2Z59A

Complex structures of mouse rpn13 (22-130aa) and ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ADRM1
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z59A00
2KR0A 2R2YA 2Z4DA 5IRSA 2Z59A 2NBVA
chains in the Genus database with same CATH superfamily
1FHXA 1U2BA 2HE7A 1EAZA 1ISNA 2GJYA 2D9VA 1M7EA 4HB2B 2X18A 4KAXB 3X23A 1V5MA 2K8EA 3T06A 4NSWA 4MK0A 2YSZA 4YONA 3AJ4A 2LYDA 1Y19B 1X11A 2CY5A 1AQCA 3FM8C 4HDQA 2DHKA 4QXAB 3M1IB 3SNHA 2RGNB 3TVVA 4A6FA 4A6KA 3ODOA 4MY6A 3DXCA 2P8VA 5JLJB 4HATB 1J19A 2KCJA 2D2QA 3QWMA 4HAYB 4IAPA 1U29A 1OMWA 4CHJA 2IFSA 4TKNA 1FHOA 2H7EA 4WJ7A 4K2PA 3G9WA 1W1GA 4DX90 3QBVB 3IVFA 1DBHA 2Y8FA 5C5BA 5HE0A 2IYBA 3PP2A 2YT2A 2DHIA 1V5UA 4F7UP 3HQCA 3F0WA 3NW8A 1DROA 2D10A 4HB0B 3QIJA 2MKRA 1P3RA 1Y5OA 2M14A 2YT1A 2Z4DA 2Y8GA 3AU4A 4HAWB 1FGYA 1GC6A 4H8SA 3NWDA 1UNRA 3TFMA 3HIEA 1MK9B 2GCLA 3NWFA 1TQZA 4PNKA 1BTNA 4NY0A 3OANA 4A6HA 2KIGA 4TYZA 1UNPA 4Z2MB 2LKOA 5LONB 2D4QA 5JP4A 3A8QA 5D27A 1BAKA 1XKEA 2EJ8A 5FI0A 3A98B 1DDVA 2RSGA 2VSZA 1U27A 2Z14A 2R2YA 2CODA 1P5TA 1SGHA 4HB4B 3CIKA 2G35A 1X1GA 3KY9A 1WVHA 5M4YB 2GS0A 3MPXA 1FHWA 5HE3A 1KZGA 2D9YA 2K2UA 5CLLB 2P0DA 1AWEA 5DIFB 2NMBA 1Q67A 2DN6A 5CLQB 4HHVA 1XD4A 4KHOA 2Z0OA 4F7GA 2ZPYA 2RUKB 5D3YA 3FSSA 2EC1A 1P6SA 4DXAB 1TJ6A 3KZ1A 2J59M 3KRXA 1V88A 2Y7BA 5DH9B 4ZRKA 1H4RA 2H7DA 3BJIA 4GOUA 2V76A 2I1JA 4GNKB 4CSQA 4KHBA 1I7AA 2FJLA 1U5FA 1MK7B 3NWAA 2FJUB 3SUZA 1DDMA 4HB3B 1XX0A 2KUQA 4GN1A 2D11A 3SYXA 5D3XA 3VIAA 4HAZB 4CHMA 1X1FA 1QC6A 2W2XC 3VOQA 1RJ2A 4Z2NA 2YS5A 2DA0A 4DIXA 1W1DA 5EFXA 2M38A 2UZSA 2ROVA 1BWNA 1EGXA 2R0DA 2MFQA 2Q13A 3PVUA 1U5EA 1X86A 2HTHB 2ZKMX 3GYOA 4QJ4B 1ZM0A 3SV1A 3PZDA 2DHJA 4HSIA 4GZUA 4YL8A 2ELBA 4HAVB 1T77A 2LG1A 5DI9B 2YRYA 2W2WA 3PVWA 2OTXA 4WVFB 5HE1A 1M7RA 2BCJA 2CRFA 4PQ0A 1WJMA 1WJ1A 3U12A 3CXBB 1X05A 4K81A 1TXDA 4EMOA 3ZDTA 2E2XA 3N7CA 3GYPA 5GOWB 1KZ7A 2RLOA 2Z13A 4K2OA 2JP2A 2COCA 3TW1A 2DYNA 3TCAA 4QJ5B 1ZSQA 2LOXA 4L1RA 1Z87A 3RCPA 1MIXA 5C16A 4A6FB 5C6RA 5I2SA 5C79A 1PFJA 3P6AA 3OHMB 3FEHA 2D9WA 2N23A 1FGZA 2UZRA 3ML4A 4B6HA 1ZC3B 2CAYA 1WGQA 1DYNA 2GCJA 2ELAA 2GUMA 3HSAA 1V5PA 3DXEA 2J0MA 3D8EA 4DBBA 2LOZA 4XWXA 4D0NB 5JHGA 2L2IA 3ULBA 4C0AA 4ZRJA 2YS1A 5J3QA 4EKUA 3O96A 1PLSA 2N0YA 2MWNB 3AU5A 4DX8A 2KIEA 1GG3A 1MKEA 2RNRB 1ZVRA 2KR0A 4KHAA 2PZ1A 5J3YA 1U5DA 4IFSA 2NZ8B 2AL6A 5FI1A 2QKMA 2OQBA 4MT7A 3V5WA 4EJNA 5KQ1A 1NU2A 2ROZB 4GXBA 2YT0A 5KQ4A 1N3HA 3NSUA 1OQNA 5D3VA 2YF0A 4A5KA 2I5CA 2K00A 2DLWA 4HDOA 2J0JA 2W2XD 4GMVA 1UPRA 2COAA 3F5RA 3ODXA 2EMSA 3DCXA 4GMXB 1FAOA 2ADZA 3PVLA 2DX1A 3P7ZA 4KVGB 2P0FA 1J0WA 4K17A 4WSFA 1PMSA 2RRFA 2Z0QA 3PSCA 3MDBC 4CYEA 2YVCA 3TO1A 2MDXA 2DFKA 1RRPB 2DYQA 1NTVA 3FVCA 1V89A 2Z0PA 1WGUA 1MIZB 3U7DA 2XQNM 2DKQA 4BBKA 2VKIA 4HAUB 4Y94A 1H10A 1XODA 2LULA 3A58A 4OT1A 4D6WA 2NBVA 2D9ZA 3ODWA 2I5FA 5KCVA 1GC7A 3KSYA 3WA0A 3PEGA 1MI1A 4KHBB 1FB8A 1FOEA 1K5DB 1NTYA 5HE2A 2P0HA 1V61A 2K2JA 4L6EA 1LB1A 1U5GA 1NI2A 3U8ZA 2D9XA 1IRSA 2J0KA 5I2MA 1XR0B 2I1KA 1SHCA 3A8PA 1XCGA 1MAIA 1BTKA 1OY2A 2DX5A 1K5GB 5LOPB 1WI1A 5LG4B 1E5WA 1EVHA 5D3WA 2KGXB 5J3TA 4IOYX 5DHAB 1LW3A 3D8FA 2VRWB 2AEHA 3B77A 2KUPA 2COFA 4QJ3B 5C5BB 1ZC4B 3PG7A 3WYFB 1ZYIA 1EF1A 2DTCA 2UVMA 3D8DA 4GPTB 4P7IA 3DXDA 3BINA 3HW2B 2RVBB 3HK0A 3LJUX 5DHFB 1B55A 1WG7A 2YS3A 3ULCA 2DKPA 1UNQA 5IRSA 2QKLA 3ZVRA 1KI1B 3UZTA 2L1CA 4HAXB 4F7HA 2EMTA 1I2HA 2R09A 4OSNA 2Z59A 1QQGA 2K49A 4ZRIA 5L81A 1UPQA 2CY4A 1UEFA 3SO6A 1DDWA 1W1HA 1MPHA 3KRWA 5JHHA
chains in the Genus database with same CATH topology
5M4YB 4HSIA 3TW1A 2KIGA 3NW8A 3TO1A 4Z2NA 4Z2MB 5LG4B 4QJ5B 4KHBB 4IFSA 4GOUA 4IOYX 4DIXA 4L1RA 3FVCA 4PQ0A 2K8EA 5I2SA 2Z4DA 5IRSA 2Z13A 4GNKB 3U12A 4CSQA 4KHBA 4QJ3B 3OHMB 4QXAB 3NWDA 2Z14A 3NWAA 2R2YA 3TVVA 4KHOA 2FJUB 2RRFA 2Z59A 2KIEA 4OSNA 5I2MA 2K49A 3GYPA 3HIEA 2GCLA 2KUQA 3NWFA 2KR0A 2ZKMX 1ZYIA 3GYOA 3A58A 4QJ4B 2GCJA 4OT1A 4KHAA 3FSSA 2YT2A 2GUMA 4D6WA 2NBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2R2Y A;  2Z4D A;  5IRS A;  2Z59 A;  2NBV A; 
#chains in the Genus database with same CATH topology
 1FHX A;  1U2B A;  2HE7 A;  1EAZ A;  1ISN A;  2GJY A;  2D9V A;  1M7E A;  4HB2 B;  2X18 A;  4KAX B;  3X23 A;  1V5M A;  2K8E A;  3T06 A;  4NSW A;  4MK0 A;  2YSZ A;  4YON A;  3AJ4 A;  2LYD A;  1Y19 B;  1X11 A;  2CY5 A;  1AQC A;  3FM8 C;  4HDQ A;  2DHK A;  4QXA B;  3M1I B;  3SNH A;  2RGN B;  3TVV A;  4A6F A;  4A6K A;  3ODO A;  4MY6 A;  3DXC A;  2P8V A;  5JLJ B;  4HAT B;  1J19 A;  2KCJ A;  2D2Q A;  3QWM A;  4HAY B;  4IAP A;  1U29 A;  1OMW A;  4CHJ A;  2IFS A;  4TKN A;  1FHO A;  2H7E A;  4WJ7 A;  4K2P A;  3G9W A;  1W1G A;  4DX9 0;  3QBV B;  3IVF A;  1DBH A;  2Y8F A;  5C5B A;  5HE0 A;  2IYB A;  3PP2 A;  2YT2 A;  2DHI A;  1V5U A;  4F7U P;  3HQC A;  3F0W A;  3NW8 A;  1DRO A;  2D10 A;  4HB0 B;  3QIJ A;  2MKR A;  1P3R A;  1Y5O A;  2M14 A;  2YT1 A;  2Z4D A;  2Y8G A;  3AU4 A;  4HAW B;  1FGY A;  1GC6 A;  4H8S A;  3NWD A;  1UNR A;  3TFM A;  3HIE A;  1MK9 B;  2GCL A;  3NWF A;  1TQZ A;  4PNK A;  1BTN A;  4NY0 A;  3OAN A;  4A6H A;  2KIG A;  4TYZ A;  1UNP A;  4Z2M B;  2LKO A;  5LON B;  2D4Q A;  5JP4 A;  3A8Q A;  5D27 A;  1BAK A;  1XKE A;  2EJ8 A;  5FI0 A;  3A98 B;  1DDV A;  2RSG A;  2VSZ A;  1U27 A;  2Z14 A;  2R2Y A;  2COD A;  1P5T A;  1SGH A;  4HB4 B;  3CIK A;  2G35 A;  1X1G A;  3KY9 A;  1WVH A;  5M4Y B;  2GS0 A;  3MPX A;  1FHW A;  5HE3 A;  1KZG A;  2D9Y A;  2K2U A;  5CLL B;  2P0D A;  1AWE A;  5DIF B;  2NMB A;  1Q67 A;  2DN6 A;  5CLQ B;  4HHV A;  1XD4 A;  4KHO A;  2Z0O A;  4F7G A;  2ZPY A;  2RUK B;  5D3Y A;  3FSS A;  2EC1 A;  1P6S A;  4DXA B;  1TJ6 A;  3KZ1 A;  2J59 M;  3KRX A;  1V88 A;  2Y7B A;  5DH9 B;  4ZRK A;  1H4R A;  2H7D A;  3BJI A;  4GOU A;  2V76 A;  2I1J A;  4GNK B;  4CSQ A;  4KHB A;  1I7A A;  2FJL A;  1U5F A;  1MK7 B;  3NWA A;  2FJU B;  3SUZ A;  1DDM A;  4HB3 B;  1XX0 A;  2KUQ A;  4GN1 A;  2D11 A;  3SYX A;  5D3X A;  3VIA A;  4HAZ B;  4CHM A;  1X1F A;  1QC6 A;  2W2X C;  3VOQ A;  1RJ2 A;  4Z2N A;  2YS5 A;  2DA0 A;  4DIX A;  1W1D A;  5EFX A;  2M38 A;  2UZS A;  2ROV A;  1BWN A;  1EGX A;  2R0D A;  2MFQ A;  2Q13 A;  3PVU A;  1U5E A;  1X86 A;  2HTH B;  2ZKM X;  3GYO A;  4QJ4 B;  1ZM0 A;  3SV1 A;  3PZD A;  2DHJ A;  4HSI A;  4GZU A;  4YL8 A;  2ELB A;  4HAV B;  1T77 A;  2LG1 A;  5DI9 B;  2YRY A;  2W2W A;  3PVW A;  2OTX A;  4WVF B;  5HE1 A;  1M7R A;  2BCJ A;  2CRF A;  4PQ0 A;  1WJM A;  1WJ1 A;  3U12 A;  3CXB B;  1X05 A;  4K81 A;  1TXD A;  4EMO A;  3ZDT A;  2E2X A;  3N7C A;  3GYP A;  5GOW B;  1KZ7 A;  2RLO A;  2Z13 A;  4K2O A;  2JP2 A;  2COC A;  3TW1 A;  2DYN A;  3TCA A;  4QJ5 B;  1ZSQ A;  2LOX A;  4L1R A;  1Z87 A;  3RCP A;  1MIX A;  5C16 A;  4A6F B;  5C6R A;  5I2S A;  5C79 A;  1PFJ A;  3P6A A;  3OHM B;  3FEH A;  2D9W A;  2N23 A;  1FGZ A;  2UZR A;  3ML4 A;  4B6H A;  1ZC3 B;  2CAY A;  1WGQ A;  1DYN A;  2GCJ A;  2ELA A;  2GUM A;  3HSA A;  1V5P A;  3DXE A;  2J0M A;  3D8E A;  4DBB A;  2LOZ A;  4XWX A;  4D0N B;  5JHG A;  2L2I A;  3ULB A;  4C0A A;  4ZRJ A;  2YS1 A;  5J3Q A;  4EKU A;  3O96 A;  1PLS A;  2N0Y A;  2MWN B;  3AU5 A;  4DX8 A;  2KIE A;  1GG3 A;  1MKE A;  2RNR B;  1ZVR A;  2KR0 A;  4KHA A;  2PZ1 A;  5J3Y A;  1U5D A;  4IFS A;  2NZ8 B;  2AL6 A;  5FI1 A;  2QKM A;  2OQB A;  4MT7 A;  3V5W A;  4EJN A;  5KQ1 A;  1NU2 A;  2ROZ B;  4GXB A;  2YT0 A;  5KQ4 A;  1N3H A;  3NSU A;  1OQN A;  5D3V A;  2YF0 A;  4A5K A;  2I5C A;  2K00 A;  2DLW A;  4HDO A;  2J0J A;  2W2X D;  4GMV A;  1UPR A;  2COA A;  3F5R A;  3ODX A;  2EMS A;  3DCX A;  4GMX B;  1FAO A;  2ADZ A;  3PVL A;  2DX1 A;  3P7Z A;  4KVG B;  2P0F A;  1J0W A;  4K17 A;  4WSF A;  1PMS A;  2RRF A;  2Z0Q A;  3PSC A;  3MDB C;  4CYE A;  2YVC A;  3TO1 A;  2MDX A;  2DFK A;  1RRP B;  2DYQ A;  1NTV A;  3FVC A;  1V89 A;  2Z0P A;  1WGU A;  1MIZ B;  3U7D A;  2XQN M;  2DKQ A;  4BBK A;  2VKI A;  4HAU B;  4Y94 A;  1H10 A;  1XOD A;  2LUL A;  3A58 A;  4OT1 A;  4D6W A;  2NBV A;  2D9Z A;  3ODW A;  2I5F A;  5KCV A;  1GC7 A;  3KSY A;  3WA0 A;  3PEG A;  1MI1 A;  4KHB B;  1FB8 A;  1FOE A;  1K5D B;  1NTY A;  5HE2 A;  2P0H A;  1V61 A;  2K2J A;  4L6E A;  1LB1 A;  1U5G A;  1NI2 A;  3U8Z A;  2D9X A;  1IRS A;  2J0K A;  5I2M A;  1XR0 B;  2I1K A;  1SHC A;  3A8P A;  1XCG A;  1MAI A;  1BTK A;  1OY2 A;  2DX5 A;  1K5G B;  5LOP B;  1WI1 A;  5LG4 B;  1E5W A;  1EVH A;  5D3W A;  2KGX B;  5J3T A;  4IOY X;  5DHA B;  1LW3 A;  3D8F A;  2VRW B;  2AEH A;  3B77 A;  2KUP A;  2COF A;  4QJ3 B;  5C5B B;  1ZC4 B;  3PG7 A;  3WYF B;  1ZYI A;  1EF1 A;  2DTC A;  2UVM A;  3D8D A;  4GPT B;  4P7I A;  3DXD A;  3BIN A;  3HW2 B;  2RVB B;  3HK0 A;  3LJU X;  5DHF B;  1B55 A;  1WG7 A;  2YS3 A;  3ULC A;  2DKP A;  1UNQ A;  5IRS A;  2QKL A;  3ZVR A;  1KI1 B;  3UZT A;  2L1C A;  4HAX B;  4F7H A;  2EMT A;  1I2H A;  2R09 A;  4OSN A;  2Z59 A;  1QQG A;  2K49 A;  4ZRI A;  5L81 A;  1UPQ A;  2CY4 A;  1UEF A;  3SO6 A;  1DDW A;  1W1H A;  1MPH A;  3KRW A;  5JHH A; 
#chains in the Genus database with same CATH homology
 5M4Y B;  4HSI A;  3TW1 A;  2KIG A;  3NW8 A;  3TO1 A;  4Z2N A;  4Z2M B;  5LG4 B;  4QJ5 B;  4KHB B;  4IFS A;  4GOU A;  4IOY X;  4DIX A;  4L1R A;  3FVC A;  4PQ0 A;  2K8E A;  5I2S A;  2Z4D A;  5IRS A;  2Z13 A;  4GNK B;  3U12 A;  4CSQ A;  4KHB A;  4QJ3 B;  3OHM B;  4QXA B;  3NWD A;  2Z14 A;  3NWA A;  2R2Y A;  3TVV A;  4KHO A;  2FJU B;  2RRF A;  2Z59 A;  2KIE A;  4OSN A;  5I2M A;  2K49 A;  3GYP A;  3HIE A;  2GCL A;  2KUQ A;  3NWF A;  2KR0 A;  2ZKM X;  1ZYI A;  3GYO A;  3A58 A;  4QJ4 B;  2GCJ A;  4OT1 A;  4KHA A;  3FSS A;  2YT2 A;  2GUM A;  4D6W A;  2NBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...