2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase,gene regulation
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
3GYOA 1DDVA 5D3XA 1UNQA 4Z2NA 2K00A 4K17A 1UPQA 3PG7A 3ML4A 4ZRJA 1U5GA 3WYFB 5FI1A 2CY4A 2W2WA 4HB3B 3F5RA 4IOYX 1UNRA 3SYXA 2DHKA 1EGXA 2CRFA 5D27A 2EMTA 2W2XD 3DXDA 3ZDTA 4F7HA 2Y7BA 4F7GA 5C6RA 1AWEA 2NMBA 2I1JA 2DX1A 4CHMA 4HAZB 5HE3A 5KCVA 3HQCA 4GMXB 2GCLA 5GOWB 2D9ZA 3TO1A 5HE2A 2GS0A 3TW1A 1NI2A 2UVMA 3TVVA 1FOEA 5C5BB 1FB8A 2DYNA 2Y8GA 4HAWB 1K5DB 1J0WA 5CLLB 2CY5A 2DX5A 2DHJA 4D0NB 2RNRB 3ULBA 3A8PA 1MIXA 1U5DA 2MWNB 3ODWA 1Z87A 3OANA 4A6KA 1FGZA 1GC7A 4DX90 3M1IB 1WJ1A 4NSWA 1XKEA 2QKLA 4F7UP 3P6AA 2P0FA 4L6EA 5J3QA 4K2PA 2H7DA 3U8ZA 2LOZA 1XODA 3D8FA 2P8VA 3HW2B 2EC1A 2J0KA 1SHCA 2DKQA 3PSCA 2DN6A 1J19A 2W2XC 3TFMA 2LULA 2YS5A 1ZC3B 1DROA 2DYQA 3MPXA 2D9XA 1U27A 2KUPA 2GJYA 2Z0PA 3ODXA 3V5WA 1FHWA 5CLQB 1BWNA 1WGUA 1EVHA 2DLWA 1GG3A 1UPRA 4Y94A 3ULCA 5D3YA 4B6HA 3DXEA 3N7CA 2M14A 4BBKA 4A6FA 4HHVA 2DHIA 1FHXA 4HATB 3SUZA 1WG7A 2Y8FA 3FM8C 4HAYB 1NTVA 3U7DA 2MKRA 2Z0QA 3SV1A 2MDXA 3SO6A 2CODA 1K5GB 3FSSA 1V5PA 3LJUX 1X86A 4KHBB 1KZ7A 3IVFA 1DYNA 2GCJA 2J0MA 3VOQA 1OQNA 2RLOA 1QQGA 2I1KA 5DH9B 5JLJB 2RUKB 1MIZB 4A6HA 2AL6A 5LONB 2LKOA 2DTCA 1EF1A 2VRWB 3F0WA 1KI1B 2L2IA 3KZ1A 2IYBA 1P3RA 3CXBB 3GYPA 2X18A 1DDMA 2P0HA 1I2HA 3HK0A 3X23A 5D3WA 1W1GA 3PEGA 4MY6A 1P6SA 2LG1A 4XWXA 4CYEA 1LB1A 2ROVA 1OY2A 2YSZA 2G35A 1B55A 2I5CA 1AQCA 1DBHA 1NU2A 2BCJA 2K2UA 3NSUA 2EJ8A 3CIKA 2H7EA 3AJ4A 4P7IA 3PP2A 4IFSA 1MK9B 2J59M 2K2JA 2DFKA 2J0JA 3FEHA 4EKUA 1XX0A 1P5TA 1RRPB 3G9WA 3KSYA 2PZ1A 2YT1A 5C5BA 1BAKA 2AEHA 1BTKA 3KRXA 1Y19B 1MK7B 1TJ6A 2LYDA 4HB4B 4KAXB 4HAUB 1H10A 2ELAA 4TYZA 2I5FA 4C0AA 1W1DA 2VSZA 2XQNM 1V88A 4GMVA 4DBBA 5JHGA 2ZPYA 3PZDA 4WVFB 5D3VA 1IRSA 4GN1A 1N3HA 2IFSA 2D9YA 4HAVB 3A8QA 1ISNA 1PMSA 4YONA 4WJ7A 4H8SA 4IAPA 1PLSA 1WI1A 3SNHA 1X1FA 1X1GA 2ELBA 4GPTB 2KGXB 5DIFB 2LOXA 3PVUA 2YS3A 2FJLA 3AU4A 2YVCA 1UEFA 3PVLA 5LOPB 2D9WA 1Q67A 2DA0A 2D10A 2YF0A 2COFA 4MT7A 1W1HA 4TKNA 4GZUA 2UZRA 3BJIA 4HDOA 2M38A 1EAZA 5KQ1A 1M7RA 2NZ8B 2EMSA 1M7EA 3VIAA 4YL8A 1MPHA 1XCGA 1OMWA 3O96A 3T06A 5C79A 5HE1A 4A5KA 4DXAB 2N0YA 2N23A 1ZVRA 2JP2A 1WJMA 5FI0A 1MAIA 1U5FA 1WVHA 1DDWA 2D2QA 2RGNB 2HE7A 2OTXA 1U5EA 4K2OA 5J3YA 3PVWA 4DX8A 2ADZA 5J3TA 1FGYA 3KRWA 3ZVRA 4PQ0A 4ZRKA 2VKIA 1V61A 4HDQA 5KQ4A 5HE0A 2R0DA 3TCAA 2OQBA 5JP4A 4Z2MB 2ROZB 3DXCA 3A98B 2D4QA 4HAXB 1V89A 3QWMA 4HB2B 2CAYA 3BINA 4KHOA 3ODOA 4EJNA 2RSGA 2KCJA 4EMOA 2UZSA 5JHHA 1E5WA 2R09A 4K81A 5DHFB 1V5UA 2L1CA 3UZTA 1WGQA 1V5MA 1SGHA 5L81A 1X11A 2MFQA 1XD4A 4NY0A 1U29A 4CHJA 3RCPA 1RJ2A 1ZC4B 1U2BA 3QBVB 2P0DA 2COCA 2Q13A 5DHAB 3KY9A 4A6FB 4HB0B 3AU5A 2YRYA 5EFXA 1XR0B 1MKEA 1X05A 2D9VA 1I7AA 1ZM0A 1GC6A 2E2XA 3D8DA 1UNPA 4ZRIA 1TXDA 2COAA 3QIJA 3MDBC 4WSFA 2Z0OA 2YT0A 1KZGA 1LW3A 1NTYA 4PNKA 1FHOA 4MK0A 4KHAA 1QC6A 1H4RA 1FAOA 1ZSQA 1Y5OA 1BTNA 3WA0A 1TQZA 2D11A 2QKMA 2V76A 2DKPA 5C16A 2HTHB 3D8EA 3P7ZA 4KVGB 2YS1A 2RVBB 5DI9B 4GXBA 1PFJA
chains in the Genus database with same CATH superfamily
3GYOA 1DDVA 5D3XA 1UNQA 4Z2NA 2K00A 4K17A 1UPQA 3PG7A 3ML4A 4OT1A 4ZRJA 1U5GA 3DCXA 3WYFB 5FI1A 2CY4A 2W2WA 4HB3B 3F5RA 4IOYX 1UNRA 3SYXA 3B77A 2DHKA 1EGXA 2CRFA 5D27A 2EMTA 2W2XD 3DXDA 3ZDTA 4F7HA 2Y7BA 4F7GA 5C6RA 1AWEA 2NMBA 2I1JA 2DX1A 4CHMA 4HAZB 5HE3A 5KCVA 3HQCA 4GMXB 2GCLA 5GOWB 2D9ZA 3TO1A 5HE2A 2GS0A 4D6WA 2ZKMX 3TW1A 1NI2A 2Z13A 2UVMA 3TVVA 1FOEA 5C5BB 3A58A 1FB8A 3U12A 2DYNA 2Y8GA 4HAWB 3HIEA 1K5DB 1J0WA 5CLLB 2CY5A 2DX5A 2DHJA 4D0NB 2RNRB 3ULBA 3A8PA 1MIXA 1U5DA 2MWNB 3ODWA 1Z87A 3OANA 4A6KA 1FGZA 1GC7A 4DX90 3M1IB 1WJ1A 4NSWA 1XKEA 2QKLA 4F7UP 3P6AA 2P0FA 4L6EA 5J3QA 4K2PA 2H7DA 3U8ZA 2LOZA 1XODA 3D8FA 2P8VA 3HW2B 2EC1A 2J0KA 4GNKB 1SHCA 2DKQA 3PSCA 2DN6A 5I2SA 3HSAA 1J19A 2W2XC 3TFMA 2LULA 2YS5A 1ZC3B 1DROA 2DYQA 3MPXA 1MI1A 2D9XA 1U27A 2KUPA 2GJYA 2Z0PA 3ODXA 3V5WA 1FHWA 5CLQB 1BWNA 1WGUA 1EVHA 2DLWA 1GG3A 1UPRA 4Y94A 3NWFA 3ULCA 5D3YA 4B6HA 3DXEA 3N7CA 2M14A 4BBKA 4A6FA 4HHVA 2DHIA 1FHXA 4HATB 3SUZA 1WG7A 2Y8FA 3FM8C 4HAYB 1NTVA 3U7DA 2MKRA 2Z0QA 1ZYIA 3SV1A 2MDXA 3SO6A 2CODA 1K5GB 3FSSA 1V5PA 3LJUX 1X86A 4KHBB 5M4YB 1KZ7A 3IVFA 1DYNA 2GCJA 2J0MA 2KIGA 3VOQA 1OQNA 2RLOA 1QQGA 2I1KA 5DH9B 5JLJB 2RUKB 1MIZB 4A6HA 2AL6A 5LONB 2LKOA 2DTCA 1EF1A 2VRWB 2RRFA 3F0WA 1KI1B 2L2IA 3KZ1A 2IYBA 1P3RA 3CXBB 3GYPA 2X18A 3NWDA 1DDMA 2P0HA 1I2HA 3HK0A 3X23A 5D3WA 1W1GA 3PEGA 4MY6A 1P6SA 2LG1A 4XWXA 4CYEA 1LB1A 5I2MA 2ROVA 1OY2A 2YSZA 2G35A 1B55A 2I5CA 1AQCA 1DBHA 1NU2A 2BCJA 2K2UA 2FJUB 3NSUA 2EJ8A 3CIKA 2H7EA 3AJ4A 4OSNA 4P7IA 2KIEA 3PP2A 4IFSA 1MK9B 2J59M 2K2JA 2DFKA 2J0JA 3FEHA 4EKUA 1XX0A 1P5TA 5LG4B 1RRPB 3G9WA 3KSYA 2PZ1A 2YT1A 5C5BA 1BAKA 2AEHA 1BTKA 4QJ4B 3KRXA 1Y19B 1MK7B 1TJ6A 2LYDA 4HB4B 4KAXB 4HAUB 1H10A 2ELAA 4TYZA 2I5FA 4C0AA 1W1DA 2VSZA 2XQNM 1V88A 4GMVA 4DBBA 5JHGA 2ZPYA 2KR0A 3PZDA 4WVFB 5D3VA 1IRSA 4GN1A 1N3HA 2IFSA 3OHMB 2D9YA 4HAVB 3A8QA 1ISNA 1PMSA 4YONA 4WJ7A 4H8SA 4IAPA 1PLSA 1WI1A 1T77A 3SNHA 1X1FA 2KUQA 1X1GA 2ELBA 4GPTB 2KGXB 4GOUA 5DIFB 2LOXA 3PVUA 2YS3A 2FJLA 3AU4A 2YVCA 1UEFA 3PVLA 5LOPB 2D9WA 1Q67A 2DA0A 2D10A 2YF0A 2YT2A 2Z4DA 2COFA 4MT7A 1W1HA 4TKNA 4GZUA 4QJ5B 2UZRA 3BJIA 4HDOA 2M38A 1EAZA 5KQ1A 1M7RA 2NZ8B 2EMSA 1M7EA 3VIAA 4YL8A 1MPHA 1XCGA 1OMWA 3O96A 3T06A 5C79A 5HE1A 4A5KA 4DXAB 2N0YA 2N23A 1ZVRA 2JP2A 1WJMA 5FI0A 1MAIA 1U5FA 1WVHA 1DDWA 2D2QA 2RGNB 2HE7A 2OTXA 4KHBA 1U5EA 4K2OA 5J3YA 3PVWA 4DX8A 2ADZA 5J3TA 1FGYA 3KRWA 3ZVRA 4PQ0A 4ZRKA 2VKIA 3NWAA 1V61A 4HDQA 2K49A 5KQ4A 5HE0A 2R0DA 3TCAA 2OQBA 5JP4A 4Z2MB 2ROZB 3DXCA 3A98B 2D4QA 4HAXB 1V89A 3QWMA 3FVCA 4HB2B 2CAYA 3BINA 4KHOA 3ODOA 4EJNA 2Z59A 2RSGA 2KCJA 4EMOA 3NW8A 2UZSA 5JHHA 1E5WA 2R09A 2Z14A 4K81A 5DHFB 1V5UA 2L1CA 3UZTA 1WGQA 1V5MA 1SGHA 5L81A 1X11A 2MFQA 1XD4A 4NY0A 1U29A 4CHJA 3RCPA 1RJ2A 1ZC4B 4L1RA 1U2BA 3QBVB 2P0DA 2COCA 2Q13A 5DHAB 3KY9A 4A6FB 4HB0B 4HSIA 3AU5A 2YRYA 4QJ3B 5EFXA 1XR0B 1MKEA 1X05A 2D9VA 1I7AA 1ZM0A 1GC6A 2E2XA 2GUMA 3D8DA 1UNPA 4ZRIA 1TXDA 2COAA 3QIJA 4DIXA 3MDBC 4WSFA 2Z0OA 2YT0A 1KZGA 1LW3A 1NTYA 4PNKA 5IRSA 4CSQA 1FHOA 4MK0A 4KHAA 1QC6A 1H4RA 2NBVA 1FAOA 1ZSQA 1Y5OA 2R2YA 1BTNA 3WA0A 1TQZA 2D11A 2QKMA 2V76A 2DKPA 5C16A 2HTHB 3D8EA 3P7ZA 4KVGB 2YS1A 4QXAB 2RVBB 5DI9B 2K8EA 4GXBA 1PFJA
chains in the Genus database with same CATH topology
3GYOA 1DDVA 5D3XA 1UNQA 4Z2NA 2K00A 4K17A 1UPQA 3PG7A 3ML4A 4ZRJA 1U5GA 3WYFB 5FI1A 2CY4A 2W2WA 4HB3B 3F5RA 4IOYX 1UNRA 3SYXA 2DHKA 1EGXA 2CRFA 5D27A 2EMTA 2W2XD 3DXDA 3ZDTA 4F7HA 2Y7BA 4F7GA 5C6RA 1AWEA 2NMBA 2I1JA 2DX1A 4CHMA 4HAZB 5HE3A 5KCVA 3HQCA 4GMXB 2GCLA 5GOWB 2D9ZA 3TO1A 5HE2A 2GS0A 3TW1A 1NI2A 2UVMA 3TVVA 1FOEA 5C5BB 1FB8A 2DYNA 2Y8GA 4HAWB 1K5DB 1J0WA 5CLLB 2CY5A 2DX5A 2DHJA 4D0NB 2RNRB 3ULBA 3A8PA 1MIXA 1U5DA 2MWNB 3ODWA 1Z87A 3OANA 4A6KA 1FGZA 1GC7A 4DX90 3M1IB 1WJ1A 4NSWA 1XKEA 2QKLA 4F7UP 3P6AA 2P0FA 4L6EA 5J3QA 4K2PA 2H7DA 3U8ZA 2LOZA 1XODA 3D8FA 2P8VA 3HW2B 2EC1A 2J0KA 1SHCA 2DKQA 3PSCA 2DN6A 1J19A 2W2XC 3TFMA 2LULA 2YS5A 1ZC3B 1DROA 2DYQA 3MPXA 2D9XA 1U27A 2KUPA 2GJYA 2Z0PA 3ODXA 3V5WA 1FHWA 5CLQB 1BWNA 1WGUA 1EVHA 2DLWA 1GG3A 1UPRA 4Y94A 3ULCA 5D3YA 4B6HA 3DXEA 3N7CA 2M14A 4BBKA 4A6FA 4HHVA 2DHIA 1FHXA 4HATB 3SUZA 1WG7A 2Y8FA 3FM8C 4HAYB 1NTVA 3U7DA 2MKRA 2Z0QA 3SV1A 2MDXA 3SO6A 2CODA 1K5GB 3FSSA 1V5PA 3LJUX 1X86A 4KHBB 1KZ7A 3IVFA 1DYNA 2GCJA 2J0MA 3VOQA 1OQNA 2RLOA 1QQGA 2I1KA 5DH9B 5JLJB 2RUKB 1MIZB 4A6HA 2AL6A 5LONB 2LKOA 2DTCA 1EF1A 2VRWB 3F0WA 1KI1B 2L2IA 3KZ1A 2IYBA 1P3RA 3CXBB 3GYPA 2X18A 1DDMA 2P0HA 1I2HA 3HK0A 3X23A 5D3WA 1W1GA 3PEGA 4MY6A 1P6SA 2LG1A 4XWXA 4CYEA 1LB1A 2ROVA 1OY2A 2YSZA 2G35A 1B55A 2I5CA 1AQCA 1DBHA 1NU2A 2BCJA 2K2UA 3NSUA 2EJ8A 3CIKA 2H7EA 3AJ4A 4P7IA 3PP2A 4IFSA 1MK9B 2J59M 2K2JA 2DFKA 2J0JA 3FEHA 4EKUA 1XX0A 1P5TA 1RRPB 3G9WA 3KSYA 2PZ1A 2YT1A 5C5BA 1BAKA 2AEHA 1BTKA 3KRXA 1Y19B 1MK7B 1TJ6A 2LYDA 4HB4B 4KAXB 4HAUB 1H10A 2ELAA 4TYZA 2I5FA 4C0AA 1W1DA 2VSZA 2XQNM 1V88A 4GMVA 4DBBA 5JHGA 2ZPYA 3PZDA 4WVFB 5D3VA 1IRSA 4GN1A 1N3HA 2IFSA 2D9YA 4HAVB 3A8QA 1ISNA 1PMSA 4YONA 4WJ7A 4H8SA 4IAPA 1PLSA 1WI1A 3SNHA 1X1FA 1X1GA 2ELBA 4GPTB 2KGXB 5DIFB 2LOXA 3PVUA 2YS3A 2FJLA 3AU4A 2YVCA 1UEFA 3PVLA 5LOPB 2D9WA 1Q67A 2DA0A 2D10A 2YF0A 2COFA 4MT7A 1W1HA 4TKNA 4GZUA 2UZRA 3BJIA 4HDOA 2M38A 1EAZA 5KQ1A 1M7RA 2NZ8B 2EMSA 1M7EA 3VIAA 4YL8A 1MPHA 1XCGA 1OMWA 3O96A 3T06A 5C79A 5HE1A 4A5KA 4DXAB 2N0YA 2N23A 1ZVRA 2JP2A 1WJMA 5FI0A 1MAIA 1U5FA 1WVHA 1DDWA 2D2QA 2RGNB 2HE7A 2OTXA 1U5EA 4K2OA 5J3YA 3PVWA 4DX8A 2ADZA 5J3TA 1FGYA 3KRWA 3ZVRA 4PQ0A 4ZRKA 2VKIA 1V61A 4HDQA 5KQ4A 5HE0A 2R0DA 3TCAA 2OQBA 5JP4A 4Z2MB 2ROZB 3DXCA 3A98B 2D4QA 4HAXB 1V89A 3QWMA 4HB2B 2CAYA 3BINA 4KHOA 3ODOA 4EJNA 2RSGA 2KCJA 4EMOA 2UZSA 5JHHA 1E5WA 2R09A 4K81A 5DHFB 1V5UA 2L1CA 3UZTA 1WGQA 1V5MA 1SGHA 5L81A 1X11A 2MFQA 1XD4A 4NY0A 1U29A 4CHJA 3RCPA 1RJ2A 1ZC4B 1U2BA 3QBVB 2P0DA 2COCA 2Q13A 5DHAB 3KY9A 4A6FB 4HB0B 3AU5A 2YRYA 5EFXA 1XR0B 1MKEA 1X05A 2D9VA 1I7AA 1ZM0A 1GC6A 2E2XA 3D8DA 1UNPA 4ZRIA 1TXDA 2COAA 3QIJA 3MDBC 4WSFA 2Z0OA 2YT0A 1KZGA 1LW3A 1NTYA 4PNKA 1FHOA 4MK0A 4KHAA 1QC6A 1H4RA 1FAOA 1ZSQA 1Y5OA 1BTNA 3WA0A 1TQZA 2D11A 2QKMA 2V76A 2DKPA 5C16A 2HTHB 3D8EA 3P7ZA 4KVGB 2YS1A 2RVBB 5DI9B 4GXBA 1PFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYO A;  1DDV A;  5D3X A;  1UNQ A;  4Z2N A;  2K00 A;  4K17 A;  1UPQ A;  3PG7 A;  3ML4 A;  4ZRJ A;  1U5G A;  3WYF B;  5FI1 A;  2CY4 A;  2W2W A;  4HB3 B;  3F5R A;  4IOY X;  1UNR A;  3SYX A;  2DHK A;  1EGX A;  2CRF A;  5D27 A;  2EMT A;  2W2X D;  3DXD A;  3ZDT A;  4F7H A;  2Y7B A;  4F7G A;  5C6R A;  1AWE A;  2NMB A;  2I1J A;  2DX1 A;  4CHM A;  4HAZ B;  5HE3 A;  5KCV A;  3HQC A;  4GMX B;  2GCL A;  5GOW B;  2D9Z A;  3TO1 A;  5HE2 A;  2GS0 A;  3TW1 A;  1NI2 A;  2UVM A;  3TVV A;  1FOE A;  5C5B B;  1FB8 A;  2DYN A;  2Y8G A;  4HAW B;  1K5D B;  1J0W A;  5CLL B;  2CY5 A;  2DX5 A;  2DHJ A;  4D0N B;  2RNR B;  3ULB A;  3A8P A;  1MIX A;  1U5D A;  2MWN B;  3ODW A;  1Z87 A;  3OAN A;  4A6K A;  1FGZ A;  1GC7 A;  4DX9 0;  3M1I B;  1WJ1 A;  4NSW A;  1XKE A;  2QKL A;  4F7U P;  3P6A A;  2P0F A;  4L6E A;  5J3Q A;  4K2P A;  2H7D A;  3U8Z A;  2LOZ A;  1XOD A;  3D8F A;  2P8V A;  3HW2 B;  2EC1 A;  2J0K A;  1SHC A;  2DKQ A;  3PSC A;  2DN6 A;  1J19 A;  2W2X C;  3TFM A;  2LUL A;  2YS5 A;  1ZC3 B;  1DRO A;  2DYQ A;  3MPX A;  2D9X A;  1U27 A;  2KUP A;  2GJY A;  2Z0P A;  3ODX A;  3V5W A;  1FHW A;  5CLQ B;  1BWN A;  1WGU A;  1EVH A;  2DLW A;  1GG3 A;  1UPR A;  4Y94 A;  3ULC A;  5D3Y A;  4B6H A;  3DXE A;  3N7C A;  2M14 A;  4BBK A;  4A6F A;  4HHV A;  2DHI A;  1FHX A;  4HAT B;  3SUZ A;  1WG7 A;  2Y8F A;  3FM8 C;  4HAY B;  1NTV A;  3U7D A;  2MKR A;  2Z0Q A;  3SV1 A;  2MDX A;  3SO6 A;  2COD A;  1K5G B;  3FSS A;  1V5P A;  3LJU X;  1X86 A;  4KHB B;  1KZ7 A;  3IVF A;  1DYN A;  2GCJ A;  2J0M A;  3VOQ A;  1OQN A;  2RLO A;  1QQG A;  2I1K A;  5DH9 B;  5JLJ B;  2RUK B;  1MIZ B;  4A6H A;  2AL6 A;  5LON B;  2LKO A;  2DTC A;  1EF1 A;  2VRW B;  3F0W A;  1KI1 B;  2L2I A;  3KZ1 A;  2IYB A;  1P3R A;  3CXB B;  3GYP A;  2X18 A;  1DDM A;  2P0H A;  1I2H A;  3HK0 A;  3X23 A;  5D3W A;  1W1G A;  3PEG A;  4MY6 A;  1P6S A;  2LG1 A;  4XWX A;  4CYE A;  1LB1 A;  2ROV A;  1OY2 A;  2YSZ A;  2G35 A;  1B55 A;  2I5C A;  1AQC A;  1DBH A;  1NU2 A;  2BCJ A;  2K2U A;  3NSU A;  2EJ8 A;  3CIK A;  2H7E A;  3AJ4 A;  4P7I A;  3PP2 A;  4IFS A;  1MK9 B;  2J59 M;  2K2J A;  2DFK A;  2J0J A;  3FEH A;  4EKU A;  1XX0 A;  1P5T A;  1RRP B;  3G9W A;  3KSY A;  2PZ1 A;  2YT1 A;  5C5B A;  1BAK A;  2AEH A;  1BTK A;  3KRX A;  1Y19 B;  1MK7 B;  1TJ6 A;  2LYD A;  4HB4 B;  4KAX B;  4HAU B;  1H10 A;  2ELA A;  4TYZ A;  2I5F A;  4C0A A;  1W1D A;  2VSZ A;  2XQN M;  1V88 A;  4GMV A;  4DBB A;  5JHG A;  2ZPY A;  3PZD A;  4WVF B;  5D3V A;  1IRS A;  4GN1 A;  1N3H A;  2IFS A;  2D9Y A;  4HAV B;  3A8Q A;  1ISN A;  1PMS A;  4YON A;  4WJ7 A;  4H8S A;  4IAP A;  1PLS A;  1WI1 A;  3SNH A;  1X1F A;  1X1G A;  2ELB A;  4GPT B;  2KGX B;  5DIF B;  2LOX A;  3PVU A;  2YS3 A;  2FJL A;  3AU4 A;  2YVC A;  1UEF A;  3PVL A;  5LOP B;  2D9W A;  1Q67 A;  2DA0 A;  2D10 A;  2YF0 A;  2COF A;  4MT7 A;  1W1H A;  4TKN A;  4GZU A;  2UZR A;  3BJI A;  4HDO A;  2M38 A;  1EAZ A;  5KQ1 A;  1M7R A;  2NZ8 B;  2EMS A;  1M7E A;  3VIA A;  4YL8 A;  1MPH A;  1XCG A;  1OMW A;  3O96 A;  3T06 A;  5C79 A;  5HE1 A;  4A5K A;  4DXA B;  2N0Y A;  2N23 A;  1ZVR A;  2JP2 A;  1WJM A;  5FI0 A;  1MAI A;  1U5F A;  1WVH A;  1DDW A;  2D2Q A;  2RGN B;  2HE7 A;  2OTX A;  1U5E A;  4K2O A;  5J3Y A;  3PVW A;  4DX8 A;  2ADZ A;  5J3T A;  1FGY A;  3KRW A;  3ZVR A;  4PQ0 A;  4ZRK A;  2VKI A;  1V61 A;  4HDQ A;  5KQ4 A;  5HE0 A;  2R0D A;  3TCA A;  2OQB A;  5JP4 A;  4Z2M B;  2ROZ B;  3DXC A;  3A98 B;  2D4Q A;  4HAX B;  1V89 A;  3QWM A;  4HB2 B;  2CAY A;  3BIN A;  4KHO A;  3ODO A;  4EJN A;  2RSG A;  2KCJ A;  4EMO A;  2UZS A;  5JHH A;  1E5W A;  2R09 A;  4K81 A;  5DHF B;  1V5U A;  2L1C A;  3UZT A;  1WGQ A;  1V5M A;  1SGH A;  5L81 A;  1X11 A;  2MFQ A;  1XD4 A;  4NY0 A;  1U29 A;  4CHJ A;  3RCP A;  1RJ2 A;  1ZC4 B;  1U2B A;  3QBV B;  2P0D A;  2COC A;  2Q13 A;  5DHA B;  3KY9 A;  4A6F B;  4HB0 B;  3AU5 A;  2YRY A;  5EFX A;  1XR0 B;  1MKE A;  1X05 A;  2D9V A;  1I7A A;  1ZM0 A;  1GC6 A;  2E2X A;  3D8D A;  1UNP A;  4ZRI A;  1TXD A;  2COA A;  3QIJ A;  3MDB C;  4WSF A;  2Z0O A;  2YT0 A;  1KZG A;  1LW3 A;  1NTY A;  4PNK A;  1FHO A;  4MK0 A;  4KHA A;  1QC6 A;  1H4R A;  1FAO A;  1ZSQ A;  1Y5O A;  1BTN A;  3WA0 A;  1TQZ A;  2D11 A;  2QKM A;  2V76 A;  2DKP A;  5C16 A;  2HTH B;  3D8E A;  3P7Z A;  4KVG B;  2YS1 A;  2RVB B;  5DI9 B;  4GXB A;  1PFJ A; 
#chains in the Genus database with same CATH topology
 3GYO A;  1DDV A;  5D3X A;  1UNQ A;  4Z2N A;  2K00 A;  4K17 A;  1UPQ A;  3PG7 A;  3ML4 A;  4OT1 A;  4ZRJ A;  1U5G A;  3DCX A;  3WYF B;  5FI1 A;  2CY4 A;  2W2W A;  4HB3 B;  3F5R A;  4IOY X;  1UNR A;  3SYX A;  3B77 A;  2DHK A;  1EGX A;  2CRF A;  5D27 A;  2EMT A;  2W2X D;  3DXD A;  3ZDT A;  4F7H A;  2Y7B A;  4F7G A;  5C6R A;  1AWE A;  2NMB A;  2I1J A;  2DX1 A;  4CHM A;  4HAZ B;  5HE3 A;  5KCV A;  3HQC A;  4GMX B;  2GCL A;  5GOW B;  2D9Z A;  3TO1 A;  5HE2 A;  2GS0 A;  4D6W A;  2ZKM X;  3TW1 A;  1NI2 A;  2Z13 A;  2UVM A;  3TVV A;  1FOE A;  5C5B B;  3A58 A;  1FB8 A;  3U12 A;  2DYN A;  2Y8G A;  4HAW B;  3HIE A;  1K5D B;  1J0W A;  5CLL B;  2CY5 A;  2DX5 A;  2DHJ A;  4D0N B;  2RNR B;  3ULB A;  3A8P A;  1MIX A;  1U5D A;  2MWN B;  3ODW A;  1Z87 A;  3OAN A;  4A6K A;  1FGZ A;  1GC7 A;  4DX9 0;  3M1I B;  1WJ1 A;  4NSW A;  1XKE A;  2QKL A;  4F7U P;  3P6A A;  2P0F A;  4L6E A;  5J3Q A;  4K2P A;  2H7D A;  3U8Z A;  2LOZ A;  1XOD A;  3D8F A;  2P8V A;  3HW2 B;  2EC1 A;  2J0K A;  4GNK B;  1SHC A;  2DKQ A;  3PSC A;  2DN6 A;  5I2S A;  3HSA A;  1J19 A;  2W2X C;  3TFM A;  2LUL A;  2YS5 A;  1ZC3 B;  1DRO A;  2DYQ A;  3MPX A;  1MI1 A;  2D9X A;  1U27 A;  2KUP A;  2GJY A;  2Z0P A;  3ODX A;  3V5W A;  1FHW A;  5CLQ B;  1BWN A;  1WGU A;  1EVH A;  2DLW A;  1GG3 A;  1UPR A;  4Y94 A;  3NWF A;  3ULC A;  5D3Y A;  4B6H A;  3DXE A;  3N7C A;  2M14 A;  4BBK A;  4A6F A;  4HHV A;  2DHI A;  1FHX A;  4HAT B;  3SUZ A;  1WG7 A;  2Y8F A;  3FM8 C;  4HAY B;  1NTV A;  3U7D A;  2MKR A;  2Z0Q A;  1ZYI A;  3SV1 A;  2MDX A;  3SO6 A;  2COD A;  1K5G B;  3FSS A;  1V5P A;  3LJU X;  1X86 A;  4KHB B;  5M4Y B;  1KZ7 A;  3IVF A;  1DYN A;  2GCJ A;  2J0M A;  2KIG A;  3VOQ A;  1OQN A;  2RLO A;  1QQG A;  2I1K A;  5DH9 B;  5JLJ B;  2RUK B;  1MIZ B;  4A6H A;  2AL6 A;  5LON B;  2LKO A;  2DTC A;  1EF1 A;  2VRW B;  2RRF A;  3F0W A;  1KI1 B;  2L2I A;  3KZ1 A;  2IYB A;  1P3R A;  3CXB B;  3GYP A;  2X18 A;  3NWD A;  1DDM A;  2P0H A;  1I2H A;  3HK0 A;  3X23 A;  5D3W A;  1W1G A;  3PEG A;  4MY6 A;  1P6S A;  2LG1 A;  4XWX A;  4CYE A;  1LB1 A;  5I2M A;  2ROV A;  1OY2 A;  2YSZ A;  2G35 A;  1B55 A;  2I5C A;  1AQC A;  1DBH A;  1NU2 A;  2BCJ A;  2K2U A;  2FJU B;  3NSU A;  2EJ8 A;  3CIK A;  2H7E A;  3AJ4 A;  4OSN A;  4P7I A;  2KIE A;  3PP2 A;  4IFS A;  1MK9 B;  2J59 M;  2K2J A;  2DFK A;  2J0J A;  3FEH A;  4EKU A;  1XX0 A;  1P5T A;  5LG4 B;  1RRP B;  3G9W A;  3KSY A;  2PZ1 A;  2YT1 A;  5C5B A;  1BAK A;  2AEH A;  1BTK A;  4QJ4 B;  3KRX A;  1Y19 B;  1MK7 B;  1TJ6 A;  2LYD A;  4HB4 B;  4KAX B;  4HAU B;  1H10 A;  2ELA A;  4TYZ A;  2I5F A;  4C0A A;  1W1D A;  2VSZ A;  2XQN M;  1V88 A;  4GMV A;  4DBB A;  5JHG A;  2ZPY A;  2KR0 A;  3PZD A;  4WVF B;  5D3V A;  1IRS A;  4GN1 A;  1N3H A;  2IFS A;  3OHM B;  2D9Y A;  4HAV B;  3A8Q A;  1ISN A;  1PMS A;  4YON A;  4WJ7 A;  4H8S A;  4IAP A;  1PLS A;  1WI1 A;  1T77 A;  3SNH A;  1X1F A;  2KUQ A;  1X1G A;  2ELB A;  4GPT B;  2KGX B;  4GOU A;  5DIF B;  2LOX A;  3PVU A;  2YS3 A;  2FJL A;  3AU4 A;  2YVC A;  1UEF A;  3PVL A;  5LOP B;  2D9W A;  1Q67 A;  2DA0 A;  2D10 A;  2YF0 A;  2YT2 A;  2Z4D A;  2COF A;  4MT7 A;  1W1H A;  4TKN A;  4GZU A;  4QJ5 B;  2UZR A;  3BJI A;  4HDO A;  2M38 A;  1EAZ A;  5KQ1 A;  1M7R A;  2NZ8 B;  2EMS A;  1M7E A;  3VIA A;  4YL8 A;  1MPH A;  1XCG A;  1OMW A;  3O96 A;  3T06 A;  5C79 A;  5HE1 A;  4A5K A;  4DXA B;  2N0Y A;  2N23 A;  1ZVR A;  2JP2 A;  1WJM A;  5FI0 A;  1MAI A;  1U5F A;  1WVH A;  1DDW A;  2D2Q A;  2RGN B;  2HE7 A;  2OTX A;  4KHB A;  1U5E A;  4K2O A;  5J3Y A;  3PVW A;  4DX8 A;  2ADZ A;  5J3T A;  1FGY A;  3KRW A;  3ZVR A;  4PQ0 A;  4ZRK A;  2VKI A;  3NWA A;  1V61 A;  4HDQ A;  2K49 A;  5KQ4 A;  5HE0 A;  2R0D A;  3TCA A;  2OQB A;  5JP4 A;  4Z2M B;  2ROZ B;  3DXC A;  3A98 B;  2D4Q A;  4HAX B;  1V89 A;  3QWM A;  3FVC A;  4HB2 B;  2CAY A;  3BIN A;  4KHO A;  3ODO A;  4EJN A;  2Z59 A;  2RSG A;  2KCJ A;  4EMO A;  3NW8 A;  2UZS A;  5JHH A;  1E5W A;  2R09 A;  2Z14 A;  4K81 A;  5DHF B;  1V5U A;  2L1C A;  3UZT A;  1WGQ A;  1V5M A;  1SGH A;  5L81 A;  1X11 A;  2MFQ A;  1XD4 A;  4NY0 A;  1U29 A;  4CHJ A;  3RCP A;  1RJ2 A;  1ZC4 B;  4L1R A;  1U2B A;  3QBV B;  2P0D A;  2COC A;  2Q13 A;  5DHA B;  3KY9 A;  4A6F B;  4HB0 B;  4HSI A;  3AU5 A;  2YRY A;  4QJ3 B;  5EFX A;  1XR0 B;  1MKE A;  1X05 A;  2D9V A;  1I7A A;  1ZM0 A;  1GC6 A;  2E2X A;  2GUM A;  3D8D A;  1UNP A;  4ZRI A;  1TXD A;  2COA A;  3QIJ A;  4DIX A;  3MDB C;  4WSF A;  2Z0O A;  2YT0 A;  1KZG A;  1LW3 A;  1NTY A;  4PNK A;  5IRS A;  4CSQ A;  1FHO A;  4MK0 A;  4KHA A;  1QC6 A;  1H4R A;  2NBV A;  1FAO A;  1ZSQ A;  1Y5O A;  2R2Y A;  1BTN A;  3WA0 A;  1TQZ A;  2D11 A;  2QKM A;  2V76 A;  2DKP A;  5C16 A;  2HTH B;  3D8E A;  3P7Z A;  4KVG B;  2YS1 A;  4QXA B;  2RVB B;  5DI9 B;  2K8E A;  4GXB A;  1PFJ A; 
#chains in the Genus database with same CATH homology
 3GYO A;  1DDV A;  5D3X A;  1UNQ A;  4Z2N A;  2K00 A;  4K17 A;  1UPQ A;  3PG7 A;  3ML4 A;  4ZRJ A;  1U5G A;  3WYF B;  5FI1 A;  2CY4 A;  2W2W A;  4HB3 B;  3F5R A;  4IOY X;  1UNR A;  3SYX A;  2DHK A;  1EGX A;  2CRF A;  5D27 A;  2EMT A;  2W2X D;  3DXD A;  3ZDT A;  4F7H A;  2Y7B A;  4F7G A;  5C6R A;  1AWE A;  2NMB A;  2I1J A;  2DX1 A;  4CHM A;  4HAZ B;  5HE3 A;  5KCV A;  3HQC A;  4GMX B;  2GCL A;  5GOW B;  2D9Z A;  3TO1 A;  5HE2 A;  2GS0 A;  3TW1 A;  1NI2 A;  2UVM A;  3TVV A;  1FOE A;  5C5B B;  1FB8 A;  2DYN A;  2Y8G A;  4HAW B;  1K5D B;  1J0W A;  5CLL B;  2CY5 A;  2DX5 A;  2DHJ A;  4D0N B;  2RNR B;  3ULB A;  3A8P A;  1MIX A;  1U5D A;  2MWN B;  3ODW A;  1Z87 A;  3OAN A;  4A6K A;  1FGZ A;  1GC7 A;  4DX9 0;  3M1I B;  1WJ1 A;  4NSW A;  1XKE A;  2QKL A;  4F7U P;  3P6A A;  2P0F A;  4L6E A;  5J3Q A;  4K2P A;  2H7D A;  3U8Z A;  2LOZ A;  1XOD A;  3D8F A;  2P8V A;  3HW2 B;  2EC1 A;  2J0K A;  1SHC A;  2DKQ A;  3PSC A;  2DN6 A;  1J19 A;  2W2X C;  3TFM A;  2LUL A;  2YS5 A;  1ZC3 B;  1DRO A;  2DYQ A;  3MPX A;  2D9X A;  1U27 A;  2KUP A;  2GJY A;  2Z0P A;  3ODX A;  3V5W A;  1FHW A;  5CLQ B;  1BWN A;  1WGU A;  1EVH A;  2DLW A;  1GG3 A;  1UPR A;  4Y94 A;  3ULC A;  5D3Y A;  4B6H A;  3DXE A;  3N7C A;  2M14 A;  4BBK A;  4A6F A;  4HHV A;  2DHI A;  1FHX A;  4HAT B;  3SUZ A;  1WG7 A;  2Y8F A;  3FM8 C;  4HAY B;  1NTV A;  3U7D A;  2MKR A;  2Z0Q A;  3SV1 A;  2MDX A;  3SO6 A;  2COD A;  1K5G B;  3FSS A;  1V5P A;  3LJU X;  1X86 A;  4KHB B;  1KZ7 A;  3IVF A;  1DYN A;  2GCJ A;  2J0M A;  3VOQ A;  1OQN A;  2RLO A;  1QQG A;  2I1K A;  5DH9 B;  5JLJ B;  2RUK B;  1MIZ B;  4A6H A;  2AL6 A;  5LON B;  2LKO A;  2DTC A;  1EF1 A;  2VRW B;  3F0W A;  1KI1 B;  2L2I A;  3KZ1 A;  2IYB A;  1P3R A;  3CXB B;  3GYP A;  2X18 A;  1DDM A;  2P0H A;  1I2H A;  3HK0 A;  3X23 A;  5D3W A;  1W1G A;  3PEG A;  4MY6 A;  1P6S A;  2LG1 A;  4XWX A;  4CYE A;  1LB1 A;  2ROV A;  1OY2 A;  2YSZ A;  2G35 A;  1B55 A;  2I5C A;  1AQC A;  1DBH A;  1NU2 A;  2BCJ A;  2K2U A;  3NSU A;  2EJ8 A;  3CIK A;  2H7E A;  3AJ4 A;  4P7I A;  3PP2 A;  4IFS A;  1MK9 B;  2J59 M;  2K2J A;  2DFK A;  2J0J A;  3FEH A;  4EKU A;  1XX0 A;  1P5T A;  1RRP B;  3G9W A;  3KSY A;  2PZ1 A;  2YT1 A;  5C5B A;  1BAK A;  2AEH A;  1BTK A;  3KRX A;  1Y19 B;  1MK7 B;  1TJ6 A;  2LYD A;  4HB4 B;  4KAX B;  4HAU B;  1H10 A;  2ELA A;  4TYZ A;  2I5F A;  4C0A A;  1W1D A;  2VSZ A;  2XQN M;  1V88 A;  4GMV A;  4DBB A;  5JHG A;  2ZPY A;  3PZD A;  4WVF B;  5D3V A;  1IRS A;  4GN1 A;  1N3H A;  2IFS A;  2D9Y A;  4HAV B;  3A8Q A;  1ISN A;  1PMS A;  4YON A;  4WJ7 A;  4H8S A;  4IAP A;  1PLS A;  1WI1 A;  3SNH A;  1X1F A;  1X1G A;  2ELB A;  4GPT B;  2KGX B;  5DIF B;  2LOX A;  3PVU A;  2YS3 A;  2FJL A;  3AU4 A;  2YVC A;  1UEF A;  3PVL A;  5LOP B;  2D9W A;  1Q67 A;  2DA0 A;  2D10 A;  2YF0 A;  2COF A;  4MT7 A;  1W1H A;  4TKN A;  4GZU A;  2UZR A;  3BJI A;  4HDO A;  2M38 A;  1EAZ A;  5KQ1 A;  1M7R A;  2NZ8 B;  2EMS A;  1M7E A;  3VIA A;  4YL8 A;  1MPH A;  1XCG A;  1OMW A;  3O96 A;  3T06 A;  5C79 A;  5HE1 A;  4A5K A;  4DXA B;  2N0Y A;  2N23 A;  1ZVR A;  2JP2 A;  1WJM A;  5FI0 A;  1MAI A;  1U5F A;  1WVH A;  1DDW A;  2D2Q A;  2RGN B;  2HE7 A;  2OTX A;  1U5E A;  4K2O A;  5J3Y A;  3PVW A;  4DX8 A;  2ADZ A;  5J3T A;  1FGY A;  3KRW A;  3ZVR A;  4PQ0 A;  4ZRK A;  2VKI A;  1V61 A;  4HDQ A;  5KQ4 A;  5HE0 A;  2R0D A;  3TCA A;  2OQB A;  5JP4 A;  4Z2M B;  2ROZ B;  3DXC A;  3A98 B;  2D4Q A;  4HAX B;  1V89 A;  3QWM A;  4HB2 B;  2CAY A;  3BIN A;  4KHO A;  3ODO A;  4EJN A;  2RSG A;  2KCJ A;  4EMO A;  2UZS A;  5JHH A;  1E5W A;  2R09 A;  4K81 A;  5DHF B;  1V5U A;  2L1C A;  3UZT A;  1WGQ A;  1V5M A;  1SGH A;  5L81 A;  1X11 A;  2MFQ A;  1XD4 A;  4NY0 A;  1U29 A;  4CHJ A;  3RCP A;  1RJ2 A;  1ZC4 B;  1U2B A;  3QBV B;  2P0D A;  2COC A;  2Q13 A;  5DHA B;  3KY9 A;  4A6F B;  4HB0 B;  3AU5 A;  2YRY A;  5EFX A;  1XR0 B;  1MKE A;  1X05 A;  2D9V A;  1I7A A;  1ZM0 A;  1GC6 A;  2E2X A;  3D8D A;  1UNP A;  4ZRI A;  1TXD A;  2COA A;  3QIJ A;  3MDB C;  4WSF A;  2Z0O A;  2YT0 A;  1KZG A;  1LW3 A;  1NTY A;  4PNK A;  1FHO A;  4MK0 A;  4KHA A;  1QC6 A;  1H4R A;  1FAO A;  1ZSQ A;  1Y5O A;  1BTN A;  3WA0 A;  1TQZ A;  2D11 A;  2QKM A;  2V76 A;  2DKP A;  5C16 A;  2HTH B;  3D8E A;  3P7Z A;  4KVG B;  2YS1 A;  2RVB B;  5DI9 B;  4GXB A;  1PFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...