2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase,gene regulation
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
2K00A 1Y5OA 2UZRA 2Y8GA 5D27A 1N3HA 1K5DB 2E2XA 4KHOA 1V89A 4GXBA 2H7DA 2VSZA 4Z2MB 1OQNA 2ADZA 5DH9B 2YS5A 1Y19B 1Z87A 3TCAA 3ULCA 4HDQA 2X18A 1MK7B 3KSYA 1ISNA 2RLOA 1PLSA 1FAOA 4A6HA 2D9YA 1NU2A 1UNPA 4WSFA 1GC6A 1U29A 2LKOA 5DIFB 2I5FA 4NY0A 5DHFB 1SGHA 5J3TA 1KI1B 2OTXA 2GCLA 2YT1A 3HW2B 4IOYX 1EVHA 4WVFB 1BAKA 3U8ZA 1U2BA 3V5WA 2W2WA 4K81A 2CRFA 5JLJB 1UEFA 2ROVA 2MKRA 4DBBA 4GPTB 2M38A 1GG3A 4DX90 3DXEA 3VOQA 4XWXA 1ZC4B 4HB0B 1WVHA 1AWEA 3TFMA 4HAYB 5C5BB 1AQCA 3MDBC 3U7DA 4HB3B 3PVLA 5DHAB 1FHXA 2Y8FA 4C0AA 5DI9B 2COCA 2DFKA 3AU5A 2DLWA 2D4QA 3IVFA 4MT7A 2J0KA 1FHWA 4YONA 2H7EA 4K2PA 2YVCA 2LG1A 2DX5A 1BWNA 2RUKB 1NTYA 1V88A 3GYOA 3KY9A 1RJ2A 1W1HA 4BBKA 1V61A 2I1JA 4HAUB 3SV1A 1SHCA 1W1GA 2RSGA 1UNRA 3BJIA 4KVGB 1WGUA 4DXAB 5KQ4A 1Q67A 4EMOA 2R09A 2COAA 2QKLA 3A98B 1H4RA 1U5GA 4GN1A 2GS0A 2EMTA 1UPRA 4K17A 1EF1A 3PZDA 4ZRJA 2I1KA 3VIAA 4EKUA 1B55A 1E5WA 2HE7A 4K2OA 2GCJA 1EGXA 5JP4A 4F7HA 2UVMA 2COFA 1M7RA 2W2XC 3CXBB 2J0JA 2ELAA 3ZDTA 2YS3A 2D11A 4HB2B 4GMVA 3O96A 2YSZA 2AEHA 2L1CA 3UZTA 3KRWA 1KZ7A 4IAPA 2MDXA 1U27A 3HQCA 5FI0A 2DKQA 4HDOA 3KZ1A 1MIZB 3ODOA 1FOEA 3CIKA 1DYNA 1OMWA 4HAVB 4PNKA 4KHBB 4TYZA 4KAXB 5D3WA 1FGZA 2XQNM 3DXCA 5HE2A 4L6EA 2KGXB 2K2UA 5J3QA 2K2JA 4HAZB 2L2IA 1MPHA 2KCJA 1RRPB 1P5TA 5L81A 1DDWA 3AJ4A 3M1IB 4F7GA 1DDMA 2VKIA 2EC1A 1NI2A 5EFXA 3SO6A 1WJ1A 3KRXA 1WI1A 1XR0B 1XKEA 3AU4A 3PG7A 2EMSA 4TKNA 4P7IA 4F7UP 4B6HA 3TVVA 2VRWB 2V76A 4A6FA 5C16A 4DX8A 5CLLB 2D9XA 1UPQA 3ODWA 1EAZA 3NSUA 1XX0A 4HAWB 3QBVB 1V5MA 4EJNA 4CHMA 1KZGA 2P0FA 3G9WA 1K5GB 4HB4B 2I5CA 2NMBA 3P6AA 1TJ6A 1X1GA 1OY2A 2Z0OA 1X05A 2BCJA 1UNQA 3FSSA 4ZRIA 1WJMA 2JP2A 3SYXA 1FGYA 1M7EA 3D8DA 2YF0A 3WYFB 3MPXA 2N0YA 1P3RA 5D3VA 2P8VA 2DN6A 5CLQB 2QKMA 3PSCA 1MAIA 4NSWA 2N23A 5KCVA 3T06A 1MKEA 4WJ7A 2IYBA 1BTKA 4D0NB 2MWNB 3BINA 2RNRB 2D9WA 5GOWB 1XODA 5HE1A 2IFSA 4CYEA 3PP2A 2J59M 5J3YA 2YT0A 4MK0A 1FB8A 1BTNA 3F0WA 3X23A 2ELBA 3PVWA 3F5RA 5HE3A 1U5FA 2EJ8A 2DTCA 4GZUA 2FJLA 2CAYA 1X11A 2PZ1A 1WG7A 1H10A 1QC6A 2RGNB 1FHOA 4HAXB 2CY5A 2YRYA 3TW1A 1XCGA 2DX1A 4HATB 1LB1A 1PMSA 2DKPA 2LOXA 5C79A 3ULBA 1X1FA 2ZPYA 2DHKA 3SNHA 4KHAA 1IRSA 1DROA 3A8PA 3FEHA 2LULA 2P0DA 5D3YA 4GMXB 2P0HA 3P7ZA 5HE0A 3WA0A 1DDVA 1WGQA 1P6SA 2HTHB 5JHHA 4IFSA 3TO1A 3HK0A 3GYPA 2KUPA 4Z2NA 2NZ8B 3RCPA 1J19A 5KQ1A 1GC7A 5LONB 1MK9B 2D2QA 2RVBB 3ODXA 2DA0A 1V5PA 4A5KA 5C5BA 1U5EA 3D8FA 2DYNA 2DYQA 1J0WA 5C6RA 4Y94A 3D8EA 2J0MA 2W2XD 5FI1A 3PEGA 1ZVRA 2CODA 4A6FB 2MFQA 3N7CA 4CHJA 2D9VA 2AL6A 1TQZA 3QIJA 1X86A 1ZM0A 3ZVRA 4PQ0A 2M14A 1W1DA 5D3XA 2UZSA 4MY6A 3LJUX 1XD4A 1I2HA 4YL8A 2Y7BA 1MIXA 3OANA 2Z0PA 3PVUA 1ZC3B 4A6KA 3QWMA 2Q13A 1DBHA 1TXDA 3ML4A 2D9ZA 3FM8C 1ZSQA 2LOZA 2CY4A 2G35A 4ZRKA 1NTVA 2DHJA 2OQBA 3DXDA 1U5DA 3A8QA 2DHIA 2YS1A 1V5UA 2ROZB 5JHGA 1LW3A 1PFJA 2D10A 4H8SA 5LOPB 1I7AA 2R0DA 1QQGA 2Z0QA 4HHVA 2LYDA 3SUZA 2GJYA
chains in the Genus database with same CATH superfamily
3NWAA 5IRSA 2K00A 1Y5OA 2UZRA 2Y8GA 5D27A 1N3HA 1K5DB 2E2XA 4KHOA 4KHBA 1V89A 4GXBA 2H7DA 2VSZA 4Z2MB 1OQNA 2ADZA 5DH9B 2YS5A 1Y19B 1Z87A 3TCAA 3ULCA 4HDQA 2X18A 1MK7B 2YT2A 3KSYA 1ISNA 3NWFA 2RLOA 1PLSA 1FAOA 4A6HA 2D9YA 1NU2A 1UNPA 4WSFA 2Z13A 1GC6A 1U29A 2LKOA 1T77A 5DIFB 2I5FA 4NY0A 5DHFB 1SGHA 5J3TA 1KI1B 2OTXA 4HSIA 2GCLA 2YT1A 3HW2B 4IOYX 1EVHA 4WVFB 1BAKA 3U8ZA 1U2BA 3V5WA 2GUMA 4QJ5B 2W2WA 4K81A 2CRFA 5JLJB 1UEFA 5I2MA 2ROVA 2MKRA 4DBBA 4GPTB 2M38A 1GG3A 4DX90 2RRFA 3DXEA 3VOQA 4XWXA 1ZC4B 4HB0B 1WVHA 1AWEA 3TFMA 5M4YB 4HAYB 5C5BB 1AQCA 3MDBC 3U7DA 4HB3B 3PVLA 5DHAB 1FHXA 2Y8FA 4C0AA 5DI9B 2COCA 2DFKA 3AU5A 2DLWA 2D4QA 3IVFA 4MT7A 2J0KA 1FHWA 2ZKMX 4YONA 2H7EA 4K2PA 2YVCA 2LG1A 2DX5A 1BWNA 2RUKB 1NTYA 1V88A 4QJ3B 3GYOA 3KY9A 4QJ4B 1RJ2A 1W1HA 4BBKA 3OHMB 1V61A 2I1JA 4HAUB 3SV1A 1SHCA 1W1GA 4QXAB 2RSGA 1UNRA 3BJIA 4KVGB 1WGUA 2Z59A 4DXAB 2Z14A 5KQ4A 1Q67A 4L1RA 4EMOA 2R09A 2COAA 2QKLA 3A98B 1H4RA 1U5GA 4GN1A 2GS0A 2EMTA 1UPRA 4K17A 1EF1A 3PZDA 4ZRJA 2I1KA 3VIAA 4EKUA 1B55A 1E5WA 2HE7A 4K2OA 2GCJA 1EGXA 5JP4A 4F7HA 2UVMA 4OT1A 2COFA 1M7RA 3CXBB 2W2XC 4DIXA 2J0JA 2ELAA 3ZDTA 3NWDA 2YS3A 2D11A 4HB2B 4GMVA 3O96A 2KIEA 2YSZA 2AEHA 2L1CA 3UZTA 3KRWA 1KZ7A 2Z4DA 4IAPA 2MDXA 1U27A 3HQCA 5FI0A 2DKQA 3HSAA 4HDOA 3KZ1A 1MIZB 3ODOA 1FOEA 3CIKA 1DYNA 1OMWA 4HAVB 4PNKA 4KHBB 4TYZA 1MI1A 4KAXB 5D3WA 1FGZA 2XQNM 3DXCA 5HE2A 4L6EA 2KGXB 2K2UA 5J3QA 2K2JA 2KUQA 4HAZB 2L2IA 1MPHA 2KCJA 1RRPB 1P5TA 5L81A 1DDWA 3AJ4A 3M1IB 4F7GA 1DDMA 2VKIA 2EC1A 1NI2A 5EFXA 3SO6A 1WJ1A 3KRXA 1WI1A 1XR0B 1XKEA 3AU4A 3PG7A 2EMSA 4TKNA 4P7IA 4F7UP 4B6HA 3TVVA 2VRWB 2V76A 4A6FA 5C16A 4DX8A 5CLLB 2D9XA 1UPQA 3ODWA 1EAZA 3NSUA 1XX0A 4HAWB 3QBVB 3FVCA 1V5MA 4EJNA 4CHMA 1KZGA 2P0FA 3G9WA 1K5GB 4HB4B 2I5CA 2NMBA 3P6AA 1TJ6A 1X1GA 1OY2A 2Z0OA 1X05A 2BCJA 2K49A 1UNQA 3FSSA 4ZRIA 1WJMA 2JP2A 3SYXA 1FGYA 1M7EA 3D8DA 4CSQA 2YF0A 3WYFB 3MPXA 2N0YA 1P3RA 5D3VA 2P8VA 2DN6A 5I2SA 5CLQB 2QKMA 3PSCA 1MAIA 4NSWA 2N23A 5KCVA 3T06A 1MKEA 4WJ7A 2IYBA 1BTKA 4D0NB 2MWNB 3BINA 2FJUB 2RNRB 2D9WA 3A58A 5GOWB 1XODA 5HE1A 2IFSA 4CYEA 3NW8A 3PP2A 2J59M 5J3YA 2YT0A 4GOUA 4MK0A 1FB8A 1BTNA 3F0WA 3X23A 2ELBA 3PVWA 3F5RA 5HE3A 1U5FA 2EJ8A 2DTCA 4GZUA 2FJLA 2CAYA 1X11A 2PZ1A 1WG7A 3U12A 1H10A 1QC6A 2RGNB 1FHOA 4HAXB 2CY5A 2YRYA 3TW1A 1XCGA 2DX1A 4HATB 1LB1A 1PMSA 4OSNA 2DKPA 2LOXA 5C79A 3ULBA 1X1FA 2ZPYA 2DHKA 3SNHA 4KHAA 1IRSA 1DROA 3A8PA 3FEHA 2LULA 2P0DA 5D3YA 4GMXB 2P0HA 3P7ZA 5HE0A 5LG4B 3WA0A 1DDVA 1WGQA 1P6SA 2HTHB 5JHHA 4IFSA 3TO1A 3HK0A 3GYPA 2KUPA 4Z2NA 2NZ8B 2NBVA 3RCPA 1J19A 5KQ1A 1GC7A 5LONB 1MK9B 2D2QA 2RVBB 3ODXA 2DA0A 1V5PA 4A5KA 5C5BA 1U5EA 3D8FA 2DYNA 2DYQA 1J0WA 5C6RA 4Y94A 3D8EA 2J0MA 2W2XD 5FI1A 3PEGA 1ZVRA 2CODA 4A6FB 2MFQA 3N7CA 4CHJA 2D9VA 2AL6A 1TQZA 3QIJA 1X86A 1ZM0A 3ZVRA 4PQ0A 2M14A 1W1DA 5D3XA 2UZSA 4MY6A 3LJUX 1XD4A 1I2HA 4YL8A 2Y7BA 1MIXA 3OANA 2Z0PA 3PVUA 1ZC3B 4A6KA 2KR0A 3QWMA 2Q13A 1DBHA 4D6WA 1TXDA 4GNKB 3ML4A 2D9ZA 3FM8C 3HIEA 1ZSQA 2K8EA 2LOZA 2CY4A 2G35A 4ZRKA 1NTVA 2R2YA 2DHJA 2OQBA 3DXDA 1U5DA 3A8QA 1ZYIA 2DHIA 2YS1A 1V5UA 2ROZB 5JHGA 1LW3A 1PFJA 2D10A 4H8SA 2KIGA 5LOPB 3B77A 1I7AA 2R0DA 1QQGA 2Z0QA 4HHVA 2LYDA 3SUZA 2GJYA 3DCXA
chains in the Genus database with same CATH topology
2K00A 1Y5OA 2UZRA 2Y8GA 5D27A 1N3HA 1K5DB 2E2XA 4KHOA 1V89A 4GXBA 2H7DA 2VSZA 4Z2MB 1OQNA 2ADZA 5DH9B 2YS5A 1Y19B 1Z87A 3TCAA 3ULCA 4HDQA 2X18A 1MK7B 3KSYA 1ISNA 2RLOA 1PLSA 1FAOA 4A6HA 2D9YA 1NU2A 1UNPA 4WSFA 1GC6A 1U29A 2LKOA 5DIFB 2I5FA 4NY0A 5DHFB 1SGHA 5J3TA 1KI1B 2OTXA 2GCLA 2YT1A 3HW2B 4IOYX 1EVHA 4WVFB 1BAKA 3U8ZA 1U2BA 3V5WA 2W2WA 4K81A 2CRFA 5JLJB 1UEFA 2ROVA 2MKRA 4DBBA 4GPTB 2M38A 1GG3A 4DX90 3DXEA 3VOQA 4XWXA 1ZC4B 4HB0B 1WVHA 1AWEA 3TFMA 4HAYB 5C5BB 1AQCA 3MDBC 3U7DA 4HB3B 3PVLA 5DHAB 1FHXA 2Y8FA 4C0AA 5DI9B 2COCA 2DFKA 3AU5A 2DLWA 2D4QA 3IVFA 4MT7A 2J0KA 1FHWA 4YONA 2H7EA 4K2PA 2YVCA 2LG1A 2DX5A 1BWNA 2RUKB 1NTYA 1V88A 3GYOA 3KY9A 1RJ2A 1W1HA 4BBKA 1V61A 2I1JA 4HAUB 3SV1A 1SHCA 1W1GA 2RSGA 1UNRA 3BJIA 4KVGB 1WGUA 4DXAB 5KQ4A 1Q67A 4EMOA 2R09A 2COAA 2QKLA 3A98B 1H4RA 1U5GA 4GN1A 2GS0A 2EMTA 1UPRA 4K17A 1EF1A 3PZDA 4ZRJA 2I1KA 3VIAA 4EKUA 1B55A 1E5WA 2HE7A 4K2OA 2GCJA 1EGXA 5JP4A 4F7HA 2UVMA 2COFA 1M7RA 2W2XC 3CXBB 2J0JA 2ELAA 3ZDTA 2YS3A 2D11A 4HB2B 4GMVA 3O96A 2YSZA 2AEHA 2L1CA 3UZTA 3KRWA 1KZ7A 4IAPA 2MDXA 1U27A 3HQCA 5FI0A 2DKQA 4HDOA 3KZ1A 1MIZB 3ODOA 1FOEA 3CIKA 1DYNA 1OMWA 4HAVB 4PNKA 4KHBB 4TYZA 4KAXB 5D3WA 1FGZA 2XQNM 3DXCA 5HE2A 4L6EA 2KGXB 2K2UA 5J3QA 2K2JA 4HAZB 2L2IA 1MPHA 2KCJA 1RRPB 1P5TA 5L81A 1DDWA 3AJ4A 3M1IB 4F7GA 1DDMA 2VKIA 2EC1A 1NI2A 5EFXA 3SO6A 1WJ1A 3KRXA 1WI1A 1XR0B 1XKEA 3AU4A 3PG7A 2EMSA 4TKNA 4P7IA 4F7UP 4B6HA 3TVVA 2VRWB 2V76A 4A6FA 5C16A 4DX8A 5CLLB 2D9XA 1UPQA 3ODWA 1EAZA 3NSUA 1XX0A 4HAWB 3QBVB 1V5MA 4EJNA 4CHMA 1KZGA 2P0FA 3G9WA 1K5GB 4HB4B 2I5CA 2NMBA 3P6AA 1TJ6A 1X1GA 1OY2A 2Z0OA 1X05A 2BCJA 1UNQA 3FSSA 4ZRIA 1WJMA 2JP2A 3SYXA 1FGYA 1M7EA 3D8DA 2YF0A 3WYFB 3MPXA 2N0YA 1P3RA 5D3VA 2P8VA 2DN6A 5CLQB 2QKMA 3PSCA 1MAIA 4NSWA 2N23A 5KCVA 3T06A 1MKEA 4WJ7A 2IYBA 1BTKA 4D0NB 2MWNB 3BINA 2RNRB 2D9WA 5GOWB 1XODA 5HE1A 2IFSA 4CYEA 3PP2A 2J59M 5J3YA 2YT0A 4MK0A 1FB8A 1BTNA 3F0WA 3X23A 2ELBA 3PVWA 3F5RA 5HE3A 1U5FA 2EJ8A 2DTCA 4GZUA 2FJLA 2CAYA 1X11A 2PZ1A 1WG7A 1H10A 1QC6A 2RGNB 1FHOA 4HAXB 2CY5A 2YRYA 3TW1A 1XCGA 2DX1A 4HATB 1LB1A 1PMSA 2DKPA 2LOXA 5C79A 3ULBA 1X1FA 2ZPYA 2DHKA 3SNHA 4KHAA 1IRSA 1DROA 3A8PA 3FEHA 2LULA 2P0DA 5D3YA 4GMXB 2P0HA 3P7ZA 5HE0A 3WA0A 1DDVA 1WGQA 1P6SA 2HTHB 5JHHA 4IFSA 3TO1A 3HK0A 3GYPA 2KUPA 4Z2NA 2NZ8B 3RCPA 1J19A 5KQ1A 1GC7A 5LONB 1MK9B 2D2QA 2RVBB 3ODXA 2DA0A 1V5PA 4A5KA 5C5BA 1U5EA 3D8FA 2DYNA 2DYQA 1J0WA 5C6RA 4Y94A 3D8EA 2J0MA 2W2XD 5FI1A 3PEGA 1ZVRA 2CODA 4A6FB 2MFQA 3N7CA 4CHJA 2D9VA 2AL6A 1TQZA 3QIJA 1X86A 1ZM0A 3ZVRA 4PQ0A 2M14A 1W1DA 5D3XA 2UZSA 4MY6A 3LJUX 1XD4A 1I2HA 4YL8A 2Y7BA 1MIXA 3OANA 2Z0PA 3PVUA 1ZC3B 4A6KA 3QWMA 2Q13A 1DBHA 1TXDA 3ML4A 2D9ZA 3FM8C 1ZSQA 2LOZA 2CY4A 2G35A 4ZRKA 1NTVA 2DHJA 2OQBA 3DXDA 1U5DA 3A8QA 2DHIA 2YS1A 1V5UA 2ROZB 5JHGA 1LW3A 1PFJA 2D10A 4H8SA 5LOPB 1I7AA 2R0DA 1QQGA 2Z0QA 4HHVA 2LYDA 3SUZA 2GJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K00 A;  1Y5O A;  2UZR A;  2Y8G A;  5D27 A;  1N3H A;  1K5D B;  2E2X A;  4KHO A;  1V89 A;  4GXB A;  2H7D A;  2VSZ A;  4Z2M B;  1OQN A;  2ADZ A;  5DH9 B;  2YS5 A;  1Y19 B;  1Z87 A;  3TCA A;  3ULC A;  4HDQ A;  2X18 A;  1MK7 B;  3KSY A;  1ISN A;  2RLO A;  1PLS A;  1FAO A;  4A6H A;  2D9Y A;  1NU2 A;  1UNP A;  4WSF A;  1GC6 A;  1U29 A;  2LKO A;  5DIF B;  2I5F A;  4NY0 A;  5DHF B;  1SGH A;  5J3T A;  1KI1 B;  2OTX A;  2GCL A;  2YT1 A;  3HW2 B;  4IOY X;  1EVH A;  4WVF B;  1BAK A;  3U8Z A;  1U2B A;  3V5W A;  2W2W A;  4K81 A;  2CRF A;  5JLJ B;  1UEF A;  2ROV A;  2MKR A;  4DBB A;  4GPT B;  2M38 A;  1GG3 A;  4DX9 0;  3DXE A;  3VOQ A;  4XWX A;  1ZC4 B;  4HB0 B;  1WVH A;  1AWE A;  3TFM A;  4HAY B;  5C5B B;  1AQC A;  3MDB C;  3U7D A;  4HB3 B;  3PVL A;  5DHA B;  1FHX A;  2Y8F A;  4C0A A;  5DI9 B;  2COC A;  2DFK A;  3AU5 A;  2DLW A;  2D4Q A;  3IVF A;  4MT7 A;  2J0K A;  1FHW A;  4YON A;  2H7E A;  4K2P A;  2YVC A;  2LG1 A;  2DX5 A;  1BWN A;  2RUK B;  1NTY A;  1V88 A;  3GYO A;  3KY9 A;  1RJ2 A;  1W1H A;  4BBK A;  1V61 A;  2I1J A;  4HAU B;  3SV1 A;  1SHC A;  1W1G A;  2RSG A;  1UNR A;  3BJI A;  4KVG B;  1WGU A;  4DXA B;  5KQ4 A;  1Q67 A;  4EMO A;  2R09 A;  2COA A;  2QKL A;  3A98 B;  1H4R A;  1U5G A;  4GN1 A;  2GS0 A;  2EMT A;  1UPR A;  4K17 A;  1EF1 A;  3PZD A;  4ZRJ A;  2I1K A;  3VIA A;  4EKU A;  1B55 A;  1E5W A;  2HE7 A;  4K2O A;  2GCJ A;  1EGX A;  5JP4 A;  4F7H A;  2UVM A;  2COF A;  1M7R A;  2W2X C;  3CXB B;  2J0J A;  2ELA A;  3ZDT A;  2YS3 A;  2D11 A;  4HB2 B;  4GMV A;  3O96 A;  2YSZ A;  2AEH A;  2L1C A;  3UZT A;  3KRW A;  1KZ7 A;  4IAP A;  2MDX A;  1U27 A;  3HQC A;  5FI0 A;  2DKQ A;  4HDO A;  3KZ1 A;  1MIZ B;  3ODO A;  1FOE A;  3CIK A;  1DYN A;  1OMW A;  4HAV B;  4PNK A;  4KHB B;  4TYZ A;  4KAX B;  5D3W A;  1FGZ A;  2XQN M;  3DXC A;  5HE2 A;  4L6E A;  2KGX B;  2K2U A;  5J3Q A;  2K2J A;  4HAZ B;  2L2I A;  1MPH A;  2KCJ A;  1RRP B;  1P5T A;  5L81 A;  1DDW A;  3AJ4 A;  3M1I B;  4F7G A;  1DDM A;  2VKI A;  2EC1 A;  1NI2 A;  5EFX A;  3SO6 A;  1WJ1 A;  3KRX A;  1WI1 A;  1XR0 B;  1XKE A;  3AU4 A;  3PG7 A;  2EMS A;  4TKN A;  4P7I A;  4F7U P;  4B6H A;  3TVV A;  2VRW B;  2V76 A;  4A6F A;  5C16 A;  4DX8 A;  5CLL B;  2D9X A;  1UPQ A;  3ODW A;  1EAZ A;  3NSU A;  1XX0 A;  4HAW B;  3QBV B;  1V5M A;  4EJN A;  4CHM A;  1KZG A;  2P0F A;  3G9W A;  1K5G B;  4HB4 B;  2I5C A;  2NMB A;  3P6A A;  1TJ6 A;  1X1G A;  1OY2 A;  2Z0O A;  1X05 A;  2BCJ A;  1UNQ A;  3FSS A;  4ZRI A;  1WJM A;  2JP2 A;  3SYX A;  1FGY A;  1M7E A;  3D8D A;  2YF0 A;  3WYF B;  3MPX A;  2N0Y A;  1P3R A;  5D3V A;  2P8V A;  2DN6 A;  5CLQ B;  2QKM A;  3PSC A;  1MAI A;  4NSW A;  2N23 A;  5KCV A;  3T06 A;  1MKE A;  4WJ7 A;  2IYB A;  1BTK A;  4D0N B;  2MWN B;  3BIN A;  2RNR B;  2D9W A;  5GOW B;  1XOD A;  5HE1 A;  2IFS A;  4CYE A;  3PP2 A;  2J59 M;  5J3Y A;  2YT0 A;  4MK0 A;  1FB8 A;  1BTN A;  3F0W A;  3X23 A;  2ELB A;  3PVW A;  3F5R A;  5HE3 A;  1U5F A;  2EJ8 A;  2DTC A;  4GZU A;  2FJL A;  2CAY A;  1X11 A;  2PZ1 A;  1WG7 A;  1H10 A;  1QC6 A;  2RGN B;  1FHO A;  4HAX B;  2CY5 A;  2YRY A;  3TW1 A;  1XCG A;  2DX1 A;  4HAT B;  1LB1 A;  1PMS A;  2DKP A;  2LOX A;  5C79 A;  3ULB A;  1X1F A;  2ZPY A;  2DHK A;  3SNH A;  4KHA A;  1IRS A;  1DRO A;  3A8P A;  3FEH A;  2LUL A;  2P0D A;  5D3Y A;  4GMX B;  2P0H A;  3P7Z A;  5HE0 A;  3WA0 A;  1DDV A;  1WGQ A;  1P6S A;  2HTH B;  5JHH A;  4IFS A;  3TO1 A;  3HK0 A;  3GYP A;  2KUP A;  4Z2N A;  2NZ8 B;  3RCP A;  1J19 A;  5KQ1 A;  1GC7 A;  5LON B;  1MK9 B;  2D2Q A;  2RVB B;  3ODX A;  2DA0 A;  1V5P A;  4A5K A;  5C5B A;  1U5E A;  3D8F A;  2DYN A;  2DYQ A;  1J0W A;  5C6R A;  4Y94 A;  3D8E A;  2J0M A;  2W2X D;  5FI1 A;  3PEG A;  1ZVR A;  2COD A;  4A6F B;  2MFQ A;  3N7C A;  4CHJ A;  2D9V A;  2AL6 A;  1TQZ A;  3QIJ A;  1X86 A;  1ZM0 A;  3ZVR A;  4PQ0 A;  2M14 A;  1W1D A;  5D3X A;  2UZS A;  4MY6 A;  3LJU X;  1XD4 A;  1I2H A;  4YL8 A;  2Y7B A;  1MIX A;  3OAN A;  2Z0P A;  3PVU A;  1ZC3 B;  4A6K A;  3QWM A;  2Q13 A;  1DBH A;  1TXD A;  3ML4 A;  2D9Z A;  3FM8 C;  1ZSQ A;  2LOZ A;  2CY4 A;  2G35 A;  4ZRK A;  1NTV A;  2DHJ A;  2OQB A;  3DXD A;  1U5D A;  3A8Q A;  2DHI A;  2YS1 A;  1V5U A;  2ROZ B;  5JHG A;  1LW3 A;  1PFJ A;  2D10 A;  4H8S A;  5LOP B;  1I7A A;  2R0D A;  1QQG A;  2Z0Q A;  4HHV A;  2LYD A;  3SUZ A;  2GJY A; 
#chains in the Genus database with same CATH topology
 3NWA A;  5IRS A;  2K00 A;  1Y5O A;  2UZR A;  2Y8G A;  5D27 A;  1N3H A;  1K5D B;  2E2X A;  4KHO A;  4KHB A;  1V89 A;  4GXB A;  2H7D A;  2VSZ A;  4Z2M B;  1OQN A;  2ADZ A;  5DH9 B;  2YS5 A;  1Y19 B;  1Z87 A;  3TCA A;  3ULC A;  4HDQ A;  2X18 A;  1MK7 B;  2YT2 A;  3KSY A;  1ISN A;  3NWF A;  2RLO A;  1PLS A;  1FAO A;  4A6H A;  2D9Y A;  1NU2 A;  1UNP A;  4WSF A;  2Z13 A;  1GC6 A;  1U29 A;  2LKO A;  1T77 A;  5DIF B;  2I5F A;  4NY0 A;  5DHF B;  1SGH A;  5J3T A;  1KI1 B;  2OTX A;  4HSI A;  2GCL A;  2YT1 A;  3HW2 B;  4IOY X;  1EVH A;  4WVF B;  1BAK A;  3U8Z A;  1U2B A;  3V5W A;  2GUM A;  4QJ5 B;  2W2W A;  4K81 A;  2CRF A;  5JLJ B;  1UEF A;  5I2M A;  2ROV A;  2MKR A;  4DBB A;  4GPT B;  2M38 A;  1GG3 A;  4DX9 0;  2RRF A;  3DXE A;  3VOQ A;  4XWX A;  1ZC4 B;  4HB0 B;  1WVH A;  1AWE A;  3TFM A;  5M4Y B;  4HAY B;  5C5B B;  1AQC A;  3MDB C;  3U7D A;  4HB3 B;  3PVL A;  5DHA B;  1FHX A;  2Y8F A;  4C0A A;  5DI9 B;  2COC A;  2DFK A;  3AU5 A;  2DLW A;  2D4Q A;  3IVF A;  4MT7 A;  2J0K A;  1FHW A;  2ZKM X;  4YON A;  2H7E A;  4K2P A;  2YVC A;  2LG1 A;  2DX5 A;  1BWN A;  2RUK B;  1NTY A;  1V88 A;  4QJ3 B;  3GYO A;  3KY9 A;  4QJ4 B;  1RJ2 A;  1W1H A;  4BBK A;  3OHM B;  1V61 A;  2I1J A;  4HAU B;  3SV1 A;  1SHC A;  1W1G A;  4QXA B;  2RSG A;  1UNR A;  3BJI A;  4KVG B;  1WGU A;  2Z59 A;  4DXA B;  2Z14 A;  5KQ4 A;  1Q67 A;  4L1R A;  4EMO A;  2R09 A;  2COA A;  2QKL A;  3A98 B;  1H4R A;  1U5G A;  4GN1 A;  2GS0 A;  2EMT A;  1UPR A;  4K17 A;  1EF1 A;  3PZD A;  4ZRJ A;  2I1K A;  3VIA A;  4EKU A;  1B55 A;  1E5W A;  2HE7 A;  4K2O A;  2GCJ A;  1EGX A;  5JP4 A;  4F7H A;  2UVM A;  4OT1 A;  2COF A;  1M7R A;  3CXB B;  2W2X C;  4DIX A;  2J0J A;  2ELA A;  3ZDT A;  3NWD A;  2YS3 A;  2D11 A;  4HB2 B;  4GMV A;  3O96 A;  2KIE A;  2YSZ A;  2AEH A;  2L1C A;  3UZT A;  3KRW A;  1KZ7 A;  2Z4D A;  4IAP A;  2MDX A;  1U27 A;  3HQC A;  5FI0 A;  2DKQ A;  3HSA A;  4HDO A;  3KZ1 A;  1MIZ B;  3ODO A;  1FOE A;  3CIK A;  1DYN A;  1OMW A;  4HAV B;  4PNK A;  4KHB B;  4TYZ A;  1MI1 A;  4KAX B;  5D3W A;  1FGZ A;  2XQN M;  3DXC A;  5HE2 A;  4L6E A;  2KGX B;  2K2U A;  5J3Q A;  2K2J A;  2KUQ A;  4HAZ B;  2L2I A;  1MPH A;  2KCJ A;  1RRP B;  1P5T A;  5L81 A;  1DDW A;  3AJ4 A;  3M1I B;  4F7G A;  1DDM A;  2VKI A;  2EC1 A;  1NI2 A;  5EFX A;  3SO6 A;  1WJ1 A;  3KRX A;  1WI1 A;  1XR0 B;  1XKE A;  3AU4 A;  3PG7 A;  2EMS A;  4TKN A;  4P7I A;  4F7U P;  4B6H A;  3TVV A;  2VRW B;  2V76 A;  4A6F A;  5C16 A;  4DX8 A;  5CLL B;  2D9X A;  1UPQ A;  3ODW A;  1EAZ A;  3NSU A;  1XX0 A;  4HAW B;  3QBV B;  3FVC A;  1V5M A;  4EJN A;  4CHM A;  1KZG A;  2P0F A;  3G9W A;  1K5G B;  4HB4 B;  2I5C A;  2NMB A;  3P6A A;  1TJ6 A;  1X1G A;  1OY2 A;  2Z0O A;  1X05 A;  2BCJ A;  2K49 A;  1UNQ A;  3FSS A;  4ZRI A;  1WJM A;  2JP2 A;  3SYX A;  1FGY A;  1M7E A;  3D8D A;  4CSQ A;  2YF0 A;  3WYF B;  3MPX A;  2N0Y A;  1P3R A;  5D3V A;  2P8V A;  2DN6 A;  5I2S A;  5CLQ B;  2QKM A;  3PSC A;  1MAI A;  4NSW A;  2N23 A;  5KCV A;  3T06 A;  1MKE A;  4WJ7 A;  2IYB A;  1BTK A;  4D0N B;  2MWN B;  3BIN A;  2FJU B;  2RNR B;  2D9W A;  3A58 A;  5GOW B;  1XOD A;  5HE1 A;  2IFS A;  4CYE A;  3NW8 A;  3PP2 A;  2J59 M;  5J3Y A;  2YT0 A;  4GOU A;  4MK0 A;  1FB8 A;  1BTN A;  3F0W A;  3X23 A;  2ELB A;  3PVW A;  3F5R A;  5HE3 A;  1U5F A;  2EJ8 A;  2DTC A;  4GZU A;  2FJL A;  2CAY A;  1X11 A;  2PZ1 A;  1WG7 A;  3U12 A;  1H10 A;  1QC6 A;  2RGN B;  1FHO A;  4HAX B;  2CY5 A;  2YRY A;  3TW1 A;  1XCG A;  2DX1 A;  4HAT B;  1LB1 A;  1PMS A;  4OSN A;  2DKP A;  2LOX A;  5C79 A;  3ULB A;  1X1F A;  2ZPY A;  2DHK A;  3SNH A;  4KHA A;  1IRS A;  1DRO A;  3A8P A;  3FEH A;  2LUL A;  2P0D A;  5D3Y A;  4GMX B;  2P0H A;  3P7Z A;  5HE0 A;  5LG4 B;  3WA0 A;  1DDV A;  1WGQ A;  1P6S A;  2HTH B;  5JHH A;  4IFS A;  3TO1 A;  3HK0 A;  3GYP A;  2KUP A;  4Z2N A;  2NZ8 B;  2NBV A;  3RCP A;  1J19 A;  5KQ1 A;  1GC7 A;  5LON B;  1MK9 B;  2D2Q A;  2RVB B;  3ODX A;  2DA0 A;  1V5P A;  4A5K A;  5C5B A;  1U5E A;  3D8F A;  2DYN A;  2DYQ A;  1J0W A;  5C6R A;  4Y94 A;  3D8E A;  2J0M A;  2W2X D;  5FI1 A;  3PEG A;  1ZVR A;  2COD A;  4A6F B;  2MFQ A;  3N7C A;  4CHJ A;  2D9V A;  2AL6 A;  1TQZ A;  3QIJ A;  1X86 A;  1ZM0 A;  3ZVR A;  4PQ0 A;  2M14 A;  1W1D A;  5D3X A;  2UZS A;  4MY6 A;  3LJU X;  1XD4 A;  1I2H A;  4YL8 A;  2Y7B A;  1MIX A;  3OAN A;  2Z0P A;  3PVU A;  1ZC3 B;  4A6K A;  2KR0 A;  3QWM A;  2Q13 A;  1DBH A;  4D6W A;  1TXD A;  4GNK B;  3ML4 A;  2D9Z A;  3FM8 C;  3HIE A;  1ZSQ A;  2K8E A;  2LOZ A;  2CY4 A;  2G35 A;  4ZRK A;  1NTV A;  2R2Y A;  2DHJ A;  2OQB A;  3DXD A;  1U5D A;  3A8Q A;  1ZYI A;  2DHI A;  2YS1 A;  1V5U A;  2ROZ B;  5JHG A;  1LW3 A;  1PFJ A;  2D10 A;  4H8S A;  2KIG A;  5LOP B;  3B77 A;  1I7A A;  2R0D A;  1QQG A;  2Z0Q A;  4HHV A;  2LYD A;  3SUZ A;  2GJY A;  3DCX A; 
#chains in the Genus database with same CATH homology
 2K00 A;  1Y5O A;  2UZR A;  2Y8G A;  5D27 A;  1N3H A;  1K5D B;  2E2X A;  4KHO A;  1V89 A;  4GXB A;  2H7D A;  2VSZ A;  4Z2M B;  1OQN A;  2ADZ A;  5DH9 B;  2YS5 A;  1Y19 B;  1Z87 A;  3TCA A;  3ULC A;  4HDQ A;  2X18 A;  1MK7 B;  3KSY A;  1ISN A;  2RLO A;  1PLS A;  1FAO A;  4A6H A;  2D9Y A;  1NU2 A;  1UNP A;  4WSF A;  1GC6 A;  1U29 A;  2LKO A;  5DIF B;  2I5F A;  4NY0 A;  5DHF B;  1SGH A;  5J3T A;  1KI1 B;  2OTX A;  2GCL A;  2YT1 A;  3HW2 B;  4IOY X;  1EVH A;  4WVF B;  1BAK A;  3U8Z A;  1U2B A;  3V5W A;  2W2W A;  4K81 A;  2CRF A;  5JLJ B;  1UEF A;  2ROV A;  2MKR A;  4DBB A;  4GPT B;  2M38 A;  1GG3 A;  4DX9 0;  3DXE A;  3VOQ A;  4XWX A;  1ZC4 B;  4HB0 B;  1WVH A;  1AWE A;  3TFM A;  4HAY B;  5C5B B;  1AQC A;  3MDB C;  3U7D A;  4HB3 B;  3PVL A;  5DHA B;  1FHX A;  2Y8F A;  4C0A A;  5DI9 B;  2COC A;  2DFK A;  3AU5 A;  2DLW A;  2D4Q A;  3IVF A;  4MT7 A;  2J0K A;  1FHW A;  4YON A;  2H7E A;  4K2P A;  2YVC A;  2LG1 A;  2DX5 A;  1BWN A;  2RUK B;  1NTY A;  1V88 A;  3GYO A;  3KY9 A;  1RJ2 A;  1W1H A;  4BBK A;  1V61 A;  2I1J A;  4HAU B;  3SV1 A;  1SHC A;  1W1G A;  2RSG A;  1UNR A;  3BJI A;  4KVG B;  1WGU A;  4DXA B;  5KQ4 A;  1Q67 A;  4EMO A;  2R09 A;  2COA A;  2QKL A;  3A98 B;  1H4R A;  1U5G A;  4GN1 A;  2GS0 A;  2EMT A;  1UPR A;  4K17 A;  1EF1 A;  3PZD A;  4ZRJ A;  2I1K A;  3VIA A;  4EKU A;  1B55 A;  1E5W A;  2HE7 A;  4K2O A;  2GCJ A;  1EGX A;  5JP4 A;  4F7H A;  2UVM A;  2COF A;  1M7R A;  2W2X C;  3CXB B;  2J0J A;  2ELA A;  3ZDT A;  2YS3 A;  2D11 A;  4HB2 B;  4GMV A;  3O96 A;  2YSZ A;  2AEH A;  2L1C A;  3UZT A;  3KRW A;  1KZ7 A;  4IAP A;  2MDX A;  1U27 A;  3HQC A;  5FI0 A;  2DKQ A;  4HDO A;  3KZ1 A;  1MIZ B;  3ODO A;  1FOE A;  3CIK A;  1DYN A;  1OMW A;  4HAV B;  4PNK A;  4KHB B;  4TYZ A;  4KAX B;  5D3W A;  1FGZ A;  2XQN M;  3DXC A;  5HE2 A;  4L6E A;  2KGX B;  2K2U A;  5J3Q A;  2K2J A;  4HAZ B;  2L2I A;  1MPH A;  2KCJ A;  1RRP B;  1P5T A;  5L81 A;  1DDW A;  3AJ4 A;  3M1I B;  4F7G A;  1DDM A;  2VKI A;  2EC1 A;  1NI2 A;  5EFX A;  3SO6 A;  1WJ1 A;  3KRX A;  1WI1 A;  1XR0 B;  1XKE A;  3AU4 A;  3PG7 A;  2EMS A;  4TKN A;  4P7I A;  4F7U P;  4B6H A;  3TVV A;  2VRW B;  2V76 A;  4A6F A;  5C16 A;  4DX8 A;  5CLL B;  2D9X A;  1UPQ A;  3ODW A;  1EAZ A;  3NSU A;  1XX0 A;  4HAW B;  3QBV B;  1V5M A;  4EJN A;  4CHM A;  1KZG A;  2P0F A;  3G9W A;  1K5G B;  4HB4 B;  2I5C A;  2NMB A;  3P6A A;  1TJ6 A;  1X1G A;  1OY2 A;  2Z0O A;  1X05 A;  2BCJ A;  1UNQ A;  3FSS A;  4ZRI A;  1WJM A;  2JP2 A;  3SYX A;  1FGY A;  1M7E A;  3D8D A;  2YF0 A;  3WYF B;  3MPX A;  2N0Y A;  1P3R A;  5D3V A;  2P8V A;  2DN6 A;  5CLQ B;  2QKM A;  3PSC A;  1MAI A;  4NSW A;  2N23 A;  5KCV A;  3T06 A;  1MKE A;  4WJ7 A;  2IYB A;  1BTK A;  4D0N B;  2MWN B;  3BIN A;  2RNR B;  2D9W A;  5GOW B;  1XOD A;  5HE1 A;  2IFS A;  4CYE A;  3PP2 A;  2J59 M;  5J3Y A;  2YT0 A;  4MK0 A;  1FB8 A;  1BTN A;  3F0W A;  3X23 A;  2ELB A;  3PVW A;  3F5R A;  5HE3 A;  1U5F A;  2EJ8 A;  2DTC A;  4GZU A;  2FJL A;  2CAY A;  1X11 A;  2PZ1 A;  1WG7 A;  1H10 A;  1QC6 A;  2RGN B;  1FHO A;  4HAX B;  2CY5 A;  2YRY A;  3TW1 A;  1XCG A;  2DX1 A;  4HAT B;  1LB1 A;  1PMS A;  2DKP A;  2LOX A;  5C79 A;  3ULB A;  1X1F A;  2ZPY A;  2DHK A;  3SNH A;  4KHA A;  1IRS A;  1DRO A;  3A8P A;  3FEH A;  2LUL A;  2P0D A;  5D3Y A;  4GMX B;  2P0H A;  3P7Z A;  5HE0 A;  3WA0 A;  1DDV A;  1WGQ A;  1P6S A;  2HTH B;  5JHH A;  4IFS A;  3TO1 A;  3HK0 A;  3GYP A;  2KUP A;  4Z2N A;  2NZ8 B;  3RCP A;  1J19 A;  5KQ1 A;  1GC7 A;  5LON B;  1MK9 B;  2D2Q A;  2RVB B;  3ODX A;  2DA0 A;  1V5P A;  4A5K A;  5C5B A;  1U5E A;  3D8F A;  2DYN A;  2DYQ A;  1J0W A;  5C6R A;  4Y94 A;  3D8E A;  2J0M A;  2W2X D;  5FI1 A;  3PEG A;  1ZVR A;  2COD A;  4A6F B;  2MFQ A;  3N7C A;  4CHJ A;  2D9V A;  2AL6 A;  1TQZ A;  3QIJ A;  1X86 A;  1ZM0 A;  3ZVR A;  4PQ0 A;  2M14 A;  1W1D A;  5D3X A;  2UZS A;  4MY6 A;  3LJU X;  1XD4 A;  1I2H A;  4YL8 A;  2Y7B A;  1MIX A;  3OAN A;  2Z0P A;  3PVU A;  1ZC3 B;  4A6K A;  3QWM A;  2Q13 A;  1DBH A;  1TXD A;  3ML4 A;  2D9Z A;  3FM8 C;  1ZSQ A;  2LOZ A;  2CY4 A;  2G35 A;  4ZRK A;  1NTV A;  2DHJ A;  2OQB A;  3DXD A;  1U5D A;  3A8Q A;  2DHI A;  2YS1 A;  1V5U A;  2ROZ B;  5JHG A;  1LW3 A;  1PFJ A;  2D10 A;  4H8S A;  5LOP B;  1I7A A;  2R0D A;  1QQG A;  2Z0Q A;  4HHV A;  2LYD A;  3SUZ A;  2GJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...