5DH9B

Crystal structure of pki nes flip mutant peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
b'HFEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 35
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dh9B00
4A6HA 4EJNA 2YT0A 3TCAA 3N7CA 2R09A 2Y8FA 2YT1A 3WYFB 2KGXB 2CY5A 1X11A 1UNRA 1EF1A 2V76A 3P6AA 4GN1A 2H7DA 4HHVA 1J19A 2HTHB 3KRXA 4A6FA 1KI1B 2QKLA 1K5DB 3ULCA 3GYOA 1J0WA 4F7HA 2J59M 2I1JA 2G35A 1ZSQA 4GZUA 2DHIA 1WI1A 4K2PA 1NU2A 5HE0A 5FI1A 2E2XA 3QBVB 1FAOA 5JLJB 1DBHA 1LB1A 1OY2A 1P5TA 2RVBB 3PZDA 1UNPA 1Y19B 2RSGA 1FB8A 3ZDTA 2M14A 1V88A 2CRFA 4KHBB 3M1IB 3SNHA 1OMWA 5C5BA 4WSFA 2CY4A 1UPRA 1U27A 5C16A 2YRYA 4KHOA 2AL6A 2D9ZA 2VSZA 5J3TA 4MK0A 1DROA 4EKUA 2RNRB 1WGUA 2MFQA 1V61A 2XQNM 3FM8C 4A6FB 1AQCA 3ODXA 2I1KA 1BTKA 2UZRA 1V5MA 1U5FA 2L2IA 5LONB 2D9XA 3HW2B 2CODA 2W2WA 4PQ0A 1Q67A 1X05A 3DXCA 5J3YA 2GS0A 2GCJA 3CIKA 1RJ2A 4XWXA 3KY9A 5C6RA 1M7EA 4KHAA 2DX1A 2BCJA 3KSYA 2NMBA 4HB2B 2GCLA 2W2XC 3QIJA 4Z2NA 2P0DA 2COCA 4ZRIA 5KCVA 3DXEA 3IVFA 2KUPA 2D4QA 5C5BB 2LYDA 3X23A 1U2BA 2YS1A 3P7ZA 3QWMA 2J0MA 2DLWA 3SV1A 4A5KA 2MWNB 4KVGB 4K17A 2DN6A 4GPTB 3SO6A 5JHHA 4IOYX 3TW1A 2YS3A 5D27A 3ZVRA 1DYNA 3FEHA 2D9YA 5EFXA 2ZPYA 1TQZA 4HDOA 3CXBB 4NY0A 3D8FA 2Z0OA 4CHMA 3OANA 2QKMA 1I2HA 4HB0B 2IYBA 2Q13A 4GMVA 2IFSA 1GC7A 4MY6A 4F7UP 2DHKA 2JP2A 2NZ8B 3FSSA 1WJ1A 2J0JA 1MKEA 1MK7B 3MDBC 2Y7BA 3NSUA 1W1DA 1IRSA 4C0AA 1X1FA 1I7AA 1U5GA 1ZC4B 2HE7A 1XCGA 4KAXB 4DX8A 4GMXB 4K2OA 2LOXA 5KQ4A 1TXDA 4HAXB 4B6HA 1MIZB 1PLSA 2DKQA 3A8QA 4TYZA 4EMOA 3VIAA 1PMSA 3HQCA 2AEHA 3AU5A 2LULA 5HE1A 4K81A 3A8PA 5C79A 2OTXA 2DX5A 1DDVA 1MK9B 1V5PA 4A6KA 1NTVA 5DH9B 4H8SA 2ELBA 2DFKA 5D3XA 1WGQA 1SGHA 1DDWA 1EGXA 3LJUX 4D0NB 3BJIA 3V5WA 2RGNB 3GYPA 5D3VA 4IAPA 2RUKB 2COFA 4Z2MB 5D3YA 2Z0PA 5DI9B 1V5UA 4HAWB 1ZVRA 1MIXA 3WA0A 2M38A 3SUZA 4HB3B 5JP4A 1AWEA 1XR0B 5LOPB 1FHWA 2N23A 2KCJA 3TVVA 2UVMA 3U8ZA 1XD4A 1KZ7A 3ODOA 1W1HA 2YVCA 5KQ1A 2COAA 3T06A 4HAYB 5JHGA 3ULBA 3PEGA 1EVHA 2GJYA 4CYEA 2K00A 2LKOA 4HDQA 1X1GA 4HAZB 1B55A 1XODA 3PP2A 5DIFB 1LW3A 2I5FA 2EJ8A 2R0DA 2ROZB 1GG3A 1UPQA 3F5RA 4DXAB 2YS5A 1UNQA 2ADZA 2VRWB 4ZRJA 5HE3A 2LOZA 1N3HA 1WJMA 2X18A 1FHOA 1BTNA 3VOQA 5D3WA 2DYQA 1BWNA 3PVWA 3AJ4A 1NI2A 2DHJA 1K5GB 1WG7A 2DYNA 1H4RA 1RRPB 5L81A 1M7RA 2J0KA 3MPXA 5GOWB 1E5WA 1WVHA 1UEFA 3AU4A 4CHJA 3ODWA 1MPHA 3SYXA 4TKNA 1U5DA 1X86A 2Y8GA 2P8VA 1PFJA 2OQBA 4WVFB 1FGZA 2MDXA 3KRWA 1FHXA 1ZC3B 4MT7A 1P6SA 2D10A 2Z0QA 2EMSA 2D9VA 1BAKA 4IFSA 3PVLA 4HAVB 4BBKA 1XKEA 3KZ1A 5CLQB 4HB4B 3D8DA 3F0WA 5HE2A 4ZRKA 1Y5OA 5DHAB 3O96A 5DHFB 2ROVA 2CAYA 1XX0A 3U7DA 1OQNA 1V89A 2W2XD 2VKIA 2UZSA 1DDMA 1NTYA 1EAZA 2H7EA 3TFMA 4DBBA 3PSCA 2LG1A 2FJLA 1U5EA 4L6EA 1W1GA 1ZM0A 2K2JA 2MKRA 2D9WA 4P7IA 2DA0A 3PVUA 1QQGA 2D11A 2L1CA 5FI0A 2EC1A 1U29A 3UZTA 2K2UA 1TJ6A 5J3QA 2D2QA 3PG7A 2YF0A 4GXBA 2N0YA 4PNKA 1Z87A 1FGYA 2EMTA 4HATB 3D8EA 3G9WA 3RCPA 2PZ1A 1QC6A 2DTCA 2I5CA 3HK0A 5CLLB 3DXDA 4F7GA 3ML4A 4YL8A 1P3RA 4WJ7A 3BINA 4Y94A 3A98B 2YSZA 4NSWA 2P0HA 4HAUB 1SHCA 1ISNA 1H10A 4DX90 1FOEA 2ELAA 2P0FA 1MAIA 2RLOA 3TO1A 1GC6A 1KZGA 4YONA 2DKPA
chains in the Genus database with same CATH superfamily
5I2MA 4A6HA 4EJNA 2YT0A 3A58A 3NWDA 3TCAA 4KHBA 3N7CA 2GUMA 2R09A 2Y8FA 2YT1A 3WYFB 2KGXB 2CY5A 1X11A 1UNRA 1EF1A 2V76A 4HSIA 4OT1A 3P6AA 4GN1A 2H7DA 4HHVA 1J19A 2HTHB 3KRXA 4DIXA 4A6FA 1KI1B 2QKLA 1K5DB 3ULCA 3GYOA 1J0WA 4F7HA 2J59M 2I1JA 2G35A 1ZSQA 4GZUA 2DHIA 1WI1A 4K2PA 1NU2A 5HE0A 5FI1A 2E2XA 3U12A 3QBVB 1FAOA 5JLJB 1DBHA 1LB1A 1OY2A 1P5TA 2RVBB 3PZDA 1UNPA 1Y19B 2RSGA 1FB8A 3ZDTA 2M14A 1V88A 2CRFA 4KHBB 3M1IB 3SNHA 1OMWA 5C5BA 4WSFA 2CY4A 2Z59A 1UPRA 1U27A 4GOUA 5C16A 2YRYA 4KHOA 2AL6A 2D9ZA 2VSZA 5J3TA 3OHMB 4MK0A 1DROA 4EKUA 2RNRB 1WGUA 2MFQA 1V61A 2XQNM 3FM8C 4A6FB 1AQCA 3ODXA 2I1KA 1BTKA 2UZRA 1V5MA 1U5FA 2L2IA 5LONB 2D9XA 3HW2B 2CODA 2W2WA 4PQ0A 1Q67A 1X05A 3DXCA 5J3YA 2GS0A 2GCJA 3CIKA 1RJ2A 4XWXA 3KY9A 5C6RA 1M7EA 4KHAA 2DX1A 2KIEA 2BCJA 3FVCA 2NMBA 3KSYA 2GCLA 4HB2B 2W2XC 3QIJA 4Z2NA 2P0DA 2COCA 4ZRIA 5KCVA 3DXEA 3IVFA 2KUPA 2D4QA 5C5BB 2LYDA 3X23A 1U2BA 2YS1A 3P7ZA 3QWMA 2J0MA 2DLWA 3SV1A 4A5KA 1ZYIA 2MWNB 4KVGB 4K17A 2DN6A 4GPTB 3SO6A 3NWAA 5JHHA 4IOYX 3TW1A 2YS3A 5D27A 3ZVRA 1DYNA 3FEHA 2D9YA 5EFXA 4GNKB 2ZPYA 1TQZA 4HDOA 3CXBB 2ZKMX 4NY0A 3D8FA 2Z0OA 4CHMA 3OANA 2QKMA 1I2HA 4HB0B 5M4YB 2IYBA 2Q13A 4OSNA 4GMVA 2IFSA 1GC7A 4MY6A 4F7UP 2DHKA 2JP2A 2NZ8B 3FSSA 2Z4DA 1WJ1A 2J0JA 1MKEA 1MK7B 3MDBC 4L1RA 2Y7BA 3NSUA 1W1DA 1IRSA 4C0AA 1X1FA 1I7AA 3B77A 1U5GA 1ZC4B 2HE7A 1XCGA 4KAXB 4DX8A 4GMXB 3NWFA 4K2OA 2LOXA 5KQ4A 1TXDA 4HAXB 4B6HA 1MIZB 1PLSA 2DKQA 3A8QA 2FJUB 4TYZA 4EMOA 3VIAA 1PMSA 3HQCA 2AEHA 3AU5A 2LULA 2K8EA 5HE1A 4K81A 3A8PA 5C79A 2OTXA 2DX5A 1DDVA 1MK9B 1V5PA 2R2YA 4A6KA 1NTVA 5DH9B 4H8SA 2ELBA 4QJ5B 2DFKA 5D3XA 1WGQA 1SGHA 1DDWA 1EGXA 3LJUX 3HIEA 4D0NB 3BJIA 3NW8A 3V5WA 2RGNB 5IRSA 3GYPA 5D3VA 4IAPA 2RUKB 2COFA 4Z2MB 5D3YA 2Z0PA 5DI9B 1V5UA 4HAWB 4QJ4B 1ZVRA 1MIXA 3WA0A 2M38A 3SUZA 4HB3B 5JP4A 1AWEA 2RRFA 1XR0B 5LOPB 4QJ3B 1FHWA 2N23A 2KCJA 3TVVA 2UVMA 3U8ZA 1XD4A 1KZ7A 3ODOA 1W1HA 2YVCA 5KQ1A 2COAA 3T06A 4HAYB 5JHGA 3ULBA 3PEGA 1EVHA 2GJYA 4CYEA 2K00A 2LKOA 4HDQA 1X1GA 4HAZB 1B55A 1XODA 3PP2A 5DIFB 1LW3A 2I5FA 3DCXA 2EJ8A 2R0DA 2ROZB 1GG3A 1UPQA 3F5RA 4DXAB 2YS5A 1UNQA 2ADZA 2VRWB 4ZRJA 5HE3A 2LOZA 1N3HA 1WJMA 2X18A 1FHOA 1BTNA 3VOQA 2YT2A 5D3WA 2DYQA 1BWNA 3PVWA 3AJ4A 1NI2A 2DHJA 1K5GB 1WG7A 2DYNA 1H4RA 2Z13A 1RRPB 5L81A 1M7RA 2J0KA 3MPXA 5GOWB 1E5WA 1WVHA 1UEFA 3AU4A 4CHJA 3HSAA 3ODWA 1MPHA 2NBVA 4TKNA 3SYXA 1U5DA 1X86A 2Y8GA 2P8VA 1PFJA 2OQBA 4WVFB 1FGZA 2MDXA 3KRWA 1FHXA 1ZC3B 4MT7A 1P6SA 2D10A 2Z0QA 2EMSA 2D9VA 1BAKA 4QXAB 4IFSA 3PVLA 4HAVB 4BBKA 1XKEA 3KZ1A 5CLQB 4HB4B 3D8DA 3F0WA 5HE2A 4ZRKA 1Y5OA 5DHAB 3O96A 5DHFB 2ROVA 2CAYA 4CSQA 1XX0A 3U7DA 1OQNA 1V89A 2W2XD 2VKIA 2UZSA 1DDMA 1NTYA 1EAZA 2H7EA 3TFMA 4DBBA 3PSCA 2LG1A 2FJLA 1U5EA 4L6EA 1W1GA 1ZM0A 2K2JA 2MKRA 2D9WA 5LG4B 4P7IA 2DA0A 3PVUA 5I2SA 1QQGA 2D11A 2L1CA 5FI0A 2EC1A 1U29A 3UZTA 2K2UA 1TJ6A 5J3QA 2D2QA 3PG7A 2YF0A 2Z14A 4GXBA 2N0YA 2KR0A 4PNKA 1Z87A 1FGYA 2EMTA 4HATB 3D8EA 1T77A 3G9WA 3RCPA 2PZ1A 1QC6A 2DTCA 2I5CA 3HK0A 5CLLB 3DXDA 4F7GA 3ML4A 4YL8A 1P3RA 4WJ7A 3BINA 2KIGA 4Y94A 3A98B 2YSZA 4NSWA 2P0HA 4HAUB 1SHCA 1ISNA 1H10A 4DX90 1MI1A 1FOEA 2ELAA 2P0FA 1MAIA 2RLOA 3TO1A 1GC6A 2K49A 1KZGA 2KUQA 4D6WA 4YONA 2DKPA
chains in the Genus database with same CATH topology
4A6HA 4EJNA 2YT0A 3TCAA 3N7CA 2R09A 2Y8FA 2YT1A 3WYFB 2KGXB 2CY5A 1X11A 1UNRA 1EF1A 2V76A 3P6AA 4GN1A 2H7DA 4HHVA 1J19A 2HTHB 3KRXA 4A6FA 1KI1B 2QKLA 1K5DB 3ULCA 3GYOA 1J0WA 4F7HA 2J59M 2I1JA 2G35A 1ZSQA 4GZUA 2DHIA 1WI1A 4K2PA 1NU2A 5HE0A 5FI1A 2E2XA 3QBVB 1FAOA 5JLJB 1DBHA 1LB1A 1OY2A 1P5TA 2RVBB 3PZDA 1UNPA 1Y19B 2RSGA 1FB8A 3ZDTA 2M14A 1V88A 2CRFA 4KHBB 3M1IB 3SNHA 1OMWA 5C5BA 4WSFA 2CY4A 1UPRA 1U27A 5C16A 2YRYA 4KHOA 2AL6A 2D9ZA 2VSZA 5J3TA 4MK0A 1DROA 4EKUA 2RNRB 1WGUA 2MFQA 1V61A 2XQNM 3FM8C 4A6FB 1AQCA 3ODXA 2I1KA 1BTKA 2UZRA 1V5MA 1U5FA 2L2IA 5LONB 2D9XA 3HW2B 2CODA 2W2WA 4PQ0A 1Q67A 1X05A 3DXCA 5J3YA 2GS0A 2GCJA 3CIKA 1RJ2A 4XWXA 3KY9A 5C6RA 1M7EA 4KHAA 2DX1A 2BCJA 3KSYA 2NMBA 4HB2B 2GCLA 2W2XC 3QIJA 4Z2NA 2P0DA 2COCA 4ZRIA 5KCVA 3DXEA 3IVFA 2KUPA 2D4QA 5C5BB 2LYDA 3X23A 1U2BA 2YS1A 3P7ZA 3QWMA 2J0MA 2DLWA 3SV1A 4A5KA 2MWNB 4KVGB 4K17A 2DN6A 4GPTB 3SO6A 5JHHA 4IOYX 3TW1A 2YS3A 5D27A 3ZVRA 1DYNA 3FEHA 2D9YA 5EFXA 2ZPYA 1TQZA 4HDOA 3CXBB 4NY0A 3D8FA 2Z0OA 4CHMA 3OANA 2QKMA 1I2HA 4HB0B 2IYBA 2Q13A 4GMVA 2IFSA 1GC7A 4MY6A 4F7UP 2DHKA 2JP2A 2NZ8B 3FSSA 1WJ1A 2J0JA 1MKEA 1MK7B 3MDBC 2Y7BA 3NSUA 1W1DA 1IRSA 4C0AA 1X1FA 1I7AA 1U5GA 1ZC4B 2HE7A 1XCGA 4KAXB 4DX8A 4GMXB 4K2OA 2LOXA 5KQ4A 1TXDA 4HAXB 4B6HA 1MIZB 1PLSA 2DKQA 3A8QA 4TYZA 4EMOA 3VIAA 1PMSA 3HQCA 2AEHA 3AU5A 2LULA 5HE1A 4K81A 3A8PA 5C79A 2OTXA 2DX5A 1DDVA 1MK9B 1V5PA 4A6KA 1NTVA 5DH9B 4H8SA 2ELBA 2DFKA 5D3XA 1WGQA 1SGHA 1DDWA 1EGXA 3LJUX 4D0NB 3BJIA 3V5WA 2RGNB 3GYPA 5D3VA 4IAPA 2RUKB 2COFA 4Z2MB 5D3YA 2Z0PA 5DI9B 1V5UA 4HAWB 1ZVRA 1MIXA 3WA0A 2M38A 3SUZA 4HB3B 5JP4A 1AWEA 1XR0B 5LOPB 1FHWA 2N23A 2KCJA 3TVVA 2UVMA 3U8ZA 1XD4A 1KZ7A 3ODOA 1W1HA 2YVCA 5KQ1A 2COAA 3T06A 4HAYB 5JHGA 3ULBA 3PEGA 1EVHA 2GJYA 4CYEA 2K00A 2LKOA 4HDQA 1X1GA 4HAZB 1B55A 1XODA 3PP2A 5DIFB 1LW3A 2I5FA 2EJ8A 2R0DA 2ROZB 1GG3A 1UPQA 3F5RA 4DXAB 2YS5A 1UNQA 2ADZA 2VRWB 4ZRJA 5HE3A 2LOZA 1N3HA 1WJMA 2X18A 1FHOA 1BTNA 3VOQA 5D3WA 2DYQA 1BWNA 3PVWA 3AJ4A 1NI2A 2DHJA 1K5GB 1WG7A 2DYNA 1H4RA 1RRPB 5L81A 1M7RA 2J0KA 3MPXA 5GOWB 1E5WA 1WVHA 1UEFA 3AU4A 4CHJA 3ODWA 1MPHA 3SYXA 4TKNA 1U5DA 1X86A 2Y8GA 2P8VA 1PFJA 2OQBA 4WVFB 1FGZA 2MDXA 3KRWA 1FHXA 1ZC3B 4MT7A 1P6SA 2D10A 2Z0QA 2EMSA 2D9VA 1BAKA 4IFSA 3PVLA 4HAVB 4BBKA 1XKEA 3KZ1A 5CLQB 4HB4B 3D8DA 3F0WA 5HE2A 4ZRKA 1Y5OA 5DHAB 3O96A 5DHFB 2ROVA 2CAYA 1XX0A 3U7DA 1OQNA 1V89A 2W2XD 2VKIA 2UZSA 1DDMA 1NTYA 1EAZA 2H7EA 3TFMA 4DBBA 3PSCA 2LG1A 2FJLA 1U5EA 4L6EA 1W1GA 1ZM0A 2K2JA 2MKRA 2D9WA 4P7IA 2DA0A 3PVUA 1QQGA 2D11A 2L1CA 5FI0A 2EC1A 1U29A 3UZTA 2K2UA 1TJ6A 5J3QA 2D2QA 3PG7A 2YF0A 4GXBA 2N0YA 4PNKA 1Z87A 1FGYA 2EMTA 4HATB 3D8EA 3G9WA 3RCPA 2PZ1A 1QC6A 2DTCA 2I5CA 3HK0A 5CLLB 3DXDA 4F7GA 3ML4A 4YL8A 1P3RA 4WJ7A 3BINA 4Y94A 3A98B 2YSZA 4NSWA 2P0HA 4HAUB 1SHCA 1ISNA 1H10A 4DX90 1FOEA 2ELAA 2P0FA 1MAIA 2RLOA 3TO1A 1GC6A 1KZGA 4YONA 2DKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6H A;  4EJN A;  2YT0 A;  3TCA A;  3N7C A;  2R09 A;  2Y8F A;  2YT1 A;  3WYF B;  2KGX B;  2CY5 A;  1X11 A;  1UNR A;  1EF1 A;  2V76 A;  3P6A A;  4GN1 A;  2H7D A;  4HHV A;  1J19 A;  2HTH B;  3KRX A;  4A6F A;  1KI1 B;  2QKL A;  1K5D B;  3ULC A;  3GYO A;  1J0W A;  4F7H A;  2J59 M;  2I1J A;  2G35 A;  1ZSQ A;  4GZU A;  2DHI A;  1WI1 A;  4K2P A;  1NU2 A;  5HE0 A;  5FI1 A;  2E2X A;  3QBV B;  1FAO A;  5JLJ B;  1DBH A;  1LB1 A;  1OY2 A;  1P5T A;  2RVB B;  3PZD A;  1UNP A;  1Y19 B;  2RSG A;  1FB8 A;  3ZDT A;  2M14 A;  1V88 A;  2CRF A;  4KHB B;  3M1I B;  3SNH A;  1OMW A;  5C5B A;  4WSF A;  2CY4 A;  1UPR A;  1U27 A;  5C16 A;  2YRY A;  4KHO A;  2AL6 A;  2D9Z A;  2VSZ A;  5J3T A;  4MK0 A;  1DRO A;  4EKU A;  2RNR B;  1WGU A;  2MFQ A;  1V61 A;  2XQN M;  3FM8 C;  4A6F B;  1AQC A;  3ODX A;  2I1K A;  1BTK A;  2UZR A;  1V5M A;  1U5F A;  2L2I A;  5LON B;  2D9X A;  3HW2 B;  2COD A;  2W2W A;  4PQ0 A;  1Q67 A;  1X05 A;  3DXC A;  5J3Y A;  2GS0 A;  2GCJ A;  3CIK A;  1RJ2 A;  4XWX A;  3KY9 A;  5C6R A;  1M7E A;  4KHA A;  2DX1 A;  2BCJ A;  3KSY A;  2NMB A;  4HB2 B;  2GCL A;  2W2X C;  3QIJ A;  4Z2N A;  2P0D A;  2COC A;  4ZRI A;  5KCV A;  3DXE A;  3IVF A;  2KUP A;  2D4Q A;  5C5B B;  2LYD A;  3X23 A;  1U2B A;  2YS1 A;  3P7Z A;  3QWM A;  2J0M A;  2DLW A;  3SV1 A;  4A5K A;  2MWN B;  4KVG B;  4K17 A;  2DN6 A;  4GPT B;  3SO6 A;  5JHH A;  4IOY X;  3TW1 A;  2YS3 A;  5D27 A;  3ZVR A;  1DYN A;  3FEH A;  2D9Y A;  5EFX A;  2ZPY A;  1TQZ A;  4HDO A;  3CXB B;  4NY0 A;  3D8F A;  2Z0O A;  4CHM A;  3OAN A;  2QKM A;  1I2H A;  4HB0 B;  2IYB A;  2Q13 A;  4GMV A;  2IFS A;  1GC7 A;  4MY6 A;  4F7U P;  2DHK A;  2JP2 A;  2NZ8 B;  3FSS A;  1WJ1 A;  2J0J A;  1MKE A;  1MK7 B;  3MDB C;  2Y7B A;  3NSU A;  1W1D A;  1IRS A;  4C0A A;  1X1F A;  1I7A A;  1U5G A;  1ZC4 B;  2HE7 A;  1XCG A;  4KAX B;  4DX8 A;  4GMX B;  4K2O A;  2LOX A;  5KQ4 A;  1TXD A;  4HAX B;  4B6H A;  1MIZ B;  1PLS A;  2DKQ A;  3A8Q A;  4TYZ A;  4EMO A;  3VIA A;  1PMS A;  3HQC A;  2AEH A;  3AU5 A;  2LUL A;  5HE1 A;  4K81 A;  3A8P A;  5C79 A;  2OTX A;  2DX5 A;  1DDV A;  1MK9 B;  1V5P A;  4A6K A;  1NTV A;  5DH9 B;  4H8S A;  2ELB A;  2DFK A;  5D3X A;  1WGQ A;  1SGH A;  1DDW A;  1EGX A;  3LJU X;  4D0N B;  3BJI A;  3V5W A;  2RGN B;  3GYP A;  5D3V A;  4IAP A;  2RUK B;  2COF A;  4Z2M B;  5D3Y A;  2Z0P A;  5DI9 B;  1V5U A;  4HAW B;  1ZVR A;  1MIX A;  3WA0 A;  2M38 A;  3SUZ A;  4HB3 B;  5JP4 A;  1AWE A;  1XR0 B;  5LOP B;  1FHW A;  2N23 A;  2KCJ A;  3TVV A;  2UVM A;  3U8Z A;  1XD4 A;  1KZ7 A;  3ODO A;  1W1H A;  2YVC A;  5KQ1 A;  2COA A;  3T06 A;  4HAY B;  5JHG A;  3ULB A;  3PEG A;  1EVH A;  2GJY A;  4CYE A;  2K00 A;  2LKO A;  4HDQ A;  1X1G A;  4HAZ B;  1B55 A;  1XOD A;  3PP2 A;  5DIF B;  1LW3 A;  2I5F A;  2EJ8 A;  2R0D A;  2ROZ B;  1GG3 A;  1UPQ A;  3F5R A;  4DXA B;  2YS5 A;  1UNQ A;  2ADZ A;  2VRW B;  4ZRJ A;  5HE3 A;  2LOZ A;  1N3H A;  1WJM A;  2X18 A;  1FHO A;  1BTN A;  3VOQ A;  5D3W A;  2DYQ A;  1BWN A;  3PVW A;  3AJ4 A;  1NI2 A;  2DHJ A;  1K5G B;  1WG7 A;  2DYN A;  1H4R A;  1RRP B;  5L81 A;  1M7R A;  2J0K A;  3MPX A;  5GOW B;  1E5W A;  1WVH A;  1UEF A;  3AU4 A;  4CHJ A;  3ODW A;  1MPH A;  3SYX A;  4TKN A;  1U5D A;  1X86 A;  2Y8G A;  2P8V A;  1PFJ A;  2OQB A;  4WVF B;  1FGZ A;  2MDX A;  3KRW A;  1FHX A;  1ZC3 B;  4MT7 A;  1P6S A;  2D10 A;  2Z0Q A;  2EMS A;  2D9V A;  1BAK A;  4IFS A;  3PVL A;  4HAV B;  4BBK A;  1XKE A;  3KZ1 A;  5CLQ B;  4HB4 B;  3D8D A;  3F0W A;  5HE2 A;  4ZRK A;  1Y5O A;  5DHA B;  3O96 A;  5DHF B;  2ROV A;  2CAY A;  1XX0 A;  3U7D A;  1OQN A;  1V89 A;  2W2X D;  2VKI A;  2UZS A;  1DDM A;  1NTY A;  1EAZ A;  2H7E A;  3TFM A;  4DBB A;  3PSC A;  2LG1 A;  2FJL A;  1U5E A;  4L6E A;  1W1G A;  1ZM0 A;  2K2J A;  2MKR A;  2D9W A;  4P7I A;  2DA0 A;  3PVU A;  1QQG A;  2D11 A;  2L1C A;  5FI0 A;  2EC1 A;  1U29 A;  3UZT A;  2K2U A;  1TJ6 A;  5J3Q A;  2D2Q A;  3PG7 A;  2YF0 A;  4GXB A;  2N0Y A;  4PNK A;  1Z87 A;  1FGY A;  2EMT A;  4HAT B;  3D8E A;  3G9W A;  3RCP A;  2PZ1 A;  1QC6 A;  2DTC A;  2I5C A;  3HK0 A;  5CLL B;  3DXD A;  4F7G A;  3ML4 A;  4YL8 A;  1P3R A;  4WJ7 A;  3BIN A;  4Y94 A;  3A98 B;  2YSZ A;  4NSW A;  2P0H A;  4HAU B;  1SHC A;  1ISN A;  1H10 A;  4DX9 0;  1FOE A;  2ELA A;  2P0F A;  1MAI A;  2RLO A;  3TO1 A;  1GC6 A;  1KZG A;  4YON A;  2DKP A; 
#chains in the Genus database with same CATH topology
 5I2M A;  4A6H A;  4EJN A;  2YT0 A;  3A58 A;  3NWD A;  3TCA A;  4KHB A;  3N7C A;  2GUM A;  2R09 A;  2Y8F A;  2YT1 A;  3WYF B;  2KGX B;  2CY5 A;  1X11 A;  1UNR A;  1EF1 A;  2V76 A;  4HSI A;  4OT1 A;  3P6A A;  4GN1 A;  2H7D A;  4HHV A;  1J19 A;  2HTH B;  3KRX A;  4DIX A;  4A6F A;  1KI1 B;  2QKL A;  1K5D B;  3ULC A;  3GYO A;  1J0W A;  4F7H A;  2J59 M;  2I1J A;  2G35 A;  1ZSQ A;  4GZU A;  2DHI A;  1WI1 A;  4K2P A;  1NU2 A;  5HE0 A;  5FI1 A;  2E2X A;  3U12 A;  3QBV B;  1FAO A;  5JLJ B;  1DBH A;  1LB1 A;  1OY2 A;  1P5T A;  2RVB B;  3PZD A;  1UNP A;  1Y19 B;  2RSG A;  1FB8 A;  3ZDT A;  2M14 A;  1V88 A;  2CRF A;  4KHB B;  3M1I B;  3SNH A;  1OMW A;  5C5B A;  4WSF A;  2CY4 A;  2Z59 A;  1UPR A;  1U27 A;  4GOU A;  5C16 A;  2YRY A;  4KHO A;  2AL6 A;  2D9Z A;  2VSZ A;  5J3T A;  3OHM B;  4MK0 A;  1DRO A;  4EKU A;  2RNR B;  1WGU A;  2MFQ A;  1V61 A;  2XQN M;  3FM8 C;  4A6F B;  1AQC A;  3ODX A;  2I1K A;  1BTK A;  2UZR A;  1V5M A;  1U5F A;  2L2I A;  5LON B;  2D9X A;  3HW2 B;  2COD A;  2W2W A;  4PQ0 A;  1Q67 A;  1X05 A;  3DXC A;  5J3Y A;  2GS0 A;  2GCJ A;  3CIK A;  1RJ2 A;  4XWX A;  3KY9 A;  5C6R A;  1M7E A;  4KHA A;  2DX1 A;  2KIE A;  2BCJ A;  3FVC A;  2NMB A;  3KSY A;  2GCL A;  4HB2 B;  2W2X C;  3QIJ A;  4Z2N A;  2P0D A;  2COC A;  4ZRI A;  5KCV A;  3DXE A;  3IVF A;  2KUP A;  2D4Q A;  5C5B B;  2LYD A;  3X23 A;  1U2B A;  2YS1 A;  3P7Z A;  3QWM A;  2J0M A;  2DLW A;  3SV1 A;  4A5K A;  1ZYI A;  2MWN B;  4KVG B;  4K17 A;  2DN6 A;  4GPT B;  3SO6 A;  3NWA A;  5JHH A;  4IOY X;  3TW1 A;  2YS3 A;  5D27 A;  3ZVR A;  1DYN A;  3FEH A;  2D9Y A;  5EFX A;  4GNK B;  2ZPY A;  1TQZ A;  4HDO A;  3CXB B;  2ZKM X;  4NY0 A;  3D8F A;  2Z0O A;  4CHM A;  3OAN A;  2QKM A;  1I2H A;  4HB0 B;  5M4Y B;  2IYB A;  2Q13 A;  4OSN A;  4GMV A;  2IFS A;  1GC7 A;  4MY6 A;  4F7U P;  2DHK A;  2JP2 A;  2NZ8 B;  3FSS A;  2Z4D A;  1WJ1 A;  2J0J A;  1MKE A;  1MK7 B;  3MDB C;  4L1R A;  2Y7B A;  3NSU A;  1W1D A;  1IRS A;  4C0A A;  1X1F A;  1I7A A;  3B77 A;  1U5G A;  1ZC4 B;  2HE7 A;  1XCG A;  4KAX B;  4DX8 A;  4GMX B;  3NWF A;  4K2O A;  2LOX A;  5KQ4 A;  1TXD A;  4HAX B;  4B6H A;  1MIZ B;  1PLS A;  2DKQ A;  3A8Q A;  2FJU B;  4TYZ A;  4EMO A;  3VIA A;  1PMS A;  3HQC A;  2AEH A;  3AU5 A;  2LUL A;  2K8E A;  5HE1 A;  4K81 A;  3A8P A;  5C79 A;  2OTX A;  2DX5 A;  1DDV A;  1MK9 B;  1V5P A;  2R2Y A;  4A6K A;  1NTV A;  5DH9 B;  4H8S A;  2ELB A;  4QJ5 B;  2DFK A;  5D3X A;  1WGQ A;  1SGH A;  1DDW A;  1EGX A;  3LJU X;  3HIE A;  4D0N B;  3BJI A;  3NW8 A;  3V5W A;  2RGN B;  5IRS A;  3GYP A;  5D3V A;  4IAP A;  2RUK B;  2COF A;  4Z2M B;  5D3Y A;  2Z0P A;  5DI9 B;  1V5U A;  4HAW B;  4QJ4 B;  1ZVR A;  1MIX A;  3WA0 A;  2M38 A;  3SUZ A;  4HB3 B;  5JP4 A;  1AWE A;  2RRF A;  1XR0 B;  5LOP B;  4QJ3 B;  1FHW A;  2N23 A;  2KCJ A;  3TVV A;  2UVM A;  3U8Z A;  1XD4 A;  1KZ7 A;  3ODO A;  1W1H A;  2YVC A;  5KQ1 A;  2COA A;  3T06 A;  4HAY B;  5JHG A;  3ULB A;  3PEG A;  1EVH A;  2GJY A;  4CYE A;  2K00 A;  2LKO A;  4HDQ A;  1X1G A;  4HAZ B;  1B55 A;  1XOD A;  3PP2 A;  5DIF B;  1LW3 A;  2I5F A;  3DCX A;  2EJ8 A;  2R0D A;  2ROZ B;  1GG3 A;  1UPQ A;  3F5R A;  4DXA B;  2YS5 A;  1UNQ A;  2ADZ A;  2VRW B;  4ZRJ A;  5HE3 A;  2LOZ A;  1N3H A;  1WJM A;  2X18 A;  1FHO A;  1BTN A;  3VOQ A;  2YT2 A;  5D3W A;  2DYQ A;  1BWN A;  3PVW A;  3AJ4 A;  1NI2 A;  2DHJ A;  1K5G B;  1WG7 A;  2DYN A;  1H4R A;  2Z13 A;  1RRP B;  5L81 A;  1M7R A;  2J0K A;  3MPX A;  5GOW B;  1E5W A;  1WVH A;  1UEF A;  3AU4 A;  4CHJ A;  3HSA A;  3ODW A;  1MPH A;  2NBV A;  4TKN A;  3SYX A;  1U5D A;  1X86 A;  2Y8G A;  2P8V A;  1PFJ A;  2OQB A;  4WVF B;  1FGZ A;  2MDX A;  3KRW A;  1FHX A;  1ZC3 B;  4MT7 A;  1P6S A;  2D10 A;  2Z0Q A;  2EMS A;  2D9V A;  1BAK A;  4QXA B;  4IFS A;  3PVL A;  4HAV B;  4BBK A;  1XKE A;  3KZ1 A;  5CLQ B;  4HB4 B;  3D8D A;  3F0W A;  5HE2 A;  4ZRK A;  1Y5O A;  5DHA B;  3O96 A;  5DHF B;  2ROV A;  2CAY A;  4CSQ A;  1XX0 A;  3U7D A;  1OQN A;  1V89 A;  2W2X D;  2VKI A;  2UZS A;  1DDM A;  1NTY A;  1EAZ A;  2H7E A;  3TFM A;  4DBB A;  3PSC A;  2LG1 A;  2FJL A;  1U5E A;  4L6E A;  1W1G A;  1ZM0 A;  2K2J A;  2MKR A;  2D9W A;  5LG4 B;  4P7I A;  2DA0 A;  3PVU A;  5I2S A;  1QQG A;  2D11 A;  2L1C A;  5FI0 A;  2EC1 A;  1U29 A;  3UZT A;  2K2U A;  1TJ6 A;  5J3Q A;  2D2Q A;  3PG7 A;  2YF0 A;  2Z14 A;  4GXB A;  2N0Y A;  2KR0 A;  4PNK A;  1Z87 A;  1FGY A;  2EMT A;  4HAT B;  3D8E A;  1T77 A;  3G9W A;  3RCP A;  2PZ1 A;  1QC6 A;  2DTC A;  2I5C A;  3HK0 A;  5CLL B;  3DXD A;  4F7G A;  3ML4 A;  4YL8 A;  1P3R A;  4WJ7 A;  3BIN A;  2KIG A;  4Y94 A;  3A98 B;  2YSZ A;  4NSW A;  2P0H A;  4HAU B;  1SHC A;  1ISN A;  1H10 A;  4DX9 0;  1MI1 A;  1FOE A;  2ELA A;  2P0F A;  1MAI A;  2RLO A;  3TO1 A;  1GC6 A;  2K49 A;  1KZG A;  2KUQ A;  4D6W A;  4YON A;  2DKP A; 
#chains in the Genus database with same CATH homology
 4A6H A;  4EJN A;  2YT0 A;  3TCA A;  3N7C A;  2R09 A;  2Y8F A;  2YT1 A;  3WYF B;  2KGX B;  2CY5 A;  1X11 A;  1UNR A;  1EF1 A;  2V76 A;  3P6A A;  4GN1 A;  2H7D A;  4HHV A;  1J19 A;  2HTH B;  3KRX A;  4A6F A;  1KI1 B;  2QKL A;  1K5D B;  3ULC A;  3GYO A;  1J0W A;  4F7H A;  2J59 M;  2I1J A;  2G35 A;  1ZSQ A;  4GZU A;  2DHI A;  1WI1 A;  4K2P A;  1NU2 A;  5HE0 A;  5FI1 A;  2E2X A;  3QBV B;  1FAO A;  5JLJ B;  1DBH A;  1LB1 A;  1OY2 A;  1P5T A;  2RVB B;  3PZD A;  1UNP A;  1Y19 B;  2RSG A;  1FB8 A;  3ZDT A;  2M14 A;  1V88 A;  2CRF A;  4KHB B;  3M1I B;  3SNH A;  1OMW A;  5C5B A;  4WSF A;  2CY4 A;  1UPR A;  1U27 A;  5C16 A;  2YRY A;  4KHO A;  2AL6 A;  2D9Z A;  2VSZ A;  5J3T A;  4MK0 A;  1DRO A;  4EKU A;  2RNR B;  1WGU A;  2MFQ A;  1V61 A;  2XQN M;  3FM8 C;  4A6F B;  1AQC A;  3ODX A;  2I1K A;  1BTK A;  2UZR A;  1V5M A;  1U5F A;  2L2I A;  5LON B;  2D9X A;  3HW2 B;  2COD A;  2W2W A;  4PQ0 A;  1Q67 A;  1X05 A;  3DXC A;  5J3Y A;  2GS0 A;  2GCJ A;  3CIK A;  1RJ2 A;  4XWX A;  3KY9 A;  5C6R A;  1M7E A;  4KHA A;  2DX1 A;  2BCJ A;  3KSY A;  2NMB A;  4HB2 B;  2GCL A;  2W2X C;  3QIJ A;  4Z2N A;  2P0D A;  2COC A;  4ZRI A;  5KCV A;  3DXE A;  3IVF A;  2KUP A;  2D4Q A;  5C5B B;  2LYD A;  3X23 A;  1U2B A;  2YS1 A;  3P7Z A;  3QWM A;  2J0M A;  2DLW A;  3SV1 A;  4A5K A;  2MWN B;  4KVG B;  4K17 A;  2DN6 A;  4GPT B;  3SO6 A;  5JHH A;  4IOY X;  3TW1 A;  2YS3 A;  5D27 A;  3ZVR A;  1DYN A;  3FEH A;  2D9Y A;  5EFX A;  2ZPY A;  1TQZ A;  4HDO A;  3CXB B;  4NY0 A;  3D8F A;  2Z0O A;  4CHM A;  3OAN A;  2QKM A;  1I2H A;  4HB0 B;  2IYB A;  2Q13 A;  4GMV A;  2IFS A;  1GC7 A;  4MY6 A;  4F7U P;  2DHK A;  2JP2 A;  2NZ8 B;  3FSS A;  1WJ1 A;  2J0J A;  1MKE A;  1MK7 B;  3MDB C;  2Y7B A;  3NSU A;  1W1D A;  1IRS A;  4C0A A;  1X1F A;  1I7A A;  1U5G A;  1ZC4 B;  2HE7 A;  1XCG A;  4KAX B;  4DX8 A;  4GMX B;  4K2O A;  2LOX A;  5KQ4 A;  1TXD A;  4HAX B;  4B6H A;  1MIZ B;  1PLS A;  2DKQ A;  3A8Q A;  4TYZ A;  4EMO A;  3VIA A;  1PMS A;  3HQC A;  2AEH A;  3AU5 A;  2LUL A;  5HE1 A;  4K81 A;  3A8P A;  5C79 A;  2OTX A;  2DX5 A;  1DDV A;  1MK9 B;  1V5P A;  4A6K A;  1NTV A;  5DH9 B;  4H8S A;  2ELB A;  2DFK A;  5D3X A;  1WGQ A;  1SGH A;  1DDW A;  1EGX A;  3LJU X;  4D0N B;  3BJI A;  3V5W A;  2RGN B;  3GYP A;  5D3V A;  4IAP A;  2RUK B;  2COF A;  4Z2M B;  5D3Y A;  2Z0P A;  5DI9 B;  1V5U A;  4HAW B;  1ZVR A;  1MIX A;  3WA0 A;  2M38 A;  3SUZ A;  4HB3 B;  5JP4 A;  1AWE A;  1XR0 B;  5LOP B;  1FHW A;  2N23 A;  2KCJ A;  3TVV A;  2UVM A;  3U8Z A;  1XD4 A;  1KZ7 A;  3ODO A;  1W1H A;  2YVC A;  5KQ1 A;  2COA A;  3T06 A;  4HAY B;  5JHG A;  3ULB A;  3PEG A;  1EVH A;  2GJY A;  4CYE A;  2K00 A;  2LKO A;  4HDQ A;  1X1G A;  4HAZ B;  1B55 A;  1XOD A;  3PP2 A;  5DIF B;  1LW3 A;  2I5F A;  2EJ8 A;  2R0D A;  2ROZ B;  1GG3 A;  1UPQ A;  3F5R A;  4DXA B;  2YS5 A;  1UNQ A;  2ADZ A;  2VRW B;  4ZRJ A;  5HE3 A;  2LOZ A;  1N3H A;  1WJM A;  2X18 A;  1FHO A;  1BTN A;  3VOQ A;  5D3W A;  2DYQ A;  1BWN A;  3PVW A;  3AJ4 A;  1NI2 A;  2DHJ A;  1K5G B;  1WG7 A;  2DYN A;  1H4R A;  1RRP B;  5L81 A;  1M7R A;  2J0K A;  3MPX A;  5GOW B;  1E5W A;  1WVH A;  1UEF A;  3AU4 A;  4CHJ A;  3ODW A;  1MPH A;  3SYX A;  4TKN A;  1U5D A;  1X86 A;  2Y8G A;  2P8V A;  1PFJ A;  2OQB A;  4WVF B;  1FGZ A;  2MDX A;  3KRW A;  1FHX A;  1ZC3 B;  4MT7 A;  1P6S A;  2D10 A;  2Z0Q A;  2EMS A;  2D9V A;  1BAK A;  4IFS A;  3PVL A;  4HAV B;  4BBK A;  1XKE A;  3KZ1 A;  5CLQ B;  4HB4 B;  3D8D A;  3F0W A;  5HE2 A;  4ZRK A;  1Y5O A;  5DHA B;  3O96 A;  5DHF B;  2ROV A;  2CAY A;  1XX0 A;  3U7D A;  1OQN A;  1V89 A;  2W2X D;  2VKI A;  2UZS A;  1DDM A;  1NTY A;  1EAZ A;  2H7E A;  3TFM A;  4DBB A;  3PSC A;  2LG1 A;  2FJL A;  1U5E A;  4L6E A;  1W1G A;  1ZM0 A;  2K2J A;  2MKR A;  2D9W A;  4P7I A;  2DA0 A;  3PVU A;  1QQG A;  2D11 A;  2L1C A;  5FI0 A;  2EC1 A;  1U29 A;  3UZT A;  2K2U A;  1TJ6 A;  5J3Q A;  2D2Q A;  3PG7 A;  2YF0 A;  4GXB A;  2N0Y A;  4PNK A;  1Z87 A;  1FGY A;  2EMT A;  4HAT B;  3D8E A;  3G9W A;  3RCP A;  2PZ1 A;  1QC6 A;  2DTC A;  2I5C A;  3HK0 A;  5CLL B;  3DXD A;  4F7G A;  3ML4 A;  4YL8 A;  1P3R A;  4WJ7 A;  3BIN A;  4Y94 A;  3A98 B;  2YSZ A;  4NSW A;  2P0H A;  4HAU B;  1SHC A;  1ISN A;  1H10 A;  4DX9 0;  1FOE A;  2ELA A;  2P0F A;  1MAI A;  2RLO A;  3TO1 A;  1GC6 A;  1KZG A;  4YON A;  2DKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...