2Z59A

Complex structures of mouse rpn13 (22-130aa) and ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ADRM1
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z59A00
2Z59A 2R2YA 2Z4DA 2NBVA 5IRSA 2KR0A
chains in the Genus database with same CATH superfamily
2KUQA 4HDQA 2CAYA 3RCPA 1EAZA 1TJ6A 2DHJA 2COAA 1N3HA 4HB3B 1V5UA 2ELBA 2RUKB 2Z0QA 2P0HA 4HAYB 1Z87A 3PVLA 3TFMA 1NI2A 2H7DA 3CXBB 2PZ1A 1H10A 2D10A 1NU2A 4F7GA 2KGXB 1P6SA 4QJ5B 3ULBA 3D8FA 1Y19B 1U5GA 2KUPA 1U5DA 1UNPA 1WJMA 2L2IA 1DBHA 3KSYA 4MY6A 1MIZB 3HQCA 2DA0A 3A58A 3D8DA 2IFSA 1IRSA 1XCGA 3A8PA 3HIEA 4IFSA 2YT0A 1MK9B 1U2BA 1WG7A 1MIXA 1DDVA 2AL6A 4HB0B 3KRWA 2YRYA 2J0KA 1ZC4B 3DXDA 1LB1A 2BCJA 5EFXA 2YF0A 2GUMA 3OHMB 3PEGA 5M4YB 1I2HA 4GMXB 2EJ8A 1WI1A 1MKEA 4ZRKA 1U5EA 1BWNA 4DXAB 2RLOA 3DXEA 1OMWA 2UVMA 3SV1A 3KRXA 1BTNA 4EKUA 1OY2A 3ODXA 2CODA 1U5FA 3FSSA 3GYOA 1U27A 3UZTA 4DX8A 4Y94A 4NY0A 5D3XA 2Z14A 5LG4B 1FAOA 2Z4DA 5I2MA 2ADZA 2R0DA 2Z0PA 1Y5OA 3LJUX 2VRWB 1AQCA 2DLWA 4F7HA 4A6FB 2RGNB 1LW3A 1I7AA 1PMSA 4A5KA 1J0WA 3WA0A 2GJYA 3VIAA 2CY4A 2Q13A 5C79A 1NTYA 5C5BB 1V89A 2KR0A 2Y7BA 2LOXA 4HB2B 5D3WA 1P5TA 2CY5A 2RSGA 3FEHA 5DHFB 2CRFA 2YS3A 5HE1A 3X23A 1UPQA 5HE3A 1EVHA 3MPXA 5DIFB 3MDBC 1QQGA 2Z59A 1DROA 3P7ZA 3HK0A 4CHJA 2K8EA 4PQ0A 3PZDA 4DBBA 4GNKB 1DYNA 2FJLA 5DHAB 2LKOA 5JHHA 4TKNA 2I1JA 3NW8A 3ZVRA 2G35A 4GPTB 2KCJA 3PVWA 4GOUA 1EF1A 1FOEA 2M14A 4D0NB 5CLQB 2NBVA 3KY9A 1X11A 5FI1A 1MAIA 4P7IA 1T77A 5I2SA 1BTKA 5D3VA 5KQ4A 2RVBB 1MK7B 3NWFA 4GN1A 1ZC3B 2D4QA 3AU4A 2MDXA 3WYFB 4A6FA 3PG7A 4HAUB 3HSAA 5IRSA 2M38A 1TQZA 4HAWB 4OSNA 1ZSQA 2DKPA 2W2XD 2JP2A 1BAKA 2YS1A 1UNQA 3IVFA 2KIEA 5C5BA 1KZ7A 1XD4A 4WJ7A 3PP2A 3SNHA 2L1CA 1X1FA 1ZM0A 2XQNM 3PVUA 3QBVB 5JHGA 3D8EA 2MKRA 2D11A 4KHBB 4XWXA 3TO1A 4DX90 2MFQA 2HE7A 5D27A 4CSQA 2UZSA 4EJNA 1OQNA 4ZRIA 2R2YA 2KIGA 2COFA 3A98B 1GC7A 2QKMA 2NZ8B 4K81A 4NSWA 4K2OA 4EMOA 2Z0OA 1WGQA 4A6KA 1X86A 4L6EA 5JLJB 2D2QA 3ZDTA 3F5RA 4B6HA 2ROZB 1UPRA 5KQ1A 2I1KA 1UEFA 5DH9B 2NMBA 4ZRJA 4Z2MB 5J3YA 2LG1A 1GC6A 1X1GA 2P0FA 3QIJA 3U7DA 1X05A 2H7EA 1U29A 2E2XA 2FJUB 3KZ1A 1KI1B 1V88A 4QJ3B 1WJ1A 4IAPA 4CHMA 2ZKMX 1V5MA 4HDOA 5C16A 1ISNA 5LONB 5L81A 1AWEA 2DHIA 2N23A 1MPHA 2K2JA 2J59M 3V5WA 1K5GB 2I5CA 4KHBA 2UZRA 1WGUA 5KCVA 2RNRB 1EGXA 1J19A 2GCJA 1DDWA 2VSZA 1NTVA 1WVHA 2D9WA 4WVFB 2GS0A 2YSZA 4WSFA 2W2XC 4HAXB 4PNKA 2YT1A 1PLSA 4KVGB 5HE2A 3BJIA 2OTXA 1XX0A 4CYEA 1GG3A 5D3YA 4D6WA 2K00A 4HB4B 3DXCA 1W1GA 1DDMA 2ROVA 4HATB 1ZYIA 1M7EA 3U12A 4QJ4B 3PSCA 2DYNA 2I5FA 3ULCA 3GYPA 4HAVB 1RRPB 3AU5A 4MT7A 3B77A 1Q67A 1RJ2A 1QC6A 3ML4A 3VOQA 3CIKA 1UNRA 3T06A 2DX1A 2MWNB 1H4RA 2J0JA 5FI0A 1W1HA 4QXAB 1W1DA 1FGZA 2YS5A 5CLLB 3HW2B 2ELAA 2VKIA 1FHOA 2QKLA 2Y8GA 4KHOA 2YVCA 4C0AA 2D9YA 4K2PA 4Z2NA 2D9ZA 3A8QA 5HE0A 5JP4A 2LOZA 4F7UP 2HTHB 4HSIA 4IOYX 4TYZA 1MI1A 2DFKA 4KHAA 3ODOA 4YONA 3DCXA 2EC1A 5LOPB 3TVVA 4A6HA 2DTCA 2DYQA 3ODWA 5DI9B 3M1IB 2DX5A 3N7CA 2EMTA 4DIXA 2D9XA 2ZPYA 4GXBA 1V5PA 2GCLA 3SUZA 1XODA 1M7RA 2DKQA 2IYBA 1FHWA 1TXDA 4H8SA 5J3QA 4YL8A 4L1RA 1K5DB 2R09A 1KZGA 2DN6A 4KAXB 1B55A 2D9VA 2K2UA 2OQBA 4OT1A 1ZVRA 2AEHA 2X18A 1PFJA 1XR0B 2J0MA 3U8ZA 3SYXA 3AJ4A 2V76A 3BINA 3O96A 3SO6A 5J3TA 3NWDA 1FB8A 4GMVA 1XKEA 1SHCA 2DHKA 2Y8FA 2Z13A 3QWMA 3TW1A 4BBKA 1SGHA 5GOWB 1P3RA 4HHVA 1FHXA 5C6RA 3OANA 2N0YA 2COCA 2EMSA 2YT2A 3TCAA 2LULA 3F0WA 3FVCA 2P0DA 2RRFA 4K17A 2LYDA 2W2WA 1V61A 3G9WA 4GZUA 3NSUA 3NWAA 2P8VA 3P6AA 4HAZB 1E5WA 2K49A 3FM8C 4MK0A 1FGYA
chains in the Genus database with same CATH topology
3NWFA 2KUQA 4HSIA 4IOYX 3FSSA 4KHAA 3GYOA 2R2YA 2KIGA 3NW8A 4QXAB 2FJUB 4L1RA 4KHBA 4D6WA 2KR0A 4QJ3B 3TVVA 2GUMA 2YT2A 2Z14A 3OHMB 5LG4B 5M4YB 2ZKMX 2Z4DA 4KHOA 4OT1A 5IRSA 4GOUA 2GCJA 3FVCA 2RRFA 4OSNA 5I2MA 1ZYIA 3A58A 4DIXA 2Z59A 3U12A 4QJ4B 4KHBB 3TO1A 2NBVA 3HIEA 2K8EA 3GYPA 4IFSA 2GCLA 2KIEA 4PQ0A 4Z2NA 5I2SA 4GNKB 3NWAA 4QJ5B 3NWDA 4Z2MB 4CSQA 2K49A 3TW1A 2Z13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 A;  2R2Y A;  2Z4D A;  2NBV A;  5IRS A;  2KR0 A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  4HDQ A;  2CAY A;  3RCP A;  1EAZ A;  1TJ6 A;  2DHJ A;  2COA A;  1N3H A;  4HB3 B;  1V5U A;  2ELB A;  2RUK B;  2Z0Q A;  2P0H A;  4HAY B;  1Z87 A;  3PVL A;  3TFM A;  1NI2 A;  2H7D A;  3CXB B;  2PZ1 A;  1H10 A;  2D10 A;  1NU2 A;  4F7G A;  2KGX B;  1P6S A;  4QJ5 B;  3ULB A;  3D8F A;  1Y19 B;  1U5G A;  2KUP A;  1U5D A;  1UNP A;  1WJM A;  2L2I A;  1DBH A;  3KSY A;  4MY6 A;  1MIZ B;  3HQC A;  2DA0 A;  3A58 A;  3D8D A;  2IFS A;  1IRS A;  1XCG A;  3A8P A;  3HIE A;  4IFS A;  2YT0 A;  1MK9 B;  1U2B A;  1WG7 A;  1MIX A;  1DDV A;  2AL6 A;  4HB0 B;  3KRW A;  2YRY A;  2J0K A;  1ZC4 B;  3DXD A;  1LB1 A;  2BCJ A;  5EFX A;  2YF0 A;  2GUM A;  3OHM B;  3PEG A;  5M4Y B;  1I2H A;  4GMX B;  2EJ8 A;  1WI1 A;  1MKE A;  4ZRK A;  1U5E A;  1BWN A;  4DXA B;  2RLO A;  3DXE A;  1OMW A;  2UVM A;  3SV1 A;  3KRX A;  1BTN A;  4EKU A;  1OY2 A;  3ODX A;  2COD A;  1U5F A;  3FSS A;  3GYO A;  1U27 A;  3UZT A;  4DX8 A;  4Y94 A;  4NY0 A;  5D3X A;  2Z14 A;  5LG4 B;  1FAO A;  2Z4D A;  5I2M A;  2ADZ A;  2R0D A;  2Z0P A;  1Y5O A;  3LJU X;  2VRW B;  1AQC A;  2DLW A;  4F7H A;  4A6F B;  2RGN B;  1LW3 A;  1I7A A;  1PMS A;  4A5K A;  1J0W A;  3WA0 A;  2GJY A;  3VIA A;  2CY4 A;  2Q13 A;  5C79 A;  1NTY A;  5C5B B;  1V89 A;  2KR0 A;  2Y7B A;  2LOX A;  4HB2 B;  5D3W A;  1P5T A;  2CY5 A;  2RSG A;  3FEH A;  5DHF B;  2CRF A;  2YS3 A;  5HE1 A;  3X23 A;  1UPQ A;  5HE3 A;  1EVH A;  3MPX A;  5DIF B;  3MDB C;  1QQG A;  2Z59 A;  1DRO A;  3P7Z A;  3HK0 A;  4CHJ A;  2K8E A;  4PQ0 A;  3PZD A;  4DBB A;  4GNK B;  1DYN A;  2FJL A;  5DHA B;  2LKO A;  5JHH A;  4TKN A;  2I1J A;  3NW8 A;  3ZVR A;  2G35 A;  4GPT B;  2KCJ A;  3PVW A;  4GOU A;  1EF1 A;  1FOE A;  2M14 A;  4D0N B;  5CLQ B;  2NBV A;  3KY9 A;  1X11 A;  5FI1 A;  1MAI A;  4P7I A;  1T77 A;  5I2S A;  1BTK A;  5D3V A;  5KQ4 A;  2RVB B;  1MK7 B;  3NWF A;  4GN1 A;  1ZC3 B;  2D4Q A;  3AU4 A;  2MDX A;  3WYF B;  4A6F A;  3PG7 A;  4HAU B;  3HSA A;  5IRS A;  2M38 A;  1TQZ A;  4HAW B;  4OSN A;  1ZSQ A;  2DKP A;  2W2X D;  2JP2 A;  1BAK A;  2YS1 A;  1UNQ A;  3IVF A;  2KIE A;  5C5B A;  1KZ7 A;  1XD4 A;  4WJ7 A;  3PP2 A;  3SNH A;  2L1C A;  1X1F A;  1ZM0 A;  2XQN M;  3PVU A;  3QBV B;  5JHG A;  3D8E A;  2MKR A;  2D11 A;  4KHB B;  4XWX A;  3TO1 A;  4DX9 0;  2MFQ A;  2HE7 A;  5D27 A;  4CSQ A;  2UZS A;  4EJN A;  1OQN A;  4ZRI A;  2R2Y A;  2KIG A;  2COF A;  3A98 B;  1GC7 A;  2QKM A;  2NZ8 B;  4K81 A;  4NSW A;  4K2O A;  4EMO A;  2Z0O A;  1WGQ A;  4A6K A;  1X86 A;  4L6E A;  5JLJ B;  2D2Q A;  3ZDT A;  3F5R A;  4B6H A;  2ROZ B;  1UPR A;  5KQ1 A;  2I1K A;  1UEF A;  5DH9 B;  2NMB A;  4ZRJ A;  4Z2M B;  5J3Y A;  2LG1 A;  1GC6 A;  1X1G A;  2P0F A;  3QIJ A;  3U7D A;  1X05 A;  2H7E A;  1U29 A;  2E2X A;  2FJU B;  3KZ1 A;  1KI1 B;  1V88 A;  4QJ3 B;  1WJ1 A;  4IAP A;  4CHM A;  2ZKM X;  1V5M A;  4HDO A;  5C16 A;  1ISN A;  5LON B;  5L81 A;  1AWE A;  2DHI A;  2N23 A;  1MPH A;  2K2J A;  2J59 M;  3V5W A;  1K5G B;  2I5C A;  4KHB A;  2UZR A;  1WGU A;  5KCV A;  2RNR B;  1EGX A;  1J19 A;  2GCJ A;  1DDW A;  2VSZ A;  1NTV A;  1WVH A;  2D9W A;  4WVF B;  2GS0 A;  2YSZ A;  4WSF A;  2W2X C;  4HAX B;  4PNK A;  2YT1 A;  1PLS A;  4KVG B;  5HE2 A;  3BJI A;  2OTX A;  1XX0 A;  4CYE A;  1GG3 A;  5D3Y A;  4D6W A;  2K00 A;  4HB4 B;  3DXC A;  1W1G A;  1DDM A;  2ROV A;  4HAT B;  1ZYI A;  1M7E A;  3U12 A;  4QJ4 B;  3PSC A;  2DYN A;  2I5F A;  3ULC A;  3GYP A;  4HAV B;  1RRP B;  3AU5 A;  4MT7 A;  3B77 A;  1Q67 A;  1RJ2 A;  1QC6 A;  3ML4 A;  3VOQ A;  3CIK A;  1UNR A;  3T06 A;  2DX1 A;  2MWN B;  1H4R A;  2J0J A;  5FI0 A;  1W1H A;  4QXA B;  1W1D A;  1FGZ A;  2YS5 A;  5CLL B;  3HW2 B;  2ELA A;  2VKI A;  1FHO A;  2QKL A;  2Y8G A;  4KHO A;  2YVC A;  4C0A A;  2D9Y A;  4K2P A;  4Z2N A;  2D9Z A;  3A8Q A;  5HE0 A;  5JP4 A;  2LOZ A;  4F7U P;  2HTH B;  4HSI A;  4IOY X;  4TYZ A;  1MI1 A;  2DFK A;  4KHA A;  3ODO A;  4YON A;  3DCX A;  2EC1 A;  5LOP B;  3TVV A;  4A6H A;  2DTC A;  2DYQ A;  3ODW A;  5DI9 B;  3M1I B;  2DX5 A;  3N7C A;  2EMT A;  4DIX A;  2D9X A;  2ZPY A;  4GXB A;  1V5P A;  2GCL A;  3SUZ A;  1XOD A;  1M7R A;  2DKQ A;  2IYB A;  1FHW A;  1TXD A;  4H8S A;  5J3Q A;  4YL8 A;  4L1R A;  1K5D B;  2R09 A;  1KZG A;  2DN6 A;  4KAX B;  1B55 A;  2D9V A;  2K2U A;  2OQB A;  4OT1 A;  1ZVR A;  2AEH A;  2X18 A;  1PFJ A;  1XR0 B;  2J0M A;  3U8Z A;  3SYX A;  3AJ4 A;  2V76 A;  3BIN A;  3O96 A;  3SO6 A;  5J3T A;  3NWD A;  1FB8 A;  4GMV A;  1XKE A;  1SHC A;  2DHK A;  2Y8F A;  2Z13 A;  3QWM A;  3TW1 A;  4BBK A;  1SGH A;  5GOW B;  1P3R A;  4HHV A;  1FHX A;  5C6R A;  3OAN A;  2N0Y A;  2COC A;  2EMS A;  2YT2 A;  3TCA A;  2LUL A;  3F0W A;  3FVC A;  2P0D A;  2RRF A;  4K17 A;  2LYD A;  2W2W A;  1V61 A;  3G9W A;  4GZU A;  3NSU A;  3NWA A;  2P8V A;  3P6A A;  4HAZ B;  1E5W A;  2K49 A;  3FM8 C;  4MK0 A;  1FGY A; 
#chains in the Genus database with same CATH homology
 3NWF A;  2KUQ A;  4HSI A;  4IOY X;  3FSS A;  4KHA A;  3GYO A;  2R2Y A;  2KIG A;  3NW8 A;  4QXA B;  2FJU B;  4L1R A;  4KHB A;  4D6W A;  2KR0 A;  4QJ3 B;  3TVV A;  2GUM A;  2YT2 A;  2Z14 A;  3OHM B;  5LG4 B;  5M4Y B;  2ZKM X;  2Z4D A;  4KHO A;  4OT1 A;  5IRS A;  4GOU A;  2GCJ A;  3FVC A;  2RRF A;  4OSN A;  5I2M A;  1ZYI A;  3A58 A;  4DIX A;  2Z59 A;  3U12 A;  4QJ4 B;  4KHB B;  3TO1 A;  2NBV A;  3HIE A;  2K8E A;  3GYP A;  4IFS A;  2GCL A;  2KIE A;  4PQ0 A;  4Z2N A;  5I2S A;  4GNK B;  3NWA A;  4QJ5 B;  3NWD A;  4Z2M B;  4CSQ A;  2K49 A;  3TW1 A;  2Z13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...