2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,gene regulation
molecule keywords Histone-arginine methyltransferase CARM1
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
1W1DA 2H7DA 3KRWA 4P7IA 1XR0B 4ZRKA 3PVUA 1WJMA 5C79A 2LULA 4Z2MB 2EMTA 1TXDA 4K2PA 1V5PA 1IRSA 4KHBB 2K2JA 1NI2A 2CRFA 2KGXB 4WVFB 2D11A 2DFKA 4EJNA 2LOZA 1NU2A 3T06A 2YS3A 2UZSA 2MFQA 2OQBA 2Y8GA 2DKPA 1WGQA 1PFJA 3BINA 4XWXA 4MY6A 3MDBC 3PVWA 4A6FB 4MK0A 1Y19B 3WYFB 5C5BB 3WA0A 4Y94A 3AU5A 5EFXA 3ODOA 2J0JA 3X23A 2AEHA 5C16A 4F7GA 4GMVA 2HTHB 1WVHA 1DYNA 1X1GA 2IYBA 3HQCA 1GC7A 3CIKA 1U5DA 2ROZB 1I2HA 4K81A 2CY5A 5LONB 3CXBB 1FAOA 1XCGA 1U2BA 2RLOA 4HDOA 1OY2A 2D4QA 3OANA 4YONA 1I7AA 1X05A 2YRYA 4L6EA 5FI1A 3ML4A 2I5CA 1DROA 1FB8A 2LOXA 2I1KA 4EKUA 2J59M 3ULBA 1UNQA 2QKMA 1Q67A 4D0NB 2DHIA 2W2WA 3PZDA 2IFSA 2DHJA 3TVVA 1EAZA 3SNHA 1MIZB 4HDQA 4IOYX 4DBBA 1PMSA 4ZRIA 2M14A 3PG7A 5J3QA 1UPRA 4ZRJA 1RJ2A 4GPTB 4HAVB 3P6AA 1V5MA 1Y5OA 3HW2B 4A5KA 1TJ6A 5CLLB 2W2XC 1DDMA 3D8EA 1MPHA 5KQ1A 2DX1A 4Z2NA 1ISNA 2ROVA 4K2OA 4HAXB 5J3TA 2J0MA 2DHKA 1KI1B 4GXBA 5DHAB 1AQCA 2KUPA 1E5WA 5DHFB 4HHVA 2CY4A 1V88A 3FEHA 4A6HA 5KCVA 3UZTA 2YF0A 2LG1A 1FHXA 2RSGA 3KY9A 1X1FA 1FGYA 1GG3A 2LKOA 2AL6A 3GYOA 2YT0A 2BCJA 2D9WA 4HB3B 2OTXA 2GJYA 3TO1A 1V61A 2DX5A 1MAIA 3NSUA 2CAYA 3N7CA 1DDVA 2YS1A 1ZVRA 2LYDA 1SHCA 4GMXB 1WG7A 5D3VA 4HB0B 2DKQA 1MKEA 2VSZA 1QC6A 2I5FA 1PLSA 4YL8A 2M38A 1UEFA 2UZRA 1ZSQA 1MK9B 3KRXA 1XODA 1WJ1A 2YVCA 2DN6A 2Z0OA 1J19A 3U8ZA 4CHJA 2W2XD 2V76A 3HK0A 2J0KA 4F7HA 5LOPB 1UPQA 2GCLA 3IVFA 3ZVRA 3PEGA 3QIJA 3VOQA 2MDXA 5JLJB 2YT1A 5D27A 5HE0A 1KZGA 2X18A 5JP4A 4K17A 1N3HA 3SYXA 4A6FA 2K00A 5C5BA 1X11A 2FJLA 5CLQB 4F7UP 1SGHA 3ODWA 4HB2B 1B55A 2ELAA 3TW1A 4PNKA 2Q13A 2HE7A 1MIXA 1K5DB 1U5FA 3F5RA 5D3XA 4TKNA 2DYNA 2H7EA 5D3YA 3A8QA 1EF1A 2RVBB 4CYEA 4EMOA 4GZUA 1XKEA 3AU4A 2RGNB 1BTKA 3P7ZA 2L1CA 1MK7B 2EMSA 2DLWA 4HAUB 5HE2A 1OQNA 4HAWB 1J0WA 1NTYA 4IFSA 4HAZB 3D8DA 4HATB 2L2IA 2Y8FA 1UNPA 3M1IB 4BBKA 3PVLA 5HE1A 1NTVA 2PZ1A 3QWMA 1V5UA 4KAXB 4WSFA 5JHHA 2ADZA 1ZC4B 2GS0A 1FGZA 3BJIA 5DI9B 2XQNM 1U5GA 1W1HA 2COAA 4DX90 2D2QA 2VKIA 3F0WA 1V89A 2EJ8A 2N23A 4DX8A 2E2XA 4GN1A 1BAKA 1X86A 2DYQA 5JHGA 1W1GA 5C6RA 3U7DA 1M7EA 1FHOA 2JP2A 3DXCA 1H4RA 2GCJA 3A98B 1AWEA 2P0HA 3KZ1A 4HB4B 4IAPA 5DH9B 1LB1A 1EVHA 1XX0A 3PSCA 2COCA 2RUKB 1DBHA 3RCPA 2DTCA 2N0YA 1BWNA 2DA0A 2P8VA 2Y7BA 2ZPYA 5HE3A 1QQGA 1U5EA 2D9ZA 4WJ7A 1Z87A 5D3WA 2K2UA 2D9VA 4B6HA 4NY0A 3V5WA 2G35A 5KQ4A 3GYPA 4MT7A 3FM8C 4C0AA 2MWNB 3ZDTA 4KVGB 1ZC3B 1WGUA 2QKLA 1XD4A 4CHMA 1P5TA 5GOWB 2Z0QA 3TCAA 2D10A 2EC1A 1K5GB 3DXEA 1P6SA 4TYZA 2NZ8B 2NMBA 4HAYB 4DXAB 3SUZA 1H10A 1DDWA 1P3RA 3G9WA 3LJUX 3TFMA 3D8FA 2I1JA 2R0DA 5L81A 1ZM0A 3KSYA 2VRWB 5DIFB 3A8PA 1UNRA 1BTNA 2YSZA 1EGXA 1M7RA 5FI0A 3FSSA 2R09A 4KHAA 2ELBA 1FOEA 1TQZA 3SO6A 4H8SA 2RNRB 3QBVB 5J3YA 3MPXA 2P0FA 4PQ0A 3SV1A 3VIAA 1WI1A 2Z0PA 2MKRA 1KZ7A 2UVMA 3ODXA 1FHWA 1RRPB 3O96A 4A6KA 2COFA 3AJ4A 1U27A 3PP2A 2P0DA 1U29A 1OMWA 2CODA 2KCJA 2YS5A 3DXDA 1GC6A 1LW3A 4NSWA 2D9YA 4KHOA 2D9XA 3ULCA
chains in the Genus database with same CATH superfamily
1W1DA 2H7DA 3KRWA 4P7IA 1XR0B 3HIEA 4ZRKA 3PVUA 1WJMA 5C79A 2LULA 4Z2MB 2EMTA 1TXDA 4K2PA 1V5PA 1IRSA 4KHBB 2K2JA 1ZYIA 1NI2A 2CRFA 2KGXB 4WVFB 5M4YB 2D11A 2DFKA 4EJNA 2LOZA 1NU2A 3T06A 2YS3A 2UZSA 2MFQA 2OQBA 2Y8GA 2DKPA 1WGQA 1PFJA 3BINA 4XWXA 4MY6A 3MDBC 3PVWA 4A6FB 2R2YA 4MK0A 1Y19B 3WYFB 5C5BB 3WA0A 4Y94A 3AU5A 5EFXA 4L1RA 3ODOA 2J0JA 3X23A 2AEHA 5C16A 4F7GA 4GMVA 2HTHB 1WVHA 1DYNA 1X1GA 2IYBA 4KHBA 3HQCA 1GC7A 3CIKA 1U5DA 2ROZB 1I2HA 4K81A 2CY5A 5LONB 2YT2A 3CXBB 1FAOA 1XCGA 1U2BA 2RLOA 4HDOA 1OY2A 2D4QA 3OANA 4YONA 1I7AA 1X05A 2YRYA 4L6EA 5FI1A 3ML4A 2I5CA 1DROA 1FB8A 2LOXA 2I1KA 4EKUA 4QXAB 2J59M 3ULBA 1UNQA 2QKMA 1Q67A 4D0NB 2DHIA 2W2WA 3PZDA 2IFSA 2DHJA 3TVVA 1EAZA 3SNHA 1MIZB 4HDQA 4IOYX 4DBBA 1PMSA 4ZRIA 2M14A 3PG7A 5J3QA 1UPRA 4ZRJA 1RJ2A 4GOUA 4GPTB 4HAVB 3P6AA 1V5MA 1Y5OA 3HW2B 4OT1A 4A5KA 1TJ6A 5CLLB 2W2XC 1DDMA 3D8EA 2K49A 3NW8A 4CSQA 1MPHA 5KQ1A 2DX1A 4Z2NA 3B77A 1ISNA 2ROVA 4K2OA 4HAXB 5J3TA 2J0MA 2DHKA 1KI1B 4GXBA 5DHAB 1AQCA 2KUPA 1E5WA 5DHFB 4HHVA 2CY4A 1V88A 2KIEA 3FEHA 4A6HA 5KCVA 3UZTA 2YF0A 2LG1A 1FHXA 2RSGA 3KY9A 1X1FA 1FGYA 1GG3A 2LKOA 2AL6A 3GYOA 2YT0A 3NWFA 2FJUB 2BCJA 2D9WA 4HB3B 2OTXA 2GJYA 3TO1A 1V61A 2DX5A 1MAIA 3NSUA 2CAYA 3N7CA 1DDVA 2YS1A 1ZVRA 2LYDA 1SHCA 4GMXB 2KUQA 1WG7A 5D3VA 4HB0B 2DKQA 2KIGA 1MKEA 3DCXA 2VSZA 1QC6A 2I5FA 1PLSA 4YL8A 2M38A 1UEFA 2Z14A 2UZRA 1ZSQA 1MK9B 3KRXA 1XODA 1WJ1A 2YVCA 2DN6A 2Z0OA 1J19A 3U8ZA 4CHJA 2W2XD 2V76A 3HK0A 2J0KA 4F7HA 5LOPB 1UPQA 2K8EA 2GCLA 5I2MA 3IVFA 3ZVRA 3PEGA 3QIJA 3VOQA 2MDXA 5JLJB 2YT1A 5D27A 5HE0A 1KZGA 2X18A 5JP4A 4K17A 1N3HA 3SYXA 4A6FA 2K00A 3U12A 5C5BA 1X11A 2FJLA 5CLQB 4F7UP 1SGHA 3ODWA 4HB2B 1B55A 2ELAA 3TW1A 4PNKA 2Q13A 2HE7A 1MIXA 1K5DB 1U5FA 3F5RA 5D3XA 4TKNA 2DYNA 2H7EA 5D3YA 3A8QA 1EF1A 2RVBB 4CYEA 4EMOA 4GZUA 1XKEA 3AU4A 2RGNB 5I2SA 1BTKA 3P7ZA 5IRSA 2L1CA 1MK7B 2EMSA 2DLWA 2Z4DA 4HAUB 5HE2A 1OQNA 4HAWB 1J0WA 1NTYA 3FVCA 4IFSA 4HAZB 3D8DA 3A58A 4HATB 2L2IA 2Y8FA 1UNPA 3M1IB 4BBKA 3PVLA 5HE1A 4QJ3B 1NTVA 2PZ1A 3QWMA 1V5UA 4KAXB 4WSFA 5JHHA 2ADZA 3NWDA 1ZC4B 2GS0A 1FGZA 3BJIA 5DI9B 2XQNM 1U5GA 1W1HA 2COAA 4DX90 2D2QA 2VKIA 3F0WA 1V89A 2EJ8A 2N23A 4DX8A 2E2XA 4GN1A 1BAKA 1X86A 2DYQA 5JHGA 1W1GA 5C6RA 3U7DA 1M7EA 2KR0A 1FHOA 2JP2A 4GNKB 3DXCA 1H4RA 2GCJA 3A98B 1AWEA 2P0HA 3KZ1A 4HB4B 3NWAA 3HSAA 4IAPA 5DH9B 1LB1A 1EVHA 1XX0A 3PSCA 2COCA 2Z59A 2RUKB 1DBHA 3RCPA 2DTCA 2N0YA 1BWNA 2DA0A 2GUMA 2P8VA 2Y7BA 2ZPYA 5HE3A 1QQGA 1U5EA 2D9ZA 4WJ7A 1Z87A 5D3WA 2K2UA 2D9VA 4B6HA 4NY0A 4HSIA 4D6WA 3V5WA 2G35A 5KQ4A 3GYPA 4MT7A 3FM8C 4C0AA 2MWNB 3ZDTA 4KVGB 1MI1A 1ZC3B 1WGUA 2QKLA 1XD4A 4CHMA 1P5TA 5GOWB 2Z0QA 3TCAA 2D10A 2ZKMX 2EC1A 1K5GB 3DXEA 1P6SA 4TYZA 3OHMB 2NZ8B 2NMBA 2Z13A 4HAYB 4DXAB 3SUZA 1H10A 1DDWA 1P3RA 3G9WA 3LJUX 3TFMA 3D8FA 2I1JA 2R0DA 5L81A 1ZM0A 4OSNA 3KSYA 2VRWB 5DIFB 3A8PA 4QJ5B 4QJ4B 1UNRA 4DIXA 1BTNA 2YSZA 1EGXA 1M7RA 5FI0A 3FSSA 2R09A 4KHAA 2ELBA 1FOEA 1TQZA 3SO6A 4H8SA 2RNRB 3QBVB 5J3YA 3MPXA 2P0FA 4PQ0A 3SV1A 3VIAA 1WI1A 2Z0PA 2MKRA 1KZ7A 2UVMA 3ODXA 1FHWA 1RRPB 3O96A 4A6KA 2COFA 3AJ4A 1U27A 3PP2A 2P0DA 1U29A 1OMWA 1T77A 2CODA 2KCJA 2YS5A 3DXDA 1GC6A 1LW3A 4NSWA 5LG4B 2RRFA 2D9YA 4KHOA 2D9XA 2NBVA 3ULCA
chains in the Genus database with same CATH topology
1W1DA 2H7DA 3KRWA 4P7IA 1XR0B 4ZRKA 3PVUA 1WJMA 5C79A 2LULA 4Z2MB 2EMTA 1TXDA 4K2PA 1V5PA 1IRSA 4KHBB 2K2JA 1NI2A 2CRFA 2KGXB 4WVFB 2D11A 2DFKA 4EJNA 2LOZA 1NU2A 3T06A 2YS3A 2UZSA 2MFQA 2OQBA 2Y8GA 2DKPA 1WGQA 1PFJA 3BINA 4XWXA 4MY6A 3MDBC 3PVWA 4A6FB 4MK0A 1Y19B 3WYFB 5C5BB 3WA0A 4Y94A 3AU5A 5EFXA 3ODOA 2J0JA 3X23A 2AEHA 5C16A 4F7GA 4GMVA 2HTHB 1WVHA 1DYNA 1X1GA 2IYBA 3HQCA 1GC7A 3CIKA 1U5DA 2ROZB 1I2HA 4K81A 2CY5A 5LONB 3CXBB 1FAOA 1XCGA 1U2BA 2RLOA 4HDOA 1OY2A 2D4QA 3OANA 4YONA 1I7AA 1X05A 2YRYA 4L6EA 5FI1A 3ML4A 2I5CA 1DROA 1FB8A 2LOXA 2I1KA 4EKUA 2J59M 3ULBA 1UNQA 2QKMA 1Q67A 4D0NB 2DHIA 2W2WA 3PZDA 2IFSA 2DHJA 3TVVA 1EAZA 3SNHA 1MIZB 4HDQA 4IOYX 4DBBA 1PMSA 4ZRIA 2M14A 3PG7A 5J3QA 1UPRA 4ZRJA 1RJ2A 4GPTB 4HAVB 3P6AA 1V5MA 1Y5OA 3HW2B 4A5KA 1TJ6A 5CLLB 2W2XC 1DDMA 3D8EA 1MPHA 5KQ1A 2DX1A 4Z2NA 1ISNA 2ROVA 4K2OA 4HAXB 5J3TA 2J0MA 2DHKA 1KI1B 4GXBA 5DHAB 1AQCA 2KUPA 1E5WA 5DHFB 4HHVA 2CY4A 1V88A 3FEHA 4A6HA 5KCVA 3UZTA 2YF0A 2LG1A 1FHXA 2RSGA 3KY9A 1X1FA 1FGYA 1GG3A 2LKOA 2AL6A 3GYOA 2YT0A 2BCJA 2D9WA 4HB3B 2OTXA 2GJYA 3TO1A 1V61A 2DX5A 1MAIA 3NSUA 2CAYA 3N7CA 1DDVA 2YS1A 1ZVRA 2LYDA 1SHCA 4GMXB 1WG7A 5D3VA 4HB0B 2DKQA 1MKEA 2VSZA 1QC6A 2I5FA 1PLSA 4YL8A 2M38A 1UEFA 2UZRA 1ZSQA 1MK9B 3KRXA 1XODA 1WJ1A 2YVCA 2DN6A 2Z0OA 1J19A 3U8ZA 4CHJA 2W2XD 2V76A 3HK0A 2J0KA 4F7HA 5LOPB 1UPQA 2GCLA 3IVFA 3ZVRA 3PEGA 3QIJA 3VOQA 2MDXA 5JLJB 2YT1A 5D27A 5HE0A 1KZGA 2X18A 5JP4A 4K17A 1N3HA 3SYXA 4A6FA 2K00A 5C5BA 1X11A 2FJLA 5CLQB 4F7UP 1SGHA 3ODWA 4HB2B 1B55A 2ELAA 3TW1A 4PNKA 2Q13A 2HE7A 1MIXA 1K5DB 1U5FA 3F5RA 5D3XA 4TKNA 2DYNA 2H7EA 5D3YA 3A8QA 1EF1A 2RVBB 4CYEA 4EMOA 4GZUA 1XKEA 3AU4A 2RGNB 1BTKA 3P7ZA 2L1CA 1MK7B 2EMSA 2DLWA 4HAUB 5HE2A 1OQNA 4HAWB 1J0WA 1NTYA 4IFSA 4HAZB 3D8DA 4HATB 2L2IA 2Y8FA 1UNPA 3M1IB 4BBKA 3PVLA 5HE1A 1NTVA 2PZ1A 3QWMA 1V5UA 4KAXB 4WSFA 5JHHA 2ADZA 1ZC4B 2GS0A 1FGZA 3BJIA 5DI9B 2XQNM 1U5GA 1W1HA 2COAA 4DX90 2D2QA 2VKIA 3F0WA 1V89A 2EJ8A 2N23A 4DX8A 2E2XA 4GN1A 1BAKA 1X86A 2DYQA 5JHGA 1W1GA 5C6RA 3U7DA 1M7EA 1FHOA 2JP2A 3DXCA 1H4RA 2GCJA 3A98B 1AWEA 2P0HA 3KZ1A 4HB4B 4IAPA 5DH9B 1LB1A 1EVHA 1XX0A 3PSCA 2COCA 2RUKB 1DBHA 3RCPA 2DTCA 2N0YA 1BWNA 2DA0A 2P8VA 2Y7BA 2ZPYA 5HE3A 1QQGA 1U5EA 2D9ZA 4WJ7A 1Z87A 5D3WA 2K2UA 2D9VA 4B6HA 4NY0A 3V5WA 2G35A 5KQ4A 3GYPA 4MT7A 3FM8C 4C0AA 2MWNB 3ZDTA 4KVGB 1ZC3B 1WGUA 2QKLA 1XD4A 4CHMA 1P5TA 5GOWB 2Z0QA 3TCAA 2D10A 2EC1A 1K5GB 3DXEA 1P6SA 4TYZA 2NZ8B 2NMBA 4HAYB 4DXAB 3SUZA 1H10A 1DDWA 1P3RA 3G9WA 3LJUX 3TFMA 3D8FA 2I1JA 2R0DA 5L81A 1ZM0A 3KSYA 2VRWB 5DIFB 3A8PA 1UNRA 1BTNA 2YSZA 1EGXA 1M7RA 5FI0A 3FSSA 2R09A 4KHAA 2ELBA 1FOEA 1TQZA 3SO6A 4H8SA 2RNRB 3QBVB 5J3YA 3MPXA 2P0FA 4PQ0A 3SV1A 3VIAA 1WI1A 2Z0PA 2MKRA 1KZ7A 2UVMA 3ODXA 1FHWA 1RRPB 3O96A 4A6KA 2COFA 3AJ4A 1U27A 3PP2A 2P0DA 1U29A 1OMWA 2CODA 2KCJA 2YS5A 3DXDA 1GC6A 1LW3A 4NSWA 2D9YA 4KHOA 2D9XA 3ULCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1D A;  2H7D A;  3KRW A;  4P7I A;  1XR0 B;  4ZRK A;  3PVU A;  1WJM A;  5C79 A;  2LUL A;  4Z2M B;  2EMT A;  1TXD A;  4K2P A;  1V5P A;  1IRS A;  4KHB B;  2K2J A;  1NI2 A;  2CRF A;  2KGX B;  4WVF B;  2D11 A;  2DFK A;  4EJN A;  2LOZ A;  1NU2 A;  3T06 A;  2YS3 A;  2UZS A;  2MFQ A;  2OQB A;  2Y8G A;  2DKP A;  1WGQ A;  1PFJ A;  3BIN A;  4XWX A;  4MY6 A;  3MDB C;  3PVW A;  4A6F B;  4MK0 A;  1Y19 B;  3WYF B;  5C5B B;  3WA0 A;  4Y94 A;  3AU5 A;  5EFX A;  3ODO A;  2J0J A;  3X23 A;  2AEH A;  5C16 A;  4F7G A;  4GMV A;  2HTH B;  1WVH A;  1DYN A;  1X1G A;  2IYB A;  3HQC A;  1GC7 A;  3CIK A;  1U5D A;  2ROZ B;  1I2H A;  4K81 A;  2CY5 A;  5LON B;  3CXB B;  1FAO A;  1XCG A;  1U2B A;  2RLO A;  4HDO A;  1OY2 A;  2D4Q A;  3OAN A;  4YON A;  1I7A A;  1X05 A;  2YRY A;  4L6E A;  5FI1 A;  3ML4 A;  2I5C A;  1DRO A;  1FB8 A;  2LOX A;  2I1K A;  4EKU A;  2J59 M;  3ULB A;  1UNQ A;  2QKM A;  1Q67 A;  4D0N B;  2DHI A;  2W2W A;  3PZD A;  2IFS A;  2DHJ A;  3TVV A;  1EAZ A;  3SNH A;  1MIZ B;  4HDQ A;  4IOY X;  4DBB A;  1PMS A;  4ZRI A;  2M14 A;  3PG7 A;  5J3Q A;  1UPR A;  4ZRJ A;  1RJ2 A;  4GPT B;  4HAV B;  3P6A A;  1V5M A;  1Y5O A;  3HW2 B;  4A5K A;  1TJ6 A;  5CLL B;  2W2X C;  1DDM A;  3D8E A;  1MPH A;  5KQ1 A;  2DX1 A;  4Z2N A;  1ISN A;  2ROV A;  4K2O A;  4HAX B;  5J3T A;  2J0M A;  2DHK A;  1KI1 B;  4GXB A;  5DHA B;  1AQC A;  2KUP A;  1E5W A;  5DHF B;  4HHV A;  2CY4 A;  1V88 A;  3FEH A;  4A6H A;  5KCV A;  3UZT A;  2YF0 A;  2LG1 A;  1FHX A;  2RSG A;  3KY9 A;  1X1F A;  1FGY A;  1GG3 A;  2LKO A;  2AL6 A;  3GYO A;  2YT0 A;  2BCJ A;  2D9W A;  4HB3 B;  2OTX A;  2GJY A;  3TO1 A;  1V61 A;  2DX5 A;  1MAI A;  3NSU A;  2CAY A;  3N7C A;  1DDV A;  2YS1 A;  1ZVR A;  2LYD A;  1SHC A;  4GMX B;  1WG7 A;  5D3V A;  4HB0 B;  2DKQ A;  1MKE A;  2VSZ A;  1QC6 A;  2I5F A;  1PLS A;  4YL8 A;  2M38 A;  1UEF A;  2UZR A;  1ZSQ A;  1MK9 B;  3KRX A;  1XOD A;  1WJ1 A;  2YVC A;  2DN6 A;  2Z0O A;  1J19 A;  3U8Z A;  4CHJ A;  2W2X D;  2V76 A;  3HK0 A;  2J0K A;  4F7H A;  5LOP B;  1UPQ A;  2GCL A;  3IVF A;  3ZVR A;  3PEG A;  3QIJ A;  3VOQ A;  2MDX A;  5JLJ B;  2YT1 A;  5D27 A;  5HE0 A;  1KZG A;  2X18 A;  5JP4 A;  4K17 A;  1N3H A;  3SYX A;  4A6F A;  2K00 A;  5C5B A;  1X11 A;  2FJL A;  5CLQ B;  4F7U P;  1SGH A;  3ODW A;  4HB2 B;  1B55 A;  2ELA A;  3TW1 A;  4PNK A;  2Q13 A;  2HE7 A;  1MIX A;  1K5D B;  1U5F A;  3F5R A;  5D3X A;  4TKN A;  2DYN A;  2H7E A;  5D3Y A;  3A8Q A;  1EF1 A;  2RVB B;  4CYE A;  4EMO A;  4GZU A;  1XKE A;  3AU4 A;  2RGN B;  1BTK A;  3P7Z A;  2L1C A;  1MK7 B;  2EMS A;  2DLW A;  4HAU B;  5HE2 A;  1OQN A;  4HAW B;  1J0W A;  1NTY A;  4IFS A;  4HAZ B;  3D8D A;  4HAT B;  2L2I A;  2Y8F A;  1UNP A;  3M1I B;  4BBK A;  3PVL A;  5HE1 A;  1NTV A;  2PZ1 A;  3QWM A;  1V5U A;  4KAX B;  4WSF A;  5JHH A;  2ADZ A;  1ZC4 B;  2GS0 A;  1FGZ A;  3BJI A;  5DI9 B;  2XQN M;  1U5G A;  1W1H A;  2COA A;  4DX9 0;  2D2Q A;  2VKI A;  3F0W A;  1V89 A;  2EJ8 A;  2N23 A;  4DX8 A;  2E2X A;  4GN1 A;  1BAK A;  1X86 A;  2DYQ A;  5JHG A;  1W1G A;  5C6R A;  3U7D A;  1M7E A;  1FHO A;  2JP2 A;  3DXC A;  1H4R A;  2GCJ A;  3A98 B;  1AWE A;  2P0H A;  3KZ1 A;  4HB4 B;  4IAP A;  5DH9 B;  1LB1 A;  1EVH A;  1XX0 A;  3PSC A;  2COC A;  2RUK B;  1DBH A;  3RCP A;  2DTC A;  2N0Y A;  1BWN A;  2DA0 A;  2P8V A;  2Y7B A;  2ZPY A;  5HE3 A;  1QQG A;  1U5E A;  2D9Z A;  4WJ7 A;  1Z87 A;  5D3W A;  2K2U A;  2D9V A;  4B6H A;  4NY0 A;  3V5W A;  2G35 A;  5KQ4 A;  3GYP A;  4MT7 A;  3FM8 C;  4C0A A;  2MWN B;  3ZDT A;  4KVG B;  1ZC3 B;  1WGU A;  2QKL A;  1XD4 A;  4CHM A;  1P5T A;  5GOW B;  2Z0Q A;  3TCA A;  2D10 A;  2EC1 A;  1K5G B;  3DXE A;  1P6S A;  4TYZ A;  2NZ8 B;  2NMB A;  4HAY B;  4DXA B;  3SUZ A;  1H10 A;  1DDW A;  1P3R A;  3G9W A;  3LJU X;  3TFM A;  3D8F A;  2I1J A;  2R0D A;  5L81 A;  1ZM0 A;  3KSY A;  2VRW B;  5DIF B;  3A8P A;  1UNR A;  1BTN A;  2YSZ A;  1EGX A;  1M7R A;  5FI0 A;  3FSS A;  2R09 A;  4KHA A;  2ELB A;  1FOE A;  1TQZ A;  3SO6 A;  4H8S A;  2RNR B;  3QBV B;  5J3Y A;  3MPX A;  2P0F A;  4PQ0 A;  3SV1 A;  3VIA A;  1WI1 A;  2Z0P A;  2MKR A;  1KZ7 A;  2UVM A;  3ODX A;  1FHW A;  1RRP B;  3O96 A;  4A6K A;  2COF A;  3AJ4 A;  1U27 A;  3PP2 A;  2P0D A;  1U29 A;  1OMW A;  2COD A;  2KCJ A;  2YS5 A;  3DXD A;  1GC6 A;  1LW3 A;  4NSW A;  2D9Y A;  4KHO A;  2D9X A;  3ULC A; 
#chains in the Genus database with same CATH topology
 1W1D A;  2H7D A;  3KRW A;  4P7I A;  1XR0 B;  3HIE A;  4ZRK A;  3PVU A;  1WJM A;  5C79 A;  2LUL A;  4Z2M B;  2EMT A;  1TXD A;  4K2P A;  1V5P A;  1IRS A;  4KHB B;  2K2J A;  1ZYI A;  1NI2 A;  2CRF A;  2KGX B;  4WVF B;  5M4Y B;  2D11 A;  2DFK A;  4EJN A;  2LOZ A;  1NU2 A;  3T06 A;  2YS3 A;  2UZS A;  2MFQ A;  2OQB A;  2Y8G A;  2DKP A;  1WGQ A;  1PFJ A;  3BIN A;  4XWX A;  4MY6 A;  3MDB C;  3PVW A;  4A6F B;  2R2Y A;  4MK0 A;  1Y19 B;  3WYF B;  5C5B B;  3WA0 A;  4Y94 A;  3AU5 A;  5EFX A;  4L1R A;  3ODO A;  2J0J A;  3X23 A;  2AEH A;  5C16 A;  4F7G A;  4GMV A;  2HTH B;  1WVH A;  1DYN A;  1X1G A;  2IYB A;  4KHB A;  3HQC A;  1GC7 A;  3CIK A;  1U5D A;  2ROZ B;  1I2H A;  4K81 A;  2CY5 A;  5LON B;  2YT2 A;  3CXB B;  1FAO A;  1XCG A;  1U2B A;  2RLO A;  4HDO A;  1OY2 A;  2D4Q A;  3OAN A;  4YON A;  1I7A A;  1X05 A;  2YRY A;  4L6E A;  5FI1 A;  3ML4 A;  2I5C A;  1DRO A;  1FB8 A;  2LOX A;  2I1K A;  4EKU A;  4QXA B;  2J59 M;  3ULB A;  1UNQ A;  2QKM A;  1Q67 A;  4D0N B;  2DHI A;  2W2W A;  3PZD A;  2IFS A;  2DHJ A;  3TVV A;  1EAZ A;  3SNH A;  1MIZ B;  4HDQ A;  4IOY X;  4DBB A;  1PMS A;  4ZRI A;  2M14 A;  3PG7 A;  5J3Q A;  1UPR A;  4ZRJ A;  1RJ2 A;  4GOU A;  4GPT B;  4HAV B;  3P6A A;  1V5M A;  1Y5O A;  3HW2 B;  4OT1 A;  4A5K A;  1TJ6 A;  5CLL B;  2W2X C;  1DDM A;  3D8E A;  2K49 A;  3NW8 A;  4CSQ A;  1MPH A;  5KQ1 A;  2DX1 A;  4Z2N A;  3B77 A;  1ISN A;  2ROV A;  4K2O A;  4HAX B;  5J3T A;  2J0M A;  2DHK A;  1KI1 B;  4GXB A;  5DHA B;  1AQC A;  2KUP A;  1E5W A;  5DHF B;  4HHV A;  2CY4 A;  1V88 A;  2KIE A;  3FEH A;  4A6H A;  5KCV A;  3UZT A;  2YF0 A;  2LG1 A;  1FHX A;  2RSG A;  3KY9 A;  1X1F A;  1FGY A;  1GG3 A;  2LKO A;  2AL6 A;  3GYO A;  2YT0 A;  3NWF A;  2FJU B;  2BCJ A;  2D9W A;  4HB3 B;  2OTX A;  2GJY A;  3TO1 A;  1V61 A;  2DX5 A;  1MAI A;  3NSU A;  2CAY A;  3N7C A;  1DDV A;  2YS1 A;  1ZVR A;  2LYD A;  1SHC A;  4GMX B;  2KUQ A;  1WG7 A;  5D3V A;  4HB0 B;  2DKQ A;  2KIG A;  1MKE A;  3DCX A;  2VSZ A;  1QC6 A;  2I5F A;  1PLS A;  4YL8 A;  2M38 A;  1UEF A;  2Z14 A;  2UZR A;  1ZSQ A;  1MK9 B;  3KRX A;  1XOD A;  1WJ1 A;  2YVC A;  2DN6 A;  2Z0O A;  1J19 A;  3U8Z A;  4CHJ A;  2W2X D;  2V76 A;  3HK0 A;  2J0K A;  4F7H A;  5LOP B;  1UPQ A;  2K8E A;  2GCL A;  5I2M A;  3IVF A;  3ZVR A;  3PEG A;  3QIJ A;  3VOQ A;  2MDX A;  5JLJ B;  2YT1 A;  5D27 A;  5HE0 A;  1KZG A;  2X18 A;  5JP4 A;  4K17 A;  1N3H A;  3SYX A;  4A6F A;  2K00 A;  3U12 A;  5C5B A;  1X11 A;  2FJL A;  5CLQ B;  4F7U P;  1SGH A;  3ODW A;  4HB2 B;  1B55 A;  2ELA A;  3TW1 A;  4PNK A;  2Q13 A;  2HE7 A;  1MIX A;  1K5D B;  1U5F A;  3F5R A;  5D3X A;  4TKN A;  2DYN A;  2H7E A;  5D3Y A;  3A8Q A;  1EF1 A;  2RVB B;  4CYE A;  4EMO A;  4GZU A;  1XKE A;  3AU4 A;  2RGN B;  5I2S A;  1BTK A;  3P7Z A;  5IRS A;  2L1C A;  1MK7 B;  2EMS A;  2DLW A;  2Z4D A;  4HAU B;  5HE2 A;  1OQN A;  4HAW B;  1J0W A;  1NTY A;  3FVC A;  4IFS A;  4HAZ B;  3D8D A;  3A58 A;  4HAT B;  2L2I A;  2Y8F A;  1UNP A;  3M1I B;  4BBK A;  3PVL A;  5HE1 A;  4QJ3 B;  1NTV A;  2PZ1 A;  3QWM A;  1V5U A;  4KAX B;  4WSF A;  5JHH A;  2ADZ A;  3NWD A;  1ZC4 B;  2GS0 A;  1FGZ A;  3BJI A;  5DI9 B;  2XQN M;  1U5G A;  1W1H A;  2COA A;  4DX9 0;  2D2Q A;  2VKI A;  3F0W A;  1V89 A;  2EJ8 A;  2N23 A;  4DX8 A;  2E2X A;  4GN1 A;  1BAK A;  1X86 A;  2DYQ A;  5JHG A;  1W1G A;  5C6R A;  3U7D A;  1M7E A;  2KR0 A;  1FHO A;  2JP2 A;  4GNK B;  3DXC A;  1H4R A;  2GCJ A;  3A98 B;  1AWE A;  2P0H A;  3KZ1 A;  4HB4 B;  3NWA A;  3HSA A;  4IAP A;  5DH9 B;  1LB1 A;  1EVH A;  1XX0 A;  3PSC A;  2COC A;  2Z59 A;  2RUK B;  1DBH A;  3RCP A;  2DTC A;  2N0Y A;  1BWN A;  2DA0 A;  2GUM A;  2P8V A;  2Y7B A;  2ZPY A;  5HE3 A;  1QQG A;  1U5E A;  2D9Z A;  4WJ7 A;  1Z87 A;  5D3W A;  2K2U A;  2D9V A;  4B6H A;  4NY0 A;  4HSI A;  4D6W A;  3V5W A;  2G35 A;  5KQ4 A;  3GYP A;  4MT7 A;  3FM8 C;  4C0A A;  2MWN B;  3ZDT A;  4KVG B;  1MI1 A;  1ZC3 B;  1WGU A;  2QKL A;  1XD4 A;  4CHM A;  1P5T A;  5GOW B;  2Z0Q A;  3TCA A;  2D10 A;  2ZKM X;  2EC1 A;  1K5G B;  3DXE A;  1P6S A;  4TYZ A;  3OHM B;  2NZ8 B;  2NMB A;  2Z13 A;  4HAY B;  4DXA B;  3SUZ A;  1H10 A;  1DDW A;  1P3R A;  3G9W A;  3LJU X;  3TFM A;  3D8F A;  2I1J A;  2R0D A;  5L81 A;  1ZM0 A;  4OSN A;  3KSY A;  2VRW B;  5DIF B;  3A8P A;  4QJ5 B;  4QJ4 B;  1UNR A;  4DIX A;  1BTN A;  2YSZ A;  1EGX A;  1M7R A;  5FI0 A;  3FSS A;  2R09 A;  4KHA A;  2ELB A;  1FOE A;  1TQZ A;  3SO6 A;  4H8S A;  2RNR B;  3QBV B;  5J3Y A;  3MPX A;  2P0F A;  4PQ0 A;  3SV1 A;  3VIA A;  1WI1 A;  2Z0P A;  2MKR A;  1KZ7 A;  2UVM A;  3ODX A;  1FHW A;  1RRP B;  3O96 A;  4A6K A;  2COF A;  3AJ4 A;  1U27 A;  3PP2 A;  2P0D A;  1U29 A;  1OMW A;  1T77 A;  2COD A;  2KCJ A;  2YS5 A;  3DXD A;  1GC6 A;  1LW3 A;  4NSW A;  5LG4 B;  2RRF A;  2D9Y A;  4KHO A;  2D9X A;  2NBV A;  3ULC A; 
#chains in the Genus database with same CATH homology
 1W1D A;  2H7D A;  3KRW A;  4P7I A;  1XR0 B;  4ZRK A;  3PVU A;  1WJM A;  5C79 A;  2LUL A;  4Z2M B;  2EMT A;  1TXD A;  4K2P A;  1V5P A;  1IRS A;  4KHB B;  2K2J A;  1NI2 A;  2CRF A;  2KGX B;  4WVF B;  2D11 A;  2DFK A;  4EJN A;  2LOZ A;  1NU2 A;  3T06 A;  2YS3 A;  2UZS A;  2MFQ A;  2OQB A;  2Y8G A;  2DKP A;  1WGQ A;  1PFJ A;  3BIN A;  4XWX A;  4MY6 A;  3MDB C;  3PVW A;  4A6F B;  4MK0 A;  1Y19 B;  3WYF B;  5C5B B;  3WA0 A;  4Y94 A;  3AU5 A;  5EFX A;  3ODO A;  2J0J A;  3X23 A;  2AEH A;  5C16 A;  4F7G A;  4GMV A;  2HTH B;  1WVH A;  1DYN A;  1X1G A;  2IYB A;  3HQC A;  1GC7 A;  3CIK A;  1U5D A;  2ROZ B;  1I2H A;  4K81 A;  2CY5 A;  5LON B;  3CXB B;  1FAO A;  1XCG A;  1U2B A;  2RLO A;  4HDO A;  1OY2 A;  2D4Q A;  3OAN A;  4YON A;  1I7A A;  1X05 A;  2YRY A;  4L6E A;  5FI1 A;  3ML4 A;  2I5C A;  1DRO A;  1FB8 A;  2LOX A;  2I1K A;  4EKU A;  2J59 M;  3ULB A;  1UNQ A;  2QKM A;  1Q67 A;  4D0N B;  2DHI A;  2W2W A;  3PZD A;  2IFS A;  2DHJ A;  3TVV A;  1EAZ A;  3SNH A;  1MIZ B;  4HDQ A;  4IOY X;  4DBB A;  1PMS A;  4ZRI A;  2M14 A;  3PG7 A;  5J3Q A;  1UPR A;  4ZRJ A;  1RJ2 A;  4GPT B;  4HAV B;  3P6A A;  1V5M A;  1Y5O A;  3HW2 B;  4A5K A;  1TJ6 A;  5CLL B;  2W2X C;  1DDM A;  3D8E A;  1MPH A;  5KQ1 A;  2DX1 A;  4Z2N A;  1ISN A;  2ROV A;  4K2O A;  4HAX B;  5J3T A;  2J0M A;  2DHK A;  1KI1 B;  4GXB A;  5DHA B;  1AQC A;  2KUP A;  1E5W A;  5DHF B;  4HHV A;  2CY4 A;  1V88 A;  3FEH A;  4A6H A;  5KCV A;  3UZT A;  2YF0 A;  2LG1 A;  1FHX A;  2RSG A;  3KY9 A;  1X1F A;  1FGY A;  1GG3 A;  2LKO A;  2AL6 A;  3GYO A;  2YT0 A;  2BCJ A;  2D9W A;  4HB3 B;  2OTX A;  2GJY A;  3TO1 A;  1V61 A;  2DX5 A;  1MAI A;  3NSU A;  2CAY A;  3N7C A;  1DDV A;  2YS1 A;  1ZVR A;  2LYD A;  1SHC A;  4GMX B;  1WG7 A;  5D3V A;  4HB0 B;  2DKQ A;  1MKE A;  2VSZ A;  1QC6 A;  2I5F A;  1PLS A;  4YL8 A;  2M38 A;  1UEF A;  2UZR A;  1ZSQ A;  1MK9 B;  3KRX A;  1XOD A;  1WJ1 A;  2YVC A;  2DN6 A;  2Z0O A;  1J19 A;  3U8Z A;  4CHJ A;  2W2X D;  2V76 A;  3HK0 A;  2J0K A;  4F7H A;  5LOP B;  1UPQ A;  2GCL A;  3IVF A;  3ZVR A;  3PEG A;  3QIJ A;  3VOQ A;  2MDX A;  5JLJ B;  2YT1 A;  5D27 A;  5HE0 A;  1KZG A;  2X18 A;  5JP4 A;  4K17 A;  1N3H A;  3SYX A;  4A6F A;  2K00 A;  5C5B A;  1X11 A;  2FJL A;  5CLQ B;  4F7U P;  1SGH A;  3ODW A;  4HB2 B;  1B55 A;  2ELA A;  3TW1 A;  4PNK A;  2Q13 A;  2HE7 A;  1MIX A;  1K5D B;  1U5F A;  3F5R A;  5D3X A;  4TKN A;  2DYN A;  2H7E A;  5D3Y A;  3A8Q A;  1EF1 A;  2RVB B;  4CYE A;  4EMO A;  4GZU A;  1XKE A;  3AU4 A;  2RGN B;  1BTK A;  3P7Z A;  2L1C A;  1MK7 B;  2EMS A;  2DLW A;  4HAU B;  5HE2 A;  1OQN A;  4HAW B;  1J0W A;  1NTY A;  4IFS A;  4HAZ B;  3D8D A;  4HAT B;  2L2I A;  2Y8F A;  1UNP A;  3M1I B;  4BBK A;  3PVL A;  5HE1 A;  1NTV A;  2PZ1 A;  3QWM A;  1V5U A;  4KAX B;  4WSF A;  5JHH A;  2ADZ A;  1ZC4 B;  2GS0 A;  1FGZ A;  3BJI A;  5DI9 B;  2XQN M;  1U5G A;  1W1H A;  2COA A;  4DX9 0;  2D2Q A;  2VKI A;  3F0W A;  1V89 A;  2EJ8 A;  2N23 A;  4DX8 A;  2E2X A;  4GN1 A;  1BAK A;  1X86 A;  2DYQ A;  5JHG A;  1W1G A;  5C6R A;  3U7D A;  1M7E A;  1FHO A;  2JP2 A;  3DXC A;  1H4R A;  2GCJ A;  3A98 B;  1AWE A;  2P0H A;  3KZ1 A;  4HB4 B;  4IAP A;  5DH9 B;  1LB1 A;  1EVH A;  1XX0 A;  3PSC A;  2COC A;  2RUK B;  1DBH A;  3RCP A;  2DTC A;  2N0Y A;  1BWN A;  2DA0 A;  2P8V A;  2Y7B A;  2ZPY A;  5HE3 A;  1QQG A;  1U5E A;  2D9Z A;  4WJ7 A;  1Z87 A;  5D3W A;  2K2U A;  2D9V A;  4B6H A;  4NY0 A;  3V5W A;  2G35 A;  5KQ4 A;  3GYP A;  4MT7 A;  3FM8 C;  4C0A A;  2MWN B;  3ZDT A;  4KVG B;  1ZC3 B;  1WGU A;  2QKL A;  1XD4 A;  4CHM A;  1P5T A;  5GOW B;  2Z0Q A;  3TCA A;  2D10 A;  2EC1 A;  1K5G B;  3DXE A;  1P6S A;  4TYZ A;  2NZ8 B;  2NMB A;  4HAY B;  4DXA B;  3SUZ A;  1H10 A;  1DDW A;  1P3R A;  3G9W A;  3LJU X;  3TFM A;  3D8F A;  2I1J A;  2R0D A;  5L81 A;  1ZM0 A;  3KSY A;  2VRW B;  5DIF B;  3A8P A;  1UNR A;  1BTN A;  2YSZ A;  1EGX A;  1M7R A;  5FI0 A;  3FSS A;  2R09 A;  4KHA A;  2ELB A;  1FOE A;  1TQZ A;  3SO6 A;  4H8S A;  2RNR B;  3QBV B;  5J3Y A;  3MPX A;  2P0F A;  4PQ0 A;  3SV1 A;  3VIA A;  1WI1 A;  2Z0P A;  2MKR A;  1KZ7 A;  2UVM A;  3ODX A;  1FHW A;  1RRP B;  3O96 A;  4A6K A;  2COF A;  3AJ4 A;  1U27 A;  3PP2 A;  2P0D A;  1U29 A;  1OMW A;  2COD A;  2KCJ A;  2YS5 A;  3DXD A;  1GC6 A;  1LW3 A;  4NSW A;  2D9Y A;  4KHO A;  2D9X A;  3ULC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...