2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase,gene regulation
molecule keywords Histone-arginine methyltransferase CARM1
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
2YVCA 2ELBA 1P3RA 2I5CA 1N3HA 1H4RA 1NTYA 3DXEA 1RJ2A 2GJYA 1AQCA 1SHCA 1K5DB 2NMBA 3U8ZA 2ADZA 3PP2A 2RSGA 5KQ4A 2DKQA 3DXDA 2HE7A 4F7UP 4H8SA 3HQCA 2DX1A 4HAVB 5GOWB 2J59M 1Y5OA 2GCJA 4GMXB 2DA0A 4B6HA 4A6HA 4WVFB 1TQZA 3TFMA 1NU2A 2W2XC 2IYBA 4ZRJA 1WGQA 3HW2B 1V5MA 5CLLB 4KVGB 3MDBC 1NI2A 2D9WA 1V89A 3SV1A 2P8VA 5KCVA 5DHFB 4NSWA 1XD4A 4GPTB 3WA0A 1U29A 5HE1A 1W1DA 5JHGA 2YF0A 3U7DA 1WGUA 1OMWA 2HTHB 2X18A 3TO1A 3UZTA 3OANA 1Z87A 2H7DA 1DYNA 1ISNA 1BTKA 1TXDA 4EKUA 4YONA 2EMTA 3D8FA 5DHAB 1UNRA 1FGYA 1WJMA 2N0YA 2RLOA 1DDMA 3AJ4A 1KI1B 1X86A 4WSFA 4K17A 1PMSA 1M7EA 2CRFA 4IFSA 1AWEA 1B55A 2YRYA 3GYPA 4NY0A 4KHAA 1TJ6A 4A6FB 2K2JA 3X23A 5L81A 3M1IB 2W2WA 4HAYB 1MIZB 1P5TA 1W1HA 1U27A 3CIKA 1V88A 3PSCA 1OY2A 4EMOA 2EMSA 2CAYA 2ROVA 4HAXB 3QBVB 1BTNA 1V5UA 2YS1A 2GS0A 1PLSA 1KZ7A 2AEHA 2ELAA 4KHBB 3KRXA 2L2IA 3A8QA 1M7RA 4MK0A 1X05A 4HB3B 2K2UA 1UEFA 5C79A 3ULCA 2JP2A 1OQNA 2CY4A 2RNRB 3RCPA 3PVWA 3ODWA 1PFJA 5J3QA 3NSUA 3A98B 2KCJA 2LG1A 1MKEA 1V5PA 4KHOA 1U5DA 2PZ1A 1FAOA 2YT0A 3F5RA 5FI0A 5JLJB 5D3VA 3MPXA 2VKIA 2MFQA 4HDQA 2YSZA 4HB2B 2OQBA 3KSYA 2Y8GA 4P7IA 1DDVA 4PNKA 4XWXA 3FSSA 2P0DA 2D9VA 2J0MA 3AU4A 1I2HA 1MIXA 4YL8A 2P0FA 5KQ1A 2YT1A 5D3WA 2LYDA 3PZDA 4IAPA 1UPRA 3ZVRA 1EF1A 3P6AA 4DXAB 3DXCA 2D9XA 2M38A 4BBKA 5C16A 4ZRIA 2DYNA 3KZ1A 2DYQA 1WJ1A 4HB0B 3PVLA 3PEGA 1UPQA 1MK9B 3WYFB 2OTXA 2AL6A 1GC6A 5HE0A 3AU5A 1J0WA 1J19A 2QKLA 1LW3A 5CLQB 1XKEA 4IOYX 4F7GA 1WVHA 2CODA 1P6SA 1FOEA 2YS5A 4CYEA 2RVBB 1WI1A 4F7HA 5HE3A 4DBBA 1XODA 3VOQA 3TVVA 2W2XD 1GC7A 1U5EA 4Z2NA 2I1JA 4DX8A 2DTCA 1BWNA 2LOZA 4HAWB 2E2XA 1QC6A 3GYOA 5FI1A 2DX5A 3ODOA 2Z0QA 2J0JA 3ULBA 2LOXA 1ZSQA 4HHVA 2MWNB 2Y7BA 3HK0A 4KAXB 4A6KA 2MDXA 1MPHA 4K2OA 1ZC4B 5J3YA 1DBHA 4CHMA 2Q13A 1LB1A 1W1GA 5HE2A 1EVHA 4PQ0A 1H10A 1U5GA 3QIJA 3PVUA 5C5BB 4TYZA 1U5FA 2KGXB 2R09A 3ODXA 3A8PA 2UZRA 2BCJA 5DH9B 1U2BA 1Q67A 4GN1A 3SUZA 2M14A 2D2QA 2DFKA 1UNQA 2EJ8A 3IVFA 1MAIA 1GG3A 3VIAA 1ZC3B 3ML4A 4MY6A 1NTVA 3BJIA 2D10A 1X1GA 4MT7A 2G35A 1ZVRA 1Y19B 4DX90 1E5WA 1WG7A 1QQGA 4Z2MB 1UNPA 1MK7B 1XR0B 1I7AA 2QKMA 1EGXA 4K2PA 3FM8C 3SNHA 2R0DA 2DHKA 2Z0OA 3KY9A 2NZ8B 1IRSA 5D3YA 1X11A 5C6RA 4HAZB 1ZM0A 2J0KA 2COCA 2FJLA 2L1CA 5LOPB 2LKOA 2D9YA 2MKRA 3F0WA 4A6FA 2GCLA 3TCAA 3FEHA 2DLWA 2P0HA 4Y94A 3D8DA 3BINA 2KUPA 1FHOA 3SO6A 2D4QA 4L6EA 4D0NB 1FGZA 2COAA 3G9WA 3P7ZA 2DHJA 1SGHA 2D9ZA 2XQNM 4HDOA 4WJ7A 4HAUB 1DROA 5D3XA 3LJUX 1X1FA 2VSZA 2V76A 5C5BA 2N23A 2UZSA 2ROZB 2ZPYA 2Z0PA 3QWMA 2VRWB 5J3TA 4GZUA 3TW1A 4C0AA 3T06A 2RUKB 5DI9B 3CXBB 1K5GB 3V5WA 1BAKA 3N7CA 3D8EA 1XX0A 1V61A 2CY5A 4GMVA 2Y8FA 2EC1A 1RRPB 1FHWA 4ZRKA 5JHHA 4CHJA 4GXBA 2D11A 2LULA 4HB4B 2IFSA 4TKNA 2COFA 2DKPA 2H7EA 3KRWA 3O96A 2UVMA 2I5FA 3PG7A 2I1KA 5DIFB 1DDWA 1KZGA 3SYXA 3ZDTA 4K81A 2K00A 5JP4A 1EAZA 1FHXA 4EJNA 2YS3A 2RGNB 5D27A 4A5KA 2DN6A 4HATB 5LONB 1FB8A 2DHIA 5EFXA 1XCGA
chains in the Genus database with same CATH superfamily
2YVCA 2ELBA 1P3RA 2I5CA 1N3HA 1H4RA 1NTYA 3DXEA 1RJ2A 2GJYA 1AQCA 1SHCA 1K5DB 2NMBA 3U8ZA 2ADZA 3PP2A 2RSGA 5KQ4A 2DKQA 3DXDA 2KIEA 2HE7A 4F7UP 4H8SA 3HQCA 2DX1A 4HAVB 5GOWB 2J59M 1Y5OA 2GCJA 4GMXB 2DA0A 4B6HA 4A6HA 4WVFB 1TQZA 3TFMA 1NU2A 2W2XC 2IYBA 4ZRJA 1WGQA 3HW2B 1V5MA 5CLLB 4KVGB 3MDBC 1NI2A 2D9WA 1V89A 3SV1A 2P8VA 5KCVA 5DHFB 4NSWA 1XD4A 4GPTB 4DIXA 3WA0A 1U29A 5HE1A 1W1DA 5JHGA 2YF0A 2NBVA 1WGUA 3U7DA 1OMWA 2HTHB 2KUQA 2X18A 3TO1A 3UZTA 3OANA 1Z87A 2H7DA 1DYNA 1ISNA 1BTKA 1TXDA 4EKUA 4YONA 2EMTA 4QJ4B 3D8FA 5DHAB 1UNRA 1FGYA 1WJMA 2N0YA 2RLOA 1DDMA 3AJ4A 1KI1B 1X86A 4WSFA 4K17A 1PMSA 3OHMB 3B77A 1M7EA 2CRFA 4IFSA 1AWEA 1B55A 2YRYA 3DCXA 3GYPA 4GNKB 4NY0A 4KHAA 1TJ6A 4A6FB 2K2JA 3X23A 5L81A 3M1IB 2Z59A 2W2WA 4HAYB 1MIZB 1P5TA 4OT1A 1W1HA 1T77A 1U27A 3CIKA 1V88A 3PSCA 1OY2A 4EMOA 2EMSA 2CAYA 2KIGA 2ROVA 4HAXB 3QBVB 1BTNA 1V5UA 2Z13A 2YS1A 2R2YA 5LG4B 2GS0A 1PLSA 1KZ7A 2AEHA 2ZKMX 2ELAA 4KHBB 3KRXA 2L2IA 3A8QA 1M7RA 3HSAA 4MK0A 1X05A 4HB3B 2K2UA 1UEFA 4OSNA 5C79A 3ULCA 2JP2A 1OQNA 2CY4A 2RNRB 3NWAA 3RCPA 4QJ3B 3PVWA 3ODWA 1PFJA 5J3QA 3NSUA 3A98B 2KCJA 2LG1A 1MKEA 1V5PA 4KHOA 1U5DA 2PZ1A 1FAOA 2YT0A 3F5RA 5FI0A 5JLJB 5D3VA 3MPXA 2VKIA 2MFQA 4HSIA 4HDQA 2YSZA 4HB2B 2OQBA 3KSYA 2Y8GA 4P7IA 1DDVA 4PNKA 2GUMA 4XWXA 3FSSA 2P0DA 2D9VA 2J0MA 3AU4A 1I2HA 1MIXA 4YL8A 2P0FA 5KQ1A 2YT1A 5D3WA 2LYDA 3PZDA 4IAPA 1UPRA 5IRSA 3ZVRA 1EF1A 3P6AA 1MI1A 4DXAB 3DXCA 2D9XA 2M38A 4BBKA 5C16A 2YT2A 4ZRIA 2DYNA 3KZ1A 2DYQA 1WJ1A 4HB0B 3PVLA 3PEGA 1UPQA 1MK9B 3WYFB 3FVCA 2OTXA 2AL6A 1GC6A 5HE0A 2KR0A 3AU5A 1J0WA 1J19A 2QKLA 1LW3A 5CLQB 1XKEA 4IOYX 4F7GA 1WVHA 2CODA 1P6SA 1FOEA 2YS5A 4CYEA 3U12A 2RVBB 1WI1A 4F7HA 5HE3A 4DBBA 1XODA 3VOQA 1ZYIA 3TVVA 2W2XD 3NWFA 1GC7A 1U5EA 4Z2NA 2I1JA 4D6WA 4DX8A 2DTCA 1BWNA 2LOZA 4HAWB 2E2XA 1QC6A 3GYOA 5FI1A 2DX5A 3ODOA 2Z0QA 2J0JA 3ULBA 2LOXA 1ZSQA 4HHVA 2MWNB 2K8EA 2Y7BA 3HK0A 4KAXB 4A6KA 2MDXA 1MPHA 4L1RA 4K2OA 1ZC4B 5J3YA 1DBHA 4CHMA 2Q13A 1LB1A 1W1GA 5HE2A 1EVHA 4PQ0A 1H10A 2K49A 1U5GA 3QIJA 2Z14A 3PVUA 5C5BB 4TYZA 1U5FA 2R09A 2KGXB 3ODXA 3A8PA 2UZRA 2BCJA 5DH9B 1U2BA 1Q67A 4GN1A 3SUZA 2M14A 2D2QA 2DFKA 1UNQA 2EJ8A 3IVFA 1MAIA 1GG3A 3VIAA 1ZC3B 3A58A 3ML4A 4MY6A 1NTVA 3BJIA 2D10A 1X1GA 4MT7A 2G35A 5M4YB 1ZVRA 1Y19B 4DX90 1E5WA 1WG7A 1QQGA 4Z2MB 1UNPA 1MK7B 1XR0B 1I7AA 2QKMA 1EGXA 4K2PA 3FM8C 3SNHA 2R0DA 2DHKA 2Z0OA 3KY9A 2NZ8B 1IRSA 5D3YA 1X11A 4QXAB 5C6RA 4HAZB 1ZM0A 2J0KA 2COCA 4CSQA 5I2SA 2FJLA 2L1CA 5LOPB 2LKOA 2D9YA 2MKRA 3F0WA 4A6FA 2GCLA 3TCAA 3FEHA 2DLWA 2P0HA 4Y94A 3D8DA 3BINA 2KUPA 1FHOA 3SO6A 2D4QA 4L6EA 4D0NB 1FGZA 2COAA 3G9WA 3P7ZA 2DHJA 1SGHA 2D9ZA 2XQNM 4HDOA 4WJ7A 4HAUB 4GOUA 1DROA 5D3XA 3LJUX 1X1FA 2VSZA 2V76A 5C5BA 2N23A 2UZSA 3NW8A 2ROZB 2ZPYA 2Z0PA 3QWMA 2VRWB 4QJ5B 5J3TA 4GZUA 3TW1A 4C0AA 3T06A 2RUKB 5DI9B 3CXBB 1K5GB 3V5WA 5I2MA 2Z4DA 1BAKA 3N7CA 3D8EA 1XX0A 3NWDA 1V61A 2CY5A 4GMVA 2Y8FA 2EC1A 1RRPB 1FHWA 4ZRKA 5JHHA 4CHJA 4GXBA 2D11A 2LULA 2RRFA 4HB4B 2IFSA 4TKNA 2COFA 2DKPA 2H7EA 3KRWA 3O96A 2UVMA 2I5FA 3PG7A 2I1KA 4KHBA 1DDWA 1KZGA 5DIFB 3SYXA 3ZDTA 4K81A 2K00A 5JP4A 1EAZA 1FHXA 4EJNA 2YS3A 3HIEA 2RGNB 5D27A 4A5KA 2DN6A 4HATB 5LONB 2FJUB 1FB8A 2DHIA 5EFXA 1XCGA
chains in the Genus database with same CATH topology
2YVCA 2ELBA 1P3RA 2I5CA 1N3HA 1H4RA 1NTYA 3DXEA 1RJ2A 2GJYA 1AQCA 1SHCA 1K5DB 2NMBA 3U8ZA 2ADZA 3PP2A 2RSGA 5KQ4A 2DKQA 3DXDA 2HE7A 4F7UP 4H8SA 3HQCA 2DX1A 4HAVB 5GOWB 2J59M 1Y5OA 2GCJA 4GMXB 2DA0A 4B6HA 4A6HA 4WVFB 1TQZA 3TFMA 1NU2A 2W2XC 2IYBA 4ZRJA 1WGQA 3HW2B 1V5MA 5CLLB 4KVGB 3MDBC 1NI2A 2D9WA 1V89A 3SV1A 2P8VA 5KCVA 5DHFB 4NSWA 1XD4A 4GPTB 3WA0A 1U29A 5HE1A 1W1DA 5JHGA 2YF0A 3U7DA 1WGUA 1OMWA 2HTHB 2X18A 3TO1A 3UZTA 3OANA 1Z87A 2H7DA 1DYNA 1ISNA 1BTKA 1TXDA 4EKUA 4YONA 2EMTA 3D8FA 5DHAB 1UNRA 1FGYA 1WJMA 2N0YA 2RLOA 1DDMA 3AJ4A 1KI1B 1X86A 4WSFA 4K17A 1PMSA 1M7EA 2CRFA 4IFSA 1AWEA 1B55A 2YRYA 3GYPA 4NY0A 4KHAA 1TJ6A 4A6FB 2K2JA 3X23A 5L81A 3M1IB 2W2WA 4HAYB 1MIZB 1P5TA 1W1HA 1U27A 3CIKA 1V88A 3PSCA 1OY2A 4EMOA 2EMSA 2CAYA 2ROVA 4HAXB 3QBVB 1BTNA 1V5UA 2YS1A 2GS0A 1PLSA 1KZ7A 2AEHA 2ELAA 4KHBB 3KRXA 2L2IA 3A8QA 1M7RA 4MK0A 1X05A 4HB3B 2K2UA 1UEFA 5C79A 3ULCA 2JP2A 1OQNA 2CY4A 2RNRB 3RCPA 3PVWA 3ODWA 1PFJA 5J3QA 3NSUA 3A98B 2KCJA 2LG1A 1MKEA 1V5PA 4KHOA 1U5DA 2PZ1A 1FAOA 2YT0A 3F5RA 5FI0A 5JLJB 5D3VA 3MPXA 2VKIA 2MFQA 4HDQA 2YSZA 4HB2B 2OQBA 3KSYA 2Y8GA 4P7IA 1DDVA 4PNKA 4XWXA 3FSSA 2P0DA 2D9VA 2J0MA 3AU4A 1I2HA 1MIXA 4YL8A 2P0FA 5KQ1A 2YT1A 5D3WA 2LYDA 3PZDA 4IAPA 1UPRA 3ZVRA 1EF1A 3P6AA 4DXAB 3DXCA 2D9XA 2M38A 4BBKA 5C16A 4ZRIA 2DYNA 3KZ1A 2DYQA 1WJ1A 4HB0B 3PVLA 3PEGA 1UPQA 1MK9B 3WYFB 2OTXA 2AL6A 1GC6A 5HE0A 3AU5A 1J0WA 1J19A 2QKLA 1LW3A 5CLQB 1XKEA 4IOYX 4F7GA 1WVHA 2CODA 1P6SA 1FOEA 2YS5A 4CYEA 2RVBB 1WI1A 4F7HA 5HE3A 4DBBA 1XODA 3VOQA 3TVVA 2W2XD 1GC7A 1U5EA 4Z2NA 2I1JA 4DX8A 2DTCA 1BWNA 2LOZA 4HAWB 2E2XA 1QC6A 3GYOA 5FI1A 2DX5A 3ODOA 2Z0QA 2J0JA 3ULBA 2LOXA 1ZSQA 4HHVA 2MWNB 2Y7BA 3HK0A 4KAXB 4A6KA 2MDXA 1MPHA 4K2OA 1ZC4B 5J3YA 1DBHA 4CHMA 2Q13A 1LB1A 1W1GA 5HE2A 1EVHA 4PQ0A 1H10A 1U5GA 3QIJA 3PVUA 5C5BB 4TYZA 1U5FA 2KGXB 2R09A 3ODXA 3A8PA 2UZRA 2BCJA 5DH9B 1U2BA 1Q67A 4GN1A 3SUZA 2M14A 2D2QA 2DFKA 1UNQA 2EJ8A 3IVFA 1MAIA 1GG3A 3VIAA 1ZC3B 3ML4A 4MY6A 1NTVA 3BJIA 2D10A 1X1GA 4MT7A 2G35A 1ZVRA 1Y19B 4DX90 1E5WA 1WG7A 1QQGA 4Z2MB 1UNPA 1MK7B 1XR0B 1I7AA 2QKMA 1EGXA 4K2PA 3FM8C 3SNHA 2R0DA 2DHKA 2Z0OA 3KY9A 2NZ8B 1IRSA 5D3YA 1X11A 5C6RA 4HAZB 1ZM0A 2J0KA 2COCA 2FJLA 2L1CA 5LOPB 2LKOA 2D9YA 2MKRA 3F0WA 4A6FA 2GCLA 3TCAA 3FEHA 2DLWA 2P0HA 4Y94A 3D8DA 3BINA 2KUPA 1FHOA 3SO6A 2D4QA 4L6EA 4D0NB 1FGZA 2COAA 3G9WA 3P7ZA 2DHJA 1SGHA 2D9ZA 2XQNM 4HDOA 4WJ7A 4HAUB 1DROA 5D3XA 3LJUX 1X1FA 2VSZA 2V76A 5C5BA 2N23A 2UZSA 2ROZB 2ZPYA 2Z0PA 3QWMA 2VRWB 5J3TA 4GZUA 3TW1A 4C0AA 3T06A 2RUKB 5DI9B 3CXBB 1K5GB 3V5WA 1BAKA 3N7CA 3D8EA 1XX0A 1V61A 2CY5A 4GMVA 2Y8FA 2EC1A 1RRPB 1FHWA 4ZRKA 5JHHA 4CHJA 4GXBA 2D11A 2LULA 4HB4B 2IFSA 4TKNA 2COFA 2DKPA 2H7EA 3KRWA 3O96A 2UVMA 2I5FA 3PG7A 2I1KA 5DIFB 1DDWA 1KZGA 3SYXA 3ZDTA 4K81A 2K00A 5JP4A 1EAZA 1FHXA 4EJNA 2YS3A 2RGNB 5D27A 4A5KA 2DN6A 4HATB 5LONB 1FB8A 2DHIA 5EFXA 1XCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVC A;  2ELB A;  1P3R A;  2I5C A;  1N3H A;  1H4R A;  1NTY A;  3DXE A;  1RJ2 A;  2GJY A;  1AQC A;  1SHC A;  1K5D B;  2NMB A;  3U8Z A;  2ADZ A;  3PP2 A;  2RSG A;  5KQ4 A;  2DKQ A;  3DXD A;  2HE7 A;  4F7U P;  4H8S A;  3HQC A;  2DX1 A;  4HAV B;  5GOW B;  2J59 M;  1Y5O A;  2GCJ A;  4GMX B;  2DA0 A;  4B6H A;  4A6H A;  4WVF B;  1TQZ A;  3TFM A;  1NU2 A;  2W2X C;  2IYB A;  4ZRJ A;  1WGQ A;  3HW2 B;  1V5M A;  5CLL B;  4KVG B;  3MDB C;  1NI2 A;  2D9W A;  1V89 A;  3SV1 A;  2P8V A;  5KCV A;  5DHF B;  4NSW A;  1XD4 A;  4GPT B;  3WA0 A;  1U29 A;  5HE1 A;  1W1D A;  5JHG A;  2YF0 A;  3U7D A;  1WGU A;  1OMW A;  2HTH B;  2X18 A;  3TO1 A;  3UZT A;  3OAN A;  1Z87 A;  2H7D A;  1DYN A;  1ISN A;  1BTK A;  1TXD A;  4EKU A;  4YON A;  2EMT A;  3D8F A;  5DHA B;  1UNR A;  1FGY A;  1WJM A;  2N0Y A;  2RLO A;  1DDM A;  3AJ4 A;  1KI1 B;  1X86 A;  4WSF A;  4K17 A;  1PMS A;  1M7E A;  2CRF A;  4IFS A;  1AWE A;  1B55 A;  2YRY A;  3GYP A;  4NY0 A;  4KHA A;  1TJ6 A;  4A6F B;  2K2J A;  3X23 A;  5L81 A;  3M1I B;  2W2W A;  4HAY B;  1MIZ B;  1P5T A;  1W1H A;  1U27 A;  3CIK A;  1V88 A;  3PSC A;  1OY2 A;  4EMO A;  2EMS A;  2CAY A;  2ROV A;  4HAX B;  3QBV B;  1BTN A;  1V5U A;  2YS1 A;  2GS0 A;  1PLS A;  1KZ7 A;  2AEH A;  2ELA A;  4KHB B;  3KRX A;  2L2I A;  3A8Q A;  1M7R A;  4MK0 A;  1X05 A;  4HB3 B;  2K2U A;  1UEF A;  5C79 A;  3ULC A;  2JP2 A;  1OQN A;  2CY4 A;  2RNR B;  3RCP A;  3PVW A;  3ODW A;  1PFJ A;  5J3Q A;  3NSU A;  3A98 B;  2KCJ A;  2LG1 A;  1MKE A;  1V5P A;  4KHO A;  1U5D A;  2PZ1 A;  1FAO A;  2YT0 A;  3F5R A;  5FI0 A;  5JLJ B;  5D3V A;  3MPX A;  2VKI A;  2MFQ A;  4HDQ A;  2YSZ A;  4HB2 B;  2OQB A;  3KSY A;  2Y8G A;  4P7I A;  1DDV A;  4PNK A;  4XWX A;  3FSS A;  2P0D A;  2D9V A;  2J0M A;  3AU4 A;  1I2H A;  1MIX A;  4YL8 A;  2P0F A;  5KQ1 A;  2YT1 A;  5D3W A;  2LYD A;  3PZD A;  4IAP A;  1UPR A;  3ZVR A;  1EF1 A;  3P6A A;  4DXA B;  3DXC A;  2D9X A;  2M38 A;  4BBK A;  5C16 A;  4ZRI A;  2DYN A;  3KZ1 A;  2DYQ A;  1WJ1 A;  4HB0 B;  3PVL A;  3PEG A;  1UPQ A;  1MK9 B;  3WYF B;  2OTX A;  2AL6 A;  1GC6 A;  5HE0 A;  3AU5 A;  1J0W A;  1J19 A;  2QKL A;  1LW3 A;  5CLQ B;  1XKE A;  4IOY X;  4F7G A;  1WVH A;  2COD A;  1P6S A;  1FOE A;  2YS5 A;  4CYE A;  2RVB B;  1WI1 A;  4F7H A;  5HE3 A;  4DBB A;  1XOD A;  3VOQ A;  3TVV A;  2W2X D;  1GC7 A;  1U5E A;  4Z2N A;  2I1J A;  4DX8 A;  2DTC A;  1BWN A;  2LOZ A;  4HAW B;  2E2X A;  1QC6 A;  3GYO A;  5FI1 A;  2DX5 A;  3ODO A;  2Z0Q A;  2J0J A;  3ULB A;  2LOX A;  1ZSQ A;  4HHV A;  2MWN B;  2Y7B A;  3HK0 A;  4KAX B;  4A6K A;  2MDX A;  1MPH A;  4K2O A;  1ZC4 B;  5J3Y A;  1DBH A;  4CHM A;  2Q13 A;  1LB1 A;  1W1G A;  5HE2 A;  1EVH A;  4PQ0 A;  1H10 A;  1U5G A;  3QIJ A;  3PVU A;  5C5B B;  4TYZ A;  1U5F A;  2KGX B;  2R09 A;  3ODX A;  3A8P A;  2UZR A;  2BCJ A;  5DH9 B;  1U2B A;  1Q67 A;  4GN1 A;  3SUZ A;  2M14 A;  2D2Q A;  2DFK A;  1UNQ A;  2EJ8 A;  3IVF A;  1MAI A;  1GG3 A;  3VIA A;  1ZC3 B;  3ML4 A;  4MY6 A;  1NTV A;  3BJI A;  2D10 A;  1X1G A;  4MT7 A;  2G35 A;  1ZVR A;  1Y19 B;  4DX9 0;  1E5W A;  1WG7 A;  1QQG A;  4Z2M B;  1UNP A;  1MK7 B;  1XR0 B;  1I7A A;  2QKM A;  1EGX A;  4K2P A;  3FM8 C;  3SNH A;  2R0D A;  2DHK A;  2Z0O A;  3KY9 A;  2NZ8 B;  1IRS A;  5D3Y A;  1X11 A;  5C6R A;  4HAZ B;  1ZM0 A;  2J0K A;  2COC A;  2FJL A;  2L1C A;  5LOP B;  2LKO A;  2D9Y A;  2MKR A;  3F0W A;  4A6F A;  2GCL A;  3TCA A;  3FEH A;  2DLW A;  2P0H A;  4Y94 A;  3D8D A;  3BIN A;  2KUP A;  1FHO A;  3SO6 A;  2D4Q A;  4L6E A;  4D0N B;  1FGZ A;  2COA A;  3G9W A;  3P7Z A;  2DHJ A;  1SGH A;  2D9Z A;  2XQN M;  4HDO A;  4WJ7 A;  4HAU B;  1DRO A;  5D3X A;  3LJU X;  1X1F A;  2VSZ A;  2V76 A;  5C5B A;  2N23 A;  2UZS A;  2ROZ B;  2ZPY A;  2Z0P A;  3QWM A;  2VRW B;  5J3T A;  4GZU A;  3TW1 A;  4C0A A;  3T06 A;  2RUK B;  5DI9 B;  3CXB B;  1K5G B;  3V5W A;  1BAK A;  3N7C A;  3D8E A;  1XX0 A;  1V61 A;  2CY5 A;  4GMV A;  2Y8F A;  2EC1 A;  1RRP B;  1FHW A;  4ZRK A;  5JHH A;  4CHJ A;  4GXB A;  2D11 A;  2LUL A;  4HB4 B;  2IFS A;  4TKN A;  2COF A;  2DKP A;  2H7E A;  3KRW A;  3O96 A;  2UVM A;  2I5F A;  3PG7 A;  2I1K A;  5DIF B;  1DDW A;  1KZG A;  3SYX A;  3ZDT A;  4K81 A;  2K00 A;  5JP4 A;  1EAZ A;  1FHX A;  4EJN A;  2YS3 A;  2RGN B;  5D27 A;  4A5K A;  2DN6 A;  4HAT B;  5LON B;  1FB8 A;  2DHI A;  5EFX A;  1XCG A; 
#chains in the Genus database with same CATH topology
 2YVC A;  2ELB A;  1P3R A;  2I5C A;  1N3H A;  1H4R A;  1NTY A;  3DXE A;  1RJ2 A;  2GJY A;  1AQC A;  1SHC A;  1K5D B;  2NMB A;  3U8Z A;  2ADZ A;  3PP2 A;  2RSG A;  5KQ4 A;  2DKQ A;  3DXD A;  2KIE A;  2HE7 A;  4F7U P;  4H8S A;  3HQC A;  2DX1 A;  4HAV B;  5GOW B;  2J59 M;  1Y5O A;  2GCJ A;  4GMX B;  2DA0 A;  4B6H A;  4A6H A;  4WVF B;  1TQZ A;  3TFM A;  1NU2 A;  2W2X C;  2IYB A;  4ZRJ A;  1WGQ A;  3HW2 B;  1V5M A;  5CLL B;  4KVG B;  3MDB C;  1NI2 A;  2D9W A;  1V89 A;  3SV1 A;  2P8V A;  5KCV A;  5DHF B;  4NSW A;  1XD4 A;  4GPT B;  4DIX A;  3WA0 A;  1U29 A;  5HE1 A;  1W1D A;  5JHG A;  2YF0 A;  2NBV A;  1WGU A;  3U7D A;  1OMW A;  2HTH B;  2KUQ A;  2X18 A;  3TO1 A;  3UZT A;  3OAN A;  1Z87 A;  2H7D A;  1DYN A;  1ISN A;  1BTK A;  1TXD A;  4EKU A;  4YON A;  2EMT A;  4QJ4 B;  3D8F A;  5DHA B;  1UNR A;  1FGY A;  1WJM A;  2N0Y A;  2RLO A;  1DDM A;  3AJ4 A;  1KI1 B;  1X86 A;  4WSF A;  4K17 A;  1PMS A;  3OHM B;  3B77 A;  1M7E A;  2CRF A;  4IFS A;  1AWE A;  1B55 A;  2YRY A;  3DCX A;  3GYP A;  4GNK B;  4NY0 A;  4KHA A;  1TJ6 A;  4A6F B;  2K2J A;  3X23 A;  5L81 A;  3M1I B;  2Z59 A;  2W2W A;  4HAY B;  1MIZ B;  1P5T A;  4OT1 A;  1W1H A;  1T77 A;  1U27 A;  3CIK A;  1V88 A;  3PSC A;  1OY2 A;  4EMO A;  2EMS A;  2CAY A;  2KIG A;  2ROV A;  4HAX B;  3QBV B;  1BTN A;  1V5U A;  2Z13 A;  2YS1 A;  2R2Y A;  5LG4 B;  2GS0 A;  1PLS A;  1KZ7 A;  2AEH A;  2ZKM X;  2ELA A;  4KHB B;  3KRX A;  2L2I A;  3A8Q A;  1M7R A;  3HSA A;  4MK0 A;  1X05 A;  4HB3 B;  2K2U A;  1UEF A;  4OSN A;  5C79 A;  3ULC A;  2JP2 A;  1OQN A;  2CY4 A;  2RNR B;  3NWA A;  3RCP A;  4QJ3 B;  3PVW A;  3ODW A;  1PFJ A;  5J3Q A;  3NSU A;  3A98 B;  2KCJ A;  2LG1 A;  1MKE A;  1V5P A;  4KHO A;  1U5D A;  2PZ1 A;  1FAO A;  2YT0 A;  3F5R A;  5FI0 A;  5JLJ B;  5D3V A;  3MPX A;  2VKI A;  2MFQ A;  4HSI A;  4HDQ A;  2YSZ A;  4HB2 B;  2OQB A;  3KSY A;  2Y8G A;  4P7I A;  1DDV A;  4PNK A;  2GUM A;  4XWX A;  3FSS A;  2P0D A;  2D9V A;  2J0M A;  3AU4 A;  1I2H A;  1MIX A;  4YL8 A;  2P0F A;  5KQ1 A;  2YT1 A;  5D3W A;  2LYD A;  3PZD A;  4IAP A;  1UPR A;  5IRS A;  3ZVR A;  1EF1 A;  3P6A A;  1MI1 A;  4DXA B;  3DXC A;  2D9X A;  2M38 A;  4BBK A;  5C16 A;  2YT2 A;  4ZRI A;  2DYN A;  3KZ1 A;  2DYQ A;  1WJ1 A;  4HB0 B;  3PVL A;  3PEG A;  1UPQ A;  1MK9 B;  3WYF B;  3FVC A;  2OTX A;  2AL6 A;  1GC6 A;  5HE0 A;  2KR0 A;  3AU5 A;  1J0W A;  1J19 A;  2QKL A;  1LW3 A;  5CLQ B;  1XKE A;  4IOY X;  4F7G A;  1WVH A;  2COD A;  1P6S A;  1FOE A;  2YS5 A;  4CYE A;  3U12 A;  2RVB B;  1WI1 A;  4F7H A;  5HE3 A;  4DBB A;  1XOD A;  3VOQ A;  1ZYI A;  3TVV A;  2W2X D;  3NWF A;  1GC7 A;  1U5E A;  4Z2N A;  2I1J A;  4D6W A;  4DX8 A;  2DTC A;  1BWN A;  2LOZ A;  4HAW B;  2E2X A;  1QC6 A;  3GYO A;  5FI1 A;  2DX5 A;  3ODO A;  2Z0Q A;  2J0J A;  3ULB A;  2LOX A;  1ZSQ A;  4HHV A;  2MWN B;  2K8E A;  2Y7B A;  3HK0 A;  4KAX B;  4A6K A;  2MDX A;  1MPH A;  4L1R A;  4K2O A;  1ZC4 B;  5J3Y A;  1DBH A;  4CHM A;  2Q13 A;  1LB1 A;  1W1G A;  5HE2 A;  1EVH A;  4PQ0 A;  1H10 A;  2K49 A;  1U5G A;  3QIJ A;  2Z14 A;  3PVU A;  5C5B B;  4TYZ A;  1U5F A;  2R09 A;  2KGX B;  3ODX A;  3A8P A;  2UZR A;  2BCJ A;  5DH9 B;  1U2B A;  1Q67 A;  4GN1 A;  3SUZ A;  2M14 A;  2D2Q A;  2DFK A;  1UNQ A;  2EJ8 A;  3IVF A;  1MAI A;  1GG3 A;  3VIA A;  1ZC3 B;  3A58 A;  3ML4 A;  4MY6 A;  1NTV A;  3BJI A;  2D10 A;  1X1G A;  4MT7 A;  2G35 A;  5M4Y B;  1ZVR A;  1Y19 B;  4DX9 0;  1E5W A;  1WG7 A;  1QQG A;  4Z2M B;  1UNP A;  1MK7 B;  1XR0 B;  1I7A A;  2QKM A;  1EGX A;  4K2P A;  3FM8 C;  3SNH A;  2R0D A;  2DHK A;  2Z0O A;  3KY9 A;  2NZ8 B;  1IRS A;  5D3Y A;  1X11 A;  4QXA B;  5C6R A;  4HAZ B;  1ZM0 A;  2J0K A;  2COC A;  4CSQ A;  5I2S A;  2FJL A;  2L1C A;  5LOP B;  2LKO A;  2D9Y A;  2MKR A;  3F0W A;  4A6F A;  2GCL A;  3TCA A;  3FEH A;  2DLW A;  2P0H A;  4Y94 A;  3D8D A;  3BIN A;  2KUP A;  1FHO A;  3SO6 A;  2D4Q A;  4L6E A;  4D0N B;  1FGZ A;  2COA A;  3G9W A;  3P7Z A;  2DHJ A;  1SGH A;  2D9Z A;  2XQN M;  4HDO A;  4WJ7 A;  4HAU B;  4GOU A;  1DRO A;  5D3X A;  3LJU X;  1X1F A;  2VSZ A;  2V76 A;  5C5B A;  2N23 A;  2UZS A;  3NW8 A;  2ROZ B;  2ZPY A;  2Z0P A;  3QWM A;  2VRW B;  4QJ5 B;  5J3T A;  4GZU A;  3TW1 A;  4C0A A;  3T06 A;  2RUK B;  5DI9 B;  3CXB B;  1K5G B;  3V5W A;  5I2M A;  2Z4D A;  1BAK A;  3N7C A;  3D8E A;  1XX0 A;  3NWD A;  1V61 A;  2CY5 A;  4GMV A;  2Y8F A;  2EC1 A;  1RRP B;  1FHW A;  4ZRK A;  5JHH A;  4CHJ A;  4GXB A;  2D11 A;  2LUL A;  2RRF A;  4HB4 B;  2IFS A;  4TKN A;  2COF A;  2DKP A;  2H7E A;  3KRW A;  3O96 A;  2UVM A;  2I5F A;  3PG7 A;  2I1K A;  4KHB A;  1DDW A;  1KZG A;  5DIF B;  3SYX A;  3ZDT A;  4K81 A;  2K00 A;  5JP4 A;  1EAZ A;  1FHX A;  4EJN A;  2YS3 A;  3HIE A;  2RGN B;  5D27 A;  4A5K A;  2DN6 A;  4HAT B;  5LON B;  2FJU B;  1FB8 A;  2DHI A;  5EFX A;  1XCG A; 
#chains in the Genus database with same CATH homology
 2YVC A;  2ELB A;  1P3R A;  2I5C A;  1N3H A;  1H4R A;  1NTY A;  3DXE A;  1RJ2 A;  2GJY A;  1AQC A;  1SHC A;  1K5D B;  2NMB A;  3U8Z A;  2ADZ A;  3PP2 A;  2RSG A;  5KQ4 A;  2DKQ A;  3DXD A;  2HE7 A;  4F7U P;  4H8S A;  3HQC A;  2DX1 A;  4HAV B;  5GOW B;  2J59 M;  1Y5O A;  2GCJ A;  4GMX B;  2DA0 A;  4B6H A;  4A6H A;  4WVF B;  1TQZ A;  3TFM A;  1NU2 A;  2W2X C;  2IYB A;  4ZRJ A;  1WGQ A;  3HW2 B;  1V5M A;  5CLL B;  4KVG B;  3MDB C;  1NI2 A;  2D9W A;  1V89 A;  3SV1 A;  2P8V A;  5KCV A;  5DHF B;  4NSW A;  1XD4 A;  4GPT B;  3WA0 A;  1U29 A;  5HE1 A;  1W1D A;  5JHG A;  2YF0 A;  3U7D A;  1WGU A;  1OMW A;  2HTH B;  2X18 A;  3TO1 A;  3UZT A;  3OAN A;  1Z87 A;  2H7D A;  1DYN A;  1ISN A;  1BTK A;  1TXD A;  4EKU A;  4YON A;  2EMT A;  3D8F A;  5DHA B;  1UNR A;  1FGY A;  1WJM A;  2N0Y A;  2RLO A;  1DDM A;  3AJ4 A;  1KI1 B;  1X86 A;  4WSF A;  4K17 A;  1PMS A;  1M7E A;  2CRF A;  4IFS A;  1AWE A;  1B55 A;  2YRY A;  3GYP A;  4NY0 A;  4KHA A;  1TJ6 A;  4A6F B;  2K2J A;  3X23 A;  5L81 A;  3M1I B;  2W2W A;  4HAY B;  1MIZ B;  1P5T A;  1W1H A;  1U27 A;  3CIK A;  1V88 A;  3PSC A;  1OY2 A;  4EMO A;  2EMS A;  2CAY A;  2ROV A;  4HAX B;  3QBV B;  1BTN A;  1V5U A;  2YS1 A;  2GS0 A;  1PLS A;  1KZ7 A;  2AEH A;  2ELA A;  4KHB B;  3KRX A;  2L2I A;  3A8Q A;  1M7R A;  4MK0 A;  1X05 A;  4HB3 B;  2K2U A;  1UEF A;  5C79 A;  3ULC A;  2JP2 A;  1OQN A;  2CY4 A;  2RNR B;  3RCP A;  3PVW A;  3ODW A;  1PFJ A;  5J3Q A;  3NSU A;  3A98 B;  2KCJ A;  2LG1 A;  1MKE A;  1V5P A;  4KHO A;  1U5D A;  2PZ1 A;  1FAO A;  2YT0 A;  3F5R A;  5FI0 A;  5JLJ B;  5D3V A;  3MPX A;  2VKI A;  2MFQ A;  4HDQ A;  2YSZ A;  4HB2 B;  2OQB A;  3KSY A;  2Y8G A;  4P7I A;  1DDV A;  4PNK A;  4XWX A;  3FSS A;  2P0D A;  2D9V A;  2J0M A;  3AU4 A;  1I2H A;  1MIX A;  4YL8 A;  2P0F A;  5KQ1 A;  2YT1 A;  5D3W A;  2LYD A;  3PZD A;  4IAP A;  1UPR A;  3ZVR A;  1EF1 A;  3P6A A;  4DXA B;  3DXC A;  2D9X A;  2M38 A;  4BBK A;  5C16 A;  4ZRI A;  2DYN A;  3KZ1 A;  2DYQ A;  1WJ1 A;  4HB0 B;  3PVL A;  3PEG A;  1UPQ A;  1MK9 B;  3WYF B;  2OTX A;  2AL6 A;  1GC6 A;  5HE0 A;  3AU5 A;  1J0W A;  1J19 A;  2QKL A;  1LW3 A;  5CLQ B;  1XKE A;  4IOY X;  4F7G A;  1WVH A;  2COD A;  1P6S A;  1FOE A;  2YS5 A;  4CYE A;  2RVB B;  1WI1 A;  4F7H A;  5HE3 A;  4DBB A;  1XOD A;  3VOQ A;  3TVV A;  2W2X D;  1GC7 A;  1U5E A;  4Z2N A;  2I1J A;  4DX8 A;  2DTC A;  1BWN A;  2LOZ A;  4HAW B;  2E2X A;  1QC6 A;  3GYO A;  5FI1 A;  2DX5 A;  3ODO A;  2Z0Q A;  2J0J A;  3ULB A;  2LOX A;  1ZSQ A;  4HHV A;  2MWN B;  2Y7B A;  3HK0 A;  4KAX B;  4A6K A;  2MDX A;  1MPH A;  4K2O A;  1ZC4 B;  5J3Y A;  1DBH A;  4CHM A;  2Q13 A;  1LB1 A;  1W1G A;  5HE2 A;  1EVH A;  4PQ0 A;  1H10 A;  1U5G A;  3QIJ A;  3PVU A;  5C5B B;  4TYZ A;  1U5F A;  2KGX B;  2R09 A;  3ODX A;  3A8P A;  2UZR A;  2BCJ A;  5DH9 B;  1U2B A;  1Q67 A;  4GN1 A;  3SUZ A;  2M14 A;  2D2Q A;  2DFK A;  1UNQ A;  2EJ8 A;  3IVF A;  1MAI A;  1GG3 A;  3VIA A;  1ZC3 B;  3ML4 A;  4MY6 A;  1NTV A;  3BJI A;  2D10 A;  1X1G A;  4MT7 A;  2G35 A;  1ZVR A;  1Y19 B;  4DX9 0;  1E5W A;  1WG7 A;  1QQG A;  4Z2M B;  1UNP A;  1MK7 B;  1XR0 B;  1I7A A;  2QKM A;  1EGX A;  4K2P A;  3FM8 C;  3SNH A;  2R0D A;  2DHK A;  2Z0O A;  3KY9 A;  2NZ8 B;  1IRS A;  5D3Y A;  1X11 A;  5C6R A;  4HAZ B;  1ZM0 A;  2J0K A;  2COC A;  2FJL A;  2L1C A;  5LOP B;  2LKO A;  2D9Y A;  2MKR A;  3F0W A;  4A6F A;  2GCL A;  3TCA A;  3FEH A;  2DLW A;  2P0H A;  4Y94 A;  3D8D A;  3BIN A;  2KUP A;  1FHO A;  3SO6 A;  2D4Q A;  4L6E A;  4D0N B;  1FGZ A;  2COA A;  3G9W A;  3P7Z A;  2DHJ A;  1SGH A;  2D9Z A;  2XQN M;  4HDO A;  4WJ7 A;  4HAU B;  1DRO A;  5D3X A;  3LJU X;  1X1F A;  2VSZ A;  2V76 A;  5C5B A;  2N23 A;  2UZS A;  2ROZ B;  2ZPY A;  2Z0P A;  3QWM A;  2VRW B;  5J3T A;  4GZU A;  3TW1 A;  4C0A A;  3T06 A;  2RUK B;  5DI9 B;  3CXB B;  1K5G B;  3V5W A;  1BAK A;  3N7C A;  3D8E A;  1XX0 A;  1V61 A;  2CY5 A;  4GMV A;  2Y8F A;  2EC1 A;  1RRP B;  1FHW A;  4ZRK A;  5JHH A;  4CHJ A;  4GXB A;  2D11 A;  2LUL A;  4HB4 B;  2IFS A;  4TKN A;  2COF A;  2DKP A;  2H7E A;  3KRW A;  3O96 A;  2UVM A;  2I5F A;  3PG7 A;  2I1K A;  5DIF B;  1DDW A;  1KZG A;  3SYX A;  3ZDT A;  4K81 A;  2K00 A;  5JP4 A;  1EAZ A;  1FHX A;  4EJN A;  2YS3 A;  2RGN B;  5D27 A;  4A5K A;  2DN6 A;  4HAT B;  5LON B;  1FB8 A;  2DHI A;  5EFX A;  1XCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...