5DH9B

Crystal structure of pki nes flip mutant peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 35
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dh9B00
2R09A 5KCVA 3FM8C 1SGHA 1WGQA 1ZM0A 1U5DA 1J19A 2AL6A 1UNRA 1V89A 2W2WA 1M7EA 2DYQA 3SUZA 1GC7A 1IRSA 5JHHA 5L81A 2P0FA 4ZRKA 2P0HA 3X23A 3MDBC 2MKRA 1OY2A 3TW1A 1FHWA 1B55A 1Y5OA 2HE7A 1NTYA 2DTCA 1XKEA 2DKQA 2Z0OA 5JLJB 3DXEA 2RVBB 3NSUA 5C5BA 1U27A 3TVVA 3ZDTA 1MAIA 4KVGB 1NI2A 4A6HA 4CHMA 4K2OA 2RLOA 1ISNA 5EFXA 2RGNB 1XR0B 3HK0A 2OQBA 1Y19B 2UVMA 3TO1A 1OQNA 1QQGA 4K2PA 1XCGA 2ELBA 1U5FA 4HAWB 1RJ2A 3HQCA 3PSCA 2YF0A 1UNQA 1DBHA 5FI0A 3F0WA 2J59M 5JHGA 2LYDA 2QKMA 2CRFA 4EJNA 1X1GA 3MPXA 5KQ1A 2LKOA 3F5RA 4WVFB 1M7RA 4GZUA 1ZC4B 2BCJA 5J3QA 3ULCA 3D8DA 4HATB 1EVHA 3KY9A 4NY0A 2RNRB 3N7CA 3ODWA 1V5UA 2CAYA 2DKPA 1BAKA 4P7IA 1SHCA 1RRPB 2YRYA 1XD4A 4MK0A 1X86A 5C6RA 3U7DA 3KRWA 4CHJA 2KCJA 2D9WA 1X05A 2GS0A 1NTVA 1FGYA 1E5WA 3P6AA 1J0WA 3AU4A 2GCLA 4DBBA 5GOWB 1MIZB 1TJ6A 4GPTB 1XX0A 4WSFA 2D9XA 5J3YA 1FGZA 4ZRJA 1PLSA 1UPQA 4A6FB 2NMBA 2LOZA 1AWEA 2I5FA 3PG7A 1UPRA 2QKLA 1H10A 2COAA 1ZVRA 2ROVA 2DLWA 1WJMA 2D2QA 1U5GA 1WG7A 3FEHA 1X11A 2VKIA 1DDWA 2EMTA 4F7GA 4HDQA 2MFQA 4TYZA 5LOPB 2D9VA 4PQ0A 4TKNA 2K00A 2KUPA 2X18A 3OANA 1WVHA 2K2JA 5KQ4A 5D3VA 2DHKA 2FJLA 1K5GB 4HAUB 3P7ZA 3TCAA 2XQNM 3SO6A 1V5PA 2L1CA 3ODOA 4A6KA 4GMXB 3DXCA 2ELAA 5HE1A 1KI1B 2EJ8A 2N23A 3AJ4A 4CYEA 2DHIA 1KZGA 1Z87A 2DN6A 1MK7B 4IOYX 2VSZA 2YT0A 1WJ1A 3D8FA 2R0DA 2I1JA 1GC6A 3PEGA 1BWNA 4HB2B 2G35A 3WYFB 2IYBA 1GG3A 3A98B 1EGXA 3FSSA 3PVUA 2DA0A 2MDXA 2IFSA 1DDMA 1U5EA 3BINA 2D11A 4HB3B 4D0NB 1AQCA 2CY4A 5DIFB 3SV1A 4HAXB 4BBKA 3VOQA 4XWXA 1TQZA 5J3TA 2N0YA 3V5WA 1W1HA 5D3XA 1V61A 4F7UP 1QC6A 5HE2A 2Z0PA 5DI9B 1UEFA 5C16A 4ZRIA 3WA0A 1N3HA 4MT7A 4EKUA 2W2XC 1DYNA 3GYOA 4HHVA 4B6HA 2LULA 3SNHA 2W2XD 4WJ7A 1Q67A 3QWMA 5FI1A 2DFKA 2H7DA 4DXAB 1EF1A 2YSZA 1KZ7A 1P3RA 3LJUX 5D3WA 4DX8A 1H4RA 2RUKB 2DX5A 1MPHA 1UNPA 1W1GA 5DHAB 4C0AA 2DYNA 4HB4B 3KZ1A 2CODA 4Y94A 5D3YA 3QBVB 3HW2B 3PVLA 2EC1A 4A5KA 2ADZA 2EMSA 2NZ8B 5C5BB 1I2HA 2GJYA 5D27A 4A6FA 2E2XA 2HTHB 3ULBA 2YS1A 3U8ZA 2D4QA 1BTNA 5LONB 1PMSA 4KHBB 2VRWB 1ZC3B 3QIJA 3AU5A 2Z0QA 1V88A 4KHAA 1P6SA 2P8VA 5HE3A 3GYPA 2Y8GA 5HE0A 2J0MA 4YONA 1FAOA 1U2BA 3ML4A 3T06A 4GN1A 3IVFA 4Z2NA 3ZVRA 1WGUA 2KGXB 4PNKA 2Y8FA 2COCA 3A8QA 4L6EA 4HAYB 4K81A 3VIAA 5DH9B 5DHFB 4EMOA 3M1IB 1FB8A 2D9ZA 1ZSQA 4HAZB 2ROZB 3PP2A 5JP4A 1XODA 4KAXB 4K17A 2PZ1A 4GXBA 1K5DB 4HAVB 2J0JA 1TXDA 2YS5A 4HDOA 4MY6A 3UZTA 2OTXA 2AEHA 2CY5A 1NU2A 2DHJA 2K2UA 5CLLB 2RSGA 3PZDA 3PVWA 5C79A 1FOEA 4DX90 1DROA 1V5MA 1W1DA 2YS3A 2V76A 3CIKA 1I7AA 3D8EA 1PFJA 2YT1A 5CLQB 3SYXA 4YL8A 3A8PA 2J0KA 3ODXA 2JP2A 3O96A 1BTKA 4KHOA 2I5CA 2D9YA 1FHOA 4Z2MB 3DXDA 2LG1A 2P0DA 1EAZA 2UZSA 2UZRA 2MWNB 2COFA 1OMWA 1X1FA 2DX1A 2ZPYA 4F7HA 2Y7BA 2D10A 1LW3A 2Q13A 3CXBB 4IFSA 4NSWA 4HB0B 1U29A 3RCPA 2M14A 4IAPA 2YVCA 1DDVA 2H7EA 3KSYA 2M38A 2L2IA 1LB1A 3BJIA 2GCJA 4GMVA 1FHXA 2I1KA 3TFMA 4H8SA 2LOXA 3G9WA 1MIXA 1P5TA 3KRXA 1MKEA 1MK9B 1WI1A
chains in the Genus database with same CATH superfamily
4GOUA 2R09A 5KCVA 3FM8C 1SGHA 1WGQA 1ZM0A 1U5DA 1J19A 2AL6A 1UNRA 1V89A 2W2WA 1M7EA 2DYQA 3SUZA 1GC7A 5IRSA 1IRSA 5JHHA 5L81A 2P0FA 4ZRKA 2P0HA 3X23A 3MDBC 2MKRA 1OY2A 3TW1A 1FHWA 4QXAB 1B55A 1Y5OA 2HE7A 1NTYA 2DTCA 1XKEA 2DKQA 2Z0OA 5JLJB 3DXEA 2RVBB 3NSUA 5C5BA 1MI1A 1U27A 3NWDA 3TVVA 2Z59A 3ZDTA 1MAIA 3NWAA 4KVGB 1NI2A 4A6HA 4CHMA 4K2OA 4KHBA 2RLOA 1ISNA 5EFXA 2RGNB 2YT2A 1XR0B 3HK0A 2OQBA 1Y19B 2UVMA 3TO1A 1OQNA 1QQGA 4K2PA 1XCGA 2ELBA 4OSNA 1U5FA 4HAWB 1RJ2A 3HQCA 3PSCA 2YF0A 1UNQA 1DBHA 5FI0A 3F0WA 2J59M 3OHMB 5JHGA 2LYDA 4OT1A 4GNKB 2QKMA 2CRFA 4EJNA 2R2YA 1X1GA 3MPXA 5KQ1A 2LKOA 3F5RA 4WVFB 1M7RA 4GZUA 1ZC4B 2BCJA 3HIEA 5J3QA 3ULCA 3D8DA 4HATB 1EVHA 3KY9A 4NY0A 2RNRB 3N7CA 1V5UA 3ODWA 2CAYA 2DKPA 1BAKA 4P7IA 1SHCA 1RRPB 2YRYA 1XD4A 4MK0A 1X86A 5C6RA 3U7DA 3KRWA 4CHJA 2KCJA 2D9WA 1X05A 2GS0A 1NTVA 1FGYA 1E5WA 3P6AA 4QJ4B 1J0WA 3AU4A 2GCLA 4DBBA 5GOWB 1MIZB 1TJ6A 4GPTB 4DIXA 1XX0A 5LG4B 4WSFA 2KIEA 2Z14A 2D9XA 5J3YA 1FGZA 4ZRJA 1PLSA 1UPQA 4A6FB 2NMBA 2LOZA 1AWEA 2I5FA 4D6WA 3PG7A 1UPRA 2QKLA 1H10A 2COAA 1ZVRA 2ROVA 2DLWA 1WJMA 2D2QA 1U5GA 1WG7A 3FEHA 1X11A 2VKIA 1DDWA 4L1RA 2Z13A 2EMTA 4F7GA 4HDQA 2MFQA 4TYZA 4HSIA 5LOPB 2D9VA 4PQ0A 4TKNA 2K00A 2KUPA 2X18A 3OANA 1WVHA 2K2JA 5KQ4A 5D3VA 2DHKA 2FJLA 1K5GB 4HAUB 3P7ZA 3TCAA 2XQNM 3SO6A 1V5PA 2L1CA 3ODOA 4A6KA 4GMXB 3DXCA 2ELAA 5HE1A 1KI1B 2RRFA 2EJ8A 2N23A 3AJ4A 4CYEA 2DHIA 1KZGA 1Z87A 2DN6A 1MK7B 4IOYX 3U12A 2VSZA 2YT0A 3FVCA 1WJ1A 3D8FA 2R0DA 2I1JA 1GC6A 2Z4DA 3PEGA 1BWNA 4HB2B 2G35A 3WYFB 2IYBA 1GG3A 3A98B 1EGXA 3FSSA 3PVUA 2DA0A 2MDXA 2IFSA 1DDMA 1U5EA 3BINA 2D11A 4HB3B 4D0NB 1AQCA 2CY4A 5DIFB 3SV1A 4HAXB 4BBKA 3VOQA 4XWXA 1TQZA 5J3TA 2N0YA 3V5WA 1W1HA 5D3XA 1V61A 4F7UP 1QC6A 5HE2A 2FJUB 2Z0PA 5DI9B 1UEFA 5C16A 4ZRIA 3WA0A 1N3HA 4MT7A 4EKUA 2W2XC 5M4YB 1DYNA 3GYOA 2KUQA 4HHVA 4B6HA 2LULA 2K8EA 3SNHA 2W2XD 4WJ7A 1Q67A 3QWMA 5FI1A 2DFKA 2H7DA 4DXAB 1EF1A 2YSZA 1KZ7A 2KIGA 1P3RA 3LJUX 2GUMA 5D3WA 1H4RA 2RUKB 4DX8A 2DX5A 1MPHA 1UNPA 1W1GA 4QJ3B 5DHAB 4C0AA 2DYNA 4HB4B 3KZ1A 2CODA 4Y94A 5D3YA 3QBVB 3HW2B 3PVLA 2EC1A 4A5KA 2NBVA 2ADZA 2EMSA 2NZ8B 5C5BB 5I2SA 1I2HA 2GJYA 5D27A 4A6FA 2E2XA 2HTHB 3ULBA 2YS1A 3U8ZA 2D4QA 1BTNA 5LONB 1PMSA 4KHBB 2VRWB 5I2MA 1ZC3B 3QIJA 3AU5A 2Z0QA 1V88A 4KHAA 1P6SA 2P8VA 5HE3A 3GYPA 2Y8GA 5HE0A 3NWFA 2KR0A 2J0MA 4YONA 1FAOA 1U2BA 3ML4A 3T06A 4GN1A 3IVFA 4QJ5B 4Z2NA 3ZVRA 1WGUA 2KGXB 4PNKA 2Y8FA 2COCA 3A8QA 4L6EA 4HAYB 4K81A 3VIAA 2K49A 5DH9B 5DHFB 4EMOA 3M1IB 1FB8A 2D9ZA 1ZSQA 4HAZB 2ROZB 3PP2A 5JP4A 1XODA 4KAXB 4K17A 2PZ1A 4GXBA 3DCXA 1K5DB 4HAVB 2J0JA 1TXDA 2YS5A 4HDOA 4MY6A 1ZYIA 3UZTA 2OTXA 2AEHA 2CY5A 1NU2A 2DHJA 2K2UA 5CLLB 2RSGA 3PZDA 3PVWA 5C79A 1FOEA 4DX90 1DROA 1V5MA 1W1DA 2YS3A 2V76A 3CIKA 1I7AA 3D8EA 1PFJA 2YT1A 3HSAA 5CLQB 3SYXA 4YL8A 3A8PA 2J0KA 3NW8A 3ODXA 2JP2A 3O96A 1BTKA 4KHOA 2I5CA 2D9YA 1FHOA 4Z2MB 3DXDA 2LG1A 2P0DA 1EAZA 2UZSA 2UZRA 3B77A 2MWNB 2COFA 1OMWA 1X1FA 2DX1A 2ZPYA 4F7HA 2Y7BA 2D10A 1LW3A 2Q13A 3CXBB 4IFSA 4NSWA 4HB0B 1U29A 3RCPA 2M14A 4IAPA 2YVCA 1DDVA 2H7EA 2ZKMX 3KSYA 2M38A 2L2IA 3A58A 1LB1A 3BJIA 2GCJA 4GMVA 1FHXA 2I1KA 3TFMA 4H8SA 1T77A 2LOXA 4CSQA 3G9WA 1MIXA 1P5TA 3KRXA 1MKEA 1MK9B 1WI1A
chains in the Genus database with same CATH topology
2R09A 5KCVA 3FM8C 1SGHA 1WGQA 1ZM0A 1U5DA 1J19A 2AL6A 1UNRA 1V89A 2W2WA 1M7EA 2DYQA 3SUZA 1GC7A 1IRSA 5JHHA 5L81A 2P0FA 4ZRKA 2P0HA 3X23A 3MDBC 2MKRA 1OY2A 3TW1A 1FHWA 1B55A 1Y5OA 2HE7A 1NTYA 2DTCA 1XKEA 2DKQA 2Z0OA 5JLJB 3DXEA 2RVBB 3NSUA 5C5BA 1U27A 3TVVA 3ZDTA 1MAIA 4KVGB 1NI2A 4A6HA 4CHMA 4K2OA 2RLOA 1ISNA 5EFXA 2RGNB 1XR0B 3HK0A 2OQBA 1Y19B 2UVMA 3TO1A 1OQNA 1QQGA 4K2PA 1XCGA 2ELBA 1U5FA 4HAWB 1RJ2A 3HQCA 3PSCA 2YF0A 1UNQA 1DBHA 5FI0A 3F0WA 2J59M 5JHGA 2LYDA 2QKMA 2CRFA 4EJNA 1X1GA 3MPXA 5KQ1A 2LKOA 3F5RA 4WVFB 1M7RA 4GZUA 1ZC4B 2BCJA 5J3QA 3ULCA 3D8DA 4HATB 1EVHA 3KY9A 4NY0A 2RNRB 3N7CA 3ODWA 1V5UA 2CAYA 2DKPA 1BAKA 4P7IA 1SHCA 1RRPB 2YRYA 1XD4A 4MK0A 1X86A 5C6RA 3U7DA 3KRWA 4CHJA 2KCJA 2D9WA 1X05A 2GS0A 1NTVA 1FGYA 1E5WA 3P6AA 1J0WA 3AU4A 2GCLA 4DBBA 5GOWB 1MIZB 1TJ6A 4GPTB 1XX0A 4WSFA 2D9XA 5J3YA 1FGZA 4ZRJA 1PLSA 1UPQA 4A6FB 2NMBA 2LOZA 1AWEA 2I5FA 3PG7A 1UPRA 2QKLA 1H10A 2COAA 1ZVRA 2ROVA 2DLWA 1WJMA 2D2QA 1U5GA 1WG7A 3FEHA 1X11A 2VKIA 1DDWA 2EMTA 4F7GA 4HDQA 2MFQA 4TYZA 5LOPB 2D9VA 4PQ0A 4TKNA 2K00A 2KUPA 2X18A 3OANA 1WVHA 2K2JA 5KQ4A 5D3VA 2DHKA 2FJLA 1K5GB 4HAUB 3P7ZA 3TCAA 2XQNM 3SO6A 1V5PA 2L1CA 3ODOA 4A6KA 4GMXB 3DXCA 2ELAA 5HE1A 1KI1B 2EJ8A 2N23A 3AJ4A 4CYEA 2DHIA 1KZGA 1Z87A 2DN6A 1MK7B 4IOYX 2VSZA 2YT0A 1WJ1A 3D8FA 2R0DA 2I1JA 1GC6A 3PEGA 1BWNA 4HB2B 2G35A 3WYFB 2IYBA 1GG3A 3A98B 1EGXA 3FSSA 3PVUA 2DA0A 2MDXA 2IFSA 1DDMA 1U5EA 3BINA 2D11A 4HB3B 4D0NB 1AQCA 2CY4A 5DIFB 3SV1A 4HAXB 4BBKA 3VOQA 4XWXA 1TQZA 5J3TA 2N0YA 3V5WA 1W1HA 5D3XA 1V61A 4F7UP 1QC6A 5HE2A 2Z0PA 5DI9B 1UEFA 5C16A 4ZRIA 3WA0A 1N3HA 4MT7A 4EKUA 2W2XC 1DYNA 3GYOA 4HHVA 4B6HA 2LULA 3SNHA 2W2XD 4WJ7A 1Q67A 3QWMA 5FI1A 2DFKA 2H7DA 4DXAB 1EF1A 2YSZA 1KZ7A 1P3RA 3LJUX 5D3WA 4DX8A 1H4RA 2RUKB 2DX5A 1MPHA 1UNPA 1W1GA 5DHAB 4C0AA 2DYNA 4HB4B 3KZ1A 2CODA 4Y94A 5D3YA 3QBVB 3HW2B 3PVLA 2EC1A 4A5KA 2ADZA 2EMSA 2NZ8B 5C5BB 1I2HA 2GJYA 5D27A 4A6FA 2E2XA 2HTHB 3ULBA 2YS1A 3U8ZA 2D4QA 1BTNA 5LONB 1PMSA 4KHBB 2VRWB 1ZC3B 3QIJA 3AU5A 2Z0QA 1V88A 4KHAA 1P6SA 2P8VA 5HE3A 3GYPA 2Y8GA 5HE0A 2J0MA 4YONA 1FAOA 1U2BA 3ML4A 3T06A 4GN1A 3IVFA 4Z2NA 3ZVRA 1WGUA 2KGXB 4PNKA 2Y8FA 2COCA 3A8QA 4L6EA 4HAYB 4K81A 3VIAA 5DH9B 5DHFB 4EMOA 3M1IB 1FB8A 2D9ZA 1ZSQA 4HAZB 2ROZB 3PP2A 5JP4A 1XODA 4KAXB 4K17A 2PZ1A 4GXBA 1K5DB 4HAVB 2J0JA 1TXDA 2YS5A 4HDOA 4MY6A 3UZTA 2OTXA 2AEHA 2CY5A 1NU2A 2DHJA 2K2UA 5CLLB 2RSGA 3PZDA 3PVWA 5C79A 1FOEA 4DX90 1DROA 1V5MA 1W1DA 2YS3A 2V76A 3CIKA 1I7AA 3D8EA 1PFJA 2YT1A 5CLQB 3SYXA 4YL8A 3A8PA 2J0KA 3ODXA 2JP2A 3O96A 1BTKA 4KHOA 2I5CA 2D9YA 1FHOA 4Z2MB 3DXDA 2LG1A 2P0DA 1EAZA 2UZSA 2UZRA 2MWNB 2COFA 1OMWA 1X1FA 2DX1A 2ZPYA 4F7HA 2Y7BA 2D10A 1LW3A 2Q13A 3CXBB 4IFSA 4NSWA 4HB0B 1U29A 3RCPA 2M14A 4IAPA 2YVCA 1DDVA 2H7EA 3KSYA 2M38A 2L2IA 1LB1A 3BJIA 2GCJA 4GMVA 1FHXA 2I1KA 3TFMA 4H8SA 2LOXA 3G9WA 1MIXA 1P5TA 3KRXA 1MKEA 1MK9B 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R09 A;  5KCV A;  3FM8 C;  1SGH A;  1WGQ A;  1ZM0 A;  1U5D A;  1J19 A;  2AL6 A;  1UNR A;  1V89 A;  2W2W A;  1M7E A;  2DYQ A;  3SUZ A;  1GC7 A;  1IRS A;  5JHH A;  5L81 A;  2P0F A;  4ZRK A;  2P0H A;  3X23 A;  3MDB C;  2MKR A;  1OY2 A;  3TW1 A;  1FHW A;  1B55 A;  1Y5O A;  2HE7 A;  1NTY A;  2DTC A;  1XKE A;  2DKQ A;  2Z0O A;  5JLJ B;  3DXE A;  2RVB B;  3NSU A;  5C5B A;  1U27 A;  3TVV A;  3ZDT A;  1MAI A;  4KVG B;  1NI2 A;  4A6H A;  4CHM A;  4K2O A;  2RLO A;  1ISN A;  5EFX A;  2RGN B;  1XR0 B;  3HK0 A;  2OQB A;  1Y19 B;  2UVM A;  3TO1 A;  1OQN A;  1QQG A;  4K2P A;  1XCG A;  2ELB A;  1U5F A;  4HAW B;  1RJ2 A;  3HQC A;  3PSC A;  2YF0 A;  1UNQ A;  1DBH A;  5FI0 A;  3F0W A;  2J59 M;  5JHG A;  2LYD A;  2QKM A;  2CRF A;  4EJN A;  1X1G A;  3MPX A;  5KQ1 A;  2LKO A;  3F5R A;  4WVF B;  1M7R A;  4GZU A;  1ZC4 B;  2BCJ A;  5J3Q A;  3ULC A;  3D8D A;  4HAT B;  1EVH A;  3KY9 A;  4NY0 A;  2RNR B;  3N7C A;  3ODW A;  1V5U A;  2CAY A;  2DKP A;  1BAK A;  4P7I A;  1SHC A;  1RRP B;  2YRY A;  1XD4 A;  4MK0 A;  1X86 A;  5C6R A;  3U7D A;  3KRW A;  4CHJ A;  2KCJ A;  2D9W A;  1X05 A;  2GS0 A;  1NTV A;  1FGY A;  1E5W A;  3P6A A;  1J0W A;  3AU4 A;  2GCL A;  4DBB A;  5GOW B;  1MIZ B;  1TJ6 A;  4GPT B;  1XX0 A;  4WSF A;  2D9X A;  5J3Y A;  1FGZ A;  4ZRJ A;  1PLS A;  1UPQ A;  4A6F B;  2NMB A;  2LOZ A;  1AWE A;  2I5F A;  3PG7 A;  1UPR A;  2QKL A;  1H10 A;  2COA A;  1ZVR A;  2ROV A;  2DLW A;  1WJM A;  2D2Q A;  1U5G A;  1WG7 A;  3FEH A;  1X11 A;  2VKI A;  1DDW A;  2EMT A;  4F7G A;  4HDQ A;  2MFQ A;  4TYZ A;  5LOP B;  2D9V A;  4PQ0 A;  4TKN A;  2K00 A;  2KUP A;  2X18 A;  3OAN A;  1WVH A;  2K2J A;  5KQ4 A;  5D3V A;  2DHK A;  2FJL A;  1K5G B;  4HAU B;  3P7Z A;  3TCA A;  2XQN M;  3SO6 A;  1V5P A;  2L1C A;  3ODO A;  4A6K A;  4GMX B;  3DXC A;  2ELA A;  5HE1 A;  1KI1 B;  2EJ8 A;  2N23 A;  3AJ4 A;  4CYE A;  2DHI A;  1KZG A;  1Z87 A;  2DN6 A;  1MK7 B;  4IOY X;  2VSZ A;  2YT0 A;  1WJ1 A;  3D8F A;  2R0D A;  2I1J A;  1GC6 A;  3PEG A;  1BWN A;  4HB2 B;  2G35 A;  3WYF B;  2IYB A;  1GG3 A;  3A98 B;  1EGX A;  3FSS A;  3PVU A;  2DA0 A;  2MDX A;  2IFS A;  1DDM A;  1U5E A;  3BIN A;  2D11 A;  4HB3 B;  4D0N B;  1AQC A;  2CY4 A;  5DIF B;  3SV1 A;  4HAX B;  4BBK A;  3VOQ A;  4XWX A;  1TQZ A;  5J3T A;  2N0Y A;  3V5W A;  1W1H A;  5D3X A;  1V61 A;  4F7U P;  1QC6 A;  5HE2 A;  2Z0P A;  5DI9 B;  1UEF A;  5C16 A;  4ZRI A;  3WA0 A;  1N3H A;  4MT7 A;  4EKU A;  2W2X C;  1DYN A;  3GYO A;  4HHV A;  4B6H A;  2LUL A;  3SNH A;  2W2X D;  4WJ7 A;  1Q67 A;  3QWM A;  5FI1 A;  2DFK A;  2H7D A;  4DXA B;  1EF1 A;  2YSZ A;  1KZ7 A;  1P3R A;  3LJU X;  5D3W A;  4DX8 A;  1H4R A;  2RUK B;  2DX5 A;  1MPH A;  1UNP A;  1W1G A;  5DHA B;  4C0A A;  2DYN A;  4HB4 B;  3KZ1 A;  2COD A;  4Y94 A;  5D3Y A;  3QBV B;  3HW2 B;  3PVL A;  2EC1 A;  4A5K A;  2ADZ A;  2EMS A;  2NZ8 B;  5C5B B;  1I2H A;  2GJY A;  5D27 A;  4A6F A;  2E2X A;  2HTH B;  3ULB A;  2YS1 A;  3U8Z A;  2D4Q A;  1BTN A;  5LON B;  1PMS A;  4KHB B;  2VRW B;  1ZC3 B;  3QIJ A;  3AU5 A;  2Z0Q A;  1V88 A;  4KHA A;  1P6S A;  2P8V A;  5HE3 A;  3GYP A;  2Y8G A;  5HE0 A;  2J0M A;  4YON A;  1FAO A;  1U2B A;  3ML4 A;  3T06 A;  4GN1 A;  3IVF A;  4Z2N A;  3ZVR A;  1WGU A;  2KGX B;  4PNK A;  2Y8F A;  2COC A;  3A8Q A;  4L6E A;  4HAY B;  4K81 A;  3VIA A;  5DH9 B;  5DHF B;  4EMO A;  3M1I B;  1FB8 A;  2D9Z A;  1ZSQ A;  4HAZ B;  2ROZ B;  3PP2 A;  5JP4 A;  1XOD A;  4KAX B;  4K17 A;  2PZ1 A;  4GXB A;  1K5D B;  4HAV B;  2J0J A;  1TXD A;  2YS5 A;  4HDO A;  4MY6 A;  3UZT A;  2OTX A;  2AEH A;  2CY5 A;  1NU2 A;  2DHJ A;  2K2U A;  5CLL B;  2RSG A;  3PZD A;  3PVW A;  5C79 A;  1FOE A;  4DX9 0;  1DRO A;  1V5M A;  1W1D A;  2YS3 A;  2V76 A;  3CIK A;  1I7A A;  3D8E A;  1PFJ A;  2YT1 A;  5CLQ B;  3SYX A;  4YL8 A;  3A8P A;  2J0K A;  3ODX A;  2JP2 A;  3O96 A;  1BTK A;  4KHO A;  2I5C A;  2D9Y A;  1FHO A;  4Z2M B;  3DXD A;  2LG1 A;  2P0D A;  1EAZ A;  2UZS A;  2UZR A;  2MWN B;  2COF A;  1OMW A;  1X1F A;  2DX1 A;  2ZPY A;  4F7H A;  2Y7B A;  2D10 A;  1LW3 A;  2Q13 A;  3CXB B;  4IFS A;  4NSW A;  4HB0 B;  1U29 A;  3RCP A;  2M14 A;  4IAP A;  2YVC A;  1DDV A;  2H7E A;  3KSY A;  2M38 A;  2L2I A;  1LB1 A;  3BJI A;  2GCJ A;  4GMV A;  1FHX A;  2I1K A;  3TFM A;  4H8S A;  2LOX A;  3G9W A;  1MIX A;  1P5T A;  3KRX A;  1MKE A;  1MK9 B;  1WI1 A; 
#chains in the Genus database with same CATH topology
 4GOU A;  2R09 A;  5KCV A;  3FM8 C;  1SGH A;  1WGQ A;  1ZM0 A;  1U5D A;  1J19 A;  2AL6 A;  1UNR A;  1V89 A;  2W2W A;  1M7E A;  2DYQ A;  3SUZ A;  1GC7 A;  5IRS A;  1IRS A;  5JHH A;  5L81 A;  2P0F A;  4ZRK A;  2P0H A;  3X23 A;  3MDB C;  2MKR A;  1OY2 A;  3TW1 A;  1FHW A;  4QXA B;  1B55 A;  1Y5O A;  2HE7 A;  1NTY A;  2DTC A;  1XKE A;  2DKQ A;  2Z0O A;  5JLJ B;  3DXE A;  2RVB B;  3NSU A;  5C5B A;  1MI1 A;  1U27 A;  3NWD A;  3TVV A;  2Z59 A;  3ZDT A;  1MAI A;  3NWA A;  4KVG B;  1NI2 A;  4A6H A;  4CHM A;  4K2O A;  4KHB A;  2RLO A;  1ISN A;  5EFX A;  2RGN B;  2YT2 A;  1XR0 B;  3HK0 A;  2OQB A;  1Y19 B;  2UVM A;  3TO1 A;  1OQN A;  1QQG A;  4K2P A;  1XCG A;  2ELB A;  4OSN A;  1U5F A;  4HAW B;  1RJ2 A;  3HQC A;  3PSC A;  2YF0 A;  1UNQ A;  1DBH A;  5FI0 A;  3F0W A;  2J59 M;  3OHM B;  5JHG A;  2LYD A;  4OT1 A;  4GNK B;  2QKM A;  2CRF A;  4EJN A;  2R2Y A;  1X1G A;  3MPX A;  5KQ1 A;  2LKO A;  3F5R A;  4WVF B;  1M7R A;  4GZU A;  1ZC4 B;  2BCJ A;  3HIE A;  5J3Q A;  3ULC A;  3D8D A;  4HAT B;  1EVH A;  3KY9 A;  4NY0 A;  2RNR B;  3N7C A;  1V5U A;  3ODW A;  2CAY A;  2DKP A;  1BAK A;  4P7I A;  1SHC A;  1RRP B;  2YRY A;  1XD4 A;  4MK0 A;  1X86 A;  5C6R A;  3U7D A;  3KRW A;  4CHJ A;  2KCJ A;  2D9W A;  1X05 A;  2GS0 A;  1NTV A;  1FGY A;  1E5W A;  3P6A A;  4QJ4 B;  1J0W A;  3AU4 A;  2GCL A;  4DBB A;  5GOW B;  1MIZ B;  1TJ6 A;  4GPT B;  4DIX A;  1XX0 A;  5LG4 B;  4WSF A;  2KIE A;  2Z14 A;  2D9X A;  5J3Y A;  1FGZ A;  4ZRJ A;  1PLS A;  1UPQ A;  4A6F B;  2NMB A;  2LOZ A;  1AWE A;  2I5F A;  4D6W A;  3PG7 A;  1UPR A;  2QKL A;  1H10 A;  2COA A;  1ZVR A;  2ROV A;  2DLW A;  1WJM A;  2D2Q A;  1U5G A;  1WG7 A;  3FEH A;  1X11 A;  2VKI A;  1DDW A;  4L1R A;  2Z13 A;  2EMT A;  4F7G A;  4HDQ A;  2MFQ A;  4TYZ A;  4HSI A;  5LOP B;  2D9V A;  4PQ0 A;  4TKN A;  2K00 A;  2KUP A;  2X18 A;  3OAN A;  1WVH A;  2K2J A;  5KQ4 A;  5D3V A;  2DHK A;  2FJL A;  1K5G B;  4HAU B;  3P7Z A;  3TCA A;  2XQN M;  3SO6 A;  1V5P A;  2L1C A;  3ODO A;  4A6K A;  4GMX B;  3DXC A;  2ELA A;  5HE1 A;  1KI1 B;  2RRF A;  2EJ8 A;  2N23 A;  3AJ4 A;  4CYE A;  2DHI A;  1KZG A;  1Z87 A;  2DN6 A;  1MK7 B;  4IOY X;  3U12 A;  2VSZ A;  2YT0 A;  3FVC A;  1WJ1 A;  3D8F A;  2R0D A;  2I1J A;  1GC6 A;  2Z4D A;  3PEG A;  1BWN A;  4HB2 B;  2G35 A;  3WYF B;  2IYB A;  1GG3 A;  3A98 B;  1EGX A;  3FSS A;  3PVU A;  2DA0 A;  2MDX A;  2IFS A;  1DDM A;  1U5E A;  3BIN A;  2D11 A;  4HB3 B;  4D0N B;  1AQC A;  2CY4 A;  5DIF B;  3SV1 A;  4HAX B;  4BBK A;  3VOQ A;  4XWX A;  1TQZ A;  5J3T A;  2N0Y A;  3V5W A;  1W1H A;  5D3X A;  1V61 A;  4F7U P;  1QC6 A;  5HE2 A;  2FJU B;  2Z0P A;  5DI9 B;  1UEF A;  5C16 A;  4ZRI A;  3WA0 A;  1N3H A;  4MT7 A;  4EKU A;  2W2X C;  5M4Y B;  1DYN A;  3GYO A;  2KUQ A;  4HHV A;  4B6H A;  2LUL A;  2K8E A;  3SNH A;  2W2X D;  4WJ7 A;  1Q67 A;  3QWM A;  5FI1 A;  2DFK A;  2H7D A;  4DXA B;  1EF1 A;  2YSZ A;  1KZ7 A;  2KIG A;  1P3R A;  3LJU X;  2GUM A;  5D3W A;  1H4R A;  2RUK B;  4DX8 A;  2DX5 A;  1MPH A;  1UNP A;  1W1G A;  4QJ3 B;  5DHA B;  4C0A A;  2DYN A;  4HB4 B;  3KZ1 A;  2COD A;  4Y94 A;  5D3Y A;  3QBV B;  3HW2 B;  3PVL A;  2EC1 A;  4A5K A;  2NBV A;  2ADZ A;  2EMS A;  2NZ8 B;  5C5B B;  5I2S A;  1I2H A;  2GJY A;  5D27 A;  4A6F A;  2E2X A;  2HTH B;  3ULB A;  2YS1 A;  3U8Z A;  2D4Q A;  1BTN A;  5LON B;  1PMS A;  4KHB B;  2VRW B;  5I2M A;  1ZC3 B;  3QIJ A;  3AU5 A;  2Z0Q A;  1V88 A;  4KHA A;  1P6S A;  2P8V A;  5HE3 A;  3GYP A;  2Y8G A;  5HE0 A;  3NWF A;  2KR0 A;  2J0M A;  4YON A;  1FAO A;  1U2B A;  3ML4 A;  3T06 A;  4GN1 A;  3IVF A;  4QJ5 B;  4Z2N A;  3ZVR A;  1WGU A;  2KGX B;  4PNK A;  2Y8F A;  2COC A;  3A8Q A;  4L6E A;  4HAY B;  4K81 A;  3VIA A;  2K49 A;  5DH9 B;  5DHF B;  4EMO A;  3M1I B;  1FB8 A;  2D9Z A;  1ZSQ A;  4HAZ B;  2ROZ B;  3PP2 A;  5JP4 A;  1XOD A;  4KAX B;  4K17 A;  2PZ1 A;  4GXB A;  3DCX A;  1K5D B;  4HAV B;  2J0J A;  1TXD A;  2YS5 A;  4HDO A;  4MY6 A;  1ZYI A;  3UZT A;  2OTX A;  2AEH A;  2CY5 A;  1NU2 A;  2DHJ A;  2K2U A;  5CLL B;  2RSG A;  3PZD A;  3PVW A;  5C79 A;  1FOE A;  4DX9 0;  1DRO A;  1V5M A;  1W1D A;  2YS3 A;  2V76 A;  3CIK A;  1I7A A;  3D8E A;  1PFJ A;  2YT1 A;  3HSA A;  5CLQ B;  3SYX A;  4YL8 A;  3A8P A;  2J0K A;  3NW8 A;  3ODX A;  2JP2 A;  3O96 A;  1BTK A;  4KHO A;  2I5C A;  2D9Y A;  1FHO A;  4Z2M B;  3DXD A;  2LG1 A;  2P0D A;  1EAZ A;  2UZS A;  2UZR A;  3B77 A;  2MWN B;  2COF A;  1OMW A;  1X1F A;  2DX1 A;  2ZPY A;  4F7H A;  2Y7B A;  2D10 A;  1LW3 A;  2Q13 A;  3CXB B;  4IFS A;  4NSW A;  4HB0 B;  1U29 A;  3RCP A;  2M14 A;  4IAP A;  2YVC A;  1DDV A;  2H7E A;  2ZKM X;  3KSY A;  2M38 A;  2L2I A;  3A58 A;  1LB1 A;  3BJI A;  2GCJ A;  4GMV A;  1FHX A;  2I1K A;  3TFM A;  4H8S A;  1T77 A;  2LOX A;  4CSQ A;  3G9W A;  1MIX A;  1P5T A;  3KRX A;  1MKE A;  1MK9 B;  1WI1 A; 
#chains in the Genus database with same CATH homology
 2R09 A;  5KCV A;  3FM8 C;  1SGH A;  1WGQ A;  1ZM0 A;  1U5D A;  1J19 A;  2AL6 A;  1UNR A;  1V89 A;  2W2W A;  1M7E A;  2DYQ A;  3SUZ A;  1GC7 A;  1IRS A;  5JHH A;  5L81 A;  2P0F A;  4ZRK A;  2P0H A;  3X23 A;  3MDB C;  2MKR A;  1OY2 A;  3TW1 A;  1FHW A;  1B55 A;  1Y5O A;  2HE7 A;  1NTY A;  2DTC A;  1XKE A;  2DKQ A;  2Z0O A;  5JLJ B;  3DXE A;  2RVB B;  3NSU A;  5C5B A;  1U27 A;  3TVV A;  3ZDT A;  1MAI A;  4KVG B;  1NI2 A;  4A6H A;  4CHM A;  4K2O A;  2RLO A;  1ISN A;  5EFX A;  2RGN B;  1XR0 B;  3HK0 A;  2OQB A;  1Y19 B;  2UVM A;  3TO1 A;  1OQN A;  1QQG A;  4K2P A;  1XCG A;  2ELB A;  1U5F A;  4HAW B;  1RJ2 A;  3HQC A;  3PSC A;  2YF0 A;  1UNQ A;  1DBH A;  5FI0 A;  3F0W A;  2J59 M;  5JHG A;  2LYD A;  2QKM A;  2CRF A;  4EJN A;  1X1G A;  3MPX A;  5KQ1 A;  2LKO A;  3F5R A;  4WVF B;  1M7R A;  4GZU A;  1ZC4 B;  2BCJ A;  5J3Q A;  3ULC A;  3D8D A;  4HAT B;  1EVH A;  3KY9 A;  4NY0 A;  2RNR B;  3N7C A;  3ODW A;  1V5U A;  2CAY A;  2DKP A;  1BAK A;  4P7I A;  1SHC A;  1RRP B;  2YRY A;  1XD4 A;  4MK0 A;  1X86 A;  5C6R A;  3U7D A;  3KRW A;  4CHJ A;  2KCJ A;  2D9W A;  1X05 A;  2GS0 A;  1NTV A;  1FGY A;  1E5W A;  3P6A A;  1J0W A;  3AU4 A;  2GCL A;  4DBB A;  5GOW B;  1MIZ B;  1TJ6 A;  4GPT B;  1XX0 A;  4WSF A;  2D9X A;  5J3Y A;  1FGZ A;  4ZRJ A;  1PLS A;  1UPQ A;  4A6F B;  2NMB A;  2LOZ A;  1AWE A;  2I5F A;  3PG7 A;  1UPR A;  2QKL A;  1H10 A;  2COA A;  1ZVR A;  2ROV A;  2DLW A;  1WJM A;  2D2Q A;  1U5G A;  1WG7 A;  3FEH A;  1X11 A;  2VKI A;  1DDW A;  2EMT A;  4F7G A;  4HDQ A;  2MFQ A;  4TYZ A;  5LOP B;  2D9V A;  4PQ0 A;  4TKN A;  2K00 A;  2KUP A;  2X18 A;  3OAN A;  1WVH A;  2K2J A;  5KQ4 A;  5D3V A;  2DHK A;  2FJL A;  1K5G B;  4HAU B;  3P7Z A;  3TCA A;  2XQN M;  3SO6 A;  1V5P A;  2L1C A;  3ODO A;  4A6K A;  4GMX B;  3DXC A;  2ELA A;  5HE1 A;  1KI1 B;  2EJ8 A;  2N23 A;  3AJ4 A;  4CYE A;  2DHI A;  1KZG A;  1Z87 A;  2DN6 A;  1MK7 B;  4IOY X;  2VSZ A;  2YT0 A;  1WJ1 A;  3D8F A;  2R0D A;  2I1J A;  1GC6 A;  3PEG A;  1BWN A;  4HB2 B;  2G35 A;  3WYF B;  2IYB A;  1GG3 A;  3A98 B;  1EGX A;  3FSS A;  3PVU A;  2DA0 A;  2MDX A;  2IFS A;  1DDM A;  1U5E A;  3BIN A;  2D11 A;  4HB3 B;  4D0N B;  1AQC A;  2CY4 A;  5DIF B;  3SV1 A;  4HAX B;  4BBK A;  3VOQ A;  4XWX A;  1TQZ A;  5J3T A;  2N0Y A;  3V5W A;  1W1H A;  5D3X A;  1V61 A;  4F7U P;  1QC6 A;  5HE2 A;  2Z0P A;  5DI9 B;  1UEF A;  5C16 A;  4ZRI A;  3WA0 A;  1N3H A;  4MT7 A;  4EKU A;  2W2X C;  1DYN A;  3GYO A;  4HHV A;  4B6H A;  2LUL A;  3SNH A;  2W2X D;  4WJ7 A;  1Q67 A;  3QWM A;  5FI1 A;  2DFK A;  2H7D A;  4DXA B;  1EF1 A;  2YSZ A;  1KZ7 A;  1P3R A;  3LJU X;  5D3W A;  4DX8 A;  1H4R A;  2RUK B;  2DX5 A;  1MPH A;  1UNP A;  1W1G A;  5DHA B;  4C0A A;  2DYN A;  4HB4 B;  3KZ1 A;  2COD A;  4Y94 A;  5D3Y A;  3QBV B;  3HW2 B;  3PVL A;  2EC1 A;  4A5K A;  2ADZ A;  2EMS A;  2NZ8 B;  5C5B B;  1I2H A;  2GJY A;  5D27 A;  4A6F A;  2E2X A;  2HTH B;  3ULB A;  2YS1 A;  3U8Z A;  2D4Q A;  1BTN A;  5LON B;  1PMS A;  4KHB B;  2VRW B;  1ZC3 B;  3QIJ A;  3AU5 A;  2Z0Q A;  1V88 A;  4KHA A;  1P6S A;  2P8V A;  5HE3 A;  3GYP A;  2Y8G A;  5HE0 A;  2J0M A;  4YON A;  1FAO A;  1U2B A;  3ML4 A;  3T06 A;  4GN1 A;  3IVF A;  4Z2N A;  3ZVR A;  1WGU A;  2KGX B;  4PNK A;  2Y8F A;  2COC A;  3A8Q A;  4L6E A;  4HAY B;  4K81 A;  3VIA A;  5DH9 B;  5DHF B;  4EMO A;  3M1I B;  1FB8 A;  2D9Z A;  1ZSQ A;  4HAZ B;  2ROZ B;  3PP2 A;  5JP4 A;  1XOD A;  4KAX B;  4K17 A;  2PZ1 A;  4GXB A;  1K5D B;  4HAV B;  2J0J A;  1TXD A;  2YS5 A;  4HDO A;  4MY6 A;  3UZT A;  2OTX A;  2AEH A;  2CY5 A;  1NU2 A;  2DHJ A;  2K2U A;  5CLL B;  2RSG A;  3PZD A;  3PVW A;  5C79 A;  1FOE A;  4DX9 0;  1DRO A;  1V5M A;  1W1D A;  2YS3 A;  2V76 A;  3CIK A;  1I7A A;  3D8E A;  1PFJ A;  2YT1 A;  5CLQ B;  3SYX A;  4YL8 A;  3A8P A;  2J0K A;  3ODX A;  2JP2 A;  3O96 A;  1BTK A;  4KHO A;  2I5C A;  2D9Y A;  1FHO A;  4Z2M B;  3DXD A;  2LG1 A;  2P0D A;  1EAZ A;  2UZS A;  2UZR A;  2MWN B;  2COF A;  1OMW A;  1X1F A;  2DX1 A;  2ZPY A;  4F7H A;  2Y7B A;  2D10 A;  1LW3 A;  2Q13 A;  3CXB B;  4IFS A;  4NSW A;  4HB0 B;  1U29 A;  3RCP A;  2M14 A;  4IAP A;  2YVC A;  1DDV A;  2H7E A;  3KSY A;  2M38 A;  2L2I A;  1LB1 A;  3BJI A;  2GCJ A;  4GMV A;  1FHX A;  2I1K A;  3TFM A;  4H8S A;  2LOX A;  3G9W A;  1MIX A;  1P5T A;  3KRX A;  1MKE A;  1MK9 B;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...