5DH9B

Crystal structure of pki nes flip mutant peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 35
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dh9B00
1KI1B 2Z0QA 2LOXA 1ZVRA 1AWEA 3AU4A 4A6HA 5FI0A 4GZUA 4ZRKA 1Y5OA 2RVBB 3QWMA 4PQ0A 5CLQB 1LW3A 1XCGA 2GCLA 2H7EA 4KHBB 1U27A 4C0AA 4HDOA 2P0HA 2NMBA 2LKOA 4HAZB 3P7ZA 5LONB 1N3HA 3UZTA 3HQCA 3D8EA 1DROA 5J3QA 2R0DA 4DXAB 1UEFA 1J19A 3PZDA 3X23A 2COAA 2RGNB 2DHKA 4WSFA 4F7UP 4NSWA 1X11A 1GC6A 1MKEA 3QBVB 5C6RA 3T06A 3GYOA 4ZRJA 3WA0A 4HAXB 1U5GA 1MPHA 2COCA 3WYFB 3D8FA 4GN1A 1V5MA 2D4QA 2KGXB 3O96A 4DBBA 2OTXA 3SNHA 1MIZB 3HK0A 3G9WA 4L6EA 3ULBA 3PVUA 4HAUB 1SHCA 1XR0B 2LOZA 3AU5A 1MK7B 2UZRA 4DX8A 1P5TA 4WVFB 2DA0A 3KY9A 4KAXB 2VSZA 2PZ1A 1ZM0A 2M38A 5DHFB 4TYZA 2D9VA 1AQCA 1GG3A 2P0FA 1W1DA 2DTCA 4Y94A 1UNQA 1M7EA 1U5DA 5KQ1A 2ZPYA 4MT7A 1ISNA 4HB0B 2R09A 5GOWB 1WVHA 1KZ7A 1GC7A 4HAVB 2J59M 2L2IA 3TW1A 2ADZA 2N23A 4TKNA 4GXBA 3KSYA 2YS5A 2CAYA 1QC6A 5EFXA 5C5BA 1MK9B 5J3YA 1LB1A 3N7CA 2P8VA 1MAIA 5DH9B 1WGQA 1FAOA 1K5DB 5JHGA 1XX0A 2ROZB 3M1IB 5LOPB 2D11A 4B6HA 3SV1A 5CLLB 4YONA 2I5CA 1DDMA 4HAYB 2JP2A 3U8ZA 2DHIA 2H7DA 2L1CA 4HDQA 2CY5A 2UVMA 5HE1A 4CYEA 2LULA 4F7HA 2EMTA 1I2HA 5D27A 4BBKA 4HB2B 3PP2A 3HW2B 1FOEA 3A8QA 2K2JA 1XD4A 2Z0OA 3MPXA 3ML4A 2CY4A 1BWNA 3MDBC 4GPTB 1BAKA 1E5WA 3ZVRA 1X1FA 2YRYA 5C5BB 2W2WA 2D9YA 2RUKB 2D10A 1K5GB 3D8DA 2D9WA 2OQBA 2D9XA 2DHJA 3A8PA 4EKUA 2V76A 2J0KA 5D3YA 4CHJA 4P7IA 1ZC4B 4EJNA 3KRWA 5C16A 1J0WA 2ELBA 3QIJA 5FI1A 1BTNA 2GCJA 4K2OA 2YS1A 1UPQA 2DN6A 1OY2A 4MY6A 2YS3A 3VOQA 1V5UA 5DI9B 1WJ1A 1IRSA 2G35A 2NZ8B 1DDVA 1EVHA 3ODXA 4KVGB 1B55A 1U5EA 1NTVA 2FJLA 3CIKA 5HE3A 2I1KA 2D2QA 2DYQA 3RCPA 3ZDTA 4EMOA 5DIFB 1OQNA 2IYBA 2KCJA 3TVVA 2GJYA 3VIAA 4D0NB 3SUZA 3FEHA 2DKQA 3FM8C 5HE0A 4A6FA 4K81A 1P6SA 4YL8A 2DKPA 1TJ6A 1FHWA 4HB4B 1WJMA 1PMSA 1PLSA 1X1GA 2EJ8A 1H4RA 5JLJB 4K17A 2K00A 2COFA 3PSCA 2LG1A 1V61A 4HB3B 1DDWA 1U2BA 5KCVA 4NY0A 2HTHB 5JHHA 3DXDA 2VRWB 2YT0A 1EAZA 3GYPA 2CRFA 1W1GA 1WI1A 2MDXA 4KHAA 4Z2MB 4DX90 1U29A 2CODA 1EGXA 3DXEA 1MIXA 1UNRA 2EC1A 1NTYA 3PG7A 2RLOA 4A6FB 2DX1A 4IOYX 5HE2A 1H10A 1SGHA 2DX5A 1ZSQA 1V5PA 3SO6A 2I1JA 3OANA 4GMVA 5D3XA 4CHMA 1U5FA 4K2PA 3ODWA 2EMSA 2KUPA 1TXDA 2YVCA 3ULCA 2RNRB 1FGYA 1NU2A 2D9ZA 1RJ2A 2AEHA 2XQNM 2I5FA 1KZGA 3TFMA 4F7GA 4IAPA 3TO1A 4WJ7A 1V88A 1Y19B 1NI2A 5D3WA 5D3VA 1DYNA 3FSSA 5DHAB 1EF1A 5J3TA 1M7RA 2K2UA 1QQGA 1FGZA 5L81A 2IFSA 1PFJA 1X86A 3PVWA 1Q67A 1V89A 3LJUX 1ZC3B 3IVFA 2Y7BA 1P3RA 2W2XC 4A6KA 1XKEA 3NSUA 2DYNA 1DBHA 2YF0A 1OMWA 2GS0A 2DLWA 4H8SA 1FHXA 3V5WA 4HAWB 2N0YA 4HATB 3BJIA 3U7DA 1X05A 3KRXA 2VKIA 1WG7A 4KHOA 3CXBB 3AJ4A 1TQZA 4ZRIA 3SYXA 2Y8FA 2MKRA 2YSZA 2UZSA 1XODA 4XWXA 3A98B 3TCAA 2X18A 1W1HA 2MFQA 1UNPA 2YT1A 3F5RA 2QKMA 2E2XA 2W2XD 5C79A 1I7AA 4PNKA 2MWNB 2Z0PA 3P6AA 5KQ4A 1UPRA 3KZ1A 2J0MA 3PVLA 1FHOA 1WGUA 2J0JA 2P0DA 5JP4A 2ELAA 3BINA 3PEGA 1Z87A 3ODOA 1BTKA 4IFSA 3F0WA 2RSGA 4A5KA 1RRPB 4MK0A 2DFKA 2Q13A 2ROVA 1FB8A 2BCJA 2LYDA 2HE7A 2Y8GA 4GMXB 2M14A 4HHVA 4Z2NA 2AL6A 2QKLA 3DXCA
chains in the Genus database with same CATH superfamily
1KI1B 2Z0QA 2LOXA 1ZVRA 1AWEA 3AU4A 4A6HA 5FI0A 3DCXA 4GZUA 4ZRKA 1Y5OA 2RVBB 3QWMA 4PQ0A 3A58A 5CLQB 1LW3A 1XCGA 2GCLA 2H7EA 4KHBB 1U27A 4C0AA 2ZKMX 4HDOA 2P0HA 2NMBA 4L1RA 2LKOA 4HAZB 3P7ZA 5LONB 1N3HA 2K8EA 3UZTA 3HQCA 3D8EA 1DROA 2Z59A 5J3QA 2FJUB 2R0DA 4DXAB 1UEFA 1J19A 3PZDA 3X23A 2COAA 2RGNB 2DHKA 4WSFA 4F7UP 1T77A 4NSWA 1X11A 1GC6A 1MKEA 3QBVB 5C6RA 3T06A 3GYOA 4ZRJA 3WA0A 4HAXB 1U5GA 1MPHA 2COCA 3WYFB 3D8FA 2NBVA 4GN1A 1V5MA 2YT2A 2D4QA 2KGXB 3O96A 4DBBA 2OTXA 3OHMB 3SNHA 5IRSA 1MIZB 3HK0A 3G9WA 4L6EA 3ULBA 3PVUA 4HAUB 1SHCA 1XR0B 2LOZA 3AU5A 1MK7B 2UZRA 4DX8A 1P5TA 4WVFB 2DA0A 3KY9A 4KAXB 2VSZA 2PZ1A 1ZM0A 2M38A 5DHFB 2KIGA 4TYZA 2D9VA 1AQCA 1GG3A 2P0FA 1W1DA 2DTCA 4Y94A 1UNQA 1M7EA 1U5DA 5KQ1A 2ZPYA 4MT7A 1ISNA 4HB0B 2R09A 5GOWB 1WVHA 1KZ7A 1GC7A 4HAVB 2J59M 2L2IA 3TW1A 2ADZA 2N23A 4TKNA 4GXBA 3KSYA 2YS5A 2CAYA 5M4YB 1QC6A 5EFXA 5C5BA 1MK9B 5J3YA 1LB1A 3N7CA 2P8VA 1MAIA 5DH9B 1WGQA 4OT1A 2Z13A 1FAOA 4CSQA 1K5DB 5JHGA 1XX0A 2ROZB 3M1IB 5LOPB 2D11A 4B6HA 3SV1A 5CLLB 4YONA 2I5CA 2RRFA 1DDMA 4HAYB 2JP2A 3U8ZA 4QJ3B 2DHIA 2KR0A 2H7DA 2L1CA 4HDQA 2CY5A 2UVMA 5HE1A 4CYEA 2LULA 4F7HA 2EMTA 1I2HA 5D27A 4BBKA 4HB2B 3PP2A 3HW2B 1FOEA 3A8QA 2K2JA 1XD4A 2Z0OA 3MPXA 3ML4A 1ZYIA 2CY4A 1BWNA 3MDBC 4GPTB 1BAKA 1E5WA 3ZVRA 1X1FA 2YRYA 3NWFA 5C5BB 2W2WA 2D9YA 2RUKB 2D10A 1K5GB 3D8DA 2D9WA 2OQBA 2D9XA 2DHJA 3A8PA 4EKUA 2V76A 2J0KA 5D3YA 4CHJA 4P7IA 1ZC4B 4EJNA 3KRWA 5C16A 1J0WA 2ELBA 3QIJA 5FI1A 2KUQA 1BTNA 2GCJA 4K2OA 2YS1A 1UPQA 2DN6A 1OY2A 4MY6A 2YS3A 3VOQA 1V5UA 5DI9B 1WJ1A 1IRSA 2G35A 2NZ8B 1DDVA 1EVHA 4D6WA 3ODXA 4KVGB 1B55A 1U5EA 1NTVA 2FJLA 3CIKA 5HE3A 2I1KA 2D2QA 2DYQA 3RCPA 4OSNA 3ZDTA 4EMOA 5DIFB 1OQNA 2IYBA 2KCJA 3TVVA 2GJYA 3VIAA 4D0NB 3SUZA 3FEHA 2DKQA 3FM8C 5HE0A 4A6FA 4K81A 1P6SA 4YL8A 2DKPA 1TJ6A 1FHWA 4HB4B 1WJMA 1MI1A 1PMSA 1PLSA 1X1GA 2EJ8A 1H4RA 3NW8A 5JLJB 3U12A 2R2YA 4K17A 2K00A 2COFA 3PSCA 4KHBA 2LG1A 3HSAA 1V61A 4HB3B 1DDWA 1U2BA 5KCVA 4QJ5B 4NY0A 2HTHB 5JHHA 3DXDA 2VRWB 2YT0A 5I2MA 1EAZA 3GYPA 2CRFA 1W1GA 4DIXA 1WI1A 2MDXA 4KHAA 4Z2MB 4DX90 1U29A 2CODA 1EGXA 3DXEA 1MIXA 1UNRA 2EC1A 1NTYA 3PG7A 2RLOA 4A6FB 2DX1A 2K49A 4IOYX 5HE2A 3FVCA 1H10A 1SGHA 2DX5A 1ZSQA 1V5PA 2GUMA 3SO6A 2I1JA 3OANA 4GMVA 5D3XA 3NWAA 4HSIA 4CHMA 1U5FA 4K2PA 3ODWA 2EMSA 2KUPA 1TXDA 2YVCA 3ULCA 5LG4B 2RNRB 1FGYA 1NU2A 2D9ZA 1RJ2A 2AEHA 2XQNM 2I5FA 1KZGA 3TFMA 4F7GA 4IAPA 3TO1A 4WJ7A 1V88A 1Y19B 1NI2A 2KIEA 5D3WA 5D3VA 1DYNA 3FSSA 5DHAB 2Z14A 1EF1A 5J3TA 1M7RA 2K2UA 1QQGA 1FGZA 5L81A 2IFSA 1PFJA 1X86A 3PVWA 3NWDA 5I2SA 1Q67A 1V89A 3LJUX 1ZC3B 3IVFA 2Y7BA 1P3RA 2W2XC 4A6KA 1XKEA 3NSUA 2DYNA 1DBHA 2YF0A 1OMWA 2GS0A 2DLWA 2Z4DA 4QJ4B 4H8SA 1FHXA 3V5WA 4HAWB 2N0YA 4HATB 3BJIA 3U7DA 1X05A 3HIEA 3KRXA 2VKIA 1WG7A 4KHOA 3CXBB 3AJ4A 1TQZA 4ZRIA 3SYXA 2Y8FA 2MKRA 3B77A 2YSZA 2UZSA 1XODA 4XWXA 3A98B 3TCAA 2X18A 1W1HA 2MFQA 1UNPA 2YT1A 3F5RA 2QKMA 2E2XA 2W2XD 5C79A 1I7AA 4PNKA 2MWNB 2Z0PA 4GOUA 3P6AA 5KQ4A 1UPRA 3KZ1A 2J0MA 3PVLA 1FHOA 1WGUA 4GNKB 2J0JA 2P0DA 5JP4A 2ELAA 3BINA 3PEGA 1Z87A 3ODOA 1BTKA 4IFSA 3F0WA 2RSGA 4A5KA 1RRPB 4MK0A 2DFKA 2Q13A 2ROVA 1FB8A 2BCJA 4QXAB 2LYDA 2HE7A 2Y8GA 4GMXB 2M14A 4HHVA 4Z2NA 2AL6A 2QKLA 3DXCA
chains in the Genus database with same CATH topology
1KI1B 2Z0QA 2LOXA 1ZVRA 1AWEA 3AU4A 4A6HA 5FI0A 4GZUA 4ZRKA 1Y5OA 2RVBB 3QWMA 4PQ0A 5CLQB 1LW3A 1XCGA 2GCLA 2H7EA 4KHBB 1U27A 4C0AA 4HDOA 2P0HA 2NMBA 2LKOA 4HAZB 3P7ZA 5LONB 1N3HA 3UZTA 3HQCA 3D8EA 1DROA 5J3QA 2R0DA 4DXAB 1UEFA 1J19A 3PZDA 3X23A 2COAA 2RGNB 2DHKA 4WSFA 4F7UP 4NSWA 1X11A 1GC6A 1MKEA 3QBVB 5C6RA 3T06A 3GYOA 4ZRJA 3WA0A 4HAXB 1U5GA 1MPHA 2COCA 3WYFB 3D8FA 4GN1A 1V5MA 2D4QA 2KGXB 3O96A 4DBBA 2OTXA 3SNHA 1MIZB 3HK0A 3G9WA 4L6EA 3ULBA 3PVUA 4HAUB 1SHCA 1XR0B 2LOZA 3AU5A 1MK7B 2UZRA 4DX8A 1P5TA 4WVFB 2DA0A 3KY9A 4KAXB 2VSZA 2PZ1A 1ZM0A 2M38A 5DHFB 4TYZA 2D9VA 1AQCA 1GG3A 2P0FA 1W1DA 2DTCA 4Y94A 1UNQA 1M7EA 1U5DA 5KQ1A 2ZPYA 4MT7A 1ISNA 4HB0B 2R09A 5GOWB 1WVHA 1KZ7A 1GC7A 4HAVB 2J59M 2L2IA 3TW1A 2ADZA 2N23A 4TKNA 4GXBA 3KSYA 2YS5A 2CAYA 1QC6A 5EFXA 5C5BA 1MK9B 5J3YA 1LB1A 3N7CA 2P8VA 1MAIA 5DH9B 1WGQA 1FAOA 1K5DB 5JHGA 1XX0A 2ROZB 3M1IB 5LOPB 2D11A 4B6HA 3SV1A 5CLLB 4YONA 2I5CA 1DDMA 4HAYB 2JP2A 3U8ZA 2DHIA 2H7DA 2L1CA 4HDQA 2CY5A 2UVMA 5HE1A 4CYEA 2LULA 4F7HA 2EMTA 1I2HA 5D27A 4BBKA 4HB2B 3PP2A 3HW2B 1FOEA 3A8QA 2K2JA 1XD4A 2Z0OA 3MPXA 3ML4A 2CY4A 1BWNA 3MDBC 4GPTB 1BAKA 1E5WA 3ZVRA 1X1FA 2YRYA 5C5BB 2W2WA 2D9YA 2RUKB 2D10A 1K5GB 3D8DA 2D9WA 2OQBA 2D9XA 2DHJA 3A8PA 4EKUA 2V76A 2J0KA 5D3YA 4CHJA 4P7IA 1ZC4B 4EJNA 3KRWA 5C16A 1J0WA 2ELBA 3QIJA 5FI1A 1BTNA 2GCJA 4K2OA 2YS1A 1UPQA 2DN6A 1OY2A 4MY6A 2YS3A 3VOQA 1V5UA 5DI9B 1WJ1A 1IRSA 2G35A 2NZ8B 1DDVA 1EVHA 3ODXA 4KVGB 1B55A 1U5EA 1NTVA 2FJLA 3CIKA 5HE3A 2I1KA 2D2QA 2DYQA 3RCPA 3ZDTA 4EMOA 5DIFB 1OQNA 2IYBA 2KCJA 3TVVA 2GJYA 3VIAA 4D0NB 3SUZA 3FEHA 2DKQA 3FM8C 5HE0A 4A6FA 4K81A 1P6SA 4YL8A 2DKPA 1TJ6A 1FHWA 4HB4B 1WJMA 1PMSA 1PLSA 1X1GA 2EJ8A 1H4RA 5JLJB 4K17A 2K00A 2COFA 3PSCA 2LG1A 1V61A 4HB3B 1DDWA 1U2BA 5KCVA 4NY0A 2HTHB 5JHHA 3DXDA 2VRWB 2YT0A 1EAZA 3GYPA 2CRFA 1W1GA 1WI1A 2MDXA 4KHAA 4Z2MB 4DX90 1U29A 2CODA 1EGXA 3DXEA 1MIXA 1UNRA 2EC1A 1NTYA 3PG7A 2RLOA 4A6FB 2DX1A 4IOYX 5HE2A 1H10A 1SGHA 2DX5A 1ZSQA 1V5PA 3SO6A 2I1JA 3OANA 4GMVA 5D3XA 4CHMA 1U5FA 4K2PA 3ODWA 2EMSA 2KUPA 1TXDA 2YVCA 3ULCA 2RNRB 1FGYA 1NU2A 2D9ZA 1RJ2A 2AEHA 2XQNM 2I5FA 1KZGA 3TFMA 4F7GA 4IAPA 3TO1A 4WJ7A 1V88A 1Y19B 1NI2A 5D3WA 5D3VA 1DYNA 3FSSA 5DHAB 1EF1A 5J3TA 1M7RA 2K2UA 1QQGA 1FGZA 5L81A 2IFSA 1PFJA 1X86A 3PVWA 1Q67A 1V89A 3LJUX 1ZC3B 3IVFA 2Y7BA 1P3RA 2W2XC 4A6KA 1XKEA 3NSUA 2DYNA 1DBHA 2YF0A 1OMWA 2GS0A 2DLWA 4H8SA 1FHXA 3V5WA 4HAWB 2N0YA 4HATB 3BJIA 3U7DA 1X05A 3KRXA 2VKIA 1WG7A 4KHOA 3CXBB 3AJ4A 1TQZA 4ZRIA 3SYXA 2Y8FA 2MKRA 2YSZA 2UZSA 1XODA 4XWXA 3A98B 3TCAA 2X18A 1W1HA 2MFQA 1UNPA 2YT1A 3F5RA 2QKMA 2E2XA 2W2XD 5C79A 1I7AA 4PNKA 2MWNB 2Z0PA 3P6AA 5KQ4A 1UPRA 3KZ1A 2J0MA 3PVLA 1FHOA 1WGUA 2J0JA 2P0DA 5JP4A 2ELAA 3BINA 3PEGA 1Z87A 3ODOA 1BTKA 4IFSA 3F0WA 2RSGA 4A5KA 1RRPB 4MK0A 2DFKA 2Q13A 2ROVA 1FB8A 2BCJA 2LYDA 2HE7A 2Y8GA 4GMXB 2M14A 4HHVA 4Z2NA 2AL6A 2QKLA 3DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KI1 B;  2Z0Q A;  2LOX A;  1ZVR A;  1AWE A;  3AU4 A;  4A6H A;  5FI0 A;  4GZU A;  4ZRK A;  1Y5O A;  2RVB B;  3QWM A;  4PQ0 A;  5CLQ B;  1LW3 A;  1XCG A;  2GCL A;  2H7E A;  4KHB B;  1U27 A;  4C0A A;  4HDO A;  2P0H A;  2NMB A;  2LKO A;  4HAZ B;  3P7Z A;  5LON B;  1N3H A;  3UZT A;  3HQC A;  3D8E A;  1DRO A;  5J3Q A;  2R0D A;  4DXA B;  1UEF A;  1J19 A;  3PZD A;  3X23 A;  2COA A;  2RGN B;  2DHK A;  4WSF A;  4F7U P;  4NSW A;  1X11 A;  1GC6 A;  1MKE A;  3QBV B;  5C6R A;  3T06 A;  3GYO A;  4ZRJ A;  3WA0 A;  4HAX B;  1U5G A;  1MPH A;  2COC A;  3WYF B;  3D8F A;  4GN1 A;  1V5M A;  2D4Q A;  2KGX B;  3O96 A;  4DBB A;  2OTX A;  3SNH A;  1MIZ B;  3HK0 A;  3G9W A;  4L6E A;  3ULB A;  3PVU A;  4HAU B;  1SHC A;  1XR0 B;  2LOZ A;  3AU5 A;  1MK7 B;  2UZR A;  4DX8 A;  1P5T A;  4WVF B;  2DA0 A;  3KY9 A;  4KAX B;  2VSZ A;  2PZ1 A;  1ZM0 A;  2M38 A;  5DHF B;  4TYZ A;  2D9V A;  1AQC A;  1GG3 A;  2P0F A;  1W1D A;  2DTC A;  4Y94 A;  1UNQ A;  1M7E A;  1U5D A;  5KQ1 A;  2ZPY A;  4MT7 A;  1ISN A;  4HB0 B;  2R09 A;  5GOW B;  1WVH A;  1KZ7 A;  1GC7 A;  4HAV B;  2J59 M;  2L2I A;  3TW1 A;  2ADZ A;  2N23 A;  4TKN A;  4GXB A;  3KSY A;  2YS5 A;  2CAY A;  1QC6 A;  5EFX A;  5C5B A;  1MK9 B;  5J3Y A;  1LB1 A;  3N7C A;  2P8V A;  1MAI A;  5DH9 B;  1WGQ A;  1FAO A;  1K5D B;  5JHG A;  1XX0 A;  2ROZ B;  3M1I B;  5LOP B;  2D11 A;  4B6H A;  3SV1 A;  5CLL B;  4YON A;  2I5C A;  1DDM A;  4HAY B;  2JP2 A;  3U8Z A;  2DHI A;  2H7D A;  2L1C A;  4HDQ A;  2CY5 A;  2UVM A;  5HE1 A;  4CYE A;  2LUL A;  4F7H A;  2EMT A;  1I2H A;  5D27 A;  4BBK A;  4HB2 B;  3PP2 A;  3HW2 B;  1FOE A;  3A8Q A;  2K2J A;  1XD4 A;  2Z0O A;  3MPX A;  3ML4 A;  2CY4 A;  1BWN A;  3MDB C;  4GPT B;  1BAK A;  1E5W A;  3ZVR A;  1X1F A;  2YRY A;  5C5B B;  2W2W A;  2D9Y A;  2RUK B;  2D10 A;  1K5G B;  3D8D A;  2D9W A;  2OQB A;  2D9X A;  2DHJ A;  3A8P A;  4EKU A;  2V76 A;  2J0K A;  5D3Y A;  4CHJ A;  4P7I A;  1ZC4 B;  4EJN A;  3KRW A;  5C16 A;  1J0W A;  2ELB A;  3QIJ A;  5FI1 A;  1BTN A;  2GCJ A;  4K2O A;  2YS1 A;  1UPQ A;  2DN6 A;  1OY2 A;  4MY6 A;  2YS3 A;  3VOQ A;  1V5U A;  5DI9 B;  1WJ1 A;  1IRS A;  2G35 A;  2NZ8 B;  1DDV A;  1EVH A;  3ODX A;  4KVG B;  1B55 A;  1U5E A;  1NTV A;  2FJL A;  3CIK A;  5HE3 A;  2I1K A;  2D2Q A;  2DYQ A;  3RCP A;  3ZDT A;  4EMO A;  5DIF B;  1OQN A;  2IYB A;  2KCJ A;  3TVV A;  2GJY A;  3VIA A;  4D0N B;  3SUZ A;  3FEH A;  2DKQ A;  3FM8 C;  5HE0 A;  4A6F A;  4K81 A;  1P6S A;  4YL8 A;  2DKP A;  1TJ6 A;  1FHW A;  4HB4 B;  1WJM A;  1PMS A;  1PLS A;  1X1G A;  2EJ8 A;  1H4R A;  5JLJ B;  4K17 A;  2K00 A;  2COF A;  3PSC A;  2LG1 A;  1V61 A;  4HB3 B;  1DDW A;  1U2B A;  5KCV A;  4NY0 A;  2HTH B;  5JHH A;  3DXD A;  2VRW B;  2YT0 A;  1EAZ A;  3GYP A;  2CRF A;  1W1G A;  1WI1 A;  2MDX A;  4KHA A;  4Z2M B;  4DX9 0;  1U29 A;  2COD A;  1EGX A;  3DXE A;  1MIX A;  1UNR A;  2EC1 A;  1NTY A;  3PG7 A;  2RLO A;  4A6F B;  2DX1 A;  4IOY X;  5HE2 A;  1H10 A;  1SGH A;  2DX5 A;  1ZSQ A;  1V5P A;  3SO6 A;  2I1J A;  3OAN A;  4GMV A;  5D3X A;  4CHM A;  1U5F A;  4K2P A;  3ODW A;  2EMS A;  2KUP A;  1TXD A;  2YVC A;  3ULC A;  2RNR B;  1FGY A;  1NU2 A;  2D9Z A;  1RJ2 A;  2AEH A;  2XQN M;  2I5F A;  1KZG A;  3TFM A;  4F7G A;  4IAP A;  3TO1 A;  4WJ7 A;  1V88 A;  1Y19 B;  1NI2 A;  5D3W A;  5D3V A;  1DYN A;  3FSS A;  5DHA B;  1EF1 A;  5J3T A;  1M7R A;  2K2U A;  1QQG A;  1FGZ A;  5L81 A;  2IFS A;  1PFJ A;  1X86 A;  3PVW A;  1Q67 A;  1V89 A;  3LJU X;  1ZC3 B;  3IVF A;  2Y7B A;  1P3R A;  2W2X C;  4A6K A;  1XKE A;  3NSU A;  2DYN A;  1DBH A;  2YF0 A;  1OMW A;  2GS0 A;  2DLW A;  4H8S A;  1FHX A;  3V5W A;  4HAW B;  2N0Y A;  4HAT B;  3BJI A;  3U7D A;  1X05 A;  3KRX A;  2VKI A;  1WG7 A;  4KHO A;  3CXB B;  3AJ4 A;  1TQZ A;  4ZRI A;  3SYX A;  2Y8F A;  2MKR A;  2YSZ A;  2UZS A;  1XOD A;  4XWX A;  3A98 B;  3TCA A;  2X18 A;  1W1H A;  2MFQ A;  1UNP A;  2YT1 A;  3F5R A;  2QKM A;  2E2X A;  2W2X D;  5C79 A;  1I7A A;  4PNK A;  2MWN B;  2Z0P A;  3P6A A;  5KQ4 A;  1UPR A;  3KZ1 A;  2J0M A;  3PVL A;  1FHO A;  1WGU A;  2J0J A;  2P0D A;  5JP4 A;  2ELA A;  3BIN A;  3PEG A;  1Z87 A;  3ODO A;  1BTK A;  4IFS A;  3F0W A;  2RSG A;  4A5K A;  1RRP B;  4MK0 A;  2DFK A;  2Q13 A;  2ROV A;  1FB8 A;  2BCJ A;  2LYD A;  2HE7 A;  2Y8G A;  4GMX B;  2M14 A;  4HHV A;  4Z2N A;  2AL6 A;  2QKL A;  3DXC A; 
#chains in the Genus database with same CATH topology
 1KI1 B;  2Z0Q A;  2LOX A;  1ZVR A;  1AWE A;  3AU4 A;  4A6H A;  5FI0 A;  3DCX A;  4GZU A;  4ZRK A;  1Y5O A;  2RVB B;  3QWM A;  4PQ0 A;  3A58 A;  5CLQ B;  1LW3 A;  1XCG A;  2GCL A;  2H7E A;  4KHB B;  1U27 A;  4C0A A;  2ZKM X;  4HDO A;  2P0H A;  2NMB A;  4L1R A;  2LKO A;  4HAZ B;  3P7Z A;  5LON B;  1N3H A;  2K8E A;  3UZT A;  3HQC A;  3D8E A;  1DRO A;  2Z59 A;  5J3Q A;  2FJU B;  2R0D A;  4DXA B;  1UEF A;  1J19 A;  3PZD A;  3X23 A;  2COA A;  2RGN B;  2DHK A;  4WSF A;  4F7U P;  1T77 A;  4NSW A;  1X11 A;  1GC6 A;  1MKE A;  3QBV B;  5C6R A;  3T06 A;  3GYO A;  4ZRJ A;  3WA0 A;  4HAX B;  1U5G A;  1MPH A;  2COC A;  3WYF B;  3D8F A;  2NBV A;  4GN1 A;  1V5M A;  2YT2 A;  2D4Q A;  2KGX B;  3O96 A;  4DBB A;  2OTX A;  3OHM B;  3SNH A;  5IRS A;  1MIZ B;  3HK0 A;  3G9W A;  4L6E A;  3ULB A;  3PVU A;  4HAU B;  1SHC A;  1XR0 B;  2LOZ A;  3AU5 A;  1MK7 B;  2UZR A;  4DX8 A;  1P5T A;  4WVF B;  2DA0 A;  3KY9 A;  4KAX B;  2VSZ A;  2PZ1 A;  1ZM0 A;  2M38 A;  5DHF B;  2KIG A;  4TYZ A;  2D9V A;  1AQC A;  1GG3 A;  2P0F A;  1W1D A;  2DTC A;  4Y94 A;  1UNQ A;  1M7E A;  1U5D A;  5KQ1 A;  2ZPY A;  4MT7 A;  1ISN A;  4HB0 B;  2R09 A;  5GOW B;  1WVH A;  1KZ7 A;  1GC7 A;  4HAV B;  2J59 M;  2L2I A;  3TW1 A;  2ADZ A;  2N23 A;  4TKN A;  4GXB A;  3KSY A;  2YS5 A;  2CAY A;  5M4Y B;  1QC6 A;  5EFX A;  5C5B A;  1MK9 B;  5J3Y A;  1LB1 A;  3N7C A;  2P8V A;  1MAI A;  5DH9 B;  1WGQ A;  4OT1 A;  2Z13 A;  1FAO A;  4CSQ A;  1K5D B;  5JHG A;  1XX0 A;  2ROZ B;  3M1I B;  5LOP B;  2D11 A;  4B6H A;  3SV1 A;  5CLL B;  4YON A;  2I5C A;  2RRF A;  1DDM A;  4HAY B;  2JP2 A;  3U8Z A;  4QJ3 B;  2DHI A;  2KR0 A;  2H7D A;  2L1C A;  4HDQ A;  2CY5 A;  2UVM A;  5HE1 A;  4CYE A;  2LUL A;  4F7H A;  2EMT A;  1I2H A;  5D27 A;  4BBK A;  4HB2 B;  3PP2 A;  3HW2 B;  1FOE A;  3A8Q A;  2K2J A;  1XD4 A;  2Z0O A;  3MPX A;  3ML4 A;  1ZYI A;  2CY4 A;  1BWN A;  3MDB C;  4GPT B;  1BAK A;  1E5W A;  3ZVR A;  1X1F A;  2YRY A;  3NWF A;  5C5B B;  2W2W A;  2D9Y A;  2RUK B;  2D10 A;  1K5G B;  3D8D A;  2D9W A;  2OQB A;  2D9X A;  2DHJ A;  3A8P A;  4EKU A;  2V76 A;  2J0K A;  5D3Y A;  4CHJ A;  4P7I A;  1ZC4 B;  4EJN A;  3KRW A;  5C16 A;  1J0W A;  2ELB A;  3QIJ A;  5FI1 A;  2KUQ A;  1BTN A;  2GCJ A;  4K2O A;  2YS1 A;  1UPQ A;  2DN6 A;  1OY2 A;  4MY6 A;  2YS3 A;  3VOQ A;  1V5U A;  5DI9 B;  1WJ1 A;  1IRS A;  2G35 A;  2NZ8 B;  1DDV A;  1EVH A;  4D6W A;  3ODX A;  4KVG B;  1B55 A;  1U5E A;  1NTV A;  2FJL A;  3CIK A;  5HE3 A;  2I1K A;  2D2Q A;  2DYQ A;  3RCP A;  4OSN A;  3ZDT A;  4EMO A;  5DIF B;  1OQN A;  2IYB A;  2KCJ A;  3TVV A;  2GJY A;  3VIA A;  4D0N B;  3SUZ A;  3FEH A;  2DKQ A;  3FM8 C;  5HE0 A;  4A6F A;  4K81 A;  1P6S A;  4YL8 A;  2DKP A;  1TJ6 A;  1FHW A;  4HB4 B;  1WJM A;  1MI1 A;  1PMS A;  1PLS A;  1X1G A;  2EJ8 A;  1H4R A;  3NW8 A;  5JLJ B;  3U12 A;  2R2Y A;  4K17 A;  2K00 A;  2COF A;  3PSC A;  4KHB A;  2LG1 A;  3HSA A;  1V61 A;  4HB3 B;  1DDW A;  1U2B A;  5KCV A;  4QJ5 B;  4NY0 A;  2HTH B;  5JHH A;  3DXD A;  2VRW B;  2YT0 A;  5I2M A;  1EAZ A;  3GYP A;  2CRF A;  1W1G A;  4DIX A;  1WI1 A;  2MDX A;  4KHA A;  4Z2M B;  4DX9 0;  1U29 A;  2COD A;  1EGX A;  3DXE A;  1MIX A;  1UNR A;  2EC1 A;  1NTY A;  3PG7 A;  2RLO A;  4A6F B;  2DX1 A;  2K49 A;  4IOY X;  5HE2 A;  3FVC A;  1H10 A;  1SGH A;  2DX5 A;  1ZSQ A;  1V5P A;  2GUM A;  3SO6 A;  2I1J A;  3OAN A;  4GMV A;  5D3X A;  3NWA A;  4HSI A;  4CHM A;  1U5F A;  4K2P A;  3ODW A;  2EMS A;  2KUP A;  1TXD A;  2YVC A;  3ULC A;  5LG4 B;  2RNR B;  1FGY A;  1NU2 A;  2D9Z A;  1RJ2 A;  2AEH A;  2XQN M;  2I5F A;  1KZG A;  3TFM A;  4F7G A;  4IAP A;  3TO1 A;  4WJ7 A;  1V88 A;  1Y19 B;  1NI2 A;  2KIE A;  5D3W A;  5D3V A;  1DYN A;  3FSS A;  5DHA B;  2Z14 A;  1EF1 A;  5J3T A;  1M7R A;  2K2U A;  1QQG A;  1FGZ A;  5L81 A;  2IFS A;  1PFJ A;  1X86 A;  3PVW A;  3NWD A;  5I2S A;  1Q67 A;  1V89 A;  3LJU X;  1ZC3 B;  3IVF A;  2Y7B A;  1P3R A;  2W2X C;  4A6K A;  1XKE A;  3NSU A;  2DYN A;  1DBH A;  2YF0 A;  1OMW A;  2GS0 A;  2DLW A;  2Z4D A;  4QJ4 B;  4H8S A;  1FHX A;  3V5W A;  4HAW B;  2N0Y A;  4HAT B;  3BJI A;  3U7D A;  1X05 A;  3HIE A;  3KRX A;  2VKI A;  1WG7 A;  4KHO A;  3CXB B;  3AJ4 A;  1TQZ A;  4ZRI A;  3SYX A;  2Y8F A;  2MKR A;  3B77 A;  2YSZ A;  2UZS A;  1XOD A;  4XWX A;  3A98 B;  3TCA A;  2X18 A;  1W1H A;  2MFQ A;  1UNP A;  2YT1 A;  3F5R A;  2QKM A;  2E2X A;  2W2X D;  5C79 A;  1I7A A;  4PNK A;  2MWN B;  2Z0P A;  4GOU A;  3P6A A;  5KQ4 A;  1UPR A;  3KZ1 A;  2J0M A;  3PVL A;  1FHO A;  1WGU A;  4GNK B;  2J0J A;  2P0D A;  5JP4 A;  2ELA A;  3BIN A;  3PEG A;  1Z87 A;  3ODO A;  1BTK A;  4IFS A;  3F0W A;  2RSG A;  4A5K A;  1RRP B;  4MK0 A;  2DFK A;  2Q13 A;  2ROV A;  1FB8 A;  2BCJ A;  4QXA B;  2LYD A;  2HE7 A;  2Y8G A;  4GMX B;  2M14 A;  4HHV A;  4Z2N A;  2AL6 A;  2QKL A;  3DXC A; 
#chains in the Genus database with same CATH homology
 1KI1 B;  2Z0Q A;  2LOX A;  1ZVR A;  1AWE A;  3AU4 A;  4A6H A;  5FI0 A;  4GZU A;  4ZRK A;  1Y5O A;  2RVB B;  3QWM A;  4PQ0 A;  5CLQ B;  1LW3 A;  1XCG A;  2GCL A;  2H7E A;  4KHB B;  1U27 A;  4C0A A;  4HDO A;  2P0H A;  2NMB A;  2LKO A;  4HAZ B;  3P7Z A;  5LON B;  1N3H A;  3UZT A;  3HQC A;  3D8E A;  1DRO A;  5J3Q A;  2R0D A;  4DXA B;  1UEF A;  1J19 A;  3PZD A;  3X23 A;  2COA A;  2RGN B;  2DHK A;  4WSF A;  4F7U P;  4NSW A;  1X11 A;  1GC6 A;  1MKE A;  3QBV B;  5C6R A;  3T06 A;  3GYO A;  4ZRJ A;  3WA0 A;  4HAX B;  1U5G A;  1MPH A;  2COC A;  3WYF B;  3D8F A;  4GN1 A;  1V5M A;  2D4Q A;  2KGX B;  3O96 A;  4DBB A;  2OTX A;  3SNH A;  1MIZ B;  3HK0 A;  3G9W A;  4L6E A;  3ULB A;  3PVU A;  4HAU B;  1SHC A;  1XR0 B;  2LOZ A;  3AU5 A;  1MK7 B;  2UZR A;  4DX8 A;  1P5T A;  4WVF B;  2DA0 A;  3KY9 A;  4KAX B;  2VSZ A;  2PZ1 A;  1ZM0 A;  2M38 A;  5DHF B;  4TYZ A;  2D9V A;  1AQC A;  1GG3 A;  2P0F A;  1W1D A;  2DTC A;  4Y94 A;  1UNQ A;  1M7E A;  1U5D A;  5KQ1 A;  2ZPY A;  4MT7 A;  1ISN A;  4HB0 B;  2R09 A;  5GOW B;  1WVH A;  1KZ7 A;  1GC7 A;  4HAV B;  2J59 M;  2L2I A;  3TW1 A;  2ADZ A;  2N23 A;  4TKN A;  4GXB A;  3KSY A;  2YS5 A;  2CAY A;  1QC6 A;  5EFX A;  5C5B A;  1MK9 B;  5J3Y A;  1LB1 A;  3N7C A;  2P8V A;  1MAI A;  5DH9 B;  1WGQ A;  1FAO A;  1K5D B;  5JHG A;  1XX0 A;  2ROZ B;  3M1I B;  5LOP B;  2D11 A;  4B6H A;  3SV1 A;  5CLL B;  4YON A;  2I5C A;  1DDM A;  4HAY B;  2JP2 A;  3U8Z A;  2DHI A;  2H7D A;  2L1C A;  4HDQ A;  2CY5 A;  2UVM A;  5HE1 A;  4CYE A;  2LUL A;  4F7H A;  2EMT A;  1I2H A;  5D27 A;  4BBK A;  4HB2 B;  3PP2 A;  3HW2 B;  1FOE A;  3A8Q A;  2K2J A;  1XD4 A;  2Z0O A;  3MPX A;  3ML4 A;  2CY4 A;  1BWN A;  3MDB C;  4GPT B;  1BAK A;  1E5W A;  3ZVR A;  1X1F A;  2YRY A;  5C5B B;  2W2W A;  2D9Y A;  2RUK B;  2D10 A;  1K5G B;  3D8D A;  2D9W A;  2OQB A;  2D9X A;  2DHJ A;  3A8P A;  4EKU A;  2V76 A;  2J0K A;  5D3Y A;  4CHJ A;  4P7I A;  1ZC4 B;  4EJN A;  3KRW A;  5C16 A;  1J0W A;  2ELB A;  3QIJ A;  5FI1 A;  1BTN A;  2GCJ A;  4K2O A;  2YS1 A;  1UPQ A;  2DN6 A;  1OY2 A;  4MY6 A;  2YS3 A;  3VOQ A;  1V5U A;  5DI9 B;  1WJ1 A;  1IRS A;  2G35 A;  2NZ8 B;  1DDV A;  1EVH A;  3ODX A;  4KVG B;  1B55 A;  1U5E A;  1NTV A;  2FJL A;  3CIK A;  5HE3 A;  2I1K A;  2D2Q A;  2DYQ A;  3RCP A;  3ZDT A;  4EMO A;  5DIF B;  1OQN A;  2IYB A;  2KCJ A;  3TVV A;  2GJY A;  3VIA A;  4D0N B;  3SUZ A;  3FEH A;  2DKQ A;  3FM8 C;  5HE0 A;  4A6F A;  4K81 A;  1P6S A;  4YL8 A;  2DKP A;  1TJ6 A;  1FHW A;  4HB4 B;  1WJM A;  1PMS A;  1PLS A;  1X1G A;  2EJ8 A;  1H4R A;  5JLJ B;  4K17 A;  2K00 A;  2COF A;  3PSC A;  2LG1 A;  1V61 A;  4HB3 B;  1DDW A;  1U2B A;  5KCV A;  4NY0 A;  2HTH B;  5JHH A;  3DXD A;  2VRW B;  2YT0 A;  1EAZ A;  3GYP A;  2CRF A;  1W1G A;  1WI1 A;  2MDX A;  4KHA A;  4Z2M B;  4DX9 0;  1U29 A;  2COD A;  1EGX A;  3DXE A;  1MIX A;  1UNR A;  2EC1 A;  1NTY A;  3PG7 A;  2RLO A;  4A6F B;  2DX1 A;  4IOY X;  5HE2 A;  1H10 A;  1SGH A;  2DX5 A;  1ZSQ A;  1V5P A;  3SO6 A;  2I1J A;  3OAN A;  4GMV A;  5D3X A;  4CHM A;  1U5F A;  4K2P A;  3ODW A;  2EMS A;  2KUP A;  1TXD A;  2YVC A;  3ULC A;  2RNR B;  1FGY A;  1NU2 A;  2D9Z A;  1RJ2 A;  2AEH A;  2XQN M;  2I5F A;  1KZG A;  3TFM A;  4F7G A;  4IAP A;  3TO1 A;  4WJ7 A;  1V88 A;  1Y19 B;  1NI2 A;  5D3W A;  5D3V A;  1DYN A;  3FSS A;  5DHA B;  1EF1 A;  5J3T A;  1M7R A;  2K2U A;  1QQG A;  1FGZ A;  5L81 A;  2IFS A;  1PFJ A;  1X86 A;  3PVW A;  1Q67 A;  1V89 A;  3LJU X;  1ZC3 B;  3IVF A;  2Y7B A;  1P3R A;  2W2X C;  4A6K A;  1XKE A;  3NSU A;  2DYN A;  1DBH A;  2YF0 A;  1OMW A;  2GS0 A;  2DLW A;  4H8S A;  1FHX A;  3V5W A;  4HAW B;  2N0Y A;  4HAT B;  3BJI A;  3U7D A;  1X05 A;  3KRX A;  2VKI A;  1WG7 A;  4KHO A;  3CXB B;  3AJ4 A;  1TQZ A;  4ZRI A;  3SYX A;  2Y8F A;  2MKR A;  2YSZ A;  2UZS A;  1XOD A;  4XWX A;  3A98 B;  3TCA A;  2X18 A;  1W1H A;  2MFQ A;  1UNP A;  2YT1 A;  3F5R A;  2QKM A;  2E2X A;  2W2X D;  5C79 A;  1I7A A;  4PNK A;  2MWN B;  2Z0P A;  3P6A A;  5KQ4 A;  1UPR A;  3KZ1 A;  2J0M A;  3PVL A;  1FHO A;  1WGU A;  2J0J A;  2P0D A;  5JP4 A;  2ELA A;  3BIN A;  3PEG A;  1Z87 A;  3ODO A;  1BTK A;  4IFS A;  3F0W A;  2RSG A;  4A5K A;  1RRP B;  4MK0 A;  2DFK A;  2Q13 A;  2ROV A;  1FB8 A;  2BCJ A;  2LYD A;  2HE7 A;  2Y8G A;  4GMX B;  2M14 A;  4HHV A;  4Z2N A;  2AL6 A;  2QKL A;  3DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...