2MWNB

Talin-f3 / riam n-terminal peptide complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
b'YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/signaling protein
total genus 11
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mwnB00
3G9WA 2EJ8A 1FAOA 2RLOA 3V5WA 4DBBA 3HK0A 2YRYA 1BAKA 2DKQA 4DX8A 4WJ7A 1I2HA 1X11A 4EJNA 3ULBA 4DX90 4CHJA 3ML4A 1EF1A 1NU2A 3BINA 3D8DA 2COCA 4KHBB 2UVMA 1ZSQA 3A98B 2LKOA 4HB2B 1WG7A 2RSGA 4K2PA 2GCJA 3KY9A 2D9XA 4TKNA 2I1KA 2DHJA 1W1DA 4YONA 2UZSA 3CIKA 4F7GA 2P0HA 5D3XA 5J3QA 4A5KA 2CODA 1UNPA 2BCJA 3A8PA 3F5RA 3U7DA 2YS3A 5DHAB 1DDVA 3TCAA 4L6EA 3PVLA 1PLSA 1V61A 5C16A 4EMOA 2YSZA 3DXEA 3PG7A 2J59M 1K5GB 2COFA 4H8SA 1Q67A 2DN6A 1FOEA 5D3VA 3KRWA 2G35A 1NTVA 1V5PA 4ZRIA 3DXDA 2RUKB 3U8ZA 2DTCA 2P0DA 3PVUA 2GS0A 1BTNA 1P6SA 1RJ2A 4IAPA 3KRXA 1WJMA 1X05A 2DFKA 4NSWA 4Z2NA 2H7DA 2X18A 2LULA 2R0DA 1DBHA 1MAIA 4PQ0A 1Y19B 2CY5A 2XQNM 3QIJA 1UEFA 2YF0A 2J0MA 3NSUA 2E2XA 2GJYA 4A6FA 5DIFB 1PFJA 2OQBA 3FSSA 5GOWB 3AJ4A 1U5GA 1TXDA 5JHGA 1V5UA 1UNRA 3BJIA 2Y8FA 1B55A 1Z87A 2DKPA 3ZVRA 2D11A 1XKEA 2MWNB 1U27A 3HW2B 4HAWB 2D2QA 3D8EA 1FGZA 3VOQA 3ODWA 4ZRJA 5EFXA 1ZC3B 4HATB 1XCGA 4YL8A 1J0WA 4A6FB 1X1GA 1XX0A 2W2XC 1V88A 4F7UP 1OQNA 3OANA 1MIXA 3CXBB 4K17A 1TQZA 2M14A 2CAYA 3ODOA 3FM8C 3GYOA 3PZDA 2MDXA 1P5TA 3TFMA 2EMSA 2DX1A 2D4QA 1V89A 5C6RA 2ELBA 1GC6A 5HE3A 1ISNA 1W1GA 5JHHA 3SNHA 2CRFA 2DX5A 1NI2A 2H7EA 3QBVB 4PNKA 2CY4A 2KUPA 3P7ZA 3TVVA 2I5CA 2ZPYA 2Z0OA 3TW1A 5KCVA 2DYNA 1UNQA 2PZ1A 2I1JA 1J19A 3MDBC 2DHKA 5C5BA 2ADZA 4HDQA 4HAXB 4CHMA 4GN1A 1NTYA 3A8QA 3LJUX 1GG3A 1WGQA 1MK9B 2LOXA 1QC6A 4GMXB 3KZ1A 1MKEA 5D27A 2Q13A 1H4RA 5KQ4A 2VRWB 1FB8A 5DI9B 1DDWA 1UPRA 1P3RA 2W2XD 2DA0A 5C5BB 3VIAA 5LONB 1SGHA 4HDOA 3IVFA 4HAZB 5KQ1A 1FGYA 1ZVRA 4WSFA 2LYDA 3D8FA 1IRSA 1V5MA 2RNRB 1PMSA 4MK0A 3F0WA 3ULCA 1BWNA 5DH9B 2D9ZA 2GCLA 1OY2A 3SV1A 3AU5A 1EGXA 3PEGA 1E5WA 3FEHA 5FI0A 3SUZA 2VKIA 2DLWA 5L81A 3PVWA 5DHFB 3SYXA 2J0JA 1U5DA 1W1HA 2W2WA 4P7IA 4GMVA 4WVFB 2D9WA 2NMBA 2YVCA 4EKUA 1FHWA 2HTHB 5JLJB 1EAZA 2P8VA 3PP2A 1WJ1A 5C79A 4D0NB 1OMWA 5CLQB 3GYPA 2YT1A 4HB3B 2DYQA 2D9YA 4KHOA 3N7CA 1ZC4B 4GZUA 4GPTB 2Z0QA 5D3WA 2YS5A 1M7EA 2QKLA 1XD4A 2ROVA 5LOPB 2Z0PA 1WVHA 4IFSA 4A6HA 3WA0A 2K00A 2KGXB 1KI1B 1K5DB 5J3YA 2HE7A 4C0AA 5HE2A 4KVGB 2K2JA 1TJ6A 1LB1A 1BTKA 2LOZA 4B6HA 2KCJA 1H10A 2YS1A 2D10A 1U5FA 2P0FA 5CLLB 4Y94A 1WI1A 1MIZB 2ROZB 2UZRA 4NY0A 2K2UA 1LW3A 2RGNB 2OTXA 4DXAB 2Y8GA 3O96A 3MPXA 2M38A 3TO1A 4Z2MB 2RVBB 4HAYB 3AU4A 4XWXA 2EMTA 3ODXA 4IOYX 4KAXB 2AL6A 1N3HA 1Y5OA 3X23A 1U2BA 4GXBA 3WYFB 2MFQA 1DYNA 1M7RA 4F7HA 3UZTA 1FHOA 1X86A 2J0KA 2L2IA 2QKMA 2V76A 1U29A 3DXCA 1MPHA 4CYEA 3RCPA 3HQCA 2FJLA 1KZGA 2D9VA 5J3TA 4BBKA 1X1FA 3PSCA 5HE0A 4TYZA 2DHIA 4HAVB 1MK7B 1DROA 2ELAA 4MY6A 3ZDTA 3SO6A 4KHAA 1SHCA 2VSZA 1QQGA 3P6AA 4K81A 3KSYA 1WGUA 2IFSA 4HAUB 2L1CA 2R09A 1XODA 5D3YA 1ZM0A 1XR0B 5FI1A 4K2OA 5JP4A 4HHVA 5HE1A 2EC1A 2COAA 1RRPB 3QWMA 1DDMA 3M1IB 2MKRA 2YT0A 4HB0B 1UPQA 2AEHA 2N23A 1KZ7A 1FHXA 1I7AA 4ZRKA 4A6KA 4MT7A 4HB4B 1AWEA 2I5FA 1EVHA 2Y7BA 2LG1A 1AQCA 2NZ8B 2N0YA 3T06A 2JP2A 2IYBA 1GC7A 1U5EA
chains in the Genus database with same CATH superfamily
3G9WA 2EJ8A 1FAOA 2RLOA 3DCXA 3V5WA 4DBBA 3HK0A 4KHBA 2YRYA 4OSNA 1BAKA 2DKQA 4DX8A 4WJ7A 1I2HA 1X11A 4EJNA 3ULBA 4DX90 4GOUA 4CHJA 3OHMB 3ML4A 1EF1A 1NU2A 3BINA 3D8DA 4DIXA 2COCA 3FVCA 4KHBB 2UVMA 1ZSQA 3A98B 2LKOA 4HB2B 1WG7A 2RSGA 4K2PA 2GCJA 3KY9A 2D9XA 4TKNA 2I1KA 2DHJA 1W1DA 4YONA 2UZSA 3CIKA 4F7GA 2P0HA 5D3XA 5J3QA 4A5KA 2CODA 1UNPA 2BCJA 3A8PA 3F5RA 3U7DA 2YS3A 5DHAB 1DDVA 3TCAA 4L6EA 3PVLA 1PLSA 1V61A 5C16A 4EMOA 2YSZA 3DXEA 3PG7A 2J59M 1K5GB 1MI1A 3NWFA 2COFA 3HSAA 4H8SA 1Q67A 2FJUB 2DN6A 1FOEA 5D3VA 2K8EA 3KRWA 2G35A 1NTVA 1V5PA 4ZRIA 3DXDA 2RUKB 3U8ZA 2DTCA 2P0DA 3PVUA 2GS0A 1BTNA 1P6SA 1RJ2A 4IAPA 3KRXA 3U12A 1WJMA 1X05A 2DFKA 4NSWA 4Z2NA 2KIEA 2H7DA 2X18A 2LULA 2R0DA 1DBHA 1MAIA 4PQ0A 1T77A 1Y19B 2CY5A 2XQNM 3QIJA 1UEFA 2YF0A 2J0MA 5I2MA 2Z4DA 3NSUA 2E2XA 2GJYA 4A6FA 5M4YB 5DIFB 1PFJA 2OQBA 3FSSA 5GOWB 3AJ4A 1U5GA 1TXDA 5JHGA 1V5UA 1UNRA 3BJIA 2Y8FA 1B55A 1Z87A 2DKPA 3ZVRA 2R2YA 2D11A 1XKEA 2MWNB 1U27A 3HW2B 4HAWB 2D2QA 3D8EA 1FGZA 3VOQA 3ODWA 4D6WA 4ZRJA 2GUMA 5EFXA 1ZC3B 2K49A 4HATB 1XCGA 4YL8A 1J0WA 4A6FB 1X1GA 1XX0A 2W2XC 1V88A 4F7UP 1OQNA 4CSQA 3OANA 1MIXA 3CXBB 4K17A 1TQZA 2M14A 2CAYA 2NBVA 3ODOA 3FM8C 3GYOA 3PZDA 2MDXA 1P5TA 3TFMA 2EMSA 2DX1A 2D4QA 1V89A 5C6RA 2ELBA 1GC6A 5HE3A 1ISNA 1W1GA 5JHHA 3SNHA 2CRFA 2DX5A 1NI2A 2H7EA 3QBVB 4L1RA 4PNKA 2CY4A 2KUPA 3P7ZA 3TVVA 2I5CA 4QJ3B 2ZPYA 2Z0OA 3TW1A 5KCVA 4QJ5B 2DYNA 1UNQA 2PZ1A 4QXAB 2I1JA 1J19A 3MDBC 2DHKA 5C5BA 2ADZA 4HDQA 4HAXB 4CHMA 4GN1A 5I2SA 1NTYA 3A8QA 3LJUX 1GG3A 1WGQA 1MK9B 2LOXA 1QC6A 4GMXB 3KZ1A 1MKEA 5D27A 2Q13A 1H4RA 5KQ4A 2VRWB 1FB8A 5DI9B 1DDWA 1UPRA 1P3RA 3NW8A 2W2XD 2DA0A 5C5BB 3VIAA 5LONB 1SGHA 4HDOA 3IVFA 4HAZB 5KQ1A 1FGYA 1ZVRA 4WSFA 2LYDA 3D8FA 1IRSA 1V5MA 2RNRB 1PMSA 4MK0A 3F0WA 3ULCA 1BWNA 5DH9B 2D9ZA 2GCLA 1OY2A 3HIEA 3SV1A 3AU5A 1EGXA 3A58A 3PEGA 1E5WA 3FEHA 5FI0A 3SUZA 2VKIA 2DLWA 5L81A 3PVWA 5DHFB 2YT2A 4GNKB 3SYXA 2J0JA 1U5DA 1W1HA 2W2WA 4P7IA 4GMVA 4WVFB 1ZYIA 2D9WA 2NMBA 2YVCA 4EKUA 1FHWA 2HTHB 5JLJB 1EAZA 2P8VA 3PP2A 1WJ1A 5C79A 4D0NB 1OMWA 5CLQB 3GYPA 2YT1A 4HB3B 2DYQA 2D9YA 4KHOA 3N7CA 1ZC4B 4GZUA 4GPTB 2Z0QA 5D3WA 2YS5A 1M7EA 2QKLA 1XD4A 2ROVA 3B77A 5LG4B 5LOPB 2Z0PA 1WVHA 4IFSA 4A6HA 3WA0A 2K00A 2KGXB 1KI1B 1K5DB 5J3YA 2HE7A 4C0AA 5HE2A 4KVGB 2K2JA 1TJ6A 1LB1A 1BTKA 2LOZA 4B6HA 2KCJA 1H10A 2YS1A 2D10A 1U5FA 2P0FA 5CLLB 4Y94A 1WI1A 1MIZB 2ROZB 2UZRA 2Z14A 4NY0A 2K2UA 1LW3A 2RGNB 2KR0A 2OTXA 4DXAB 2Y8GA 3O96A 3MPXA 2M38A 3TO1A 4Z2MB 2RVBB 4HAYB 3AU4A 2KIGA 4XWXA 2EMTA 3ODXA 4IOYX 4KAXB 2AL6A 1N3HA 1Y5OA 3X23A 1U2BA 4GXBA 3WYFB 2MFQA 1DYNA 1M7RA 4F7HA 3UZTA 1FHOA 1X86A 2J0KA 2L2IA 2QKMA 2V76A 1U29A 3DXCA 1MPHA 4CYEA 3RCPA 3HQCA 2FJLA 1KZGA 2D9VA 5J3TA 4BBKA 1X1FA 2KUQA 3PSCA 4QJ4B 5HE0A 4TYZA 2DHIA 4HAVB 1MK7B 1DROA 2ELAA 4MY6A 3ZDTA 3SO6A 4KHAA 1SHCA 2VSZA 1QQGA 3P6AA 4K81A 3KSYA 1WGUA 2IFSA 4HSIA 4HAUB 2L1CA 2R09A 1XODA 5D3YA 1ZM0A 1XR0B 3NWAA 5FI1A 4K2OA 5JP4A 3NWDA 4HHVA 5HE1A 2EC1A 2COAA 1RRPB 3QWMA 2Z13A 1DDMA 3M1IB 2MKRA 2ZKMX 2YT0A 4HB0B 1UPQA 2AEHA 2N23A 2Z59A 1KZ7A 1FHXA 1I7AA 4ZRKA 4A6KA 4MT7A 5IRSA 4HB4B 1AWEA 2I5FA 2RRFA 1EVHA 2Y7BA 2LG1A 1AQCA 2NZ8B 2N0YA 3T06A 4OT1A 2JP2A 2IYBA 1GC7A 1U5EA
chains in the Genus database with same CATH topology
3G9WA 2EJ8A 1FAOA 2RLOA 3V5WA 4DBBA 3HK0A 2YRYA 1BAKA 2DKQA 4DX8A 4WJ7A 1I2HA 1X11A 4EJNA 3ULBA 4DX90 4CHJA 3ML4A 1EF1A 1NU2A 3BINA 3D8DA 2COCA 4KHBB 2UVMA 1ZSQA 3A98B 2LKOA 4HB2B 1WG7A 2RSGA 4K2PA 2GCJA 3KY9A 2D9XA 4TKNA 2I1KA 2DHJA 1W1DA 4YONA 2UZSA 3CIKA 4F7GA 2P0HA 5D3XA 5J3QA 4A5KA 2CODA 1UNPA 2BCJA 3A8PA 3F5RA 3U7DA 2YS3A 5DHAB 1DDVA 3TCAA 4L6EA 3PVLA 1PLSA 1V61A 5C16A 4EMOA 2YSZA 3DXEA 3PG7A 2J59M 1K5GB 2COFA 4H8SA 1Q67A 2DN6A 1FOEA 5D3VA 3KRWA 2G35A 1NTVA 1V5PA 4ZRIA 3DXDA 2RUKB 3U8ZA 2DTCA 2P0DA 3PVUA 2GS0A 1BTNA 1P6SA 1RJ2A 4IAPA 3KRXA 1WJMA 1X05A 2DFKA 4NSWA 4Z2NA 2H7DA 2X18A 2LULA 2R0DA 1DBHA 1MAIA 4PQ0A 1Y19B 2CY5A 2XQNM 3QIJA 1UEFA 2YF0A 2J0MA 3NSUA 2E2XA 2GJYA 4A6FA 5DIFB 1PFJA 2OQBA 3FSSA 5GOWB 3AJ4A 1U5GA 1TXDA 5JHGA 1V5UA 1UNRA 3BJIA 2Y8FA 1B55A 1Z87A 2DKPA 3ZVRA 2D11A 1XKEA 2MWNB 1U27A 3HW2B 4HAWB 2D2QA 3D8EA 1FGZA 3VOQA 3ODWA 4ZRJA 5EFXA 1ZC3B 4HATB 1XCGA 4YL8A 1J0WA 4A6FB 1X1GA 1XX0A 2W2XC 1V88A 4F7UP 1OQNA 3OANA 1MIXA 3CXBB 4K17A 1TQZA 2M14A 2CAYA 3ODOA 3FM8C 3GYOA 3PZDA 2MDXA 1P5TA 3TFMA 2EMSA 2DX1A 2D4QA 1V89A 5C6RA 2ELBA 1GC6A 5HE3A 1ISNA 1W1GA 5JHHA 3SNHA 2CRFA 2DX5A 1NI2A 2H7EA 3QBVB 4PNKA 2CY4A 2KUPA 3P7ZA 3TVVA 2I5CA 2ZPYA 2Z0OA 3TW1A 5KCVA 2DYNA 1UNQA 2PZ1A 2I1JA 1J19A 3MDBC 2DHKA 5C5BA 2ADZA 4HDQA 4HAXB 4CHMA 4GN1A 1NTYA 3A8QA 3LJUX 1GG3A 1WGQA 1MK9B 2LOXA 1QC6A 4GMXB 3KZ1A 1MKEA 5D27A 2Q13A 1H4RA 5KQ4A 2VRWB 1FB8A 5DI9B 1DDWA 1UPRA 1P3RA 2W2XD 2DA0A 5C5BB 3VIAA 5LONB 1SGHA 4HDOA 3IVFA 4HAZB 5KQ1A 1FGYA 1ZVRA 4WSFA 2LYDA 3D8FA 1IRSA 1V5MA 2RNRB 1PMSA 4MK0A 3F0WA 3ULCA 1BWNA 5DH9B 2D9ZA 2GCLA 1OY2A 3SV1A 3AU5A 1EGXA 3PEGA 1E5WA 3FEHA 5FI0A 3SUZA 2VKIA 2DLWA 5L81A 3PVWA 5DHFB 3SYXA 2J0JA 1U5DA 1W1HA 2W2WA 4P7IA 4GMVA 4WVFB 2D9WA 2NMBA 2YVCA 4EKUA 1FHWA 2HTHB 5JLJB 1EAZA 2P8VA 3PP2A 1WJ1A 5C79A 4D0NB 1OMWA 5CLQB 3GYPA 2YT1A 4HB3B 2DYQA 2D9YA 4KHOA 3N7CA 1ZC4B 4GZUA 4GPTB 2Z0QA 5D3WA 2YS5A 1M7EA 2QKLA 1XD4A 2ROVA 5LOPB 2Z0PA 1WVHA 4IFSA 4A6HA 3WA0A 2K00A 2KGXB 1KI1B 1K5DB 5J3YA 2HE7A 4C0AA 5HE2A 4KVGB 2K2JA 1TJ6A 1LB1A 1BTKA 2LOZA 4B6HA 2KCJA 1H10A 2YS1A 2D10A 1U5FA 2P0FA 5CLLB 4Y94A 1WI1A 1MIZB 2ROZB 2UZRA 4NY0A 2K2UA 1LW3A 2RGNB 2OTXA 4DXAB 2Y8GA 3O96A 3MPXA 2M38A 3TO1A 4Z2MB 2RVBB 4HAYB 3AU4A 4XWXA 2EMTA 3ODXA 4IOYX 4KAXB 2AL6A 1N3HA 1Y5OA 3X23A 1U2BA 4GXBA 3WYFB 2MFQA 1DYNA 1M7RA 4F7HA 3UZTA 1FHOA 1X86A 2J0KA 2L2IA 2QKMA 2V76A 1U29A 3DXCA 1MPHA 4CYEA 3RCPA 3HQCA 2FJLA 1KZGA 2D9VA 5J3TA 4BBKA 1X1FA 3PSCA 5HE0A 4TYZA 2DHIA 4HAVB 1MK7B 1DROA 2ELAA 4MY6A 3ZDTA 3SO6A 4KHAA 1SHCA 2VSZA 1QQGA 3P6AA 4K81A 3KSYA 1WGUA 2IFSA 4HAUB 2L1CA 2R09A 1XODA 5D3YA 1ZM0A 1XR0B 5FI1A 4K2OA 5JP4A 4HHVA 5HE1A 2EC1A 2COAA 1RRPB 3QWMA 1DDMA 3M1IB 2MKRA 2YT0A 4HB0B 1UPQA 2AEHA 2N23A 1KZ7A 1FHXA 1I7AA 4ZRKA 4A6KA 4MT7A 4HB4B 1AWEA 2I5FA 1EVHA 2Y7BA 2LG1A 1AQCA 2NZ8B 2N0YA 3T06A 2JP2A 2IYBA 1GC7A 1U5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9W A;  2EJ8 A;  1FAO A;  2RLO A;  3V5W A;  4DBB A;  3HK0 A;  2YRY A;  1BAK A;  2DKQ A;  4DX8 A;  4WJ7 A;  1I2H A;  1X11 A;  4EJN A;  3ULB A;  4DX9 0;  4CHJ A;  3ML4 A;  1EF1 A;  1NU2 A;  3BIN A;  3D8D A;  2COC A;  4KHB B;  2UVM A;  1ZSQ A;  3A98 B;  2LKO A;  4HB2 B;  1WG7 A;  2RSG A;  4K2P A;  2GCJ A;  3KY9 A;  2D9X A;  4TKN A;  2I1K A;  2DHJ A;  1W1D A;  4YON A;  2UZS A;  3CIK A;  4F7G A;  2P0H A;  5D3X A;  5J3Q A;  4A5K A;  2COD A;  1UNP A;  2BCJ A;  3A8P A;  3F5R A;  3U7D A;  2YS3 A;  5DHA B;  1DDV A;  3TCA A;  4L6E A;  3PVL A;  1PLS A;  1V61 A;  5C16 A;  4EMO A;  2YSZ A;  3DXE A;  3PG7 A;  2J59 M;  1K5G B;  2COF A;  4H8S A;  1Q67 A;  2DN6 A;  1FOE A;  5D3V A;  3KRW A;  2G35 A;  1NTV A;  1V5P A;  4ZRI A;  3DXD A;  2RUK B;  3U8Z A;  2DTC A;  2P0D A;  3PVU A;  2GS0 A;  1BTN A;  1P6S A;  1RJ2 A;  4IAP A;  3KRX A;  1WJM A;  1X05 A;  2DFK A;  4NSW A;  4Z2N A;  2H7D A;  2X18 A;  2LUL A;  2R0D A;  1DBH A;  1MAI A;  4PQ0 A;  1Y19 B;  2CY5 A;  2XQN M;  3QIJ A;  1UEF A;  2YF0 A;  2J0M A;  3NSU A;  2E2X A;  2GJY A;  4A6F A;  5DIF B;  1PFJ A;  2OQB A;  3FSS A;  5GOW B;  3AJ4 A;  1U5G A;  1TXD A;  5JHG A;  1V5U A;  1UNR A;  3BJI A;  2Y8F A;  1B55 A;  1Z87 A;  2DKP A;  3ZVR A;  2D11 A;  1XKE A;  2MWN B;  1U27 A;  3HW2 B;  4HAW B;  2D2Q A;  3D8E A;  1FGZ A;  3VOQ A;  3ODW A;  4ZRJ A;  5EFX A;  1ZC3 B;  4HAT B;  1XCG A;  4YL8 A;  1J0W A;  4A6F B;  1X1G A;  1XX0 A;  2W2X C;  1V88 A;  4F7U P;  1OQN A;  3OAN A;  1MIX A;  3CXB B;  4K17 A;  1TQZ A;  2M14 A;  2CAY A;  3ODO A;  3FM8 C;  3GYO A;  3PZD A;  2MDX A;  1P5T A;  3TFM A;  2EMS A;  2DX1 A;  2D4Q A;  1V89 A;  5C6R A;  2ELB A;  1GC6 A;  5HE3 A;  1ISN A;  1W1G A;  5JHH A;  3SNH A;  2CRF A;  2DX5 A;  1NI2 A;  2H7E A;  3QBV B;  4PNK A;  2CY4 A;  2KUP A;  3P7Z A;  3TVV A;  2I5C A;  2ZPY A;  2Z0O A;  3TW1 A;  5KCV A;  2DYN A;  1UNQ A;  2PZ1 A;  2I1J A;  1J19 A;  3MDB C;  2DHK A;  5C5B A;  2ADZ A;  4HDQ A;  4HAX B;  4CHM A;  4GN1 A;  1NTY A;  3A8Q A;  3LJU X;  1GG3 A;  1WGQ A;  1MK9 B;  2LOX A;  1QC6 A;  4GMX B;  3KZ1 A;  1MKE A;  5D27 A;  2Q13 A;  1H4R A;  5KQ4 A;  2VRW B;  1FB8 A;  5DI9 B;  1DDW A;  1UPR A;  1P3R A;  2W2X D;  2DA0 A;  5C5B B;  3VIA A;  5LON B;  1SGH A;  4HDO A;  3IVF A;  4HAZ B;  5KQ1 A;  1FGY A;  1ZVR A;  4WSF A;  2LYD A;  3D8F A;  1IRS A;  1V5M A;  2RNR B;  1PMS A;  4MK0 A;  3F0W A;  3ULC A;  1BWN A;  5DH9 B;  2D9Z A;  2GCL A;  1OY2 A;  3SV1 A;  3AU5 A;  1EGX A;  3PEG A;  1E5W A;  3FEH A;  5FI0 A;  3SUZ A;  2VKI A;  2DLW A;  5L81 A;  3PVW A;  5DHF B;  3SYX A;  2J0J A;  1U5D A;  1W1H A;  2W2W A;  4P7I A;  4GMV A;  4WVF B;  2D9W A;  2NMB A;  2YVC A;  4EKU A;  1FHW A;  2HTH B;  5JLJ B;  1EAZ A;  2P8V A;  3PP2 A;  1WJ1 A;  5C79 A;  4D0N B;  1OMW A;  5CLQ B;  3GYP A;  2YT1 A;  4HB3 B;  2DYQ A;  2D9Y A;  4KHO A;  3N7C A;  1ZC4 B;  4GZU A;  4GPT B;  2Z0Q A;  5D3W A;  2YS5 A;  1M7E A;  2QKL A;  1XD4 A;  2ROV A;  5LOP B;  2Z0P A;  1WVH A;  4IFS A;  4A6H A;  3WA0 A;  2K00 A;  2KGX B;  1KI1 B;  1K5D B;  5J3Y A;  2HE7 A;  4C0A A;  5HE2 A;  4KVG B;  2K2J A;  1TJ6 A;  1LB1 A;  1BTK A;  2LOZ A;  4B6H A;  2KCJ A;  1H10 A;  2YS1 A;  2D10 A;  1U5F A;  2P0F A;  5CLL B;  4Y94 A;  1WI1 A;  1MIZ B;  2ROZ B;  2UZR A;  4NY0 A;  2K2U A;  1LW3 A;  2RGN B;  2OTX A;  4DXA B;  2Y8G A;  3O96 A;  3MPX A;  2M38 A;  3TO1 A;  4Z2M B;  2RVB B;  4HAY B;  3AU4 A;  4XWX A;  2EMT A;  3ODX A;  4IOY X;  4KAX B;  2AL6 A;  1N3H A;  1Y5O A;  3X23 A;  1U2B A;  4GXB A;  3WYF B;  2MFQ A;  1DYN A;  1M7R A;  4F7H A;  3UZT A;  1FHO A;  1X86 A;  2J0K A;  2L2I A;  2QKM A;  2V76 A;  1U29 A;  3DXC A;  1MPH A;  4CYE A;  3RCP A;  3HQC A;  2FJL A;  1KZG A;  2D9V A;  5J3T A;  4BBK A;  1X1F A;  3PSC A;  5HE0 A;  4TYZ A;  2DHI A;  4HAV B;  1MK7 B;  1DRO A;  2ELA A;  4MY6 A;  3ZDT A;  3SO6 A;  4KHA A;  1SHC A;  2VSZ A;  1QQG A;  3P6A A;  4K81 A;  3KSY A;  1WGU A;  2IFS A;  4HAU B;  2L1C A;  2R09 A;  1XOD A;  5D3Y A;  1ZM0 A;  1XR0 B;  5FI1 A;  4K2O A;  5JP4 A;  4HHV A;  5HE1 A;  2EC1 A;  2COA A;  1RRP B;  3QWM A;  1DDM A;  3M1I B;  2MKR A;  2YT0 A;  4HB0 B;  1UPQ A;  2AEH A;  2N23 A;  1KZ7 A;  1FHX A;  1I7A A;  4ZRK A;  4A6K A;  4MT7 A;  4HB4 B;  1AWE A;  2I5F A;  1EVH A;  2Y7B A;  2LG1 A;  1AQC A;  2NZ8 B;  2N0Y A;  3T06 A;  2JP2 A;  2IYB A;  1GC7 A;  1U5E A; 
#chains in the Genus database with same CATH topology
 3G9W A;  2EJ8 A;  1FAO A;  2RLO A;  3DCX A;  3V5W A;  4DBB A;  3HK0 A;  4KHB A;  2YRY A;  4OSN A;  1BAK A;  2DKQ A;  4DX8 A;  4WJ7 A;  1I2H A;  1X11 A;  4EJN A;  3ULB A;  4DX9 0;  4GOU A;  4CHJ A;  3OHM B;  3ML4 A;  1EF1 A;  1NU2 A;  3BIN A;  3D8D A;  4DIX A;  2COC A;  3FVC A;  4KHB B;  2UVM A;  1ZSQ A;  3A98 B;  2LKO A;  4HB2 B;  1WG7 A;  2RSG A;  4K2P A;  2GCJ A;  3KY9 A;  2D9X A;  4TKN A;  2I1K A;  2DHJ A;  1W1D A;  4YON A;  2UZS A;  3CIK A;  4F7G A;  2P0H A;  5D3X A;  5J3Q A;  4A5K A;  2COD A;  1UNP A;  2BCJ A;  3A8P A;  3F5R A;  3U7D A;  2YS3 A;  5DHA B;  1DDV A;  3TCA A;  4L6E A;  3PVL A;  1PLS A;  1V61 A;  5C16 A;  4EMO A;  2YSZ A;  3DXE A;  3PG7 A;  2J59 M;  1K5G B;  1MI1 A;  3NWF A;  2COF A;  3HSA A;  4H8S A;  1Q67 A;  2FJU B;  2DN6 A;  1FOE A;  5D3V A;  2K8E A;  3KRW A;  2G35 A;  1NTV A;  1V5P A;  4ZRI A;  3DXD A;  2RUK B;  3U8Z A;  2DTC A;  2P0D A;  3PVU A;  2GS0 A;  1BTN A;  1P6S A;  1RJ2 A;  4IAP A;  3KRX A;  3U12 A;  1WJM A;  1X05 A;  2DFK A;  4NSW A;  4Z2N A;  2KIE A;  2H7D A;  2X18 A;  2LUL A;  2R0D A;  1DBH A;  1MAI A;  4PQ0 A;  1T77 A;  1Y19 B;  2CY5 A;  2XQN M;  3QIJ A;  1UEF A;  2YF0 A;  2J0M A;  5I2M A;  2Z4D A;  3NSU A;  2E2X A;  2GJY A;  4A6F A;  5M4Y B;  5DIF B;  1PFJ A;  2OQB A;  3FSS A;  5GOW B;  3AJ4 A;  1U5G A;  1TXD A;  5JHG A;  1V5U A;  1UNR A;  3BJI A;  2Y8F A;  1B55 A;  1Z87 A;  2DKP A;  3ZVR A;  2R2Y A;  2D11 A;  1XKE A;  2MWN B;  1U27 A;  3HW2 B;  4HAW B;  2D2Q A;  3D8E A;  1FGZ A;  3VOQ A;  3ODW A;  4D6W A;  4ZRJ A;  2GUM A;  5EFX A;  1ZC3 B;  2K49 A;  4HAT B;  1XCG A;  4YL8 A;  1J0W A;  4A6F B;  1X1G A;  1XX0 A;  2W2X C;  1V88 A;  4F7U P;  1OQN A;  4CSQ A;  3OAN A;  1MIX A;  3CXB B;  4K17 A;  1TQZ A;  2M14 A;  2CAY A;  2NBV A;  3ODO A;  3FM8 C;  3GYO A;  3PZD A;  2MDX A;  1P5T A;  3TFM A;  2EMS A;  2DX1 A;  2D4Q A;  1V89 A;  5C6R A;  2ELB A;  1GC6 A;  5HE3 A;  1ISN A;  1W1G A;  5JHH A;  3SNH A;  2CRF A;  2DX5 A;  1NI2 A;  2H7E A;  3QBV B;  4L1R A;  4PNK A;  2CY4 A;  2KUP A;  3P7Z A;  3TVV A;  2I5C A;  4QJ3 B;  2ZPY A;  2Z0O A;  3TW1 A;  5KCV A;  4QJ5 B;  2DYN A;  1UNQ A;  2PZ1 A;  4QXA B;  2I1J A;  1J19 A;  3MDB C;  2DHK A;  5C5B A;  2ADZ A;  4HDQ A;  4HAX B;  4CHM A;  4GN1 A;  5I2S A;  1NTY A;  3A8Q A;  3LJU X;  1GG3 A;  1WGQ A;  1MK9 B;  2LOX A;  1QC6 A;  4GMX B;  3KZ1 A;  1MKE A;  5D27 A;  2Q13 A;  1H4R A;  5KQ4 A;  2VRW B;  1FB8 A;  5DI9 B;  1DDW A;  1UPR A;  1P3R A;  3NW8 A;  2W2X D;  2DA0 A;  5C5B B;  3VIA A;  5LON B;  1SGH A;  4HDO A;  3IVF A;  4HAZ B;  5KQ1 A;  1FGY A;  1ZVR A;  4WSF A;  2LYD A;  3D8F A;  1IRS A;  1V5M A;  2RNR B;  1PMS A;  4MK0 A;  3F0W A;  3ULC A;  1BWN A;  5DH9 B;  2D9Z A;  2GCL A;  1OY2 A;  3HIE A;  3SV1 A;  3AU5 A;  1EGX A;  3A58 A;  3PEG A;  1E5W A;  3FEH A;  5FI0 A;  3SUZ A;  2VKI A;  2DLW A;  5L81 A;  3PVW A;  5DHF B;  2YT2 A;  4GNK B;  3SYX A;  2J0J A;  1U5D A;  1W1H A;  2W2W A;  4P7I A;  4GMV A;  4WVF B;  1ZYI A;  2D9W A;  2NMB A;  2YVC A;  4EKU A;  1FHW A;  2HTH B;  5JLJ B;  1EAZ A;  2P8V A;  3PP2 A;  1WJ1 A;  5C79 A;  4D0N B;  1OMW A;  5CLQ B;  3GYP A;  2YT1 A;  4HB3 B;  2DYQ A;  2D9Y A;  4KHO A;  3N7C A;  1ZC4 B;  4GZU A;  4GPT B;  2Z0Q A;  5D3W A;  2YS5 A;  1M7E A;  2QKL A;  1XD4 A;  2ROV A;  3B77 A;  5LG4 B;  5LOP B;  2Z0P A;  1WVH A;  4IFS A;  4A6H A;  3WA0 A;  2K00 A;  2KGX B;  1KI1 B;  1K5D B;  5J3Y A;  2HE7 A;  4C0A A;  5HE2 A;  4KVG B;  2K2J A;  1TJ6 A;  1LB1 A;  1BTK A;  2LOZ A;  4B6H A;  2KCJ A;  1H10 A;  2YS1 A;  2D10 A;  1U5F A;  2P0F A;  5CLL B;  4Y94 A;  1WI1 A;  1MIZ B;  2ROZ B;  2UZR A;  2Z14 A;  4NY0 A;  2K2U A;  1LW3 A;  2RGN B;  2KR0 A;  2OTX A;  4DXA B;  2Y8G A;  3O96 A;  3MPX A;  2M38 A;  3TO1 A;  4Z2M B;  2RVB B;  4HAY B;  3AU4 A;  2KIG A;  4XWX A;  2EMT A;  3ODX A;  4IOY X;  4KAX B;  2AL6 A;  1N3H A;  1Y5O A;  3X23 A;  1U2B A;  4GXB A;  3WYF B;  2MFQ A;  1DYN A;  1M7R A;  4F7H A;  3UZT A;  1FHO A;  1X86 A;  2J0K A;  2L2I A;  2QKM A;  2V76 A;  1U29 A;  3DXC A;  1MPH A;  4CYE A;  3RCP A;  3HQC A;  2FJL A;  1KZG A;  2D9V A;  5J3T A;  4BBK A;  1X1F A;  2KUQ A;  3PSC A;  4QJ4 B;  5HE0 A;  4TYZ A;  2DHI A;  4HAV B;  1MK7 B;  1DRO A;  2ELA A;  4MY6 A;  3ZDT A;  3SO6 A;  4KHA A;  1SHC A;  2VSZ A;  1QQG A;  3P6A A;  4K81 A;  3KSY A;  1WGU A;  2IFS A;  4HSI A;  4HAU B;  2L1C A;  2R09 A;  1XOD A;  5D3Y A;  1ZM0 A;  1XR0 B;  3NWA A;  5FI1 A;  4K2O A;  5JP4 A;  3NWD A;  4HHV A;  5HE1 A;  2EC1 A;  2COA A;  1RRP B;  3QWM A;  2Z13 A;  1DDM A;  3M1I B;  2MKR A;  2ZKM X;  2YT0 A;  4HB0 B;  1UPQ A;  2AEH A;  2N23 A;  2Z59 A;  1KZ7 A;  1FHX A;  1I7A A;  4ZRK A;  4A6K A;  4MT7 A;  5IRS A;  4HB4 B;  1AWE A;  2I5F A;  2RRF A;  1EVH A;  2Y7B A;  2LG1 A;  1AQC A;  2NZ8 B;  2N0Y A;  3T06 A;  4OT1 A;  2JP2 A;  2IYB A;  1GC7 A;  1U5E A; 
#chains in the Genus database with same CATH homology
 3G9W A;  2EJ8 A;  1FAO A;  2RLO A;  3V5W A;  4DBB A;  3HK0 A;  2YRY A;  1BAK A;  2DKQ A;  4DX8 A;  4WJ7 A;  1I2H A;  1X11 A;  4EJN A;  3ULB A;  4DX9 0;  4CHJ A;  3ML4 A;  1EF1 A;  1NU2 A;  3BIN A;  3D8D A;  2COC A;  4KHB B;  2UVM A;  1ZSQ A;  3A98 B;  2LKO A;  4HB2 B;  1WG7 A;  2RSG A;  4K2P A;  2GCJ A;  3KY9 A;  2D9X A;  4TKN A;  2I1K A;  2DHJ A;  1W1D A;  4YON A;  2UZS A;  3CIK A;  4F7G A;  2P0H A;  5D3X A;  5J3Q A;  4A5K A;  2COD A;  1UNP A;  2BCJ A;  3A8P A;  3F5R A;  3U7D A;  2YS3 A;  5DHA B;  1DDV A;  3TCA A;  4L6E A;  3PVL A;  1PLS A;  1V61 A;  5C16 A;  4EMO A;  2YSZ A;  3DXE A;  3PG7 A;  2J59 M;  1K5G B;  2COF A;  4H8S A;  1Q67 A;  2DN6 A;  1FOE A;  5D3V A;  3KRW A;  2G35 A;  1NTV A;  1V5P A;  4ZRI A;  3DXD A;  2RUK B;  3U8Z A;  2DTC A;  2P0D A;  3PVU A;  2GS0 A;  1BTN A;  1P6S A;  1RJ2 A;  4IAP A;  3KRX A;  1WJM A;  1X05 A;  2DFK A;  4NSW A;  4Z2N A;  2H7D A;  2X18 A;  2LUL A;  2R0D A;  1DBH A;  1MAI A;  4PQ0 A;  1Y19 B;  2CY5 A;  2XQN M;  3QIJ A;  1UEF A;  2YF0 A;  2J0M A;  3NSU A;  2E2X A;  2GJY A;  4A6F A;  5DIF B;  1PFJ A;  2OQB A;  3FSS A;  5GOW B;  3AJ4 A;  1U5G A;  1TXD A;  5JHG A;  1V5U A;  1UNR A;  3BJI A;  2Y8F A;  1B55 A;  1Z87 A;  2DKP A;  3ZVR A;  2D11 A;  1XKE A;  2MWN B;  1U27 A;  3HW2 B;  4HAW B;  2D2Q A;  3D8E A;  1FGZ A;  3VOQ A;  3ODW A;  4ZRJ A;  5EFX A;  1ZC3 B;  4HAT B;  1XCG A;  4YL8 A;  1J0W A;  4A6F B;  1X1G A;  1XX0 A;  2W2X C;  1V88 A;  4F7U P;  1OQN A;  3OAN A;  1MIX A;  3CXB B;  4K17 A;  1TQZ A;  2M14 A;  2CAY A;  3ODO A;  3FM8 C;  3GYO A;  3PZD A;  2MDX A;  1P5T A;  3TFM A;  2EMS A;  2DX1 A;  2D4Q A;  1V89 A;  5C6R A;  2ELB A;  1GC6 A;  5HE3 A;  1ISN A;  1W1G A;  5JHH A;  3SNH A;  2CRF A;  2DX5 A;  1NI2 A;  2H7E A;  3QBV B;  4PNK A;  2CY4 A;  2KUP A;  3P7Z A;  3TVV A;  2I5C A;  2ZPY A;  2Z0O A;  3TW1 A;  5KCV A;  2DYN A;  1UNQ A;  2PZ1 A;  2I1J A;  1J19 A;  3MDB C;  2DHK A;  5C5B A;  2ADZ A;  4HDQ A;  4HAX B;  4CHM A;  4GN1 A;  1NTY A;  3A8Q A;  3LJU X;  1GG3 A;  1WGQ A;  1MK9 B;  2LOX A;  1QC6 A;  4GMX B;  3KZ1 A;  1MKE A;  5D27 A;  2Q13 A;  1H4R A;  5KQ4 A;  2VRW B;  1FB8 A;  5DI9 B;  1DDW A;  1UPR A;  1P3R A;  2W2X D;  2DA0 A;  5C5B B;  3VIA A;  5LON B;  1SGH A;  4HDO A;  3IVF A;  4HAZ B;  5KQ1 A;  1FGY A;  1ZVR A;  4WSF A;  2LYD A;  3D8F A;  1IRS A;  1V5M A;  2RNR B;  1PMS A;  4MK0 A;  3F0W A;  3ULC A;  1BWN A;  5DH9 B;  2D9Z A;  2GCL A;  1OY2 A;  3SV1 A;  3AU5 A;  1EGX A;  3PEG A;  1E5W A;  3FEH A;  5FI0 A;  3SUZ A;  2VKI A;  2DLW A;  5L81 A;  3PVW A;  5DHF B;  3SYX A;  2J0J A;  1U5D A;  1W1H A;  2W2W A;  4P7I A;  4GMV A;  4WVF B;  2D9W A;  2NMB A;  2YVC A;  4EKU A;  1FHW A;  2HTH B;  5JLJ B;  1EAZ A;  2P8V A;  3PP2 A;  1WJ1 A;  5C79 A;  4D0N B;  1OMW A;  5CLQ B;  3GYP A;  2YT1 A;  4HB3 B;  2DYQ A;  2D9Y A;  4KHO A;  3N7C A;  1ZC4 B;  4GZU A;  4GPT B;  2Z0Q A;  5D3W A;  2YS5 A;  1M7E A;  2QKL A;  1XD4 A;  2ROV A;  5LOP B;  2Z0P A;  1WVH A;  4IFS A;  4A6H A;  3WA0 A;  2K00 A;  2KGX B;  1KI1 B;  1K5D B;  5J3Y A;  2HE7 A;  4C0A A;  5HE2 A;  4KVG B;  2K2J A;  1TJ6 A;  1LB1 A;  1BTK A;  2LOZ A;  4B6H A;  2KCJ A;  1H10 A;  2YS1 A;  2D10 A;  1U5F A;  2P0F A;  5CLL B;  4Y94 A;  1WI1 A;  1MIZ B;  2ROZ B;  2UZR A;  4NY0 A;  2K2U A;  1LW3 A;  2RGN B;  2OTX A;  4DXA B;  2Y8G A;  3O96 A;  3MPX A;  2M38 A;  3TO1 A;  4Z2M B;  2RVB B;  4HAY B;  3AU4 A;  4XWX A;  2EMT A;  3ODX A;  4IOY X;  4KAX B;  2AL6 A;  1N3H A;  1Y5O A;  3X23 A;  1U2B A;  4GXB A;  3WYF B;  2MFQ A;  1DYN A;  1M7R A;  4F7H A;  3UZT A;  1FHO A;  1X86 A;  2J0K A;  2L2I A;  2QKM A;  2V76 A;  1U29 A;  3DXC A;  1MPH A;  4CYE A;  3RCP A;  3HQC A;  2FJL A;  1KZG A;  2D9V A;  5J3T A;  4BBK A;  1X1F A;  3PSC A;  5HE0 A;  4TYZ A;  2DHI A;  4HAV B;  1MK7 B;  1DRO A;  2ELA A;  4MY6 A;  3ZDT A;  3SO6 A;  4KHA A;  1SHC A;  2VSZ A;  1QQG A;  3P6A A;  4K81 A;  3KSY A;  1WGU A;  2IFS A;  4HAU B;  2L1C A;  2R09 A;  1XOD A;  5D3Y A;  1ZM0 A;  1XR0 B;  5FI1 A;  4K2O A;  5JP4 A;  4HHV A;  5HE1 A;  2EC1 A;  2COA A;  1RRP B;  3QWM A;  1DDM A;  3M1I B;  2MKR A;  2YT0 A;  4HB0 B;  1UPQ A;  2AEH A;  2N23 A;  1KZ7 A;  1FHX A;  1I7A A;  4ZRK A;  4A6K A;  4MT7 A;  4HB4 B;  1AWE A;  2I5F A;  1EVH A;  2Y7B A;  2LG1 A;  1AQC A;  2NZ8 B;  2N0Y A;  3T06 A;  2JP2 A;  2IYB A;  1GC7 A;  1U5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...