2Z59A

Complex structures of mouse rpn13 (22-130aa) and ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ADRM1
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z59A00
2KR0A 2NBVA 5IRSA 2Z4DA 2R2YA 2Z59A
chains in the Genus database with same CATH superfamily
2NBVA 1V61A 1MIZB 2COAA 2DYNA 3HK0A 5EFXA 4L6EA 1I2HA 2I1KA 5D3XA 4H8SA 2ADZA 1TXDA 2RSGA 1V5UA 1IRSA 1SHCA 2D9WA 2LYDA 3PSCA 2KUPA 3A8QA 2P0FA 3U12A 3FM8C 2Y8GA 2DKQA 4GZUA 2K2JA 2Z59A 1RJ2A 4A6FB 1UPQA 1Q67A 3TVVA 5FI0A 4YONA 3A98B 4HAVB 1UNRA 4KVGB 4CHMA 2IYBA 3X23A 5CLLB 5C79A 3AU5A 3O96A 1BWNA 2GJYA 3VOQA 3IVFA 4NY0A 1RRPB 5C6RA 1XX0A 2YS3A 4XWXA 1MAIA 1ZYIA 1WJ1A 4EKUA 2KR0A 3KRWA 3AU4A 3KRXA 1U5FA 4Y94A 2Z0QA 1J0WA 3ML4A 3D8DA 1NTYA 4HAUB 2ZKMX 2DTCA 3TFMA 3DXEA 3KY9A 4PQ0A 1ISNA 3FEHA 4F7GA 4OT1A 3GYOA 4IAPA 4HB2B 4CHJA 4DX90 3F0WA 3U7DA 2CY5A 2YT2A 1OQNA 4GMXB 1X1GA 4IFSA 2P0HA 2D11A 1M7RA 4HATB 4TYZA 1ZVRA 2K8EA 2D9XA 1X11A 2VSZA 3BJIA 4MT7A 1DYNA 4IOYX 2J0JA 2EC1A 4QJ5B 5J3YA 2Z4DA 3NWDA 4EMOA 1XR0B 4BBKA 3KZ1A 4GMVA 2CY4A 2W2XD 2D4QA 2KGXB 2Z13A 3PG7A 4HB0B 3HW2B 3MPXA 4GNKB 5D3WA 4NSWA 2YS5A 2DHJA 1GG3A 1NI2A 2D9YA 3A8PA 4DBBA 1M7EA 3QBVB 1UPRA 3FVCA 1SGHA 1XD4A 1U5DA 2R0DA 3BINA 1U5GA 2Z0PA 3N7CA 2K2UA 5DI9B 5I2SA 5LONB 2IFSA 2J59M 4Z2NA 2J0KA 2D9ZA 4GPTB 3U8ZA 3P7ZA 1W1GA 3P6AA 1TJ6A 1I7AA 2RRFA 2YS1A 4A6KA 1MK7B 3TCAA 2R09A 5KQ4A 1H4RA 4WJ7A 2JP2A 2D9VA 4WSFA 5HE1A 5KQ1A 2LG1A 2P8VA 1ZC3B 3HIEA 4TKNA 2YT1A 3T06A 1LB1A 1E5WA 3OANA 2PZ1A 4HSIA 3DXDA 5C5BA 1ZM0A 5C16A 1AWEA 2COFA 4KHOA 3WYFB 1OMWA 2DFKA 4QJ3B 1DBHA 2BCJA 2Y8FA 3PP2A 2KCJA 2YVCA 5IRSA 1P5TA 2UZSA 4KAXB 4HAYB 1WVHA 1Y19B 5M4YB 1PMSA 4F7UP 2DHIA 2MFQA 1UNPA 2L1CA 4HHVA 2LOXA 5J3TA 2D2QA 4HAWB 2DYQA 3SV1A 4HB4B 4D0NB 2AEHA 1Y5OA 2NMBA 4K2OA 2R2YA 1DROA 1WG7A 2MDXA 2DLWA 1MPHA 1U5EA 1EAZA 2M14A 3PVLA 3QIJA 1KI1B 4OSNA 3ULBA 3SO6A 4QXAB 4D6WA 1EF1A 1XODA 2MWNB 3GYPA 1H10A 2M38A 1WGUA 4KHBA 1P6SA 2RGNB 5DH9B 1FHXA 1QC6A 2EMSA 3NW8A 3ODOA 2FJLA 2K49A 5GOWB 3ODWA 5JHHA 2YF0A 5HE0A 4MK0A 3NWAA 3SNHA 1WI1A 1J19A 3CIKA 2DX1A 2L2IA 2G35A 2EJ8A 3G9WA 2I1JA 2OTXA 4HAZB 5J3QA 2HTHB 2XQNM 5D3YA 3A58A 2ROVA 1K5DB 2CRFA 1W1DA 1PFJA 4GXBA 1PLSA 2COCA 1B55A 1V88A 3MDBC 4Z2MB 5JLJB 1U27A 2LOZA 2RUKB 1KZ7A 4C0AA 5I2MA 4L1RA 1AQCA 1UNQA 2DHKA 4A5KA 4K17A 4QJ4B 4DX8A 2GUMA 4F7HA 5DHAB 1KZGA 1GC6A 4KHAA 2I5FA 2YSZA 1FOEA 1X1FA 1BAKA 1NTVA 1WJMA 2UZRA 1XCGA 1FGZA 2H7DA 2GCLA 2ZPYA 2CAYA 3ULCA 4CYEA 2P0DA 5LOPB 1N3HA 2V76A 3PEGA 1FB8A 1QQGA 2AL6A 1FHOA 4A6FA 3AJ4A 1BTNA 3ZDTA 1MKEA 4ZRJA 2W2WA 4A6HA 3DCXA 5CLQB 1NU2A 1LW3A 4GN1A 4DXAB 3TO1A 3SUZA 4EJNA 1EGXA 3UZTA 1DDWA 5DIFB 1W1HA 1XKEA 2LULA 5L81A 1X05A 5C5BB 2VRWB 3PVUA 1FHWA 4DIXA 3PVWA 3KSYA 2Z14A 2Q13A 2MKRA 3CXBB 2DKPA 1BTKA 2KIEA 2OQBA 2Y7BA 2Z0OA 2KIGA 4K81A 3RCPA 1DDVA 2RVBB 2CODA 1V89A 2RNRB 2YRYA 1K5GB 1T77A 2FJUB 1FGYA 4PNKA 3B77A 2NZ8B 4MY6A 1ZC4B 2K00A 3WA0A 1P3RA 2ROZB 1OY2A 2E2XA 1U29A 4K2PA 1ZSQA 1MIXA 1WGQA 2DN6A 2QKLA 3ZVRA 4HAXB 5LG4B 5FI1A 2HE7A 1UEFA 4HB3B 3OHMB 3D8FA 1U2BA 2GCJA 2UVMA 3DXCA 3HQCA 3ODXA 1Z87A 1GC7A 4YL8A 2LKOA 5JHGA 2N23A 2DA0A 4ZRKA 3HSAA 2QKMA 2DX5A 4P7IA 2N0YA 2W2XC 3M1IB 4CSQA 1TQZA 1EVHA 1MI1A 2RLOA 4KHBB 1MK9B 5D3VA 2D10A 3NWFA 4WVFB 1FAOA 2KUQA 2ELAA 4HDQA 5JP4A 3VIAA 2VKIA 2X18A 2ELBA 5HE3A 4B6HA 2EMTA 2GS0A 4HDOA 3PZDA 2I5CA 1V5PA 4ZRIA 3NSUA 4GOUA 1DDMA 3LJUX 3F5RA 5KCVA 2J0MA 3QWMA 5D27A 2YT0A 3FSSA 3TW1A 3D8EA 1V5MA 5DHFB 1X86A 3V5WA 5HE2A 3SYXA 2H7EA
chains in the Genus database with same CATH topology
2NBVA 2K8EA 2RRFA 4QJ4B 4GNKB 3TVVA 2KIEA 2ZKMX 4CSQA 4IOYX 4KHOA 4OSNA 5LG4B 2GUMA 2KIGA 4GOUA 4PQ0A 4QJ3B 4QJ5B 4KHBB 4QXAB 4KHAA 4D6WA 3FVCA 3OHMB 2Z4DA 3A58A 3GYOA 3NWDA 3GYPA 2GCJA 4OT1A 3NWFA 4KHBA 2FJUB 2KUQA 5IRSA 3TO1A 3FSSA 3NW8A 3TW1A 2R2YA 3HIEA 5I2SA 2K49A 4Z2NA 4Z2MB 1ZYIA 2KR0A 2Z13A 2YT2A 3NWAA 2GCLA 5I2MA 3U12A 5M4YB 4L1RA 4IFSA 4DIXA 2Z59A 4HSIA 2Z14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2NBV A;  5IRS A;  2Z4D A;  2R2Y A;  2Z59 A; 
#chains in the Genus database with same CATH topology
 2NBV A;  1V61 A;  1MIZ B;  2COA A;  2DYN A;  3HK0 A;  5EFX A;  4L6E A;  1I2H A;  2I1K A;  5D3X A;  4H8S A;  2ADZ A;  1TXD A;  2RSG A;  1V5U A;  1IRS A;  1SHC A;  2D9W A;  2LYD A;  3PSC A;  2KUP A;  3A8Q A;  2P0F A;  3U12 A;  3FM8 C;  2Y8G A;  2DKQ A;  4GZU A;  2K2J A;  2Z59 A;  1RJ2 A;  4A6F B;  1UPQ A;  1Q67 A;  3TVV A;  5FI0 A;  4YON A;  3A98 B;  4HAV B;  1UNR A;  4KVG B;  4CHM A;  2IYB A;  3X23 A;  5CLL B;  5C79 A;  3AU5 A;  3O96 A;  1BWN A;  2GJY A;  3VOQ A;  3IVF A;  4NY0 A;  1RRP B;  5C6R A;  1XX0 A;  2YS3 A;  4XWX A;  1MAI A;  1ZYI A;  1WJ1 A;  4EKU A;  2KR0 A;  3KRW A;  3AU4 A;  3KRX A;  1U5F A;  4Y94 A;  2Z0Q A;  1J0W A;  3ML4 A;  3D8D A;  1NTY A;  4HAU B;  2ZKM X;  2DTC A;  3TFM A;  3DXE A;  3KY9 A;  4PQ0 A;  1ISN A;  3FEH A;  4F7G A;  4OT1 A;  3GYO A;  4IAP A;  4HB2 B;  4CHJ A;  4DX9 0;  3F0W A;  3U7D A;  2CY5 A;  2YT2 A;  1OQN A;  4GMX B;  1X1G A;  4IFS A;  2P0H A;  2D11 A;  1M7R A;  4HAT B;  4TYZ A;  1ZVR A;  2K8E A;  2D9X A;  1X11 A;  2VSZ A;  3BJI A;  4MT7 A;  1DYN A;  4IOY X;  2J0J A;  2EC1 A;  4QJ5 B;  5J3Y A;  2Z4D A;  3NWD A;  4EMO A;  1XR0 B;  4BBK A;  3KZ1 A;  4GMV A;  2CY4 A;  2W2X D;  2D4Q A;  2KGX B;  2Z13 A;  3PG7 A;  4HB0 B;  3HW2 B;  3MPX A;  4GNK B;  5D3W A;  4NSW A;  2YS5 A;  2DHJ A;  1GG3 A;  1NI2 A;  2D9Y A;  3A8P A;  4DBB A;  1M7E A;  3QBV B;  1UPR A;  3FVC A;  1SGH A;  1XD4 A;  1U5D A;  2R0D A;  3BIN A;  1U5G A;  2Z0P A;  3N7C A;  2K2U A;  5DI9 B;  5I2S A;  5LON B;  2IFS A;  2J59 M;  4Z2N A;  2J0K A;  2D9Z A;  4GPT B;  3U8Z A;  3P7Z A;  1W1G A;  3P6A A;  1TJ6 A;  1I7A A;  2RRF A;  2YS1 A;  4A6K A;  1MK7 B;  3TCA A;  2R09 A;  5KQ4 A;  1H4R A;  4WJ7 A;  2JP2 A;  2D9V A;  4WSF A;  5HE1 A;  5KQ1 A;  2LG1 A;  2P8V A;  1ZC3 B;  3HIE A;  4TKN A;  2YT1 A;  3T06 A;  1LB1 A;  1E5W A;  3OAN A;  2PZ1 A;  4HSI A;  3DXD A;  5C5B A;  1ZM0 A;  5C16 A;  1AWE A;  2COF A;  4KHO A;  3WYF B;  1OMW A;  2DFK A;  4QJ3 B;  1DBH A;  2BCJ A;  2Y8F A;  3PP2 A;  2KCJ A;  2YVC A;  5IRS A;  1P5T A;  2UZS A;  4KAX B;  4HAY B;  1WVH A;  1Y19 B;  5M4Y B;  1PMS A;  4F7U P;  2DHI A;  2MFQ A;  1UNP A;  2L1C A;  4HHV A;  2LOX A;  5J3T A;  2D2Q A;  4HAW B;  2DYQ A;  3SV1 A;  4HB4 B;  4D0N B;  2AEH A;  1Y5O A;  2NMB A;  4K2O A;  2R2Y A;  1DRO A;  1WG7 A;  2MDX A;  2DLW A;  1MPH A;  1U5E A;  1EAZ A;  2M14 A;  3PVL A;  3QIJ A;  1KI1 B;  4OSN A;  3ULB A;  3SO6 A;  4QXA B;  4D6W A;  1EF1 A;  1XOD A;  2MWN B;  3GYP A;  1H10 A;  2M38 A;  1WGU A;  4KHB A;  1P6S A;  2RGN B;  5DH9 B;  1FHX A;  1QC6 A;  2EMS A;  3NW8 A;  3ODO A;  2FJL A;  2K49 A;  5GOW B;  3ODW A;  5JHH A;  2YF0 A;  5HE0 A;  4MK0 A;  3NWA A;  3SNH A;  1WI1 A;  1J19 A;  3CIK A;  2DX1 A;  2L2I A;  2G35 A;  2EJ8 A;  3G9W A;  2I1J A;  2OTX A;  4HAZ B;  5J3Q A;  2HTH B;  2XQN M;  5D3Y A;  3A58 A;  2ROV A;  1K5D B;  2CRF A;  1W1D A;  1PFJ A;  4GXB A;  1PLS A;  2COC A;  1B55 A;  1V88 A;  3MDB C;  4Z2M B;  5JLJ B;  1U27 A;  2LOZ A;  2RUK B;  1KZ7 A;  4C0A A;  5I2M A;  4L1R A;  1AQC A;  1UNQ A;  2DHK A;  4A5K A;  4K17 A;  4QJ4 B;  4DX8 A;  2GUM A;  4F7H A;  5DHA B;  1KZG A;  1GC6 A;  4KHA A;  2I5F A;  2YSZ A;  1FOE A;  1X1F A;  1BAK A;  1NTV A;  1WJM A;  2UZR A;  1XCG A;  1FGZ A;  2H7D A;  2GCL A;  2ZPY A;  2CAY A;  3ULC A;  4CYE A;  2P0D A;  5LOP B;  1N3H A;  2V76 A;  3PEG A;  1FB8 A;  1QQG A;  2AL6 A;  1FHO A;  4A6F A;  3AJ4 A;  1BTN A;  3ZDT A;  1MKE A;  4ZRJ A;  2W2W A;  4A6H A;  3DCX A;  5CLQ B;  1NU2 A;  1LW3 A;  4GN1 A;  4DXA B;  3TO1 A;  3SUZ A;  4EJN A;  1EGX A;  3UZT A;  1DDW A;  5DIF B;  1W1H A;  1XKE A;  2LUL A;  5L81 A;  1X05 A;  5C5B B;  2VRW B;  3PVU A;  1FHW A;  4DIX A;  3PVW A;  3KSY A;  2Z14 A;  2Q13 A;  2MKR A;  3CXB B;  2DKP A;  1BTK A;  2KIE A;  2OQB A;  2Y7B A;  2Z0O A;  2KIG A;  4K81 A;  3RCP A;  1DDV A;  2RVB B;  2COD A;  1V89 A;  2RNR B;  2YRY A;  1K5G B;  1T77 A;  2FJU B;  1FGY A;  4PNK A;  3B77 A;  2NZ8 B;  4MY6 A;  1ZC4 B;  2K00 A;  3WA0 A;  1P3R A;  2ROZ B;  1OY2 A;  2E2X A;  1U29 A;  4K2P A;  1ZSQ A;  1MIX A;  1WGQ A;  2DN6 A;  2QKL A;  3ZVR A;  4HAX B;  5LG4 B;  5FI1 A;  2HE7 A;  1UEF A;  4HB3 B;  3OHM B;  3D8F A;  1U2B A;  2GCJ A;  2UVM A;  3DXC A;  3HQC A;  3ODX A;  1Z87 A;  1GC7 A;  4YL8 A;  2LKO A;  5JHG A;  2N23 A;  2DA0 A;  4ZRK A;  3HSA A;  2QKM A;  2DX5 A;  4P7I A;  2N0Y A;  2W2X C;  3M1I B;  4CSQ A;  1TQZ A;  1EVH A;  1MI1 A;  2RLO A;  4KHB B;  1MK9 B;  5D3V A;  2D10 A;  3NWF A;  4WVF B;  1FAO A;  2KUQ A;  2ELA A;  4HDQ A;  5JP4 A;  3VIA A;  2VKI A;  2X18 A;  2ELB A;  5HE3 A;  4B6H A;  2EMT A;  2GS0 A;  4HDO A;  3PZD A;  2I5C A;  1V5P A;  4ZRI A;  3NSU A;  4GOU A;  1DDM A;  3LJU X;  3F5R A;  5KCV A;  2J0M A;  3QWM A;  5D27 A;  2YT0 A;  3FSS A;  3TW1 A;  3D8E A;  1V5M A;  5DHF B;  1X86 A;  3V5W A;  5HE2 A;  3SYX A;  2H7E A; 
#chains in the Genus database with same CATH homology
 2NBV A;  2K8E A;  2RRF A;  4QJ4 B;  4GNK B;  3TVV A;  2KIE A;  2ZKM X;  4CSQ A;  4IOY X;  4KHO A;  4OSN A;  5LG4 B;  2GUM A;  2KIG A;  4GOU A;  4PQ0 A;  4QJ3 B;  4QJ5 B;  4KHB B;  4QXA B;  4KHA A;  4D6W A;  3FVC A;  3OHM B;  2Z4D A;  3A58 A;  3GYO A;  3NWD A;  3GYP A;  2GCJ A;  4OT1 A;  3NWF A;  4KHB A;  2FJU B;  2KUQ A;  5IRS A;  3TO1 A;  3FSS A;  3NW8 A;  3TW1 A;  2R2Y A;  3HIE A;  5I2S A;  2K49 A;  4Z2N A;  4Z2M B;  1ZYI A;  2KR0 A;  2Z13 A;  2YT2 A;  3NWA A;  2GCL A;  5I2M A;  3U12 A;  5M4Y B;  4L1R A;  4IFS A;  4DIX A;  2Z59 A;  4HSI A;  2Z14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...