5DH9B

Crystal structure of pki nes flip mutant peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dh9B00
2W2XD 1UPQA 1UPRA 3GYPA 3P6AA 2W2XC 2D10A 2ROZB 5D3WA 1WVHA 2EC1A 1ZC4B 1WGQA 5D3VA 1EAZA 1XCGA 2DX5A 1GG3A 4K2PA 1V61A 2ZPYA 1FB8A 1TQZA 2VRWB 5GOWB 3GYOA 3A98B 2UZSA 1W1DA 5J3QA 2DYNA 3TW1A 4HHVA 5HE1A 1QC6A 4HB3B 5FI1A 1DDWA 3PZDA 5DIFB 2M38A 2I5FA 4EKUA 2EMTA 1DDVA 4NSWA 1U27A 1X86A 2DYQA 2DFKA 4PQ0A 1SGHA 2YVCA 1GC7A 1OQNA 3D8EA 1N3HA 2COAA 3U8ZA 4D0NB 4HDOA 4A6KA 2LYDA 1E5WA 2LOXA 5KCVA 4HB0B 5FI0A 5D3XA 2EMSA 2I1JA 3DXEA 1LB1A 2D11A 3AU4A 4HAVB 1WGUA 5C6RA 1MK9B 1P6SA 2YF0A 5EFXA 1GC6A 2YT1A 1FAOA 3KSYA 5J3YA 1BWNA 2IYBA 1B55A 1U5DA 2DN6A 4DXAB 4DX90 2FJLA 4MK0A 1I7AA 2LULA 1NU2A 1J0WA 2H7EA 1Y19B 5D27A 5DHFB 1BTKA 4Z2MB 2Z0QA 5LOPB 4HB4B 3SO6A 2KCJA 1K5DB 2GJYA 3CXBB 2YT0A 3ODXA 3PEGA 1NTYA 2Z0PA 5CLQB 2J0MA 1U29A 5C5BA 2CODA 1PMSA 2I1KA 2VKIA 3FEHA 3A8PA 1DROA 2UZRA 1KZGA 2DA0A 5JP4A 2COFA 3HQCA 1XD4A 1PLSA 2DHJA 2K2UA 3LJUX 3TCAA 1FOEA 3SNHA 5DI9B 3DXCA 2I5CA 4GPTB 4IAPA 3ULCA 2RVBB 1Y5OA 2BCJA 1DBHA 2P0DA 3ML4A 1Z87A 1OY2A 3ODWA 5C5BB 4IFSA 4NY0A 4A6FA 3TO1A 3PVLA 2DX1A 2RLOA 2N23A 1FGYA 1DDMA 1FHWA 1AQCA 3M1IB 2JP2A 1XODA 4K17A 4GXBA 1XR0B 3P7ZA 1ZM0A 1W1GA 3PSCA 3O96A 1TJ6A 4YL8A 3SYXA 2OTXA 1P3RA 2H7DA 5DH9B 2CY4A 4GZUA 3KY9A 2R09A 1MIXA 4GMXB 2K2JA 2Z0OA 2YS5A 2NZ8B 2D9WA 2RSGA 4A6FB 2J0KA 3ULBA 1K5GB 4F7HA 2YSZA 2AL6A 1X1GA 1MPHA 1EGXA 1ZC3B 2IFSA 2YS3A 2Q13A 3PP2A 2QKLA 1BTNA 3KZ1A 4GN1A 4BBKA 2HTHB 1PFJA 4K2OA 2RNRB 4ZRJA 3TFMA 1EF1A 1FGZA 3KRWA 1UNQA 1WJMA 1RRPB 3ODOA 2LKOA 4P7IA 3MDBC 2E2XA 1X05A 2MDXA 1MK7B 1W1HA 4KHBB 4ZRIA 4MY6A 4PNKA 3BJIA 1UNRA 2D4QA 2COCA 1UNPA 4KVGB 4C0AA 1V5PA 4KHOA 4TKNA 1U5GA 1V5MA 5CLLB 5DHAB 3HK0A 1U5FA 2QKMA 3UZTA 1M7RA 1TXDA 2ELBA 1RJ2A 4HDQA 3KRXA 4HAUB 5D3YA 3AU5A 2GS0A 1XX0A 4EMOA 3RCPA 2AEHA 2P8VA 2LOZA 5C79A 5JHHA 3U7DA 4DBBA 2ELAA 2R0DA 3D8DA 2M14A 1FHOA 5JLJB 1J19A 3TVVA 3ZVRA 5HE3A 3N7CA 3AJ4A 4A6HA 2ROVA 3WA0A 3F5RA 4CHJA 2LG1A 2HE7A 1AWEA 4WSFA 2RGNB 3CIKA 2XQNM 4KHAA 2EJ8A 3V5WA 3PG7A 4KAXB 2CRFA 1OMWA 4HB2B 2GCJA 3QIJA 2GCLA 1BAKA 2J0JA 4WVFB 2D9ZA 3QBVB 3VIAA 2DTCA 4L6EA 1X1FA 3BINA 2L1CA 1WI1A 1DYNA 2PZ1A 2W2WA 3ZDTA 4HATB 2MWNB 2K00A 1KZ7A 4K81A 4A5KA 1XKEA 1ISNA 3G9WA 5C16A 4TYZA 1UEFA 2MFQA 2Y7BA 3SV1A 2NMBA 4XWXA 3MPXA 1WG7A 3NSUA 1X11A 4HAYB 2G35A 3FM8C 2D9VA 5HE2A 4CYEA 2DHIA 2MKRA 1MKEA 5JHGA 1U5EA 1Q67A 4B6HA 1QQGA 2OQBA 2N0YA 1H10A 5L81A 1H4RA 4GMVA 3WYFB 3PVWA 1P5TA 1MAIA 2YS1A 4WJ7A 2V76A 2VSZA 2CAYA 3SUZA 4IOYX 2KUPA 5HE0A 3IVFA 3DXDA 1V89A 3X23A 5KQ4A 4Y94A 1NTVA 2KGXB 4HAXB 2D9YA 2X18A 3VOQA 4Z2NA 4CHMA 3QWMA 1MIZB 2DHKA 4HAZB 1WJ1A 2Y8GA 3PVUA 2D9XA 1I2HA 2DLWA 4MT7A 4DX8A 4EJNA 2DKQA 2Y8FA 2DKPA 3D8FA 1LW3A 4H8SA 3F0WA 3HW2B 3T06A 4F7GA 2L2IA 1FHXA 1NI2A 2RUKB 1M7EA 2P0HA 2YRYA 1IRSA 5J3TA 1SHCA 1EVHA 4YONA 2P0FA 2D2QA 3FSSA 3A8QA 1ZSQA 4ZRKA 1ZVRA 2UVMA 5LONB 1KI1B 1V5UA 4HAWB 1V88A 1U2BA 2J59M 2ADZA 4F7UP 2CY5A 3OANA 5KQ1A
chains in the Genus database with same CATH superfamily
2W2XD 1UPQA 1UPRA 3GYPA 3P6AA 2W2XC 2D10A 2ROZB 5D3WA 1WVHA 2EC1A 1ZC4B 1WGQA 3OHMB 5D3VA 1EAZA 1XCGA 2DX5A 1GG3A 4K2PA 1V61A 2ZPYA 3FVCA 1FB8A 1TQZA 2VRWB 4HSIA 5GOWB 3GYOA 3A98B 2UZSA 1W1DA 5J3QA 2Z14A 2DYNA 3TW1A 3U12A 4HHVA 5HE1A 1QC6A 4HB3B 5FI1A 1DDWA 3PZDA 5DIFB 2M38A 2I5FA 4EKUA 2EMTA 2K8EA 1DDVA 4NSWA 1U27A 1MI1A 1X86A 2DYQA 2DFKA 4PQ0A 1SGHA 2YVCA 1GC7A 1OQNA 3D8EA 1N3HA 2COAA 3U8ZA 4D0NB 4HDOA 4A6KA 2LYDA 1E5WA 2LOXA 5KCVA 4HB0B 4GOUA 5FI0A 5D3XA 2EMSA 2I1JA 3DXEA 1LB1A 2D11A 3AU4A 4HAVB 1WGUA 5C6RA 1MK9B 1P6SA 2YF0A 5EFXA 1GC6A 2YT1A 1FAOA 3KSYA 5J3YA 1BWNA 2IYBA 1B55A 1U5DA 2DN6A 4DXAB 4DX90 2FJLA 1ZYIA 4MK0A 1I7AA 2LULA 1NU2A 1J0WA 2H7EA 1Y19B 2KR0A 5D27A 5DHFB 1BTKA 2Z59A 4Z2MB 2Z0QA 5LOPB 2KIEA 4HB4B 3SO6A 2KCJA 3DCXA 1K5DB 2GJYA 3CXBB 2YT0A 3ODXA 3PEGA 1NTYA 2Z0PA 5CLQB 2J0MA 1U29A 5C5BA 2CODA 1PMSA 2I1KA 2VKIA 5IRSA 3FEHA 3A8PA 1DROA 2UZRA 1KZGA 2DA0A 5JP4A 2COFA 3HQCA 1XD4A 1PLSA 2DHJA 2K2UA 3LJUX 3TCAA 1FOEA 3SNHA 5DI9B 3DXCA 2I5CA 4GPTB 4IAPA 3ULCA 2RVBB 1Y5OA 2BCJA 1DBHA 2P0DA 3ML4A 1Z87A 1OY2A 3ODWA 4D6WA 5C5BB 4IFSA 4NY0A 4A6FA 3TO1A 3PVLA 4QJ4B 2DX1A 2RLOA 2NBVA 2N23A 1FGYA 1DDMA 1FHWA 1AQCA 3M1IB 2YT2A 2JP2A 1XODA 4K17A 4GXBA 1XR0B 3P7ZA 1ZM0A 1W1GA 3PSCA 3O96A 1TJ6A 4YL8A 4OT1A 3SYXA 2OTXA 1P3RA 2H7DA 5DH9B 2FJUB 2CY4A 4GZUA 3KY9A 2R09A 1MIXA 4GMXB 2K2JA 2Z0OA 2YS5A 2NZ8B 2D9WA 2RSGA 4KHBA 2J0KA 4A6FB 3ULBA 1K5GB 4F7HA 2YSZA 2AL6A 1X1GA 1MPHA 1EGXA 1ZC3B 2IFSA 2YS3A 2Q13A 3PP2A 2QKLA 1BTNA 3KZ1A 4GN1A 4BBKA 2HTHB 1PFJA 4K2OA 2RNRB 4ZRJA 3TFMA 1EF1A 1FGZA 3KRWA 1UNQA 1WJMA 1RRPB 3ODOA 2LKOA 4P7IA 3MDBC 2E2XA 1X05A 2MDXA 1MK7B 1W1HA 4KHBB 4ZRIA 4MY6A 4PNKA 3BJIA 1UNRA 2D4QA 2COCA 1UNPA 4KVGB 2GUMA 1V5PA 4C0AA 4KHOA 4TKNA 1U5GA 2Z13A 1V5MA 5CLLB 5DHAB 3HK0A 1U5FA 2QKMA 3UZTA 1M7RA 1TXDA 2ELBA 1RJ2A 4HDQA 3KRXA 1T77A 4HAUB 5D3YA 3AU5A 2GS0A 1XX0A 4EMOA 3RCPA 2AEHA 2P8VA 2LOZA 3HSAA 5C79A 5JHHA 3U7DA 4DBBA 2ELAA 2R0DA 3D8DA 4OSNA 2M14A 1FHOA 5JLJB 1J19A 3TVVA 3ZVRA 5HE3A 3N7CA 3AJ4A 4A6HA 2ROVA 3WA0A 3F5RA 4CHJA 2LG1A 2HE7A 1AWEA 4WSFA 2RGNB 3CIKA 2XQNM 4KHAA 2EJ8A 3V5WA 3PG7A 4KAXB 2CRFA 1OMWA 4HB2B 2GCJA 3QIJA 2GCLA 1BAKA 2J0JA 4WVFB 2D9ZA 3QBVB 3VIAA 4GNKB 2DTCA 4L6EA 1X1FA 3BINA 2L1CA 1WI1A 1DYNA 2PZ1A 3NWAA 2W2WA 3ZDTA 5M4YB 3NWDA 4HATB 2MWNB 5I2SA 2K00A 1KZ7A 4K81A 4A5KA 3B77A 1XKEA 1ISNA 3G9WA 5C16A 4TYZA 1UEFA 2MFQA 2Y7BA 3SV1A 2NMBA 4XWXA 3MPXA 1WG7A 3NSUA 1X11A 4HAYB 4L1RA 2G35A 2KIGA 3FM8C 2D9VA 5HE2A 4CYEA 2DHIA 2MKRA 1MKEA 5JHGA 3NWFA 1U5EA 1Q67A 4B6HA 1QQGA 2OQBA 2N0YA 1H10A 2RRFA 5L81A 5I2MA 1H4RA 5LG4B 4DIXA 4GMVA 3WYFB 3PVWA 1P5TA 1MAIA 2ZKMX 4QJ3B 2YS1A 4WJ7A 2V76A 2VSZA 2CAYA 3SUZA 4IOYX 2KUPA 5HE0A 3IVFA 3DXDA 1V89A 3X23A 5KQ4A 4Y94A 2KUQA 1NTVA 2KGXB 4HAXB 2D9YA 2X18A 3VOQA 2K49A 4Z2NA 4CHMA 3QWMA 1MIZB 2DHKA 4HAZB 1WJ1A 2Y8GA 3NW8A 3PVUA 2D9XA 1I2HA 2DLWA 4MT7A 4DX8A 2R2YA 4EJNA 2DKQA 2Y8FA 2DKPA 4CSQA 3D8FA 1LW3A 4H8SA 4QXAB 3F0WA 3HW2B 3T06A 4F7GA 2L2IA 1FHXA 1NI2A 2RUKB 1M7EA 2P0HA 2YRYA 3A58A 2Z4DA 1IRSA 5J3TA 1SHCA 1EVHA 4YONA 2P0FA 2D2QA 3FSSA 3A8QA 1ZSQA 4ZRKA 1ZVRA 2UVMA 4QJ5B 5LONB 1KI1B 1V5UA 4HAWB 1V88A 1U2BA 2J59M 2ADZA 4F7UP 3HIEA 2CY5A 3OANA 5KQ1A
chains in the Genus database with same CATH topology
2W2XD 1UPQA 1UPRA 3GYPA 3P6AA 2W2XC 2D10A 2ROZB 5D3WA 1WVHA 2EC1A 1ZC4B 1WGQA 5D3VA 1EAZA 1XCGA 2DX5A 1GG3A 4K2PA 1V61A 2ZPYA 1FB8A 1TQZA 2VRWB 5GOWB 3GYOA 3A98B 2UZSA 1W1DA 5J3QA 2DYNA 3TW1A 4HHVA 5HE1A 1QC6A 4HB3B 5FI1A 1DDWA 3PZDA 5DIFB 2M38A 2I5FA 4EKUA 2EMTA 1DDVA 4NSWA 1U27A 1X86A 2DYQA 2DFKA 4PQ0A 1SGHA 2YVCA 1GC7A 1OQNA 3D8EA 1N3HA 2COAA 3U8ZA 4D0NB 4HDOA 4A6KA 2LYDA 1E5WA 2LOXA 5KCVA 4HB0B 5FI0A 5D3XA 2EMSA 2I1JA 3DXEA 1LB1A 2D11A 3AU4A 4HAVB 1WGUA 5C6RA 1MK9B 1P6SA 2YF0A 5EFXA 1GC6A 2YT1A 1FAOA 3KSYA 5J3YA 1BWNA 2IYBA 1B55A 1U5DA 2DN6A 4DXAB 4DX90 2FJLA 4MK0A 1I7AA 2LULA 1NU2A 1J0WA 2H7EA 1Y19B 5D27A 5DHFB 1BTKA 4Z2MB 2Z0QA 5LOPB 4HB4B 3SO6A 2KCJA 1K5DB 2GJYA 3CXBB 2YT0A 3ODXA 3PEGA 1NTYA 2Z0PA 5CLQB 2J0MA 1U29A 5C5BA 2CODA 1PMSA 2I1KA 2VKIA 3FEHA 3A8PA 1DROA 2UZRA 1KZGA 2DA0A 5JP4A 2COFA 3HQCA 1XD4A 1PLSA 2DHJA 2K2UA 3LJUX 3TCAA 1FOEA 3SNHA 5DI9B 3DXCA 2I5CA 4GPTB 4IAPA 3ULCA 2RVBB 1Y5OA 2BCJA 1DBHA 2P0DA 3ML4A 1Z87A 1OY2A 3ODWA 5C5BB 4IFSA 4NY0A 4A6FA 3TO1A 3PVLA 2DX1A 2RLOA 2N23A 1FGYA 1DDMA 1FHWA 1AQCA 3M1IB 2JP2A 1XODA 4K17A 4GXBA 1XR0B 3P7ZA 1ZM0A 1W1GA 3PSCA 3O96A 1TJ6A 4YL8A 3SYXA 2OTXA 1P3RA 2H7DA 5DH9B 2CY4A 4GZUA 3KY9A 2R09A 1MIXA 4GMXB 2K2JA 2Z0OA 2YS5A 2NZ8B 2D9WA 2RSGA 4A6FB 2J0KA 3ULBA 1K5GB 4F7HA 2YSZA 2AL6A 1X1GA 1MPHA 1EGXA 1ZC3B 2IFSA 2YS3A 2Q13A 3PP2A 2QKLA 1BTNA 3KZ1A 4GN1A 4BBKA 2HTHB 1PFJA 4K2OA 2RNRB 4ZRJA 3TFMA 1EF1A 1FGZA 3KRWA 1UNQA 1WJMA 1RRPB 3ODOA 2LKOA 4P7IA 3MDBC 2E2XA 1X05A 2MDXA 1MK7B 1W1HA 4KHBB 4ZRIA 4MY6A 4PNKA 3BJIA 1UNRA 2D4QA 2COCA 1UNPA 4KVGB 4C0AA 1V5PA 4KHOA 4TKNA 1U5GA 1V5MA 5CLLB 5DHAB 3HK0A 1U5FA 2QKMA 3UZTA 1M7RA 1TXDA 2ELBA 1RJ2A 4HDQA 3KRXA 4HAUB 5D3YA 3AU5A 2GS0A 1XX0A 4EMOA 3RCPA 2AEHA 2P8VA 2LOZA 5C79A 5JHHA 3U7DA 4DBBA 2ELAA 2R0DA 3D8DA 2M14A 1FHOA 5JLJB 1J19A 3TVVA 3ZVRA 5HE3A 3N7CA 3AJ4A 4A6HA 2ROVA 3WA0A 3F5RA 4CHJA 2LG1A 2HE7A 1AWEA 4WSFA 2RGNB 3CIKA 2XQNM 4KHAA 2EJ8A 3V5WA 3PG7A 4KAXB 2CRFA 1OMWA 4HB2B 2GCJA 3QIJA 2GCLA 1BAKA 2J0JA 4WVFB 2D9ZA 3QBVB 3VIAA 2DTCA 4L6EA 1X1FA 3BINA 2L1CA 1WI1A 1DYNA 2PZ1A 2W2WA 3ZDTA 4HATB 2MWNB 2K00A 1KZ7A 4K81A 4A5KA 1XKEA 1ISNA 3G9WA 5C16A 4TYZA 1UEFA 2MFQA 2Y7BA 3SV1A 2NMBA 4XWXA 3MPXA 1WG7A 3NSUA 1X11A 4HAYB 2G35A 3FM8C 2D9VA 5HE2A 4CYEA 2DHIA 2MKRA 1MKEA 5JHGA 1U5EA 1Q67A 4B6HA 1QQGA 2OQBA 2N0YA 1H10A 5L81A 1H4RA 4GMVA 3WYFB 3PVWA 1P5TA 1MAIA 2YS1A 4WJ7A 2V76A 2VSZA 2CAYA 3SUZA 4IOYX 2KUPA 5HE0A 3IVFA 3DXDA 1V89A 3X23A 5KQ4A 4Y94A 1NTVA 2KGXB 4HAXB 2D9YA 2X18A 3VOQA 4Z2NA 4CHMA 3QWMA 1MIZB 2DHKA 4HAZB 1WJ1A 2Y8GA 3PVUA 2D9XA 1I2HA 2DLWA 4MT7A 4DX8A 4EJNA 2DKQA 2Y8FA 2DKPA 3D8FA 1LW3A 4H8SA 3F0WA 3HW2B 3T06A 4F7GA 2L2IA 1FHXA 1NI2A 2RUKB 1M7EA 2P0HA 2YRYA 1IRSA 5J3TA 1SHCA 1EVHA 4YONA 2P0FA 2D2QA 3FSSA 3A8QA 1ZSQA 4ZRKA 1ZVRA 2UVMA 5LONB 1KI1B 1V5UA 4HAWB 1V88A 1U2BA 2J59M 2ADZA 4F7UP 2CY5A 3OANA 5KQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X D;  1UPQ A;  1UPR A;  3GYP A;  3P6A A;  2W2X C;  2D10 A;  2ROZ B;  5D3W A;  1WVH A;  2EC1 A;  1ZC4 B;  1WGQ A;  5D3V A;  1EAZ A;  1XCG A;  2DX5 A;  1GG3 A;  4K2P A;  1V61 A;  2ZPY A;  1FB8 A;  1TQZ A;  2VRW B;  5GOW B;  3GYO A;  3A98 B;  2UZS A;  1W1D A;  5J3Q A;  2DYN A;  3TW1 A;  4HHV A;  5HE1 A;  1QC6 A;  4HB3 B;  5FI1 A;  1DDW A;  3PZD A;  5DIF B;  2M38 A;  2I5F A;  4EKU A;  2EMT A;  1DDV A;  4NSW A;  1U27 A;  1X86 A;  2DYQ A;  2DFK A;  4PQ0 A;  1SGH A;  2YVC A;  1GC7 A;  1OQN A;  3D8E A;  1N3H A;  2COA A;  3U8Z A;  4D0N B;  4HDO A;  4A6K A;  2LYD A;  1E5W A;  2LOX A;  5KCV A;  4HB0 B;  5FI0 A;  5D3X A;  2EMS A;  2I1J A;  3DXE A;  1LB1 A;  2D11 A;  3AU4 A;  4HAV B;  1WGU A;  5C6R A;  1MK9 B;  1P6S A;  2YF0 A;  5EFX A;  1GC6 A;  2YT1 A;  1FAO A;  3KSY A;  5J3Y A;  1BWN A;  2IYB A;  1B55 A;  1U5D A;  2DN6 A;  4DXA B;  4DX9 0;  2FJL A;  4MK0 A;  1I7A A;  2LUL A;  1NU2 A;  1J0W A;  2H7E A;  1Y19 B;  5D27 A;  5DHF B;  1BTK A;  4Z2M B;  2Z0Q A;  5LOP B;  4HB4 B;  3SO6 A;  2KCJ A;  1K5D B;  2GJY A;  3CXB B;  2YT0 A;  3ODX A;  3PEG A;  1NTY A;  2Z0P A;  5CLQ B;  2J0M A;  1U29 A;  5C5B A;  2COD A;  1PMS A;  2I1K A;  2VKI A;  3FEH A;  3A8P A;  1DRO A;  2UZR A;  1KZG A;  2DA0 A;  5JP4 A;  2COF A;  3HQC A;  1XD4 A;  1PLS A;  2DHJ A;  2K2U A;  3LJU X;  3TCA A;  1FOE A;  3SNH A;  5DI9 B;  3DXC A;  2I5C A;  4GPT B;  4IAP A;  3ULC A;  2RVB B;  1Y5O A;  2BCJ A;  1DBH A;  2P0D A;  3ML4 A;  1Z87 A;  1OY2 A;  3ODW A;  5C5B B;  4IFS A;  4NY0 A;  4A6F A;  3TO1 A;  3PVL A;  2DX1 A;  2RLO A;  2N23 A;  1FGY A;  1DDM A;  1FHW A;  1AQC A;  3M1I B;  2JP2 A;  1XOD A;  4K17 A;  4GXB A;  1XR0 B;  3P7Z A;  1ZM0 A;  1W1G A;  3PSC A;  3O96 A;  1TJ6 A;  4YL8 A;  3SYX A;  2OTX A;  1P3R A;  2H7D A;  5DH9 B;  2CY4 A;  4GZU A;  3KY9 A;  2R09 A;  1MIX A;  4GMX B;  2K2J A;  2Z0O A;  2YS5 A;  2NZ8 B;  2D9W A;  2RSG A;  4A6F B;  2J0K A;  3ULB A;  1K5G B;  4F7H A;  2YSZ A;  2AL6 A;  1X1G A;  1MPH A;  1EGX A;  1ZC3 B;  2IFS A;  2YS3 A;  2Q13 A;  3PP2 A;  2QKL A;  1BTN A;  3KZ1 A;  4GN1 A;  4BBK A;  2HTH B;  1PFJ A;  4K2O A;  2RNR B;  4ZRJ A;  3TFM A;  1EF1 A;  1FGZ A;  3KRW A;  1UNQ A;  1WJM A;  1RRP B;  3ODO A;  2LKO A;  4P7I A;  3MDB C;  2E2X A;  1X05 A;  2MDX A;  1MK7 B;  1W1H A;  4KHB B;  4ZRI A;  4MY6 A;  4PNK A;  3BJI A;  1UNR A;  2D4Q A;  2COC A;  1UNP A;  4KVG B;  4C0A A;  1V5P A;  4KHO A;  4TKN A;  1U5G A;  1V5M A;  5CLL B;  5DHA B;  3HK0 A;  1U5F A;  2QKM A;  3UZT A;  1M7R A;  1TXD A;  2ELB A;  1RJ2 A;  4HDQ A;  3KRX A;  4HAU B;  5D3Y A;  3AU5 A;  2GS0 A;  1XX0 A;  4EMO A;  3RCP A;  2AEH A;  2P8V A;  2LOZ A;  5C79 A;  5JHH A;  3U7D A;  4DBB A;  2ELA A;  2R0D A;  3D8D A;  2M14 A;  1FHO A;  5JLJ B;  1J19 A;  3TVV A;  3ZVR A;  5HE3 A;  3N7C A;  3AJ4 A;  4A6H A;  2ROV A;  3WA0 A;  3F5R A;  4CHJ A;  2LG1 A;  2HE7 A;  1AWE A;  4WSF A;  2RGN B;  3CIK A;  2XQN M;  4KHA A;  2EJ8 A;  3V5W A;  3PG7 A;  4KAX B;  2CRF A;  1OMW A;  4HB2 B;  2GCJ A;  3QIJ A;  2GCL A;  1BAK A;  2J0J A;  4WVF B;  2D9Z A;  3QBV B;  3VIA A;  2DTC A;  4L6E A;  1X1F A;  3BIN A;  2L1C A;  1WI1 A;  1DYN A;  2PZ1 A;  2W2W A;  3ZDT A;  4HAT B;  2MWN B;  2K00 A;  1KZ7 A;  4K81 A;  4A5K A;  1XKE A;  1ISN A;  3G9W A;  5C16 A;  4TYZ A;  1UEF A;  2MFQ A;  2Y7B A;  3SV1 A;  2NMB A;  4XWX A;  3MPX A;  1WG7 A;  3NSU A;  1X11 A;  4HAY B;  2G35 A;  3FM8 C;  2D9V A;  5HE2 A;  4CYE A;  2DHI A;  2MKR A;  1MKE A;  5JHG A;  1U5E A;  1Q67 A;  4B6H A;  1QQG A;  2OQB A;  2N0Y A;  1H10 A;  5L81 A;  1H4R A;  4GMV A;  3WYF B;  3PVW A;  1P5T A;  1MAI A;  2YS1 A;  4WJ7 A;  2V76 A;  2VSZ A;  2CAY A;  3SUZ A;  4IOY X;  2KUP A;  5HE0 A;  3IVF A;  3DXD A;  1V89 A;  3X23 A;  5KQ4 A;  4Y94 A;  1NTV A;  2KGX B;  4HAX B;  2D9Y A;  2X18 A;  3VOQ A;  4Z2N A;  4CHM A;  3QWM A;  1MIZ B;  2DHK A;  4HAZ B;  1WJ1 A;  2Y8G A;  3PVU A;  2D9X A;  1I2H A;  2DLW A;  4MT7 A;  4DX8 A;  4EJN A;  2DKQ A;  2Y8F A;  2DKP A;  3D8F A;  1LW3 A;  4H8S A;  3F0W A;  3HW2 B;  3T06 A;  4F7G A;  2L2I A;  1FHX A;  1NI2 A;  2RUK B;  1M7E A;  2P0H A;  2YRY A;  1IRS A;  5J3T A;  1SHC A;  1EVH A;  4YON A;  2P0F A;  2D2Q A;  3FSS A;  3A8Q A;  1ZSQ A;  4ZRK A;  1ZVR A;  2UVM A;  5LON B;  1KI1 B;  1V5U A;  4HAW B;  1V88 A;  1U2B A;  2J59 M;  2ADZ A;  4F7U P;  2CY5 A;  3OAN A;  5KQ1 A; 
#chains in the Genus database with same CATH topology
 2W2X D;  1UPQ A;  1UPR A;  3GYP A;  3P6A A;  2W2X C;  2D10 A;  2ROZ B;  5D3W A;  1WVH A;  2EC1 A;  1ZC4 B;  1WGQ A;  3OHM B;  5D3V A;  1EAZ A;  1XCG A;  2DX5 A;  1GG3 A;  4K2P A;  1V61 A;  2ZPY A;  3FVC A;  1FB8 A;  1TQZ A;  2VRW B;  4HSI A;  5GOW B;  3GYO A;  3A98 B;  2UZS A;  1W1D A;  5J3Q A;  2Z14 A;  2DYN A;  3TW1 A;  3U12 A;  4HHV A;  5HE1 A;  1QC6 A;  4HB3 B;  5FI1 A;  1DDW A;  3PZD A;  5DIF B;  2M38 A;  2I5F A;  4EKU A;  2EMT A;  2K8E A;  1DDV A;  4NSW A;  1U27 A;  1MI1 A;  1X86 A;  2DYQ A;  2DFK A;  4PQ0 A;  1SGH A;  2YVC A;  1GC7 A;  1OQN A;  3D8E A;  1N3H A;  2COA A;  3U8Z A;  4D0N B;  4HDO A;  4A6K A;  2LYD A;  1E5W A;  2LOX A;  5KCV A;  4HB0 B;  4GOU A;  5FI0 A;  5D3X A;  2EMS A;  2I1J A;  3DXE A;  1LB1 A;  2D11 A;  3AU4 A;  4HAV B;  1WGU A;  5C6R A;  1MK9 B;  1P6S A;  2YF0 A;  5EFX A;  1GC6 A;  2YT1 A;  1FAO A;  3KSY A;  5J3Y A;  1BWN A;  2IYB A;  1B55 A;  1U5D A;  2DN6 A;  4DXA B;  4DX9 0;  2FJL A;  1ZYI A;  4MK0 A;  1I7A A;  2LUL A;  1NU2 A;  1J0W A;  2H7E A;  1Y19 B;  2KR0 A;  5D27 A;  5DHF B;  1BTK A;  2Z59 A;  4Z2M B;  2Z0Q A;  5LOP B;  2KIE A;  4HB4 B;  3SO6 A;  2KCJ A;  3DCX A;  1K5D B;  2GJY A;  3CXB B;  2YT0 A;  3ODX A;  3PEG A;  1NTY A;  2Z0P A;  5CLQ B;  2J0M A;  1U29 A;  5C5B A;  2COD A;  1PMS A;  2I1K A;  2VKI A;  5IRS A;  3FEH A;  3A8P A;  1DRO A;  2UZR A;  1KZG A;  2DA0 A;  5JP4 A;  2COF A;  3HQC A;  1XD4 A;  1PLS A;  2DHJ A;  2K2U A;  3LJU X;  3TCA A;  1FOE A;  3SNH A;  5DI9 B;  3DXC A;  2I5C A;  4GPT B;  4IAP A;  3ULC A;  2RVB B;  1Y5O A;  2BCJ A;  1DBH A;  2P0D A;  3ML4 A;  1Z87 A;  1OY2 A;  3ODW A;  4D6W A;  5C5B B;  4IFS A;  4NY0 A;  4A6F A;  3TO1 A;  3PVL A;  4QJ4 B;  2DX1 A;  2RLO A;  2NBV A;  2N23 A;  1FGY A;  1DDM A;  1FHW A;  1AQC A;  3M1I B;  2YT2 A;  2JP2 A;  1XOD A;  4K17 A;  4GXB A;  1XR0 B;  3P7Z A;  1ZM0 A;  1W1G A;  3PSC A;  3O96 A;  1TJ6 A;  4YL8 A;  4OT1 A;  3SYX A;  2OTX A;  1P3R A;  2H7D A;  5DH9 B;  2FJU B;  2CY4 A;  4GZU A;  3KY9 A;  2R09 A;  1MIX A;  4GMX B;  2K2J A;  2Z0O A;  2YS5 A;  2NZ8 B;  2D9W A;  2RSG A;  4KHB A;  2J0K A;  4A6F B;  3ULB A;  1K5G B;  4F7H A;  2YSZ A;  2AL6 A;  1X1G A;  1MPH A;  1EGX A;  1ZC3 B;  2IFS A;  2YS3 A;  2Q13 A;  3PP2 A;  2QKL A;  1BTN A;  3KZ1 A;  4GN1 A;  4BBK A;  2HTH B;  1PFJ A;  4K2O A;  2RNR B;  4ZRJ A;  3TFM A;  1EF1 A;  1FGZ A;  3KRW A;  1UNQ A;  1WJM A;  1RRP B;  3ODO A;  2LKO A;  4P7I A;  3MDB C;  2E2X A;  1X05 A;  2MDX A;  1MK7 B;  1W1H A;  4KHB B;  4ZRI A;  4MY6 A;  4PNK A;  3BJI A;  1UNR A;  2D4Q A;  2COC A;  1UNP A;  4KVG B;  2GUM A;  1V5P A;  4C0A A;  4KHO A;  4TKN A;  1U5G A;  2Z13 A;  1V5M A;  5CLL B;  5DHA B;  3HK0 A;  1U5F A;  2QKM A;  3UZT A;  1M7R A;  1TXD A;  2ELB A;  1RJ2 A;  4HDQ A;  3KRX A;  1T77 A;  4HAU B;  5D3Y A;  3AU5 A;  2GS0 A;  1XX0 A;  4EMO A;  3RCP A;  2AEH A;  2P8V A;  2LOZ A;  3HSA A;  5C79 A;  5JHH A;  3U7D A;  4DBB A;  2ELA A;  2R0D A;  3D8D A;  4OSN A;  2M14 A;  1FHO A;  5JLJ B;  1J19 A;  3TVV A;  3ZVR A;  5HE3 A;  3N7C A;  3AJ4 A;  4A6H A;  2ROV A;  3WA0 A;  3F5R A;  4CHJ A;  2LG1 A;  2HE7 A;  1AWE A;  4WSF A;  2RGN B;  3CIK A;  2XQN M;  4KHA A;  2EJ8 A;  3V5W A;  3PG7 A;  4KAX B;  2CRF A;  1OMW A;  4HB2 B;  2GCJ A;  3QIJ A;  2GCL A;  1BAK A;  2J0J A;  4WVF B;  2D9Z A;  3QBV B;  3VIA A;  4GNK B;  2DTC A;  4L6E A;  1X1F A;  3BIN A;  2L1C A;  1WI1 A;  1DYN A;  2PZ1 A;  3NWA A;  2W2W A;  3ZDT A;  5M4Y B;  3NWD A;  4HAT B;  2MWN B;  5I2S A;  2K00 A;  1KZ7 A;  4K81 A;  4A5K A;  3B77 A;  1XKE A;  1ISN A;  3G9W A;  5C16 A;  4TYZ A;  1UEF A;  2MFQ A;  2Y7B A;  3SV1 A;  2NMB A;  4XWX A;  3MPX A;  1WG7 A;  3NSU A;  1X11 A;  4HAY B;  4L1R A;  2G35 A;  2KIG A;  3FM8 C;  2D9V A;  5HE2 A;  4CYE A;  2DHI A;  2MKR A;  1MKE A;  5JHG A;  3NWF A;  1U5E A;  1Q67 A;  4B6H A;  1QQG A;  2OQB A;  2N0Y A;  1H10 A;  2RRF A;  5L81 A;  5I2M A;  1H4R A;  5LG4 B;  4DIX A;  4GMV A;  3WYF B;  3PVW A;  1P5T A;  1MAI A;  2ZKM X;  4QJ3 B;  2YS1 A;  4WJ7 A;  2V76 A;  2VSZ A;  2CAY A;  3SUZ A;  4IOY X;  2KUP A;  5HE0 A;  3IVF A;  3DXD A;  1V89 A;  3X23 A;  5KQ4 A;  4Y94 A;  2KUQ A;  1NTV A;  2KGX B;  4HAX B;  2D9Y A;  2X18 A;  3VOQ A;  2K49 A;  4Z2N A;  4CHM A;  3QWM A;  1MIZ B;  2DHK A;  4HAZ B;  1WJ1 A;  2Y8G A;  3NW8 A;  3PVU A;  2D9X A;  1I2H A;  2DLW A;  4MT7 A;  4DX8 A;  2R2Y A;  4EJN A;  2DKQ A;  2Y8F A;  2DKP A;  4CSQ A;  3D8F A;  1LW3 A;  4H8S A;  4QXA B;  3F0W A;  3HW2 B;  3T06 A;  4F7G A;  2L2I A;  1FHX A;  1NI2 A;  2RUK B;  1M7E A;  2P0H A;  2YRY A;  3A58 A;  2Z4D A;  1IRS A;  5J3T A;  1SHC A;  1EVH A;  4YON A;  2P0F A;  2D2Q A;  3FSS A;  3A8Q A;  1ZSQ A;  4ZRK A;  1ZVR A;  2UVM A;  4QJ5 B;  5LON B;  1KI1 B;  1V5U A;  4HAW B;  1V88 A;  1U2B A;  2J59 M;  2ADZ A;  4F7U P;  3HIE A;  2CY5 A;  3OAN A;  5KQ1 A; 
#chains in the Genus database with same CATH homology
 2W2X D;  1UPQ A;  1UPR A;  3GYP A;  3P6A A;  2W2X C;  2D10 A;  2ROZ B;  5D3W A;  1WVH A;  2EC1 A;  1ZC4 B;  1WGQ A;  5D3V A;  1EAZ A;  1XCG A;  2DX5 A;  1GG3 A;  4K2P A;  1V61 A;  2ZPY A;  1FB8 A;  1TQZ A;  2VRW B;  5GOW B;  3GYO A;  3A98 B;  2UZS A;  1W1D A;  5J3Q A;  2DYN A;  3TW1 A;  4HHV A;  5HE1 A;  1QC6 A;  4HB3 B;  5FI1 A;  1DDW A;  3PZD A;  5DIF B;  2M38 A;  2I5F A;  4EKU A;  2EMT A;  1DDV A;  4NSW A;  1U27 A;  1X86 A;  2DYQ A;  2DFK A;  4PQ0 A;  1SGH A;  2YVC A;  1GC7 A;  1OQN A;  3D8E A;  1N3H A;  2COA A;  3U8Z A;  4D0N B;  4HDO A;  4A6K A;  2LYD A;  1E5W A;  2LOX A;  5KCV A;  4HB0 B;  5FI0 A;  5D3X A;  2EMS A;  2I1J A;  3DXE A;  1LB1 A;  2D11 A;  3AU4 A;  4HAV B;  1WGU A;  5C6R A;  1MK9 B;  1P6S A;  2YF0 A;  5EFX A;  1GC6 A;  2YT1 A;  1FAO A;  3KSY A;  5J3Y A;  1BWN A;  2IYB A;  1B55 A;  1U5D A;  2DN6 A;  4DXA B;  4DX9 0;  2FJL A;  4MK0 A;  1I7A A;  2LUL A;  1NU2 A;  1J0W A;  2H7E A;  1Y19 B;  5D27 A;  5DHF B;  1BTK A;  4Z2M B;  2Z0Q A;  5LOP B;  4HB4 B;  3SO6 A;  2KCJ A;  1K5D B;  2GJY A;  3CXB B;  2YT0 A;  3ODX A;  3PEG A;  1NTY A;  2Z0P A;  5CLQ B;  2J0M A;  1U29 A;  5C5B A;  2COD A;  1PMS A;  2I1K A;  2VKI A;  3FEH A;  3A8P A;  1DRO A;  2UZR A;  1KZG A;  2DA0 A;  5JP4 A;  2COF A;  3HQC A;  1XD4 A;  1PLS A;  2DHJ A;  2K2U A;  3LJU X;  3TCA A;  1FOE A;  3SNH A;  5DI9 B;  3DXC A;  2I5C A;  4GPT B;  4IAP A;  3ULC A;  2RVB B;  1Y5O A;  2BCJ A;  1DBH A;  2P0D A;  3ML4 A;  1Z87 A;  1OY2 A;  3ODW A;  5C5B B;  4IFS A;  4NY0 A;  4A6F A;  3TO1 A;  3PVL A;  2DX1 A;  2RLO A;  2N23 A;  1FGY A;  1DDM A;  1FHW A;  1AQC A;  3M1I B;  2JP2 A;  1XOD A;  4K17 A;  4GXB A;  1XR0 B;  3P7Z A;  1ZM0 A;  1W1G A;  3PSC A;  3O96 A;  1TJ6 A;  4YL8 A;  3SYX A;  2OTX A;  1P3R A;  2H7D A;  5DH9 B;  2CY4 A;  4GZU A;  3KY9 A;  2R09 A;  1MIX A;  4GMX B;  2K2J A;  2Z0O A;  2YS5 A;  2NZ8 B;  2D9W A;  2RSG A;  4A6F B;  2J0K A;  3ULB A;  1K5G B;  4F7H A;  2YSZ A;  2AL6 A;  1X1G A;  1MPH A;  1EGX A;  1ZC3 B;  2IFS A;  2YS3 A;  2Q13 A;  3PP2 A;  2QKL A;  1BTN A;  3KZ1 A;  4GN1 A;  4BBK A;  2HTH B;  1PFJ A;  4K2O A;  2RNR B;  4ZRJ A;  3TFM A;  1EF1 A;  1FGZ A;  3KRW A;  1UNQ A;  1WJM A;  1RRP B;  3ODO A;  2LKO A;  4P7I A;  3MDB C;  2E2X A;  1X05 A;  2MDX A;  1MK7 B;  1W1H A;  4KHB B;  4ZRI A;  4MY6 A;  4PNK A;  3BJI A;  1UNR A;  2D4Q A;  2COC A;  1UNP A;  4KVG B;  4C0A A;  1V5P A;  4KHO A;  4TKN A;  1U5G A;  1V5M A;  5CLL B;  5DHA B;  3HK0 A;  1U5F A;  2QKM A;  3UZT A;  1M7R A;  1TXD A;  2ELB A;  1RJ2 A;  4HDQ A;  3KRX A;  4HAU B;  5D3Y A;  3AU5 A;  2GS0 A;  1XX0 A;  4EMO A;  3RCP A;  2AEH A;  2P8V A;  2LOZ A;  5C79 A;  5JHH A;  3U7D A;  4DBB A;  2ELA A;  2R0D A;  3D8D A;  2M14 A;  1FHO A;  5JLJ B;  1J19 A;  3TVV A;  3ZVR A;  5HE3 A;  3N7C A;  3AJ4 A;  4A6H A;  2ROV A;  3WA0 A;  3F5R A;  4CHJ A;  2LG1 A;  2HE7 A;  1AWE A;  4WSF A;  2RGN B;  3CIK A;  2XQN M;  4KHA A;  2EJ8 A;  3V5W A;  3PG7 A;  4KAX B;  2CRF A;  1OMW A;  4HB2 B;  2GCJ A;  3QIJ A;  2GCL A;  1BAK A;  2J0J A;  4WVF B;  2D9Z A;  3QBV B;  3VIA A;  2DTC A;  4L6E A;  1X1F A;  3BIN A;  2L1C A;  1WI1 A;  1DYN A;  2PZ1 A;  2W2W A;  3ZDT A;  4HAT B;  2MWN B;  2K00 A;  1KZ7 A;  4K81 A;  4A5K A;  1XKE A;  1ISN A;  3G9W A;  5C16 A;  4TYZ A;  1UEF A;  2MFQ A;  2Y7B A;  3SV1 A;  2NMB A;  4XWX A;  3MPX A;  1WG7 A;  3NSU A;  1X11 A;  4HAY B;  2G35 A;  3FM8 C;  2D9V A;  5HE2 A;  4CYE A;  2DHI A;  2MKR A;  1MKE A;  5JHG A;  1U5E A;  1Q67 A;  4B6H A;  1QQG A;  2OQB A;  2N0Y A;  1H10 A;  5L81 A;  1H4R A;  4GMV A;  3WYF B;  3PVW A;  1P5T A;  1MAI A;  2YS1 A;  4WJ7 A;  2V76 A;  2VSZ A;  2CAY A;  3SUZ A;  4IOY X;  2KUP A;  5HE0 A;  3IVF A;  3DXD A;  1V89 A;  3X23 A;  5KQ4 A;  4Y94 A;  1NTV A;  2KGX B;  4HAX B;  2D9Y A;  2X18 A;  3VOQ A;  4Z2N A;  4CHM A;  3QWM A;  1MIZ B;  2DHK A;  4HAZ B;  1WJ1 A;  2Y8G A;  3PVU A;  2D9X A;  1I2H A;  2DLW A;  4MT7 A;  4DX8 A;  4EJN A;  2DKQ A;  2Y8F A;  2DKP A;  3D8F A;  1LW3 A;  4H8S A;  3F0W A;  3HW2 B;  3T06 A;  4F7G A;  2L2I A;  1FHX A;  1NI2 A;  2RUK B;  1M7E A;  2P0H A;  2YRY A;  1IRS A;  5J3T A;  1SHC A;  1EVH A;  4YON A;  2P0F A;  2D2Q A;  3FSS A;  3A8Q A;  1ZSQ A;  4ZRK A;  1ZVR A;  2UVM A;  5LON B;  1KI1 B;  1V5U A;  4HAW B;  1V88 A;  1U2B A;  2J59 M;  2ADZ A;  4F7U P;  2CY5 A;  3OAN A;  5KQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...