5DH9B

Crystal structure of pki nes flip mutant peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 35
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dh9B00
2ROZB 2H7DA 2DFKA 2K2JA 2COAA 4TYZA 4F7UP 1EF1A 3SNHA 4GZUA 1V88A 2ROVA 5DHAB 1QQGA 4WSFA 5LOPB 1K5GB 4HDOA 1PMSA 3WA0A 2LULA 3PVLA 1M7RA 3G9WA 2D11A 3AU5A 2CY5A 4HB3B 5D3XA 2N23A 2D10A 4GN1A 2D9VA 1I2HA 2BCJA 3OANA 2EMSA 5J3YA 1FHOA 3BINA 3KY9A 3DXCA 1B55A 2R09A 1P6SA 3DXDA 5D3WA 2HE7A 5DIFB 1ZSQA 1W1GA 4KHOA 3D8EA 4IAPA 1NTVA 4H8SA 4KHAA 4DX90 1U5GA 5DI9B 4L6EA 5JP4A 1K5DB 2DX5A 1V5PA 2YS5A 1UPRA 4NY0A 5C79A 1DDVA 1WGQA 1W1DA 4MT7A 2P0HA 4NSWA 1XKEA 4C0AA 3PZDA 5HE0A 2RSGA 3TCAA 3U8ZA 1Y5OA 1EAZA 1X1GA 5KCVA 1U5EA 1U5FA 2AEHA 4XWXA 3FM8C 2GCLA 3TW1A 4HAVB 1LW3A 5D3YA 2W2XD 2RVBB 2D9ZA 2J0MA 2MFQA 1Z87A 3NSUA 2LOZA 5L81A 3IVFA 4HAYB 4HB2B 2J0JA 1ZVRA 2Z0OA 5J3QA 3F5RA 3P7ZA 2YVCA 4F7GA 3KRXA 4CHMA 1KI1B 2NMBA 2DN6A 1SHCA 4Z2MB 2NZ8B 1GC7A 1EGXA 1V5MA 2YRYA 5HE1A 3SUZA 3M1IB 4KVGB 2YS1A 1U2BA 4ZRKA 2CRFA 4B6HA 1E5WA 4KHBB 1UNRA 2LYDA 2V76A 5GOWB 3MPXA 1N3HA 1ZC3B 3PEGA 2YF0A 2Q13A 3D8FA 1W1HA 5LONB 3WYFB 3TVVA 3KZ1A 3KRWA 2IFSA 1DYNA 1FHXA 2PZ1A 3N7CA 4HATB 2X18A 4DXAB 4A6KA 2DX1A 1DDWA 1XX0A 4HB0B 2DHIA 2J59M 1BTNA 2DKPA 1UPQA 4EJNA 3HW2B 2Z0QA 2L1CA 2KUPA 4HAUB 4ZRIA 5JHGA 1X11A 1XR0B 4WVFB 5J3TA 5KQ1A 2VKIA 1V61A 4HAZB 4HAWB 4DX8A 1UEFA 2UZSA 4MK0A 2MDXA 5JLJB 4HAXB 3ODOA 4HDQA 1NTYA 3SV1A 3QBVB 1FHWA 3A8PA 2YSZA 1IRSA 2CODA 5CLLB 1FGZA 1MIXA 2D9XA 1WG7A 2ADZA 2MKRA 3PG7A 4K81A 2GS0A 2COFA 4Z2NA 4EMOA 1FGYA 5FI1A 5C16A 2LG1A 4GMXB 3KSYA 5D27A 3ZDTA 2W2XC 2M14A 3HQCA 1DDMA 1BAKA 1V5UA 3ZVRA 3CIKA 5HE2A 3FEHA 1DBHA 2ELAA 3A8QA 4PNKA 1EVHA 1LB1A 1TJ6A 2K00A 1Q67A 5C5BB 1X05A 2DYNA 2UVMA 4KAXB 1U29A 2Y8FA 3SYXA 4D0NB 2CY4A 1U5DA 2YT1A 2RNRB 2XQNM 2K2UA 2COCA 2DA0A 5HE3A 2DKQA 1WI1A 3PP2A 2EMTA 3ODWA 2D9WA 3QIJA 4PQ0A 2I1JA 4MY6A 1QC6A 3AU4A 5DHFB 1J19A 2I5CA 1XCGA 5CLQB 2W2WA 2EJ8A 5JHHA 3ULCA 4GPTB 1TXDA 2DTCA 1NI2A 2OQBA 2LOXA 2DHJA 3MDBC 1AWEA 3VIAA 1Y19B 2M38A 3V5WA 1ZM0A 1KZ7A 4P7IA 1AQCA 2RUKB 3UZTA 1DROA 3U7DA 1U27A 2RGNB 2DYQA 2G35A 4GXBA 4TKNA 3GYOA 1WJMA 3GYPA 2DHKA 2LKOA 2YS3A 2VSZA 3O96A 2KCJA 5C5BA 1MK7B 2P0DA 2ELBA 3P6AA 1XD4A 1P5TA 3CXBB 2N0YA 3F0WA 5FI0A 4YL8A 4A6FA 2L2IA 2JP2A 3A98B 2Y7BA 3QWMA 2VRWB 1V89A 2D4QA 4Y94A 3RCPA 4WJ7A 1ZC4B 1MPHA 3HK0A 3ODXA 5D3VA 1WVHA 2FJLA 1BWNA 1WGUA 5DH9B 4F7HA 4ZRJA 3FSSA 2D2QA 1NU2A 1M7EA 5C6RA 4GMVA 1PFJA 1GG3A 2GJYA 2RLOA 2EC1A 3AJ4A 2AL6A 1GC6A 2DLWA 4EKUA 1BTKA 3VOQA 1X86A 3TO1A 2QKLA 2QKMA 4K2PA 2OTXA 2UZRA 2I1KA 1ISNA 1XODA 2Y8GA 4YONA 4A6HA 3BJIA 1PLSA 2GCJA 3T06A 1WJ1A 2E2XA 2ZPYA 2H7EA 2J0KA 4BBKA 4A5KA 4CHJA 4IFSA 2P8VA 3PVUA 1RRPB 3ML4A 4CYEA 1X1FA 1MIZB 1UNQA 1KZGA 1TQZA 5EFXA 1FB8A 3D8DA 4A6FB 4K2OA 2P0FA 3DXEA 5KQ4A 4HHVA 4IOYX 1FAOA 1MK9B 4HB4B 3TFMA 3PSCA 2IYBA 1H10A 1OMWA 3PVWA 2I5FA 2R0DA 1FOEA 1P3RA 1RJ2A 2HTHB 1OY2A 1J0WA 4K17A 2KGXB 1I7AA 2CAYA 3ULBA 3SO6A 1OQNA 1MKEA 2YT0A 1UNPA 3X23A 3LJUX 2Z0PA 1SGHA 2MWNB 4DBBA 1MAIA 1H4RA 2D9YA
chains in the Genus database with same CATH superfamily
2Z59A 2ROZB 2H7DA 2DFKA 2K2JA 2COAA 4TYZA 4F7UP 1EF1A 3SNHA 4GZUA 1V88A 2ROVA 5DHAB 1QQGA 4WSFA 5LOPB 1K5GB 3B77A 1PMSA 4HDOA 3WA0A 2LULA 3PVLA 1M7RA 3G9WA 2D11A 3AU5A 2CY5A 4HB3B 5D3XA 2N23A 2D10A 4GN1A 2D9VA 1I2HA 2BCJA 3OANA 2EMSA 5J3YA 1FHOA 3BINA 3KY9A 3DXCA 1B55A 2R09A 1P6SA 3DXDA 5I2MA 5D3WA 2HE7A 5DIFB 2KIEA 1ZSQA 1W1GA 4KHOA 3D8EA 4IAPA 1NTVA 4H8SA 4KHAA 4DX90 3OHMB 1U5GA 5DI9B 4L6EA 5JP4A 1K5DB 2DX5A 1V5PA 2YS5A 1UPRA 4NY0A 5C79A 1DDVA 1WGQA 1W1DA 4MT7A 2P0HA 4NSWA 1XKEA 4C0AA 3PZDA 5HE0A 2RSGA 3TCAA 3U8ZA 1Y5OA 1EAZA 1X1GA 5KCVA 1U5EA 1U5FA 2AEHA 4XWXA 3FM8C 2GCLA 3TW1A 4HAVB 1LW3A 5D3YA 2W2XD 2RVBB 2D9ZA 2J0MA 2MFQA 1Z87A 5LG4B 3NSUA 2LOZA 3HSAA 5L81A 4OSNA 3IVFA 4HAYB 4HB2B 2J0JA 1ZVRA 2Z0OA 3FVCA 5J3QA 3F5RA 3P7ZA 2K49A 2YVCA 4F7GA 3KRXA 4CHMA 1KI1B 4QXAB 2NMBA 2DN6A 1SHCA 4Z2MB 2NZ8B 1GC7A 3NWAA 4KHBA 1EGXA 1V5MA 2YRYA 5HE1A 3SUZA 3M1IB 4KVGB 2YS1A 1U2BA 4ZRKA 2FJUB 2CRFA 4B6HA 1E5WA 4KHBB 1UNRA 2LYDA 2V76A 5GOWB 3MPXA 1N3HA 1ZC3B 3PEGA 2YF0A 2Q13A 3D8FA 1W1HA 5LONB 3WYFB 3TVVA 3HIEA 3KZ1A 3KRWA 2IFSA 1DYNA 1FHXA 2PZ1A 3N7CA 4HATB 2X18A 4DXAB 4A6KA 2DX1A 1DDWA 1XX0A 4HB0B 2KR0A 2DHIA 4QJ5B 2J59M 1BTNA 2DKPA 1UPQA 4EJNA 3HW2B 2Z0QA 2L1CA 2KUPA 4HAUB 4ZRIA 5JHGA 1X11A 1T77A 1XR0B 4WVFB 5J3TA 5KQ1A 2VKIA 1V61A 4HAZB 3DCXA 4HAWB 4DX8A 1UEFA 2UZSA 4MK0A 2MDXA 5JLJB 1MI1A 4HAXB 3ODOA 4HDQA 1NTYA 3SV1A 3QBVB 1FHWA 3A8PA 2YSZA 3NW8A 1IRSA 2CODA 5CLLB 1FGZA 1MIXA 2D9XA 2Z4DA 1WG7A 3U12A 2ADZA 2MKRA 3PG7A 4K81A 2GS0A 2COFA 4Z2NA 4EMOA 1FGYA 5FI1A 5C16A 2LG1A 4GMXB 3KSYA 5D27A 3ZDTA 2W2XC 3A58A 2M14A 3HQCA 1DDMA 1BAKA 1V5UA 3ZVRA 3CIKA 5HE2A 3FEHA 1DBHA 2ELAA 3A8QA 4PNKA 1EVHA 1LB1A 1TJ6A 2K00A 1Q67A 5C5BB 1X05A 2DYNA 2KIGA 2UVMA 4KAXB 1U29A 2Y8FA 3SYXA 4D0NB 2CY4A 4CSQA 1U5DA 2YT1A 2RNRB 2R2YA 2XQNM 2K2UA 2COCA 2DA0A 2KUQA 5HE3A 2DKQA 1WI1A 3PP2A 2EMTA 2YT2A 3ODWA 2D9WA 3QIJA 4PQ0A 2I1JA 4QJ4B 4MY6A 1QC6A 3AU4A 5DHFB 1J19A 2I5CA 4D6WA 1XCGA 5CLQB 2ZKMX 2Z14A 2W2WA 2EJ8A 5JHHA 2NBVA 3ULCA 4GPTB 1TXDA 2DTCA 1NI2A 2OQBA 2LOXA 2DHJA 3MDBC 1AWEA 3VIAA 1Y19B 2M38A 3NWFA 1ZM0A 3V5WA 1KZ7A 4P7IA 1AQCA 2RUKB 3UZTA 2K8EA 4L1RA 1DROA 3U7DA 1U27A 2RGNB 2DYQA 2G35A 4GXBA 4TKNA 3GYOA 1WJMA 3GYPA 2DHKA 2LKOA 2YS3A 2VSZA 3O96A 2KCJA 4OT1A 5C5BA 1MK7B 2P0DA 2ELBA 3P6AA 1XD4A 1P5TA 3CXBB 2N0YA 3F0WA 5FI0A 4YL8A 4A6FA 2L2IA 2JP2A 3A98B 2Y7BA 3QWMA 3NWDA 5M4YB 2VRWB 1V89A 2D4QA 4Y94A 3RCPA 4WJ7A 1ZC4B 1MPHA 3HK0A 3ODXA 5D3VA 1WVHA 2FJLA 1BWNA 1WGUA 5DH9B 4QJ3B 4F7HA 4ZRJA 3FSSA 2D2QA 2Z13A 1NU2A 1M7EA 5C6RA 4GMVA 1PFJA 1GG3A 2GJYA 2RLOA 2EC1A 3AJ4A 2AL6A 1GC6A 2DLWA 4EKUA 1BTKA 4GOUA 3VOQA 1X86A 3TO1A 2QKLA 2QKMA 4K2PA 2OTXA 5IRSA 2UZRA 2I1KA 1ISNA 1XODA 2Y8GA 4YONA 4A6HA 3BJIA 1PLSA 2GCJA 3T06A 1WJ1A 2E2XA 2ZPYA 2H7EA 2J0KA 4BBKA 4A5KA 4CHJA 4IFSA 2P8VA 3PVUA 1RRPB 3ML4A 4CYEA 5I2SA 1X1FA 1MIZB 1UNQA 4HSIA 1KZGA 1TQZA 5EFXA 4DIXA 1FB8A 3D8DA 4A6FB 4K2OA 2P0FA 3DXEA 5KQ4A 4HHVA 4IOYX 1FAOA 1MK9B 4HB4B 3TFMA 1ZYIA 4GNKB 2GUMA 3PSCA 2IYBA 1H10A 1OMWA 3PVWA 2I5FA 2R0DA 1FOEA 1P3RA 1RJ2A 2HTHB 1OY2A 1J0WA 2RRFA 4K17A 2KGXB 1I7AA 2CAYA 3ULBA 3SO6A 1OQNA 1MKEA 2YT0A 1UNPA 3X23A 3LJUX 2Z0PA 1SGHA 2MWNB 4DBBA 1MAIA 1H4RA 2D9YA
chains in the Genus database with same CATH topology
2ROZB 2H7DA 2DFKA 2K2JA 2COAA 4TYZA 4F7UP 1EF1A 3SNHA 4GZUA 1V88A 2ROVA 5DHAB 1QQGA 4WSFA 5LOPB 1K5GB 4HDOA 1PMSA 3WA0A 2LULA 3PVLA 1M7RA 3G9WA 2D11A 3AU5A 2CY5A 4HB3B 5D3XA 2N23A 2D10A 4GN1A 2D9VA 1I2HA 2BCJA 3OANA 2EMSA 5J3YA 1FHOA 3BINA 3KY9A 3DXCA 1B55A 2R09A 1P6SA 3DXDA 5D3WA 2HE7A 5DIFB 1ZSQA 1W1GA 4KHOA 3D8EA 4IAPA 1NTVA 4H8SA 4KHAA 4DX90 1U5GA 5DI9B 4L6EA 5JP4A 1K5DB 2DX5A 1V5PA 2YS5A 1UPRA 4NY0A 5C79A 1DDVA 1WGQA 1W1DA 4MT7A 2P0HA 4NSWA 1XKEA 4C0AA 3PZDA 5HE0A 2RSGA 3TCAA 3U8ZA 1Y5OA 1EAZA 1X1GA 5KCVA 1U5EA 1U5FA 2AEHA 4XWXA 3FM8C 2GCLA 3TW1A 4HAVB 1LW3A 5D3YA 2W2XD 2RVBB 2D9ZA 2J0MA 2MFQA 1Z87A 3NSUA 2LOZA 5L81A 3IVFA 4HAYB 4HB2B 2J0JA 1ZVRA 2Z0OA 5J3QA 3F5RA 3P7ZA 2YVCA 4F7GA 3KRXA 4CHMA 1KI1B 2NMBA 2DN6A 1SHCA 4Z2MB 2NZ8B 1GC7A 1EGXA 1V5MA 2YRYA 5HE1A 3SUZA 3M1IB 4KVGB 2YS1A 1U2BA 4ZRKA 2CRFA 4B6HA 1E5WA 4KHBB 1UNRA 2LYDA 2V76A 5GOWB 3MPXA 1N3HA 1ZC3B 3PEGA 2YF0A 2Q13A 3D8FA 1W1HA 5LONB 3WYFB 3TVVA 3KZ1A 3KRWA 2IFSA 1DYNA 1FHXA 2PZ1A 3N7CA 4HATB 2X18A 4DXAB 4A6KA 2DX1A 1DDWA 1XX0A 4HB0B 2DHIA 2J59M 1BTNA 2DKPA 1UPQA 4EJNA 3HW2B 2Z0QA 2L1CA 2KUPA 4HAUB 4ZRIA 5JHGA 1X11A 1XR0B 4WVFB 5J3TA 5KQ1A 2VKIA 1V61A 4HAZB 4HAWB 4DX8A 1UEFA 2UZSA 4MK0A 2MDXA 5JLJB 4HAXB 3ODOA 4HDQA 1NTYA 3SV1A 3QBVB 1FHWA 3A8PA 2YSZA 1IRSA 2CODA 5CLLB 1FGZA 1MIXA 2D9XA 1WG7A 2ADZA 2MKRA 3PG7A 4K81A 2GS0A 2COFA 4Z2NA 4EMOA 1FGYA 5FI1A 5C16A 2LG1A 4GMXB 3KSYA 5D27A 3ZDTA 2W2XC 2M14A 3HQCA 1DDMA 1BAKA 1V5UA 3ZVRA 3CIKA 5HE2A 3FEHA 1DBHA 2ELAA 3A8QA 4PNKA 1EVHA 1LB1A 1TJ6A 2K00A 1Q67A 5C5BB 1X05A 2DYNA 2UVMA 4KAXB 1U29A 2Y8FA 3SYXA 4D0NB 2CY4A 1U5DA 2YT1A 2RNRB 2XQNM 2K2UA 2COCA 2DA0A 5HE3A 2DKQA 1WI1A 3PP2A 2EMTA 3ODWA 2D9WA 3QIJA 4PQ0A 2I1JA 4MY6A 1QC6A 3AU4A 5DHFB 1J19A 2I5CA 1XCGA 5CLQB 2W2WA 2EJ8A 5JHHA 3ULCA 4GPTB 1TXDA 2DTCA 1NI2A 2OQBA 2LOXA 2DHJA 3MDBC 1AWEA 3VIAA 1Y19B 2M38A 3V5WA 1ZM0A 1KZ7A 4P7IA 1AQCA 2RUKB 3UZTA 1DROA 3U7DA 1U27A 2RGNB 2DYQA 2G35A 4GXBA 4TKNA 3GYOA 1WJMA 3GYPA 2DHKA 2LKOA 2YS3A 2VSZA 3O96A 2KCJA 5C5BA 1MK7B 2P0DA 2ELBA 3P6AA 1XD4A 1P5TA 3CXBB 2N0YA 3F0WA 5FI0A 4YL8A 4A6FA 2L2IA 2JP2A 3A98B 2Y7BA 3QWMA 2VRWB 1V89A 2D4QA 4Y94A 3RCPA 4WJ7A 1ZC4B 1MPHA 3HK0A 3ODXA 5D3VA 1WVHA 2FJLA 1BWNA 1WGUA 5DH9B 4F7HA 4ZRJA 3FSSA 2D2QA 1NU2A 1M7EA 5C6RA 4GMVA 1PFJA 1GG3A 2GJYA 2RLOA 2EC1A 3AJ4A 2AL6A 1GC6A 2DLWA 4EKUA 1BTKA 3VOQA 1X86A 3TO1A 2QKLA 2QKMA 4K2PA 2OTXA 2UZRA 2I1KA 1ISNA 1XODA 2Y8GA 4YONA 4A6HA 3BJIA 1PLSA 2GCJA 3T06A 1WJ1A 2E2XA 2ZPYA 2H7EA 2J0KA 4BBKA 4A5KA 4CHJA 4IFSA 2P8VA 3PVUA 1RRPB 3ML4A 4CYEA 1X1FA 1MIZB 1UNQA 1KZGA 1TQZA 5EFXA 1FB8A 3D8DA 4A6FB 4K2OA 2P0FA 3DXEA 5KQ4A 4HHVA 4IOYX 1FAOA 1MK9B 4HB4B 3TFMA 3PSCA 2IYBA 1H10A 1OMWA 3PVWA 2I5FA 2R0DA 1FOEA 1P3RA 1RJ2A 2HTHB 1OY2A 1J0WA 4K17A 2KGXB 1I7AA 2CAYA 3ULBA 3SO6A 1OQNA 1MKEA 2YT0A 1UNPA 3X23A 3LJUX 2Z0PA 1SGHA 2MWNB 4DBBA 1MAIA 1H4RA 2D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROZ B;  2H7D A;  2DFK A;  2K2J A;  2COA A;  4TYZ A;  4F7U P;  1EF1 A;  3SNH A;  4GZU A;  1V88 A;  2ROV A;  5DHA B;  1QQG A;  4WSF A;  5LOP B;  1K5G B;  4HDO A;  1PMS A;  3WA0 A;  2LUL A;  3PVL A;  1M7R A;  3G9W A;  2D11 A;  3AU5 A;  2CY5 A;  4HB3 B;  5D3X A;  2N23 A;  2D10 A;  4GN1 A;  2D9V A;  1I2H A;  2BCJ A;  3OAN A;  2EMS A;  5J3Y A;  1FHO A;  3BIN A;  3KY9 A;  3DXC A;  1B55 A;  2R09 A;  1P6S A;  3DXD A;  5D3W A;  2HE7 A;  5DIF B;  1ZSQ A;  1W1G A;  4KHO A;  3D8E A;  4IAP A;  1NTV A;  4H8S A;  4KHA A;  4DX9 0;  1U5G A;  5DI9 B;  4L6E A;  5JP4 A;  1K5D B;  2DX5 A;  1V5P A;  2YS5 A;  1UPR A;  4NY0 A;  5C79 A;  1DDV A;  1WGQ A;  1W1D A;  4MT7 A;  2P0H A;  4NSW A;  1XKE A;  4C0A A;  3PZD A;  5HE0 A;  2RSG A;  3TCA A;  3U8Z A;  1Y5O A;  1EAZ A;  1X1G A;  5KCV A;  1U5E A;  1U5F A;  2AEH A;  4XWX A;  3FM8 C;  2GCL A;  3TW1 A;  4HAV B;  1LW3 A;  5D3Y A;  2W2X D;  2RVB B;  2D9Z A;  2J0M A;  2MFQ A;  1Z87 A;  3NSU A;  2LOZ A;  5L81 A;  3IVF A;  4HAY B;  4HB2 B;  2J0J A;  1ZVR A;  2Z0O A;  5J3Q A;  3F5R A;  3P7Z A;  2YVC A;  4F7G A;  3KRX A;  4CHM A;  1KI1 B;  2NMB A;  2DN6 A;  1SHC A;  4Z2M B;  2NZ8 B;  1GC7 A;  1EGX A;  1V5M A;  2YRY A;  5HE1 A;  3SUZ A;  3M1I B;  4KVG B;  2YS1 A;  1U2B A;  4ZRK A;  2CRF A;  4B6H A;  1E5W A;  4KHB B;  1UNR A;  2LYD A;  2V76 A;  5GOW B;  3MPX A;  1N3H A;  1ZC3 B;  3PEG A;  2YF0 A;  2Q13 A;  3D8F A;  1W1H A;  5LON B;  3WYF B;  3TVV A;  3KZ1 A;  3KRW A;  2IFS A;  1DYN A;  1FHX A;  2PZ1 A;  3N7C A;  4HAT B;  2X18 A;  4DXA B;  4A6K A;  2DX1 A;  1DDW A;  1XX0 A;  4HB0 B;  2DHI A;  2J59 M;  1BTN A;  2DKP A;  1UPQ A;  4EJN A;  3HW2 B;  2Z0Q A;  2L1C A;  2KUP A;  4HAU B;  4ZRI A;  5JHG A;  1X11 A;  1XR0 B;  4WVF B;  5J3T A;  5KQ1 A;  2VKI A;  1V61 A;  4HAZ B;  4HAW B;  4DX8 A;  1UEF A;  2UZS A;  4MK0 A;  2MDX A;  5JLJ B;  4HAX B;  3ODO A;  4HDQ A;  1NTY A;  3SV1 A;  3QBV B;  1FHW A;  3A8P A;  2YSZ A;  1IRS A;  2COD A;  5CLL B;  1FGZ A;  1MIX A;  2D9X A;  1WG7 A;  2ADZ A;  2MKR A;  3PG7 A;  4K81 A;  2GS0 A;  2COF A;  4Z2N A;  4EMO A;  1FGY A;  5FI1 A;  5C16 A;  2LG1 A;  4GMX B;  3KSY A;  5D27 A;  3ZDT A;  2W2X C;  2M14 A;  3HQC A;  1DDM A;  1BAK A;  1V5U A;  3ZVR A;  3CIK A;  5HE2 A;  3FEH A;  1DBH A;  2ELA A;  3A8Q A;  4PNK A;  1EVH A;  1LB1 A;  1TJ6 A;  2K00 A;  1Q67 A;  5C5B B;  1X05 A;  2DYN A;  2UVM A;  4KAX B;  1U29 A;  2Y8F A;  3SYX A;  4D0N B;  2CY4 A;  1U5D A;  2YT1 A;  2RNR B;  2XQN M;  2K2U A;  2COC A;  2DA0 A;  5HE3 A;  2DKQ A;  1WI1 A;  3PP2 A;  2EMT A;  3ODW A;  2D9W A;  3QIJ A;  4PQ0 A;  2I1J A;  4MY6 A;  1QC6 A;  3AU4 A;  5DHF B;  1J19 A;  2I5C A;  1XCG A;  5CLQ B;  2W2W A;  2EJ8 A;  5JHH A;  3ULC A;  4GPT B;  1TXD A;  2DTC A;  1NI2 A;  2OQB A;  2LOX A;  2DHJ A;  3MDB C;  1AWE A;  3VIA A;  1Y19 B;  2M38 A;  3V5W A;  1ZM0 A;  1KZ7 A;  4P7I A;  1AQC A;  2RUK B;  3UZT A;  1DRO A;  3U7D A;  1U27 A;  2RGN B;  2DYQ A;  2G35 A;  4GXB A;  4TKN A;  3GYO A;  1WJM A;  3GYP A;  2DHK A;  2LKO A;  2YS3 A;  2VSZ A;  3O96 A;  2KCJ A;  5C5B A;  1MK7 B;  2P0D A;  2ELB A;  3P6A A;  1XD4 A;  1P5T A;  3CXB B;  2N0Y A;  3F0W A;  5FI0 A;  4YL8 A;  4A6F A;  2L2I A;  2JP2 A;  3A98 B;  2Y7B A;  3QWM A;  2VRW B;  1V89 A;  2D4Q A;  4Y94 A;  3RCP A;  4WJ7 A;  1ZC4 B;  1MPH A;  3HK0 A;  3ODX A;  5D3V A;  1WVH A;  2FJL A;  1BWN A;  1WGU A;  5DH9 B;  4F7H A;  4ZRJ A;  3FSS A;  2D2Q A;  1NU2 A;  1M7E A;  5C6R A;  4GMV A;  1PFJ A;  1GG3 A;  2GJY A;  2RLO A;  2EC1 A;  3AJ4 A;  2AL6 A;  1GC6 A;  2DLW A;  4EKU A;  1BTK A;  3VOQ A;  1X86 A;  3TO1 A;  2QKL A;  2QKM A;  4K2P A;  2OTX A;  2UZR A;  2I1K A;  1ISN A;  1XOD A;  2Y8G A;  4YON A;  4A6H A;  3BJI A;  1PLS A;  2GCJ A;  3T06 A;  1WJ1 A;  2E2X A;  2ZPY A;  2H7E A;  2J0K A;  4BBK A;  4A5K A;  4CHJ A;  4IFS A;  2P8V A;  3PVU A;  1RRP B;  3ML4 A;  4CYE A;  1X1F A;  1MIZ B;  1UNQ A;  1KZG A;  1TQZ A;  5EFX A;  1FB8 A;  3D8D A;  4A6F B;  4K2O A;  2P0F A;  3DXE A;  5KQ4 A;  4HHV A;  4IOY X;  1FAO A;  1MK9 B;  4HB4 B;  3TFM A;  3PSC A;  2IYB A;  1H10 A;  1OMW A;  3PVW A;  2I5F A;  2R0D A;  1FOE A;  1P3R A;  1RJ2 A;  2HTH B;  1OY2 A;  1J0W A;  4K17 A;  2KGX B;  1I7A A;  2CAY A;  3ULB A;  3SO6 A;  1OQN A;  1MKE A;  2YT0 A;  1UNP A;  3X23 A;  3LJU X;  2Z0P A;  1SGH A;  2MWN B;  4DBB A;  1MAI A;  1H4R A;  2D9Y A; 
#chains in the Genus database with same CATH topology
 2Z59 A;  2ROZ B;  2H7D A;  2DFK A;  2K2J A;  2COA A;  4TYZ A;  4F7U P;  1EF1 A;  3SNH A;  4GZU A;  1V88 A;  2ROV A;  5DHA B;  1QQG A;  4WSF A;  5LOP B;  1K5G B;  3B77 A;  1PMS A;  4HDO A;  3WA0 A;  2LUL A;  3PVL A;  1M7R A;  3G9W A;  2D11 A;  3AU5 A;  2CY5 A;  4HB3 B;  5D3X A;  2N23 A;  2D10 A;  4GN1 A;  2D9V A;  1I2H A;  2BCJ A;  3OAN A;  2EMS A;  5J3Y A;  1FHO A;  3BIN A;  3KY9 A;  3DXC A;  1B55 A;  2R09 A;  1P6S A;  3DXD A;  5I2M A;  5D3W A;  2HE7 A;  5DIF B;  2KIE A;  1ZSQ A;  1W1G A;  4KHO A;  3D8E A;  4IAP A;  1NTV A;  4H8S A;  4KHA A;  4DX9 0;  3OHM B;  1U5G A;  5DI9 B;  4L6E A;  5JP4 A;  1K5D B;  2DX5 A;  1V5P A;  2YS5 A;  1UPR A;  4NY0 A;  5C79 A;  1DDV A;  1WGQ A;  1W1D A;  4MT7 A;  2P0H A;  4NSW A;  1XKE A;  4C0A A;  3PZD A;  5HE0 A;  2RSG A;  3TCA A;  3U8Z A;  1Y5O A;  1EAZ A;  1X1G A;  5KCV A;  1U5E A;  1U5F A;  2AEH A;  4XWX A;  3FM8 C;  2GCL A;  3TW1 A;  4HAV B;  1LW3 A;  5D3Y A;  2W2X D;  2RVB B;  2D9Z A;  2J0M A;  2MFQ A;  1Z87 A;  5LG4 B;  3NSU A;  2LOZ A;  3HSA A;  5L81 A;  4OSN A;  3IVF A;  4HAY B;  4HB2 B;  2J0J A;  1ZVR A;  2Z0O A;  3FVC A;  5J3Q A;  3F5R A;  3P7Z A;  2K49 A;  2YVC A;  4F7G A;  3KRX A;  4CHM A;  1KI1 B;  4QXA B;  2NMB A;  2DN6 A;  1SHC A;  4Z2M B;  2NZ8 B;  1GC7 A;  3NWA A;  4KHB A;  1EGX A;  1V5M A;  2YRY A;  5HE1 A;  3SUZ A;  3M1I B;  4KVG B;  2YS1 A;  1U2B A;  4ZRK A;  2FJU B;  2CRF A;  4B6H A;  1E5W A;  4KHB B;  1UNR A;  2LYD A;  2V76 A;  5GOW B;  3MPX A;  1N3H A;  1ZC3 B;  3PEG A;  2YF0 A;  2Q13 A;  3D8F A;  1W1H A;  5LON B;  3WYF B;  3TVV A;  3HIE A;  3KZ1 A;  3KRW A;  2IFS A;  1DYN A;  1FHX A;  2PZ1 A;  3N7C A;  4HAT B;  2X18 A;  4DXA B;  4A6K A;  2DX1 A;  1DDW A;  1XX0 A;  4HB0 B;  2KR0 A;  2DHI A;  4QJ5 B;  2J59 M;  1BTN A;  2DKP A;  1UPQ A;  4EJN A;  3HW2 B;  2Z0Q A;  2L1C A;  2KUP A;  4HAU B;  4ZRI A;  5JHG A;  1X11 A;  1T77 A;  1XR0 B;  4WVF B;  5J3T A;  5KQ1 A;  2VKI A;  1V61 A;  4HAZ B;  3DCX A;  4HAW B;  4DX8 A;  1UEF A;  2UZS A;  4MK0 A;  2MDX A;  5JLJ B;  1MI1 A;  4HAX B;  3ODO A;  4HDQ A;  1NTY A;  3SV1 A;  3QBV B;  1FHW A;  3A8P A;  2YSZ A;  3NW8 A;  1IRS A;  2COD A;  5CLL B;  1FGZ A;  1MIX A;  2D9X A;  2Z4D A;  1WG7 A;  3U12 A;  2ADZ A;  2MKR A;  3PG7 A;  4K81 A;  2GS0 A;  2COF A;  4Z2N A;  4EMO A;  1FGY A;  5FI1 A;  5C16 A;  2LG1 A;  4GMX B;  3KSY A;  5D27 A;  3ZDT A;  2W2X C;  3A58 A;  2M14 A;  3HQC A;  1DDM A;  1BAK A;  1V5U A;  3ZVR A;  3CIK A;  5HE2 A;  3FEH A;  1DBH A;  2ELA A;  3A8Q A;  4PNK A;  1EVH A;  1LB1 A;  1TJ6 A;  2K00 A;  1Q67 A;  5C5B B;  1X05 A;  2DYN A;  2KIG A;  2UVM A;  4KAX B;  1U29 A;  2Y8F A;  3SYX A;  4D0N B;  2CY4 A;  4CSQ A;  1U5D A;  2YT1 A;  2RNR B;  2R2Y A;  2XQN M;  2K2U A;  2COC A;  2DA0 A;  2KUQ A;  5HE3 A;  2DKQ A;  1WI1 A;  3PP2 A;  2EMT A;  2YT2 A;  3ODW A;  2D9W A;  3QIJ A;  4PQ0 A;  2I1J A;  4QJ4 B;  4MY6 A;  1QC6 A;  3AU4 A;  5DHF B;  1J19 A;  2I5C A;  4D6W A;  1XCG A;  5CLQ B;  2ZKM X;  2Z14 A;  2W2W A;  2EJ8 A;  5JHH A;  2NBV A;  3ULC A;  4GPT B;  1TXD A;  2DTC A;  1NI2 A;  2OQB A;  2LOX A;  2DHJ A;  3MDB C;  1AWE A;  3VIA A;  1Y19 B;  2M38 A;  3NWF A;  1ZM0 A;  3V5W A;  1KZ7 A;  4P7I A;  1AQC A;  2RUK B;  3UZT A;  2K8E A;  4L1R A;  1DRO A;  3U7D A;  1U27 A;  2RGN B;  2DYQ A;  2G35 A;  4GXB A;  4TKN A;  3GYO A;  1WJM A;  3GYP A;  2DHK A;  2LKO A;  2YS3 A;  2VSZ A;  3O96 A;  2KCJ A;  4OT1 A;  5C5B A;  1MK7 B;  2P0D A;  2ELB A;  3P6A A;  1XD4 A;  1P5T A;  3CXB B;  2N0Y A;  3F0W A;  5FI0 A;  4YL8 A;  4A6F A;  2L2I A;  2JP2 A;  3A98 B;  2Y7B A;  3QWM A;  3NWD A;  5M4Y B;  2VRW B;  1V89 A;  2D4Q A;  4Y94 A;  3RCP A;  4WJ7 A;  1ZC4 B;  1MPH A;  3HK0 A;  3ODX A;  5D3V A;  1WVH A;  2FJL A;  1BWN A;  1WGU A;  5DH9 B;  4QJ3 B;  4F7H A;  4ZRJ A;  3FSS A;  2D2Q A;  2Z13 A;  1NU2 A;  1M7E A;  5C6R A;  4GMV A;  1PFJ A;  1GG3 A;  2GJY A;  2RLO A;  2EC1 A;  3AJ4 A;  2AL6 A;  1GC6 A;  2DLW A;  4EKU A;  1BTK A;  4GOU A;  3VOQ A;  1X86 A;  3TO1 A;  2QKL A;  2QKM A;  4K2P A;  2OTX A;  5IRS A;  2UZR A;  2I1K A;  1ISN A;  1XOD A;  2Y8G A;  4YON A;  4A6H A;  3BJI A;  1PLS A;  2GCJ A;  3T06 A;  1WJ1 A;  2E2X A;  2ZPY A;  2H7E A;  2J0K A;  4BBK A;  4A5K A;  4CHJ A;  4IFS A;  2P8V A;  3PVU A;  1RRP B;  3ML4 A;  4CYE A;  5I2S A;  1X1F A;  1MIZ B;  1UNQ A;  4HSI A;  1KZG A;  1TQZ A;  5EFX A;  4DIX A;  1FB8 A;  3D8D A;  4A6F B;  4K2O A;  2P0F A;  3DXE A;  5KQ4 A;  4HHV A;  4IOY X;  1FAO A;  1MK9 B;  4HB4 B;  3TFM A;  1ZYI A;  4GNK B;  2GUM A;  3PSC A;  2IYB A;  1H10 A;  1OMW A;  3PVW A;  2I5F A;  2R0D A;  1FOE A;  1P3R A;  1RJ2 A;  2HTH B;  1OY2 A;  1J0W A;  2RRF A;  4K17 A;  2KGX B;  1I7A A;  2CAY A;  3ULB A;  3SO6 A;  1OQN A;  1MKE A;  2YT0 A;  1UNP A;  3X23 A;  3LJU X;  2Z0P A;  1SGH A;  2MWN B;  4DBB A;  1MAI A;  1H4R A;  2D9Y A; 
#chains in the Genus database with same CATH homology
 2ROZ B;  2H7D A;  2DFK A;  2K2J A;  2COA A;  4TYZ A;  4F7U P;  1EF1 A;  3SNH A;  4GZU A;  1V88 A;  2ROV A;  5DHA B;  1QQG A;  4WSF A;  5LOP B;  1K5G B;  4HDO A;  1PMS A;  3WA0 A;  2LUL A;  3PVL A;  1M7R A;  3G9W A;  2D11 A;  3AU5 A;  2CY5 A;  4HB3 B;  5D3X A;  2N23 A;  2D10 A;  4GN1 A;  2D9V A;  1I2H A;  2BCJ A;  3OAN A;  2EMS A;  5J3Y A;  1FHO A;  3BIN A;  3KY9 A;  3DXC A;  1B55 A;  2R09 A;  1P6S A;  3DXD A;  5D3W A;  2HE7 A;  5DIF B;  1ZSQ A;  1W1G A;  4KHO A;  3D8E A;  4IAP A;  1NTV A;  4H8S A;  4KHA A;  4DX9 0;  1U5G A;  5DI9 B;  4L6E A;  5JP4 A;  1K5D B;  2DX5 A;  1V5P A;  2YS5 A;  1UPR A;  4NY0 A;  5C79 A;  1DDV A;  1WGQ A;  1W1D A;  4MT7 A;  2P0H A;  4NSW A;  1XKE A;  4C0A A;  3PZD A;  5HE0 A;  2RSG A;  3TCA A;  3U8Z A;  1Y5O A;  1EAZ A;  1X1G A;  5KCV A;  1U5E A;  1U5F A;  2AEH A;  4XWX A;  3FM8 C;  2GCL A;  3TW1 A;  4HAV B;  1LW3 A;  5D3Y A;  2W2X D;  2RVB B;  2D9Z A;  2J0M A;  2MFQ A;  1Z87 A;  3NSU A;  2LOZ A;  5L81 A;  3IVF A;  4HAY B;  4HB2 B;  2J0J A;  1ZVR A;  2Z0O A;  5J3Q A;  3F5R A;  3P7Z A;  2YVC A;  4F7G A;  3KRX A;  4CHM A;  1KI1 B;  2NMB A;  2DN6 A;  1SHC A;  4Z2M B;  2NZ8 B;  1GC7 A;  1EGX A;  1V5M A;  2YRY A;  5HE1 A;  3SUZ A;  3M1I B;  4KVG B;  2YS1 A;  1U2B A;  4ZRK A;  2CRF A;  4B6H A;  1E5W A;  4KHB B;  1UNR A;  2LYD A;  2V76 A;  5GOW B;  3MPX A;  1N3H A;  1ZC3 B;  3PEG A;  2YF0 A;  2Q13 A;  3D8F A;  1W1H A;  5LON B;  3WYF B;  3TVV A;  3KZ1 A;  3KRW A;  2IFS A;  1DYN A;  1FHX A;  2PZ1 A;  3N7C A;  4HAT B;  2X18 A;  4DXA B;  4A6K A;  2DX1 A;  1DDW A;  1XX0 A;  4HB0 B;  2DHI A;  2J59 M;  1BTN A;  2DKP A;  1UPQ A;  4EJN A;  3HW2 B;  2Z0Q A;  2L1C A;  2KUP A;  4HAU B;  4ZRI A;  5JHG A;  1X11 A;  1XR0 B;  4WVF B;  5J3T A;  5KQ1 A;  2VKI A;  1V61 A;  4HAZ B;  4HAW B;  4DX8 A;  1UEF A;  2UZS A;  4MK0 A;  2MDX A;  5JLJ B;  4HAX B;  3ODO A;  4HDQ A;  1NTY A;  3SV1 A;  3QBV B;  1FHW A;  3A8P A;  2YSZ A;  1IRS A;  2COD A;  5CLL B;  1FGZ A;  1MIX A;  2D9X A;  1WG7 A;  2ADZ A;  2MKR A;  3PG7 A;  4K81 A;  2GS0 A;  2COF A;  4Z2N A;  4EMO A;  1FGY A;  5FI1 A;  5C16 A;  2LG1 A;  4GMX B;  3KSY A;  5D27 A;  3ZDT A;  2W2X C;  2M14 A;  3HQC A;  1DDM A;  1BAK A;  1V5U A;  3ZVR A;  3CIK A;  5HE2 A;  3FEH A;  1DBH A;  2ELA A;  3A8Q A;  4PNK A;  1EVH A;  1LB1 A;  1TJ6 A;  2K00 A;  1Q67 A;  5C5B B;  1X05 A;  2DYN A;  2UVM A;  4KAX B;  1U29 A;  2Y8F A;  3SYX A;  4D0N B;  2CY4 A;  1U5D A;  2YT1 A;  2RNR B;  2XQN M;  2K2U A;  2COC A;  2DA0 A;  5HE3 A;  2DKQ A;  1WI1 A;  3PP2 A;  2EMT A;  3ODW A;  2D9W A;  3QIJ A;  4PQ0 A;  2I1J A;  4MY6 A;  1QC6 A;  3AU4 A;  5DHF B;  1J19 A;  2I5C A;  1XCG A;  5CLQ B;  2W2W A;  2EJ8 A;  5JHH A;  3ULC A;  4GPT B;  1TXD A;  2DTC A;  1NI2 A;  2OQB A;  2LOX A;  2DHJ A;  3MDB C;  1AWE A;  3VIA A;  1Y19 B;  2M38 A;  3V5W A;  1ZM0 A;  1KZ7 A;  4P7I A;  1AQC A;  2RUK B;  3UZT A;  1DRO A;  3U7D A;  1U27 A;  2RGN B;  2DYQ A;  2G35 A;  4GXB A;  4TKN A;  3GYO A;  1WJM A;  3GYP A;  2DHK A;  2LKO A;  2YS3 A;  2VSZ A;  3O96 A;  2KCJ A;  5C5B A;  1MK7 B;  2P0D A;  2ELB A;  3P6A A;  1XD4 A;  1P5T A;  3CXB B;  2N0Y A;  3F0W A;  5FI0 A;  4YL8 A;  4A6F A;  2L2I A;  2JP2 A;  3A98 B;  2Y7B A;  3QWM A;  2VRW B;  1V89 A;  2D4Q A;  4Y94 A;  3RCP A;  4WJ7 A;  1ZC4 B;  1MPH A;  3HK0 A;  3ODX A;  5D3V A;  1WVH A;  2FJL A;  1BWN A;  1WGU A;  5DH9 B;  4F7H A;  4ZRJ A;  3FSS A;  2D2Q A;  1NU2 A;  1M7E A;  5C6R A;  4GMV A;  1PFJ A;  1GG3 A;  2GJY A;  2RLO A;  2EC1 A;  3AJ4 A;  2AL6 A;  1GC6 A;  2DLW A;  4EKU A;  1BTK A;  3VOQ A;  1X86 A;  3TO1 A;  2QKL A;  2QKM A;  4K2P A;  2OTX A;  2UZR A;  2I1K A;  1ISN A;  1XOD A;  2Y8G A;  4YON A;  4A6H A;  3BJI A;  1PLS A;  2GCJ A;  3T06 A;  1WJ1 A;  2E2X A;  2ZPY A;  2H7E A;  2J0K A;  4BBK A;  4A5K A;  4CHJ A;  4IFS A;  2P8V A;  3PVU A;  1RRP B;  3ML4 A;  4CYE A;  1X1F A;  1MIZ B;  1UNQ A;  1KZG A;  1TQZ A;  5EFX A;  1FB8 A;  3D8D A;  4A6F B;  4K2O A;  2P0F A;  3DXE A;  5KQ4 A;  4HHV A;  4IOY X;  1FAO A;  1MK9 B;  4HB4 B;  3TFM A;  3PSC A;  2IYB A;  1H10 A;  1OMW A;  3PVW A;  2I5F A;  2R0D A;  1FOE A;  1P3R A;  1RJ2 A;  2HTH B;  1OY2 A;  1J0W A;  4K17 A;  2KGX B;  1I7A A;  2CAY A;  3ULB A;  3SO6 A;  1OQN A;  1MKE A;  2YT0 A;  1UNP A;  3X23 A;  3LJU X;  2Z0P A;  1SGH A;  2MWN B;  4DBB A;  1MAI A;  1H4R A;  2D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...