X A;  1BTN A;  4PQ0 A;  5L81 A;  2ELB A;  1PLS A;  1ZC4 B;  2DLW A;  3TVV A;  2PZ1 A;  3O96 A;  5JHG A;  2CAY A;  4IAP A;  3CXB B;  4HAW B;  2DTC A;  3F5R A;  2VSZ A;  4GZU A;  1FHX A;  3A98 B;  5DI9 B;  2KUP A;  2W2X D;  4GPT B;  4B6H A;  3KRX A;  3A8P A;  4F7G A;  2P0D A;  4D0N B;  2OTX A;  4HB2 B;  3GYP A;  4Z2M B;  1U5E A;  2Y8G A;  2RNR B;  1MAI A;  2LKO A;  2LOZ A;  2D9Z A;  2IYB A;  3TFM A;  1MK9 B;  4MY6 A;  1FB8 A;  2COC A;  5DHF B;  2J0J A;  1H10 A;  1FGY A;  2DYN A;  2YT0 A;  2LYD A;  1EVH A;  2Q13 A;  1XD4 A;  5HE2 A;  5HE0 A;  3VIA A;  1TQZ A;  1NTV A;  5D3Y A;  1UNP A;  2OQB A;  1U27 A;  2EC1 A;  3HW2 B;  2DN6 A;  2X18 A;  4WVF B;  1ZM0 A;  4KAX B;  1DDV A;  1DRO A;  2VKI A;  1EF1 A;  4KVG B;  2D9W A;  5GOW B;  4ZRK A;  1XKE A;  4WJ7 A;  1KZG A;  4DX8 A;  3HQC A;  1V89 A;  4HAU B;  2P8V A;  3M1I B;  3ODX A;  4Y94 A;  1GC6 A;  3FEH A;  1OY2 A;  1UEF A;  4F7H A;  2BCJ A;  4HDO A;  1MPH A;  2RVB B;  3QIJ A;  4P7I A;  2NZ8 B;  4K17 A;  2COA A;  3D8D A;  1AQC A;  3PVU A;  5FI0 A;  2KGX B;  3SV1 A;  1MIZ B;  2KCJ A;  1FAO A;  1DDM A;  4L6E A;  1UPQ A;  3TW1 A;  1DDW A;  1BAK A;  2W2W A;  1UNR A;  4HAZ B;  2J0M A;  1I2H A;  1LW3 A;  4ZRJ A;  2LUL A;  4EKU A;  1V5M A;  2I5C A;  2ROV A;  4GMV A;  2MFQ A;  4CHJ A;  5DIF B;  1P5T A;  1X1F A;  4TYZ A;  2P0H A;  1W1D A;  2ZPY A;  4HAV B;  2I5F A;  1XCG A;  1X1G A;  1NU2 A;  3LJU X;  2R09 A;  3QWM A;  1I7A A;  4A5K A;  2EMS A;  2Z0P A;  4GN1 A;  1MIX A;  5D3X A;  3DXE A;  3CIK A;  4HAX B;  1ZC3 B;  2P0F A;  2N0Y A;  1IRS A;  1FHW A;  1V88 A;  2DHI A;  4K81 A;  5HE3 A;  1TJ6 A;  3RCP A;  1P3R A;  4BBK A;  2N23 A;  4YON A;  4KHA A;  1W1G A;  2YT1 A;  4K2O A;  5FI1 A;  3KSY A;  3PZD A;  3DXC A;  1MKE A;  2GCJ A;  2DA0 A;  4EJN A;  1LB1 A;  1J0W A;  4PNK A;  2W2X C;  3NSU A;  2MKR A;  1NTY A;  2NMB A;  3G9W A;  4KHO A;  3KRW A;  5LON B;  2L2I A;  3ZDT A;  1ZVR A;  3FM8 C;  5D27 A;  2K2J A;  4A6K A;  2I1J A;  1AWE A;  5EFX A;  1UNQ A;  2GS0 A;  1TXD A;  2ELA A;  1Z87 A;  1BTK A;  2DHJ A;  3UZT A;  3PSC A;  1J19 A;  3SO6 A;  3GYO A;  5J3Q A;  4C0A A;  4CHM A;  5KCV A;  1UPR A;  1U29 A;  2K2U A;  2GCL A;  2ROZ B;  4A6H A;  1FHO A;  4GMX B;  3SNH A;  5HE1 A;  2LG1 A;  3MPX A;  1V5U A;  4F7U P;  3P7Z A;  1U5G A;  5DH9 B;  4IOY X;  5D3V A;  1H4R A;  5KQ4 A;  3KZ1 A;  2YS1 A;  3BJI A;  3PG7 A;  1SGH A;  2HE7 A;  3F0W A;  3FSS A;  4DX9 0;  2Y7B A;  2AL6 A;  5JHH A;  3OAN A;  3QBV B;  2RSG A;  2CRF A;  1Y19 B;  1B55 A;  2RUK B;  2K00 A;  4EMO A;  1WG7 A;  3N7C A;  3SYX A;  3A8Q A;  5D3W A;  2V76 A;  1PMS A;  2D4Q A;  3AJ4 A;  2J59 M;  2M38 A;  2UVM A;  4GXB A;  5C79 A;  3PVL A;  3D8E A;  3HK0 A;  2XQN M;  4TKN A;  3TO1 A;  3U7D A;  1EAZ A;  1GG3 A;  2YRY A;  1U2B A;  5C5B B;  2R0D A;  3ZVR A;  4MT7 A;  4HDQ A;  2DX1 A;  3ULB A;  4IFS A;  2Z0O A;  1QQG A;  2H7E A;  1BWN A;  2D9Y A;  1OQN A;  2D11 A;  1U5D A;  2DKQ A;  1EGX A;  5JP4 A;  3AU4 A;  4A6F B;  5C16 A;  1N3H A;  2RLO A;  2VRW B;  1GC7 A;  1X86 A;  2DYQ A;  4HB4 B;  1WJ1 A;  1ZSQ A;  2HTH B;  3KY9 A;  3ULC A;  1NI2 A;  2DX5 A;  1XR0 B;  4YL8 A;  2D10 A;  4NY0 A;  4DBB A;  4XWX A;  2I1K A;  2IFS A;  4MK0 A;  2LOX A;  1E5W A;  2H7D A;  1PFJ A;  1DYN A;  2JP2 A;  3ODO A;  4HAY B;  2MWN B;  3PEG A;  4KHB B;  3WYF B;  4CYE A;  3MDB C;  4HB3 B;  4NSW A;  5CLQ B;  1M7R A;  1SHC A;  3IVF A;  1FGZ A;  2RGN B;  3AU5 A;  5JLJ B;  1FOE A;  2ADZ A;  2D9V A;  1XX0 A;  2E2X A;  4HHV A;  5C6R A;  1WJM A;  5J3T A;  1X05 A;  5J3Y A;  3PVW A;  3DXD A;  2CY4 A;  1Y5O A;  2COF A;  1ISN A;  2YS5 A;  2YSZ A;  2DKP A;  1KZ7 A;  2GJY A;  3SUZ A;  2J0K A;  3D8F A;  1MK7 B;  2EMT A;  3VOQ A;  3T06 A;  1V61 A;  2AEH A;  3TCA A;  1RJ2 A;  3X23 A;  1WGU A;  2D2Q A;  2QKL A;  1W1H A;  1WGQ A;  1WI1 A;  1U5F A;  2M14 A;  4DXA B;  1V5P A;  4HAT B;  3U8Z A;  2YVC A;  1M7E A;  2UZR A;  3ML4 A;  1QC6 A;  2Y8F A;  2YS3 A;  4Z2N A;  2YF0 A;  5C5B A;  4K2P A;  3V5W A;  4WSF A;  1X11 A;  2DFK A;  2FJL A;  2COD A;  5DHA B;  4HB0 B;  3BIN A;  1XOD A;  2EJ8 A;  1Q67 A;  1WVH A;  2MDX A;  1DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...