2MWNB

Talin-f3 / riam n-terminal peptide complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/signaling protein
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
total genus 11
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mwnB00
4CYEA 2R0DA 4KHAA 1FHWA 1V5PA 3KZ1A 4HAWB 3SYXA 3TO1A 3GYPA 3TCAA 3ODXA 4Z2NA 2G35A 3U7DA 4HDOA 4HATB 5DHFB 4DXAB 1DBHA 1H10A 2L2IA 4XWXA 3A8QA 1KZ7A 4CHMA 4IFSA 4A6FB 2LULA 1NI2A 4L6EA 2AEHA 5CLLB 2DKPA 1MIZB 3VIAA 5EFXA 2UVMA 1GC7A 1DDMA 5HE0A 4HDQA 1X1GA 1UPRA 2DX5A 4HAXB 2YF0A 2NMBA 1WGQA 3O96A 1J19A 2GCJA 3QWMA 4KAXB 2VSZA 1UNRA 2I1KA 5DIFB 2Y7BA 2VKIA 3LJUX 2W2XC 4HB4B 4ZRKA 2FJLA 3DXCA 4A6HA 1PLSA 2MWNB 4KHOA 3ML4A 4GXBA 2DHJA 2I1JA 4GMVA 2MKRA 1EGXA 3HK0A 2QKLA 4YONA 1WJMA 4WVFB 4BBKA 2QKMA 4GMXB 4Z2MB 2D10A 4GZUA 2Y8GA 4EMOA 3D8EA 3GYOA 1K5DB 1FGYA 2M14A 2J0JA 2I5CA 1E5WA 1U5FA 2D4QA 5KQ1A 2OTXA 4A6FA 4ZRIA 1ZM0A 1FAOA 1N3HA 5HE1A 4WSFA 1M7RA 1RJ2A 2COCA 3BINA 3G9WA 3D8FA 5LOPB 3PP2A 3WA0A 2K00A 2CY4A 2DA0A 1DROA 1SHCA 1XKEA 3DXEA 2RLOA 1ZC4B 4B6HA 2P0FA 1U29A 4C0AA 2N23A 3PZDA 1PFJA 1X86A 2D2QA 4HAYB 2DYQA 1Y5OA 1BTNA 1SGHA 2EMTA 3QBVB 5DHAB 4TYZA 3HQCA 3IVFA 2JP2A 5D3YA 5C79A 4NY0A 2KCJA 4GN1A 5D27A 2RNRB 3OANA 1MAIA 2CAYA 1V61A 1I7AA 4IOYX 2P0HA 2V76A 4MT7A 1UPQA 1GG3A 2DTCA 3A98B 1FB8A 4PNKA 2Y8FA 3RCPA 3TFMA 2LOZA 3SUZA 1IRSA 3DXDA 1Y19B 2K2UA 3KRWA 4HAZB 2ADZA 3AU4A 1V5UA 1U5GA 3AU5A 2Z0OA 2OQBA 5J3YA 2ROZB 3SO6A 2MFQA 5JHGA 2LOXA 2MDXA 2J0KA 5JP4A 1TXDA 4Y94A 4HAUB 4DX8A 1X11A 3V5WA 2VRWB 1NTYA 2D9ZA 3ULBA 5LONB 3TVVA 2CODA 3PG7A 4PQ0A 2BCJA 3PSCA 4HAVB 3ZDTA 3F0WA 2IYBA 5D3VA 1W1GA 1ZVRA 1J0WA 2YS3A 2EJ8A 4KHBB 1MK7B 4K17A 5KCVA 1XODA 1PMSA 2K2JA 3T06A 1U5DA 3N7CA 1OY2A 5C16A 2UZRA 2RUKB 1EVHA 1KZGA 4EJNA 3P6AA 5C6RA 1V88A 1TQZA 5JHHA 4WJ7A 4HB3B 2PZ1A 3HW2B 1WVHA 5D3WA 2E2XA 1M7EA 2DHKA 2H7EA 1NU2A 4A5KA 2YVCA 3BJIA 3ODOA 3FEHA 3PVUA 3U8ZA 3SV1A 5GOWB 3ZVRA 4K81A 4F7UP 2RVBB 4EKUA 2RSGA 4KVGB 2P8VA 1OQNA 5C5BA 1V5MA 1FHXA 4HB2B 2YS5A 5FI1A 4MK0A 2DHIA 1P6SA 2COAA 5J3TA 2X18A 1ZSQA 3KRXA 2D9WA 1U5EA 1NTVA 1XR0B 4HB0B 2DKQA 2ELAA 3QIJA 3KSYA 2YT1A 2DFKA 1DDWA 2R09A 1WGUA 3UZTA 3PVWA 5JLJB 4F7HA 2UZSA 3KY9A 2CRFA 1WG7A 1BAKA 1BWNA 4DBBA 1MKEA 1MPHA 4CHJA 3FSSA 5J3QA 1P5TA 2I5FA 4H8SA 1FHOA 2HTHB 1LB1A 2YT0A 1DDVA 1FGZA 4GPTB 1I2HA 1UEFA 4P7IA 2H7DA 1QC6A 3MPXA 2YRYA 4MY6A 1BTKA 3VOQA 3MDBC 2D9VA 1WJ1A 1DYNA 2D11A 4DX90 1UNPA 1EF1A 1XX0A 2YS1A 2Z0PA 2W2XD 2ELBA 3SNHA 1QQGA 1UNQA 1OMWA 1X05A 3CXBB 4HHVA 2DX1A 2AL6A 3FM8C 2KUPA 4TKNA 2ZPYA 1ZC3B 5HE2A 4D0NB 2LG1A 3M1IB 2N0YA 2EC1A 3P7ZA 2YSZA 3ODWA 4IAPA 4NSWA 5KQ4A 2GS0A 1Q67A 1FOEA 1Z87A 2KGXB 5D3XA 1ISNA 1LW3A 2LYDA 4K2PA 2DN6A 2J59M 2D9YA 2GJYA 1KI1B 1B55A 1EAZA 5L81A 1MIXA 1W1HA 1XCGA 1W1DA 2ROVA 2COFA 1V89A 1GC6A 2EMSA 2GCLA 2NZ8B 2Q13A 3A8PA 2J0MA 4YL8A 3X23A 3CIKA 3NSUA 1AQCA 2LKOA 2L1CA 2RGNB 4ZRJA 2HE7A 1AWEA 1XD4A 2DYNA 3PEGA 2CY5A 3TW1A 2W2WA 4F7GA 4A6KA 3AJ4A 1H4RA 5CLQB 1RRPB 1WI1A 2IFSA 3WYFB 1K5GB 1P3RA 2P0DA 1TJ6A 3PVLA 5FI0A 3ULCA 5C5BB 1U27A 3D8DA 1U2BA 3F5RA 4K2OA 2M38A 5HE3A 2XQNM 2DLWA 2Z0QA 5DH9B 2D9XA 5DI9B 1X1FA 1MK9B
chains in the Genus database with same CATH superfamily
5M4YB 4CYEA 2R0DA 4KHAA 1FHWA 1V5PA 3KZ1A 3OHMB 4HAWB 3SYXA 3TO1A 3GYPA 3TCAA 3ODXA 4Z2NA 2G35A 3U7DA 4HDOA 4HATB 5DHFB 4QJ4B 4DXAB 1DBHA 1H10A 4OSNA 2L2IA 4XWXA 3A8QA 1KZ7A 4CHMA 4IFSA 4A6FB 2LULA 1NI2A 4L6EA 2AEHA 5CLLB 2DKPA 1MIZB 3VIAA 5EFXA 2UVMA 1GC7A 3NWDA 1DDMA 5HE0A 4HDQA 1X1GA 1UPRA 2DX5A 4HAXB 2YF0A 2NMBA 1WGQA 3O96A 1J19A 2GCJA 3QWMA 4KAXB 2VSZA 1UNRA 2I1KA 5DIFB 2Y7BA 2VKIA 3LJUX 2W2XC 4HB4B 4ZRKA 2FJLA 3DXCA 4A6HA 1PLSA 2MWNB 4KHOA 3ML4A 3HIEA 2DHJA 2I1JA 4GXBA 4GMVA 2MKRA 1EGXA 3HK0A 2QKLA 4YONA 1WJMA 4WVFB 4BBKA 2QKMA 4GMXB 4Z2MB 4QXAB 2D10A 4CSQA 4GZUA 2Y8GA 4EMOA 3D8EA 3GYOA 1K5DB 1FGYA 2M14A 5I2MA 2J0JA 2KIGA 2I5CA 1E5WA 1U5FA 2D4QA 5KQ1A 2OTXA 4A6FA 4ZRIA 1ZM0A 1FAOA 1N3HA 2K49A 5HE1A 4WSFA 1M7RA 1RJ2A 2COCA 3FVCA 3BINA 2Z59A 3G9WA 3D8FA 5LOPB 3PP2A 3WA0A 2K00A 1ZYIA 2CY4A 2DA0A 1DROA 1SHCA 1XKEA 3DXEA 2RLOA 1ZC4B 4B6HA 2P0FA 1U29A 4C0AA 2N23A 3PZDA 1PFJA 4OT1A 1X86A 2D2QA 4HAYB 2DYQA 1Y5OA 1BTNA 1SGHA 2EMTA 3QBVB 5DHAB 4TYZA 3HQCA 3IVFA 2JP2A 5D3YA 5C79A 4NY0A 2KCJA 4GN1A 5D27A 2RNRB 3OANA 1MAIA 2CAYA 1T77A 1V61A 1I7AA 4IOYX 2P0HA 2V76A 4MT7A 1UPQA 1GG3A 2Z4DA 2DTCA 2FJUB 3A98B 1FB8A 4PNKA 2Y8FA 3RCPA 3TFMA 2LOZA 3SUZA 1IRSA 3DXDA 1Y19B 2K2UA 3KRWA 4HAZB 2ADZA 3AU4A 1V5UA 1U5GA 3AU5A 2Z0OA 2OQBA 5J3YA 2ROZB 3SO6A 2MFQA 5JHGA 2LOXA 2MDXA 2J0KA 5JP4A 1TXDA 4Y94A 4HAUB 4DX8A 1X11A 2Z14A 3V5WA 2VRWB 1NTYA 2D9ZA 3ULBA 5LONB 3TVVA 2CODA 3PG7A 4PQ0A 2BCJA 3PSCA 4HAVB 5LG4B 3ZDTA 3F0WA 2IYBA 5D3VA 1W1GA 2K8EA 1J0WA 1ZVRA 2YS3A 2EJ8A 4KHBB 1MK7B 4K17A 5KCVA 2Z13A 1XODA 1PMSA 2K2JA 3T06A 1U5DA 3N7CA 1OY2A 5C16A 2UZRA 2RUKB 1EVHA 1KZGA 4EJNA 3P6AA 5C6RA 1V88A 1TQZA 4KHBA 5JHHA 2KIEA 4WJ7A 4HB3B 2PZ1A 3HW2B 1WVHA 5D3WA 2E2XA 1M7EA 2DHKA 2H7EA 1NU2A 5IRSA 4A5KA 2YVCA 3BJIA 4QJ5B 3ODOA 3FEHA 3PVUA 3U8ZA 3SV1A 5GOWB 3ZVRA 4K81A 4F7UP 2RVBB 4EKUA 2RSGA 4KVGB 2YT2A 4DIXA 2P8VA 3NWFA 1OQNA 5C5BA 3DCXA 1V5MA 1FHXA 3A58A 3B77A 4HB2B 2YS5A 5FI1A 4MK0A 2DHIA 1P6SA 2COAA 5J3TA 2X18A 1ZSQA 3KRXA 2D9WA 1U5EA 1NTVA 1XR0B 2DKQA 3QIJA 2ELAA 4HB0B 3KSYA 2YT1A 2DFKA 1DDWA 2R09A 1WGUA 3UZTA 3PVWA 5JLJB 4F7HA 2UZSA 3KY9A 2CRFA 1WG7A 1BAKA 3U12A 1BWNA 4DBBA 1MKEA 1MPHA 4CHJA 2KUQA 3FSSA 5J3QA 1P5TA 2I5FA 4H8SA 1FHOA 2HTHB 1LB1A 2KR0A 2YT0A 1DDVA 1FGZA 4GPTB 1I2HA 2GUMA 1UEFA 4P7IA 2H7DA 1QC6A 3MPXA 2YRYA 2RRFA 4MY6A 1BTKA 3VOQA 3MDBC 2D9VA 1WJ1A 1DYNA 2D11A 4DX90 1UNPA 1EF1A 1XX0A 2YS1A 2Z0PA 2W2XD 2ELBA 3SNHA 1QQGA 1UNQA 1OMWA 1X05A 3CXBB 4HHVA 2DX1A 2AL6A 3FM8C 2KUPA 4TKNA 2ZPYA 5I2SA 1ZC3B 5HE2A 4D0NB 2LG1A 3M1IB 2N0YA 2EC1A 3P7ZA 2YSZA 3ODWA 4IAPA 2NBVA 4NSWA 5KQ4A 2GS0A 1Q67A 1FOEA 1Z87A 2KGXB 5D3XA 1ISNA 1LW3A 2LYDA 4K2PA 2DN6A 2J59M 2D9YA 1MI1A 2GJYA 1KI1B 1B55A 1EAZA 3HSAA 5L81A 1MIXA 1W1HA 2R2YA 1XCGA 4GOUA 1W1DA 4L1RA 2ROVA 4D6WA 2COFA 1V89A 1GC6A 2EMSA 2GCLA 2NZ8B 2Q13A 3A8PA 2J0MA 4YL8A 3X23A 3CIKA 2ZKMX 3NSUA 1AQCA 2LKOA 2L1CA 2RGNB 4ZRJA 2HE7A 1AWEA 1XD4A 2DYNA 3PEGA 2CY5A 3TW1A 2W2WA 4F7GA 4A6KA 3AJ4A 1H4RA 4QJ3B 5CLQB 1RRPB 1WI1A 2IFSA 3WYFB 1K5GB 1P3RA 2P0DA 1TJ6A 3PVLA 5FI0A 3ULCA 5C5BB 1U27A 4HSIA 3D8DA 1U2BA 3NW8A 3F5RA 4K2OA 2M38A 5HE3A 2XQNM 2DLWA 2Z0QA 5DH9B 3NWAA 2D9XA 5DI9B 1X1FA 4GNKB 1MK9B
chains in the Genus database with same CATH topology
4CYEA 2R0DA 4KHAA 1FHWA 1V5PA 3KZ1A 4HAWB 3SYXA 3TO1A 3GYPA 3TCAA 3ODXA 4Z2NA 2G35A 3U7DA 4HDOA 4HATB 5DHFB 4DXAB 1DBHA 1H10A 2L2IA 4XWXA 3A8QA 1KZ7A 4CHMA 4IFSA 4A6FB 2LULA 1NI2A 4L6EA 2AEHA 5CLLB 2DKPA 1MIZB 3VIAA 5EFXA 2UVMA 1GC7A 1DDMA 5HE0A 4HDQA 1X1GA 1UPRA 2DX5A 4HAXB 2YF0A 2NMBA 1WGQA 3O96A 1J19A 2GCJA 3QWMA 4KAXB 2VSZA 1UNRA 2I1KA 5DIFB 2Y7BA 2VKIA 3LJUX 2W2XC 4HB4B 4ZRKA 2FJLA 3DXCA 4A6HA 1PLSA 2MWNB 4KHOA 3ML4A 4GXBA 2DHJA 2I1JA 4GMVA 2MKRA 1EGXA 3HK0A 2QKLA 4YONA 1WJMA 4WVFB 4BBKA 2QKMA 4GMXB 4Z2MB 2D10A 4GZUA 2Y8GA 4EMOA 3D8EA 3GYOA 1K5DB 1FGYA 2M14A 2J0JA 2I5CA 1E5WA 1U5FA 2D4QA 5KQ1A 2OTXA 4A6FA 4ZRIA 1ZM0A 1FAOA 1N3HA 5HE1A 4WSFA 1M7RA 1RJ2A 2COCA 3BINA 3G9WA 3D8FA 5LOPB 3PP2A 3WA0A 2K00A 2CY4A 2DA0A 1DROA 1SHCA 1XKEA 3DXEA 2RLOA 1ZC4B 4B6HA 2P0FA 1U29A 4C0AA 2N23A 3PZDA 1PFJA 1X86A 2D2QA 4HAYB 2DYQA 1Y5OA 1BTNA 1SGHA 2EMTA 3QBVB 5DHAB 4TYZA 3HQCA 3IVFA 2JP2A 5D3YA 5C79A 4NY0A 2KCJA 4GN1A 5D27A 2RNRB 3OANA 1MAIA 2CAYA 1V61A 1I7AA 4IOYX 2P0HA 2V76A 4MT7A 1UPQA 1GG3A 2DTCA 3A98B 1FB8A 4PNKA 2Y8FA 3RCPA 3TFMA 2LOZA 3SUZA 1IRSA 3DXDA 1Y19B 2K2UA 3KRWA 4HAZB 2ADZA 3AU4A 1V5UA 1U5GA 3AU5A 2Z0OA 2OQBA 5J3YA 2ROZB 3SO6A 2MFQA 5JHGA 2LOXA 2MDXA 2J0KA 5JP4A 1TXDA 4Y94A 4HAUB 4DX8A 1X11A 3V5WA 2VRWB 1NTYA 2D9ZA 3ULBA 5LONB 3TVVA 2CODA 3PG7A 4PQ0A 2BCJA 3PSCA 4HAVB 3ZDTA 3F0WA 2IYBA 5D3VA 1W1GA 1ZVRA 1J0WA 2YS3A 2EJ8A 4KHBB 1MK7B 4K17A 5KCVA 1XODA 1PMSA 2K2JA 3T06A 1U5DA 3N7CA 1OY2A 5C16A 2UZRA 2RUKB 1EVHA 1KZGA 4EJNA 3P6AA 5C6RA 1V88A 1TQZA 5JHHA 4WJ7A 4HB3B 2PZ1A 3HW2B 1WVHA 5D3WA 2E2XA 1M7EA 2DHKA 2H7EA 1NU2A 4A5KA 2YVCA 3BJIA 3ODOA 3FEHA 3PVUA 3U8ZA 3SV1A 5GOWB 3ZVRA 4K81A 4F7UP 2RVBB 4EKUA 2RSGA 4KVGB 2P8VA 1OQNA 5C5BA 1V5MA 1FHXA 4HB2B 2YS5A 5FI1A 4MK0A 2DHIA 1P6SA 2COAA 5J3TA 2X18A 1ZSQA 3KRXA 2D9WA 1U5EA 1NTVA 1XR0B 4HB0B 2DKQA 2ELAA 3QIJA 3KSYA 2YT1A 2DFKA 1DDWA 2R09A 1WGUA 3UZTA 3PVWA 5JLJB 4F7HA 2UZSA 3KY9A 2CRFA 1WG7A 1BAKA 1BWNA 4DBBA 1MKEA 1MPHA 4CHJA 3FSSA 5J3QA 1P5TA 2I5FA 4H8SA 1FHOA 2HTHB 1LB1A 2YT0A 1DDVA 1FGZA 4GPTB 1I2HA 1UEFA 4P7IA 2H7DA 1QC6A 3MPXA 2YRYA 4MY6A 1BTKA 3VOQA 3MDBC 2D9VA 1WJ1A 1DYNA 2D11A 4DX90 1UNPA 1EF1A 1XX0A 2YS1A 2Z0PA 2W2XD 2ELBA 3SNHA 1QQGA 1UNQA 1OMWA 1X05A 3CXBB 4HHVA 2DX1A 2AL6A 3FM8C 2KUPA 4TKNA 2ZPYA 1ZC3B 5HE2A 4D0NB 2LG1A 3M1IB 2N0YA 2EC1A 3P7ZA 2YSZA 3ODWA 4IAPA 4NSWA 5KQ4A 2GS0A 1Q67A 1FOEA 1Z87A 2KGXB 5D3XA 1ISNA 1LW3A 2LYDA 4K2PA 2DN6A 2J59M 2D9YA 2GJYA 1KI1B 1B55A 1EAZA 5L81A 1MIXA 1W1HA 1XCGA 1W1DA 2ROVA 2COFA 1V89A 1GC6A 2EMSA 2GCLA 2NZ8B 2Q13A 3A8PA 2J0MA 4YL8A 3X23A 3CIKA 3NSUA 1AQCA 2LKOA 2L1CA 2RGNB 4ZRJA 2HE7A 1AWEA 1XD4A 2DYNA 3PEGA 2CY5A 3TW1A 2W2WA 4F7GA 4A6KA 3AJ4A 1H4RA 5CLQB 1RRPB 1WI1A 2IFSA 3WYFB 1K5GB 1P3RA 2P0DA 1TJ6A 3PVLA 5FI0A 3ULCA 5C5BB 1U27A 3D8DA 1U2BA 3F5RA 4K2OA 2M38A 5HE3A 2XQNM 2DLWA 2Z0QA 5DH9B 2D9XA 5DI9B 1X1FA 1MK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  2R0D A;  4KHA A;  1FHW A;  1V5P A;  3KZ1 A;  4HAW B;  3SYX A;  3TO1 A;  3GYP A;  3TCA A;  3ODX A;  4Z2N A;  2G35 A;  3U7D A;  4HDO A;  4HAT B;  5DHF B;  4DXA B;  1DBH A;  1H10 A;  2L2I A;  4XWX A;  3A8Q A;  1KZ7 A;  4CHM A;  4IFS A;  4A6F B;  2LUL A;  1NI2 A;  4L6E A;  2AEH A;  5CLL B;  2DKP A;  1MIZ B;  3VIA A;  5EFX A;  2UVM A;  1GC7 A;  1DDM A;  5HE0 A;  4HDQ A;  1X1G A;  1UPR A;  2DX5 A;  4HAX B;  2YF0 A;  2NMB A;  1WGQ A;  3O96 A;  1J19 A;  2GCJ A;  3QWM A;  4KAX B;  2VSZ A;  1UNR A;  2I1K A;  5DIF B;  2Y7B A;  2VKI A;  3LJU X;  2W2X C;  4HB4 B;  4ZRK A;  2FJL A;  3DXC A;  4A6H A;  1PLS A;  2MWN B;  4KHO A;  3ML4 A;  4GXB A;  2DHJ A;  2I1J A;  4GMV A;  2MKR A;  1EGX A;  3HK0 A;  2QKL A;  4YON A;  1WJM A;  4WVF B;  4BBK A;  2QKM A;  4GMX B;  4Z2M B;  2D10 A;  4GZU A;  2Y8G A;  4EMO A;  3D8E A;  3GYO A;  1K5D B;  1FGY A;  2M14 A;  2J0J A;  2I5C A;  1E5W A;  1U5F A;  2D4Q A;  5KQ1 A;  2OTX A;  4A6F A;  4ZRI A;  1ZM0 A;  1FAO A;  1N3H A;  5HE1 A;  4WSF A;  1M7R A;  1RJ2 A;  2COC A;  3BIN A;  3G9W A;  3D8F A;  5LOP B;  3PP2 A;  3WA0 A;  2K00 A;  2CY4 A;  2DA0 A;  1DRO A;  1SHC A;  1XKE A;  3DXE A;  2RLO A;  1ZC4 B;  4B6H A;  2P0F A;  1U29 A;  4C0A A;  2N23 A;  3PZD A;  1PFJ A;  1X86 A;  2D2Q A;  4HAY B;  2DYQ A;  1Y5O A;  1BTN A;  1SGH A;  2EMT A;  3QBV B;  5DHA B;  4TYZ A;  3HQC A;  3IVF A;  2JP2 A;  5D3Y A;  5C79 A;  4NY0 A;  2KCJ A;  4GN1 A;  5D27 A;  2RNR B;  3OAN A;  1MAI A;  2CAY A;  1V61 A;  1I7A A;  4IOY X;  2P0H A;  2V76 A;  4MT7 A;  1UPQ A;  1GG3 A;  2DTC A;  3A98 B;  1FB8 A;  4PNK A;  2Y8F A;  3RCP A;  3TFM A;  2LOZ A;  3SUZ A;  1IRS A;  3DXD A;  1Y19 B;  2K2U A;  3KRW A;  4HAZ B;  2ADZ A;  3AU4 A;  1V5U A;  1U5G A;  3AU5 A;  2Z0O A;  2OQB A;  5J3Y A;  2ROZ B;  3SO6 A;  2MFQ A;  5JHG A;  2LOX A;  2MDX A;  2J0K A;  5JP4 A;  1TXD A;  4Y94 A;  4HAU B;  4DX8 A;  1X11 A;  3V5W A;  2VRW B;  1NTY A;  2D9Z A;  3ULB A;  5LON B;  3TVV A;  2COD A;  3PG7 A;  4PQ0 A;  2BCJ A;  3PSC A;  4HAV B;  3ZDT A;  3F0W A;  2IYB A;  5D3V A;  1W1G A;  1ZVR A;  1J0W A;  2YS3 A;  2EJ8 A;  4KHB B;  1MK7 B;  4K17 A;  5KCV A;  1XOD A;  1PMS A;  2K2J A;  3T06 A;  1U5D A;  3N7C A;  1OY2 A;  5C16 A;  2UZR A;  2RUK B;  1EVH A;  1KZG A;  4EJN A;  3P6A A;  5C6R A;  1V88 A;  1TQZ A;  5JHH A;  4WJ7 A;  4HB3 B;  2PZ1 A;  3HW2 B;  1WVH A;  5D3W A;  2E2X A;  1M7E A;  2DHK A;  2H7E A;  1NU2 A;  4A5K A;  2YVC A;  3BJI A;  3ODO A;  3FEH A;  3PVU A;  3U8Z A;  3SV1 A;  5GOW B;  3ZVR A;  4K81 A;  4F7U P;  2RVB B;  4EKU A;  2RSG A;  4KVG B;  2P8V A;  1OQN A;  5C5B A;  1V5M A;  1FHX A;  4HB2 B;  2YS5 A;  5FI1 A;  4MK0 A;  2DHI A;  1P6S A;  2COA A;  5J3T A;  2X18 A;  1ZSQ A;  3KRX A;  2D9W A;  1U5E A;  1NTV A;  1XR0 B;  4HB0 B;  2DKQ A;  2ELA A;  3QIJ A;  3KSY A;  2YT1 A;  2DFK A;  1DDW A;  2R09 A;  1WGU A;  3UZT A;  3PVW A;  5JLJ B;  4F7H A;  2UZS A;  3KY9 A;  2CRF A;  1WG7 A;  1BAK A;  1BWN A;  4DBB A;  1MKE A;  1MPH A;  4CHJ A;  3FSS A;  5J3Q A;  1P5T A;  2I5F A;  4H8S A;  1FHO A;  2HTH B;  1LB1 A;  2YT0 A;  1DDV A;  1FGZ A;  4GPT B;  1I2H A;  1UEF A;  4P7I A;  2H7D A;  1QC6 A;  3MPX A;  2YRY A;  4MY6 A;  1BTK A;  3VOQ A;  3MDB C;  2D9V A;  1WJ1 A;  1DYN A;  2D11 A;  4DX9 0;  1UNP A;  1EF1 A;  1XX0 A;  2YS1 A;  2Z0P A;  2W2X D;  2ELB A;  3SNH A;  1QQG A;  1UNQ A;  1OMW A;  1X05 A;  3CXB B;  4HHV A;  2DX1 A;  2AL6 A;  3FM8 C;  2KUP A;  4TKN A;  2ZPY A;  1ZC3 B;  5HE2 A;  4D0N B;  2LG1 A;  3M1I B;  2N0Y A;  2EC1 A;  3P7Z A;  2YSZ A;  3ODW A;  4IAP A;  4NSW A;  5KQ4 A;  2GS0 A;  1Q67 A;  1FOE A;  1Z87 A;  2KGX B;  5D3X A;  1ISN A;  1LW3 A;  2LYD A;  4K2P A;  2DN6 A;  2J59 M;  2D9Y A;  2GJY A;  1KI1 B;  1B55 A;  1EAZ A;  5L81 A;  1MIX A;  1W1H A;  1XCG A;  1W1D A;  2ROV A;  2COF A;  1V89 A;  1GC6 A;  2EMS A;  2GCL A;  2NZ8 B;  2Q13 A;  3A8P A;  2J0M A;  4YL8 A;  3X23 A;  3CIK A;  3NSU A;  1AQC A;  2LKO A;  2L1C A;  2RGN B;  4ZRJ A;  2HE7 A;  1AWE A;  1XD4 A;  2DYN A;  3PEG A;  2CY5 A;  3TW1 A;  2W2W A;  4F7G A;  4A6K A;  3AJ4 A;  1H4R A;  5CLQ B;  1RRP B;  1WI1 A;  2IFS A;  3WYF B;  1K5G B;  1P3R A;  2P0D A;  1TJ6 A;  3PVL A;  5FI0 A;  3ULC A;  5C5B B;  1U27 A;  3D8D A;  1U2B A;  3F5R A;  4K2O A;  2M38 A;  5HE3 A;  2XQN M;  2DLW A;  2Z0Q A;  5DH9 B;  2D9X A;  5DI9 B;  1X1F A;  1MK9 B; 
#chains in the Genus database with same CATH topology
 5M4Y B;  4CYE A;  2R0D A;  4KHA A;  1FHW A;  1V5P A;  3KZ1 A;  3OHM B;  4HAW B;  3SYX A;  3TO1 A;  3GYP A;  3TCA A;  3ODX A;  4Z2N A;  2G35 A;  3U7D A;  4HDO A;  4HAT B;  5DHF B;  4QJ4 B;  4DXA B;  1DBH A;  1H10 A;  4OSN A;  2L2I A;  4XWX A;  3A8Q A;  1KZ7 A;  4CHM A;  4IFS A;  4A6F B;  2LUL A;  1NI2 A;  4L6E A;  2AEH A;  5CLL B;  2DKP A;  1MIZ B;  3VIA A;  5EFX A;  2UVM A;  1GC7 A;  3NWD A;  1DDM A;  5HE0 A;  4HDQ A;  1X1G A;  1UPR A;  2DX5 A;  4HAX B;  2YF0 A;  2NMB A;  1WGQ A;  3O96 A;  1J19 A;  2GCJ A;  3QWM A;  4KAX B;  2VSZ A;  1UNR A;  2I1K A;  5DIF B;  2Y7B A;  2VKI A;  3LJU X;  2W2X C;  4HB4 B;  4ZRK A;  2FJL A;  3DXC A;  4A6H A;  1PLS A;  2MWN B;  4KHO A;  3ML4 A;  3HIE A;  2DHJ A;  2I1J A;  4GXB A;  4GMV A;  2MKR A;  1EGX A;  3HK0 A;  2QKL A;  4YON A;  1WJM A;  4WVF B;  4BBK A;  2QKM A;  4GMX B;  4Z2M B;  4QXA B;  2D10 A;  4CSQ A;  4GZU A;  2Y8G A;  4EMO A;  3D8E A;  3GYO A;  1K5D B;  1FGY A;  2M14 A;  5I2M A;  2J0J A;  2KIG A;  2I5C A;  1E5W A;  1U5F A;  2D4Q A;  5KQ1 A;  2OTX A;  4A6F A;  4ZRI A;  1ZM0 A;  1FAO A;  1N3H A;  2K49 A;  5HE1 A;  4WSF A;  1M7R A;  1RJ2 A;  2COC A;  3FVC A;  3BIN A;  2Z59 A;  3G9W A;  3D8F A;  5LOP B;  3PP2 A;  3WA0 A;  2K00 A;  1ZYI A;  2CY4 A;  2DA0 A;  1DRO A;  1SHC A;  1XKE A;  3DXE A;  2RLO A;  1ZC4 B;  4B6H A;  2P0F A;  1U29 A;  4C0A A;  2N23 A;  3PZD A;  1PFJ A;  4OT1 A;  1X86 A;  2D2Q A;  4HAY B;  2DYQ A;  1Y5O A;  1BTN A;  1SGH A;  2EMT A;  3QBV B;  5DHA B;  4TYZ A;  3HQC A;  3IVF A;  2JP2 A;  5D3Y A;  5C79 A;  4NY0 A;  2KCJ A;  4GN1 A;  5D27 A;  2RNR B;  3OAN A;  1MAI A;  2CAY A;  1T77 A;  1V61 A;  1I7A A;  4IOY X;  2P0H A;  2V76 A;  4MT7 A;  1UPQ A;  1GG3 A;  2Z4D A;  2DTC A;  2FJU B;  3A98 B;  1FB8 A;  4PNK A;  2Y8F A;  3RCP A;  3TFM A;  2LOZ A;  3SUZ A;  1IRS A;  3DXD A;  1Y19 B;  2K2U A;  3KRW A;  4HAZ B;  2ADZ A;  3AU4 A;  1V5U A;  1U5G A;  3AU5 A;  2Z0O A;  2OQB A;  5J3Y A;  2ROZ B;  3SO6 A;  2MFQ A;  5JHG A;  2LOX A;  2MDX A;  2J0K A;  5JP4 A;  1TXD A;  4Y94 A;  4HAU B;  4DX8 A;  1X11 A;  2Z14 A;  3V5W A;  2VRW B;  1NTY A;  2D9Z A;  3ULB A;  5LON B;  3TVV A;  2COD A;  3PG7 A;  4PQ0 A;  2BCJ A;  3PSC A;  4HAV B;  5LG4 B;  3ZDT A;  3F0W A;  2IYB A;  5D3V A;  1W1G A;  2K8E A;  1J0W A;  1ZVR A;  2YS3 A;  2EJ8 A;  4KHB B;  1MK7 B;  4K17 A;  5KCV A;  2Z13 A;  1XOD A;  1PMS A;  2K2J A;  3T06 A;  1U5D A;  3N7C A;  1OY2 A;  5C16 A;  2UZR A;  2RUK B;  1EVH A;  1KZG A;  4EJN A;  3P6A A;  5C6R A;  1V88 A;  1TQZ A;  4KHB A;  5JHH A;  2KIE A;  4WJ7 A;  4HB3 B;  2PZ1 A;  3HW2 B;  1WVH A;  5D3W A;  2E2X A;  1M7E A;  2DHK A;  2H7E A;  1NU2 A;  5IRS A;  4A5K A;  2YVC A;  3BJI A;  4QJ5 B;  3ODO A;  3FEH A;  3PVU A;  3U8Z A;  3SV1 A;  5GOW B;  3ZVR A;  4K81 A;  4F7U P;  2RVB B;  4EKU A;  2RSG A;  4KVG B;  2YT2 A;  4DIX A;  2P8V A;  3NWF A;  1OQN A;  5C5B A;  3DCX A;  1V5M A;  1FHX A;  3A58 A;  3B77 A;  4HB2 B;  2YS5 A;  5FI1 A;  4MK0 A;  2DHI A;  1P6S A;  2COA A;  5J3T A;  2X18 A;  1ZSQ A;  3KRX A;  2D9W A;  1U5E A;  1NTV A;  1XR0 B;  2DKQ A;  3QIJ A;  2ELA A;  4HB0 B;  3KSY A;  2YT1 A;  2DFK A;  1DDW A;  2R09 A;  1WGU A;  3UZT A;  3PVW A;  5JLJ B;  4F7H A;  2UZS A;  3KY9 A;  2CRF A;  1WG7 A;  1BAK A;  3U12 A;  1BWN A;  4DBB A;  1MKE A;  1MPH A;  4CHJ A;  2KUQ A;  3FSS A;  5J3Q A;  1P5T A;  2I5F A;  4H8S A;  1FHO A;  2HTH B;  1LB1 A;  2KR0 A;  2YT0 A;  1DDV A;  1FGZ A;  4GPT B;  1I2H A;  2GUM A;  1UEF A;  4P7I A;  2H7D A;  1QC6 A;  3MPX A;  2YRY A;  2RRF A;  4MY6 A;  1BTK A;  3VOQ A;  3MDB C;  2D9V A;  1WJ1 A;  1DYN A;  2D11 A;  4DX9 0;  1UNP A;  1EF1 A;  1XX0 A;  2YS1 A;  2Z0P A;  2W2X D;  2ELB A;  3SNH A;  1QQG A;  1UNQ A;  1OMW A;  1X05 A;  3CXB B;  4HHV A;  2DX1 A;  2AL6 A;  3FM8 C;  2KUP A;  4TKN A;  2ZPY A;  5I2S A;  1ZC3 B;  5HE2 A;  4D0N B;  2LG1 A;  3M1I B;  2N0Y A;  2EC1 A;  3P7Z A;  2YSZ A;  3ODW A;  4IAP A;  2NBV A;  4NSW A;  5KQ4 A;  2GS0 A;  1Q67 A;  1FOE A;  1Z87 A;  2KGX B;  5D3X A;  1ISN A;  1LW3 A;  2LYD A;  4K2P A;  2DN6 A;  2J59 M;  2D9Y A;  1MI1 A;  2GJY A;  1KI1 B;  1B55 A;  1EAZ A;  3HSA A;  5L81 A;  1MIX A;  1W1H A;  2R2Y A;  1XCG A;  4GOU A;  1W1D A;  4L1R A;  2ROV A;  4D6W A;  2COF A;  1V89 A;  1GC6 A;  2EMS A;  2GCL A;  2NZ8 B;  2Q13 A;  3A8P A;  2J0M A;  4YL8 A;  3X23 A;  3CIK A;  2ZKM X;  3NSU A;  1AQC A;  2LKO A;  2L1C A;  2RGN B;  4ZRJ A;  2HE7 A;  1AWE A;  1XD4 A;  2DYN A;  3PEG A;  2CY5 A;  3TW1 A;  2W2W A;  4F7G A;  4A6K A;  3AJ4 A;  1H4R A;  4QJ3 B;  5CLQ B;  1RRP B;  1WI1 A;  2IFS A;  3WYF B;  1K5G B;  1P3R A;  2P0D A;  1TJ6 A;  3PVL A;  5FI0 A;  3ULC A;  5C5B B;  1U27 A;  4HSI A;  3D8D A;  1U2B A;  3NW8 A;  3F5R A;  4K2O A;  2M38 A;  5HE3 A;  2XQN M;  2DLW A;  2Z0Q A;  5DH9 B;  3NWA A;  2D9X A;  5DI9 B;  1X1F A;  4GNK B;  1MK9 B; 
#chains in the Genus database with same CATH homology
 4CYE A;  2R0D A;  4KHA A;  1FHW A;  1V5P A;  3KZ1 A;  4HAW B;  3SYX A;  3TO1 A;  3GYP A;  3TCA A;  3ODX A;  4Z2N A;  2G35 A;  3U7D A;  4HDO A;  4HAT B;  5DHF B;  4DXA B;  1DBH A;  1H10 A;  2L2I A;  4XWX A;  3A8Q A;  1KZ7 A;  4CHM A;  4IFS A;  4A6F B;  2LUL A;  1NI2 A;  4L6E A;  2AEH A;  5CLL B;  2DKP A;  1MIZ B;  3VIA A;  5EFX A;  2UVM A;  1GC7 A;  1DDM A;  5HE0 A;  4HDQ A;  1X1G A;  1UPR A;  2DX5 A;  4HAX B;  2YF0 A;  2NMB A;  1WGQ A;  3O96 A;  1J19 A;  2GCJ A;  3QWM A;  4KAX B;  2VSZ A;  1UNR A;  2I1K A;  5DIF B;  2Y7B A;  2VKI A;  3LJU X;  2W2X C;  4HB4 B;  4ZRK A;  2FJL A;  3DXC A;  4A6H A;  1PLS A;  2MWN B;  4KHO A;  3ML4 A;  4GXB A;  2DHJ A;  2I1J A;  4GMV A;  2MKR A;  1EGX A;  3HK0 A;  2QKL A;  4YON A;  1WJM A;  4WVF B;  4BBK A;  2QKM A;  4GMX B;  4Z2M B;  2D10 A;  4GZU A;  2Y8G A;  4EMO A;  3D8E A;  3GYO A;  1K5D B;  1FGY A;  2M14 A;  2J0J A;  2I5C A;  1E5W A;  1U5F A;  2D4Q A;  5KQ1 A;  2OTX A;  4A6F A;  4ZRI A;  1ZM0 A;  1FAO A;  1N3H A;  5HE1 A;  4WSF A;  1M7R A;  1RJ2 A;  2COC A;  3BIN A;  3G9W A;  3D8F A;  5LOP B;  3PP2 A;  3WA0 A;  2K00 A;  2CY4 A;  2DA0 A;  1DRO A;  1SHC A;  1XKE A;  3DXE A;  2RLO A;  1ZC4 B;  4B6H A;  2P0F A;  1U29 A;  4C0A A;  2N23 A;  3PZD A;  1PFJ A;  1X86 A;  2D2Q A;  4HAY B;  2DYQ A;  1Y5O A;  1BTN A;  1SGH A;  2EMT A;  3QBV B;  5DHA B;  4TYZ A;  3HQC A;  3IVF A;  2JP2 A;  5D3Y A;  5C79 A;  4NY0 A;  2KCJ A;  4GN1 A;  5D27 A;  2RNR B;  3OAN A;  1MAI A;  2CAY A;  1V61 A;  1I7A A;  4IOY X;  2P0H A;  2V76 A;  4MT7 A;  1UPQ A;  1GG3 A;  2DTC A;  3A98 B;  1FB8 A;  4PNK A;  2Y8F A;  3RCP A;  3TFM A;  2LOZ A;  3SUZ A;  1IRS A;  3DXD A;  1Y19 B;  2K2U A;  3KRW A;  4HAZ B;  2ADZ A;  3AU4 A;  1V5U A;  1U5G A;  3AU5 A;  2Z0O A;  2OQB A;  5J3Y A;  2ROZ B;  3SO6 A;  2MFQ A;  5JHG A;  2LOX A;  2MDX A;  2J0K A;  5JP4 A;  1TXD A;  4Y94 A;  4HAU B;  4DX8 A;  1X11 A;  3V5W A;  2VRW B;  1NTY A;  2D9Z A;  3ULB A;  5LON B;  3TVV A;  2COD A;  3PG7 A;  4PQ0 A;  2BCJ A;  3PSC A;  4HAV B;  3ZDT A;  3F0W A;  2IYB A;  5D3V A;  1W1G A;  1ZVR A;  1J0W A;  2YS3 A;  2EJ8 A;  4KHB B;  1MK7 B;  4K17 A;  5KCV A;  1XOD A;  1PMS A;  2K2J A;  3T06 A;  1U5D A;  3N7C A;  1OY2 A;  5C16 A;  2UZR A;  2RUK B;  1EVH A;  1KZG A;  4EJN A;  3P6A A;  5C6R A;  1V88 A;  1TQZ A;  5JHH A;  4WJ7 A;  4HB3 B;  2PZ1 A;  3HW2 B;  1WVH A;  5D3W A;  2E2X A;  1M7E A;  2DHK A;  2H7E A;  1NU2 A;  4A5K A;  2YVC A;  3BJI A;  3ODO A;  3FEH A;  3PVU A;  3U8Z A;  3SV1 A;  5GOW B;  3ZVR A;  4K81 A;  4F7U P;  2RVB B;  4EKU A;  2RSG A;  4KVG B;  2P8V A;  1OQN A;  5C5B A;  1V5M A;  1FHX A;  4HB2 B;  2YS5 A;  5FI1 A;  4MK0 A;  2DHI A;  1P6S A;  2COA A;  5J3T A;  2X18 A;  1ZSQ A;  3KRX A;  2D9W A;  1U5E A;  1NTV A;  1XR0 B;  4HB0 B;  2DKQ A;  2ELA A;  3QIJ A;  3KSY A;  2YT1 A;  2DFK A;  1DDW A;  2R09 A;  1WGU A;  3UZT A;  3PVW A;  5JLJ B;  4F7H A;  2UZS A;  3KY9 A;  2CRF A;  1WG7 A;  1BAK A;  1BWN A;  4DBB A;  1MKE A;  1MPH A;  4CHJ A;  3FSS A;  5J3Q A;  1P5T A;  2I5F A;  4H8S A;  1FHO A;  2HTH B;  1LB1 A;  2YT0 A;  1DDV A;  1FGZ A;  4GPT B;  1I2H A;  1UEF A;  4P7I A;  2H7D A;  1QC6 A;  3MPX A;  2YRY A;  4MY6 A;  1BTK A;  3VOQ A;  3MDB C;  2D9V A;  1WJ1 A;  1DYN A;  2D11 A;  4DX9 0;  1UNP A;  1EF1 A;  1XX0 A;  2YS1 A;  2Z0P A;  2W2X D;  2ELB A;  3SNH A;  1QQG A;  1UNQ A;  1OMW A;  1X05 A;  3CXB B;  4HHV A;  2DX1 A;  2AL6 A;  3FM8 C;  2KUP A;  4TKN A;  2ZPY A;  1ZC3 B;  5HE2 A;  4D0N B;  2LG1 A;  3M1I B;  2N0Y A;  2EC1 A;  3P7Z A;  2YSZ A;  3ODW A;  4IAP A;  4NSW A;  5KQ4 A;  2GS0 A;  1Q67 A;  1FOE A;  1Z87 A;  2KGX B;  5D3X A;  1ISN A;  1LW3 A;  2LYD A;  4K2P A;  2DN6 A;  2J59 M;  2D9Y A;  2GJY A;  1KI1 B;  1B55 A;  1EAZ A;  5L81 A;  1MIX A;  1W1H A;  1XCG A;  1W1D A;  2ROV A;  2COF A;  1V89 A;  1GC6 A;  2EMS A;  2GCL A;  2NZ8 B;  2Q13 A;  3A8P A;  2J0M A;  4YL8 A;  3X23 A;  3CIK A;  3NSU A;  1AQC A;  2LKO A;  2L1C A;  2RGN B;  4ZRJ A;  2HE7 A;  1AWE A;  1XD4 A;  2DYN A;  3PEG A;  2CY5 A;  3TW1 A;  2W2W A;  4F7G A;  4A6K A;  3AJ4 A;  1H4R A;  5CLQ B;  1RRP B;  1WI1 A;  2IFS A;  3WYF B;  1K5G B;  1P3R A;  2P0D A;  1TJ6 A;  3PVL A;  5FI0 A;  3ULC A;  5C5B B;  1U27 A;  3D8D A;  1U2B A;  3F5R A;  4K2O A;  2M38 A;  5HE3 A;  2XQN M;  2DLW A;  2Z0Q A;  5DH9 B;  2D9X A;  5DI9 B;  1X1F A;  1MK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...