2Z59A

Complex structures of mouse rpn13 (22-130aa) and ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Protein ADRM1
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z59A00
2Z4DA 5IRSA 2R2YA 2NBVA 2Z59A 2KR0A
chains in the Genus database with same CATH superfamily
2FJUB 2DN6A 4NSWA 5HE3A 3KY9A 4QJ3B 2K2JA 3PEGA 5JP4A 4KAXB 2RUKB 2BCJA 2ZPYA 1Y19B 4Y94A 1MIZB 2MFQA 2E2XA 2UZSA 2COFA 3B77A 3GYOA 3TFMA 4GXBA 1V61A 5JHGA 3ODWA 2DYQA 2RGNB 5DH9B 1DDVA 1V5UA 3QWMA 3A8QA 1E5WA 5EFXA 1V89A 3F5RA 1EGXA 2D9ZA 3O96A 4L1RA 5GOWB 3SO6A 2D9XA 4C0AA 2D11A 2W2XC 3DXEA 2KIEA 2LULA 1ZVRA 2HTHB 4GNKB 1MK7B 2D9YA 1TQZA 3NW8A 2DLWA 4HB0B 1H4RA 3QBVB 5HE0A 5C79A 3M1IB 4HB4B 1KZ7A 3KRWA 4HB3B 2ZKMX 5DHFB 5I2SA 1MI1A 3PVUA 3AU4A 4A6FB 1N3HA 2W2WA 2EMSA 4CHJA 4KHBA 1M7RA 1W1HA 2Z0QA 5I2MA 1ZSQA 5KQ4A 4WVFB 4GZUA 4F7UP 1FAOA 3SNHA 3OHMB 2Z0PA 1MK9B 1ZYIA 2N0YA 4NY0A 1Q67A 2KGXB 2VKIA 3D8EA 2VSZA 2MDXA 5L81A 1K5GB 1V5MA 2D2QA 4HDOA 2LG1A 5FI0A 1U5FA 2D4QA 2I1JA 2GCJA 3TW1A 2IFSA 3F0WA 1GC6A 2UVMA 2DHIA 2R2YA 5D3XA 2MWNB 5FI1A 3CIKA 4HATB 4HAUB 4GMVA 2RNRB 2NBVA 1XODA 3HSAA 3ULBA 2GCLA 2R0DA 3BJIA 1GG3A 2W2XD 5CLLB 3HK0A 3P6AA 4Z2MB 5KQ1A 2LOXA 3DXCA 1FOEA 2VRWB 1ZC3B 1FGZA 2DKQA 2L1CA 4EJNA 4MK0A 2Z13A 3BINA 2FJLA 4A6FA 1DROA 2ELBA 3NWDA 2P0FA 1EAZA 3TCAA 2Y7BA 5DIFB 4CSQA 2K2UA 2UZRA 2Y8FA 1U27A 2M14A 2CY4A 4QJ5B 4OT1A 2YRYA 3NSUA 4L6EA 2H7DA 5J3TA 1LW3A 4GOUA 4ZRKA 2LKOA 1FB8A 2YVCA 1I2HA 3T06A 2K00A 1X1GA 1X05A 2Q13A 1PFJA 3ZDTA 1FGYA 4HAVB 1V88A 3SV1A 1UNRA 3U7DA 2YT2A 2I5CA 5DI9B 4B6HA 2D9WA 1MIXA 4ZRIA 1NU2A 1NTYA 2YT1A 3NWAA 5D3YA 2YS1A 3UZTA 1Y5OA 2XQNM 1RJ2A 2AL6A 2EMTA 1W1GA 3MDBC 3PSCA 1TXDA 2IYBA 3U12A 1PMSA 2CRFA 4HSIA 4HHVA 1M7EA 5LOPB 2GS0A 2COCA 1XKEA 5M4YB 4EKUA 3PG7A 1BTKA 2Y8GA 1U5GA 2LYDA 1SHCA 5IRSA 2D9VA 4A6KA 1V5PA 2V76A 1DDMA 4IFSA 2K8EA 3DXDA 5D3VA 2CODA 2I1KA 2OQBA 4HAYB 1J19A 2J59M 3A98B 5DHAB 1WJ1A 1XX0A 4DX8A 2EC1A 1IRSA 2YS3A 3PP2A 2YS5A 3KSYA 3TO1A 2CY5A 3ULCA 3WA0A 1UEFA 5D27A 3V5WA 3X23A 2N23A 3N7CA 4D0NB 5JLJB 4A5KA 2KIGA 1UNQA 1MPHA 3WYFB 4KHBB 3U8ZA 4BBKA 1AQCA 3OANA 1NTVA 5KCVA 3MPXA 5LG4B 4TYZA 2DHKA 3FM8C 3VIAA 4CHMA 1ZC4B 2ADZA 1B55A 4QJ4B 1DDWA 4OSNA 1ZM0A 3SYXA 4D6WA 5J3QA 2LOZA 2RLOA 5J3YA 2J0MA 2KCJA 2COAA 2KR0A 2JP2A 2NZ8B 3SUZA 3IVFA 1EF1A 1W1DA 4TKNA 4KHAA 4P7IA 4PNKA 3QIJA 1Z87A 2Z0OA 3HQCA 1T77A 4GPTB 1DYNA 3RCPA 4HAWB 3D8DA 1U5EA 1UNPA 4WSFA 1PLSA 4K81A 4YONA 2YT0A 1NI2A 2KUPA 2RVBB 1WI1A 3A58A 2EJ8A 1P6SA 2DKPA 4HB2B 4KVGB 4IOYX 2KUQA 2J0KA 5C16A 1UPRA 3HW2B 2L2IA 2HE7A 3ML4A 3KZ1A 4MY6A 4GN1A 4A6HA 1I7AA 3PVWA 1P5TA 1SGHA 4PQ0A 1WJMA 3D8FA 3A8PA 2P0DA 2GUMA 3CXBB 4F7GA 3FSSA 3LJUX 1U29A 2YSZA 1U5DA 2NMBA 2AEHA 2PZ1A 4ZRJA 1EVHA 1U2BA 2D10A 2RRFA 1WGQA 3PVLA 1FHWA 3DCXA 2RSGA 1XCGA 4DBBA 3NWFA 1FHXA 3TVVA 5LONB 2G35A 1P3RA 4QXAB 2QKLA 3FEHA 5C5BB 1J0WA 5C6RA 5JHHA 3G9WA 3AU5A 4WJ7A 3VOQA 4H8SA 2CAYA 2R09A 2M38A 2DA0A 3P7ZA 2Z4DA 2ROVA 1QQGA 2Z59A 2X18A 4DXAB 1GC7A 1KI1B 3GYPA 4HDQA 1XR0B 2Z14A 4DIXA 2GJYA 1XD4A 2P0HA 1KZGA 2DYNA 2I5FA 2DX1A 1UPQA 1OMWA 1WGUA 2QKMA 1FHOA 4KHOA 2DX5A 1LB1A 4YL8A 1AWEA 4HAXB 1WVHA 1WG7A 1BTNA 2DHJA 5D3WA 4EMOA 2DTCA 3ODOA 5C5BA 1QC6A 3AJ4A 1TJ6A 1DBHA 4Z2NA 1X11A 5HE2A 2K49A 1ISNA 2P8VA 1BAKA 2OTXA 2J0JA 1RRPB 1X86A 3ODXA 4K17A 4XWXA 5HE1A 2ELAA 4MT7A 4DX90 4HAZB 1OQNA 5CLQB 1OY2A 4F7HA 1MAIA 3PZDA 2YF0A 4IAPA 4K2PA 4GMXB 1BWNA 1H10A 4CYEA 1MKEA 2ROZB 3ZVRA 3HIEA 1X1FA 3KRXA 1K5DB 2H7EA 4K2OA 2MKRA 3FVCA 2DFKA
chains in the Genus database with same CATH topology
3OHMB 4KHOA 4CSQA 2FJUB 5LG4B 1ZYIA 2Z4DA 4HSIA 4PQ0A 2NBVA 2Z59A 2YT2A 3NWFA 4QJ3B 2GUMA 2GCLA 3GYPA 4QJ4B 4OSNA 4QJ5B 4OT1A 5M4YB 2Z14A 2ZKMX 4L1RA 3TVVA 4D6WA 3FSSA 4DIXA 5I2SA 4QXAB 3NWAA 3A58A 4Z2MB 3TO1A 4GOUA 5IRSA 3GYOA 4KHBA 4IOYX 2GCJA 3TW1A 4Z2NA 2KUQA 2KIEA 2KR0A 2Z13A 2KIGA 3HIEA 2K49A 4GNKB 5I2MA 3NWDA 2R2YA 2RRFA 4KHAA 4IFSA 3U12A 2K8EA 3FVCA 4KHBB 3NW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4D A;  5IRS A;  2R2Y A;  2NBV A;  2Z59 A;  2KR0 A; 
#chains in the Genus database with same CATH topology
 2FJU B;  2DN6 A;  4NSW A;  5HE3 A;  3KY9 A;  4QJ3 B;  2K2J A;  3PEG A;  5JP4 A;  4KAX B;  2RUK B;  2BCJ A;  2ZPY A;  1Y19 B;  4Y94 A;  1MIZ B;  2MFQ A;  2E2X A;  2UZS A;  2COF A;  3B77 A;  3GYO A;  3TFM A;  4GXB A;  1V61 A;  5JHG A;  3ODW A;  2DYQ A;  2RGN B;  5DH9 B;  1DDV A;  1V5U A;  3QWM A;  3A8Q A;  1E5W A;  5EFX A;  1V89 A;  3F5R A;  1EGX A;  2D9Z A;  3O96 A;  4L1R A;  5GOW B;  3SO6 A;  2D9X A;  4C0A A;  2D11 A;  2W2X C;  3DXE A;  2KIE A;  2LUL A;  1ZVR A;  2HTH B;  4GNK B;  1MK7 B;  2D9Y A;  1TQZ A;  3NW8 A;  2DLW A;  4HB0 B;  1H4R A;  3QBV B;  5HE0 A;  5C79 A;  3M1I B;  4HB4 B;  1KZ7 A;  3KRW A;  4HB3 B;  2ZKM X;  5DHF B;  5I2S A;  1MI1 A;  3PVU A;  3AU4 A;  4A6F B;  1N3H A;  2W2W A;  2EMS A;  4CHJ A;  4KHB A;  1M7R A;  1W1H A;  2Z0Q A;  5I2M A;  1ZSQ A;  5KQ4 A;  4WVF B;  4GZU A;  4F7U P;  1FAO A;  3SNH A;  3OHM B;  2Z0P A;  1MK9 B;  1ZYI A;  2N0Y A;  4NY0 A;  1Q67 A;  2KGX B;  2VKI A;  3D8E A;  2VSZ A;  2MDX A;  5L81 A;  1K5G B;  1V5M A;  2D2Q A;  4HDO A;  2LG1 A;  5FI0 A;  1U5F A;  2D4Q A;  2I1J A;  2GCJ A;  3TW1 A;  2IFS A;  3F0W A;  1GC6 A;  2UVM A;  2DHI A;  2R2Y A;  5D3X A;  2MWN B;  5FI1 A;  3CIK A;  4HAT B;  4HAU B;  4GMV A;  2RNR B;  2NBV A;  1XOD A;  3HSA A;  3ULB A;  2GCL A;  2R0D A;  3BJI A;  1GG3 A;  2W2X D;  5CLL B;  3HK0 A;  3P6A A;  4Z2M B;  5KQ1 A;  2LOX A;  3DXC A;  1FOE A;  2VRW B;  1ZC3 B;  1FGZ A;  2DKQ A;  2L1C A;  4EJN A;  4MK0 A;  2Z13 A;  3BIN A;  2FJL A;  4A6F A;  1DRO A;  2ELB A;  3NWD A;  2P0F A;  1EAZ A;  3TCA A;  2Y7B A;  5DIF B;  4CSQ A;  2K2U A;  2UZR A;  2Y8F A;  1U27 A;  2M14 A;  2CY4 A;  4QJ5 B;  4OT1 A;  2YRY A;  3NSU A;  4L6E A;  2H7D A;  5J3T A;  1LW3 A;  4GOU A;  4ZRK A;  2LKO A;  1FB8 A;  2YVC A;  1I2H A;  3T06 A;  2K00 A;  1X1G A;  1X05 A;  2Q13 A;  1PFJ A;  3ZDT A;  1FGY A;  4HAV B;  1V88 A;  3SV1 A;  1UNR A;  3U7D A;  2YT2 A;  2I5C A;  5DI9 B;  4B6H A;  2D9W A;  1MIX A;  4ZRI A;  1NU2 A;  1NTY A;  2YT1 A;  3NWA A;  5D3Y A;  2YS1 A;  3UZT A;  1Y5O A;  2XQN M;  1RJ2 A;  2AL6 A;  2EMT A;  1W1G A;  3MDB C;  3PSC A;  1TXD A;  2IYB A;  3U12 A;  1PMS A;  2CRF A;  4HSI A;  4HHV A;  1M7E A;  5LOP B;  2GS0 A;  2COC A;  1XKE A;  5M4Y B;  4EKU A;  3PG7 A;  1BTK A;  2Y8G A;  1U5G A;  2LYD A;  1SHC A;  5IRS A;  2D9V A;  4A6K A;  1V5P A;  2V76 A;  1DDM A;  4IFS A;  2K8E A;  3DXD A;  5D3V A;  2COD A;  2I1K A;  2OQB A;  4HAY B;  1J19 A;  2J59 M;  3A98 B;  5DHA B;  1WJ1 A;  1XX0 A;  4DX8 A;  2EC1 A;  1IRS A;  2YS3 A;  3PP2 A;  2YS5 A;  3KSY A;  3TO1 A;  2CY5 A;  3ULC A;  3WA0 A;  1UEF A;  5D27 A;  3V5W A;  3X23 A;  2N23 A;  3N7C A;  4D0N B;  5JLJ B;  4A5K A;  2KIG A;  1UNQ A;  1MPH A;  3WYF B;  4KHB B;  3U8Z A;  4BBK A;  1AQC A;  3OAN A;  1NTV A;  5KCV A;  3MPX A;  5LG4 B;  4TYZ A;  2DHK A;  3FM8 C;  3VIA A;  4CHM A;  1ZC4 B;  2ADZ A;  1B55 A;  4QJ4 B;  1DDW A;  4OSN A;  1ZM0 A;  3SYX A;  4D6W A;  5J3Q A;  2LOZ A;  2RLO A;  5J3Y A;  2J0M A;  2KCJ A;  2COA A;  2KR0 A;  2JP2 A;  2NZ8 B;  3SUZ A;  3IVF A;  1EF1 A;  1W1D A;  4TKN A;  4KHA A;  4P7I A;  4PNK A;  3QIJ A;  1Z87 A;  2Z0O A;  3HQC A;  1T77 A;  4GPT B;  1DYN A;  3RCP A;  4HAW B;  3D8D A;  1U5E A;  1UNP A;  4WSF A;  1PLS A;  4K81 A;  4YON A;  2YT0 A;  1NI2 A;  2KUP A;  2RVB B;  1WI1 A;  3A58 A;  2EJ8 A;  1P6S A;  2DKP A;  4HB2 B;  4KVG B;  4IOY X;  2KUQ A;  2J0K A;  5C16 A;  1UPR A;  3HW2 B;  2L2I A;  2HE7 A;  3ML4 A;  3KZ1 A;  4MY6 A;  4GN1 A;  4A6H A;  1I7A A;  3PVW A;  1P5T A;  1SGH A;  4PQ0 A;  1WJM A;  3D8F A;  3A8P A;  2P0D A;  2GUM A;  3CXB B;  4F7G A;  3FSS A;  3LJU X;  1U29 A;  2YSZ A;  1U5D A;  2NMB A;  2AEH A;  2PZ1 A;  4ZRJ A;  1EVH A;  1U2B A;  2D10 A;  2RRF A;  1WGQ A;  3PVL A;  1FHW A;  3DCX A;  2RSG A;  1XCG A;  4DBB A;  3NWF A;  1FHX A;  3TVV A;  5LON B;  2G35 A;  1P3R A;  4QXA B;  2QKL A;  3FEH A;  5C5B B;  1J0W A;  5C6R A;  5JHH A;  3G9W A;  3AU5 A;  4WJ7 A;  3VOQ A;  4H8S A;  2CAY A;  2R09 A;  2M38 A;  2DA0 A;  3P7Z A;  2Z4D A;  2ROV A;  1QQG A;  2Z59 A;  2X18 A;  4DXA B;  1GC7 A;  1KI1 B;  3GYP A;  4HDQ A;  1XR0 B;  2Z14 A;  4DIX A;  2GJY A;  1XD4 A;  2P0H A;  1KZG A;  2DYN A;  2I5F A;  2DX1 A;  1UPQ A;  1OMW A;  1WGU A;  2QKM A;  1FHO A;  4KHO A;  2DX5 A;  1LB1 A;  4YL8 A;  1AWE A;  4HAX B;  1WVH A;  1WG7 A;  1BTN A;  2DHJ A;  5D3W A;  4EMO A;  2DTC A;  3ODO A;  5C5B A;  1QC6 A;  3AJ4 A;  1TJ6 A;  1DBH A;  4Z2N A;  1X11 A;  5HE2 A;  2K49 A;  1ISN A;  2P8V A;  1BAK A;  2OTX A;  2J0J A;  1RRP B;  1X86 A;  3ODX A;  4K17 A;  4XWX A;  5HE1 A;  2ELA A;  4MT7 A;  4DX9 0;  4HAZ B;  1OQN A;  5CLQ B;  1OY2 A;  4F7H A;  1MAI A;  3PZD A;  2YF0 A;  4IAP A;  4K2P A;  4GMX B;  1BWN A;  1H10 A;  4CYE A;  1MKE A;  2ROZ B;  3ZVR A;  3HIE A;  1X1F A;  3KRX A;  1K5D B;  2H7E A;  4K2O A;  2MKR A;  3FVC A;  2DFK A; 
#chains in the Genus database with same CATH homology
 3OHM B;  4KHO A;  4CSQ A;  2FJU B;  5LG4 B;  1ZYI A;  2Z4D A;  4HSI A;  4PQ0 A;  2NBV A;  2Z59 A;  2YT2 A;  3NWF A;  4QJ3 B;  2GUM A;  2GCL A;  3GYP A;  4QJ4 B;  4OSN A;  4QJ5 B;  4OT1 A;  5M4Y B;  2Z14 A;  2ZKM X;  4L1R A;  3TVV A;  4D6W A;  3FSS A;  4DIX A;  5I2S A;  4QXA B;  3NWA A;  3A58 A;  4Z2M B;  3TO1 A;  4GOU A;  5IRS A;  3GYO A;  4KHB A;  4IOY X;  2GCJ A;  3TW1 A;  4Z2N A;  2KUQ A;  2KIE A;  2KR0 A;  2Z13 A;  2KIG A;  3HIE A;  2K49 A;  4GNK B;  5I2M A;  3NWD A;  2R2Y A;  2RRF A;  4KHA A;  4IFS A;  3U12 A;  2K8E A;  3FVC A;  4KHB B;  3NW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...