2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
b'GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase,gene regulation
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
4F7HA 1OMWA 3SYXA 2COCA 1W1GA 5C6RA 2KUPA 1XX0A 1EGXA 2GJYA 1DYNA 3DXDA 3M1IB 5JLJB 3U8ZA 1RRPB 4K2OA 5D27A 2D2QA 1MPHA 2W2WA 1XODA 2EC1A 4A6HA 2H7DA 4NY0A 1N3HA 1X11A 2DKPA 1J0WA 3U7DA 5JP4A 3PZDA 1WVHA 4HATB 1V61A 5DHAB 4MT7A 2ELAA 3DXCA 5LOPB 3GYPA 1UPQA 4WVFB 2Z0QA 5D3YA 4GXBA 2RNRB 2RGNB 1FHXA 1UEFA 2DA0A 2COFA 4HAWB 1FGYA 4HHVA 2XQNM 4HB2B 3NSUA 3ULBA 3FM8C 3D8FA 3PG7A 2K2JA 4DXAB 1RJ2A 4B6HA 1DROA 4HAYB 2D9YA 3VIAA 2MFQA 3PSCA 2GCLA 2DKQA 2EMTA 2I5CA 1NI2A 1MK9B 2RVBB 3HQCA 4KHOA 2KCJA 3A8PA 4A6FA 3PEGA 2MWNB 2LYDA 3MPXA 1EAZA 3PVWA 3IVFA 2Y8FA 5DIFB 1W1DA 3GYOA 3O96A 4DX90 2DN6A 1P5TA 1X1FA 1FAOA 1EF1A 2AEHA 4HAXB 2DHJA 4DX8A 2YT0A 1BWNA 3HW2B 4A6FB 2J0JA 1NU2A 1TXDA 2OQBA 2P0FA 4A6KA 1WJ1A 2J59M 3FEHA 2MDXA 2DFKA 1WGUA 2UZSA 3KRXA 4ZRKA 1QQGA 2HTHB 1XD4A 2LKOA 4EKUA 2FJLA 4ZRJA 1FB8A 4IFSA 1NTYA 3D8EA 5J3QA 1X86A 5FI0A 2ELBA 1FGZA 2P8VA 4GN1A 1LW3A 2ADZA 4H8SA 5KCVA 3QWMA 2CY4A 4MK0A 3WYFB 4A5KA 3P6AA 1MAIA 2AL6A 3AJ4A 2IYBA 2D10A 1P6SA 4GZUA 2IFSA 1BTKA 1X1GA 3BJIA 5LONB 4WJ7A 1PLSA 4IAPA 1M7RA 1U5FA 4Z2NA 2DX1A 5DHFB 2D9ZA 2P0HA 1XKEA 2QKMA 5GOWB 1FHOA 4TKNA 2I1JA 4XWXA 1I7AA 5J3YA 2YS5A 2DHKA 4GMVA 1FOEA 2RUKB 2YRYA 4HDOA 1DDVA 1Y5OA 1DDWA 5D3XA 1MKEA 2HE7A 1Z87A 3LJUX 3SNHA 2CODA 2EJ8A 2PZ1A 3KZ1A 4CHJA 2I1KA 4F7UP 1I2HA 1KI1B 2DYNA 2DX5A 3FSSA 3BINA 3PP2A 2NMBA 2G35A 1TQZA 2DTCA 3QBVB 2YT1A 3T06A 2VSZA 3TVVA 2D11A 3N7CA 1MIZB 2YS3A 2DYQA 2L2IA 4HB3B 2Z0OA 1V5PA 1UNRA 4HB0B 3UZTA 1PMSA 4L6EA 1ZC3B 2DLWA 3KRWA 1V5MA 2P0DA 4P7IA 1U5GA 5KQ4A 1W1HA 3DXEA 2Z0PA 2M14A 3TFMA 2UVMA 2Y7BA 3ZDTA 1U29A 1IRSA 1XR0B 1DDMA 4GPTB 1WJMA 4KHBB 4K2PA 3A8QA 2VRWB 4HAZB 1GC7A 2LOZA 5HE1A 3AU4A 1M7EA 4EJNA 1WGQA 1AWEA 4F7GA 4NSWA 2OTXA 4WSFA 3F5RA 3D8DA 3WA0A 3ODWA 2MKRA 1XCGA 3CIKA 2Y8GA 4PQ0A 2D9XA 3SV1A 1QC6A 3AU5A 1P3RA 2V76A 2ROVA 2RSGA 2J0MA 5D3VA 1OY2A 3QIJA 3ZVRA 4IOYX 2DHIA 2R09A 1E5WA 2YVCA 2GCJA 2LULA 3F0WA 3X23A 1SGHA 1V89A 3TCAA 2JP2A 4KAXB 5KQ1A 1ZC4B 5J3TA 4DBBA 1WI1A 1BTNA 2ZPYA 1ISNA 2E2XA 2LOXA 3CXBB 4MY6A 5HE3A 3V5WA 3RCPA 2Q13A 2COAA 4K17A 4GMXB 2NZ8B 2N0YA 1B55A 1K5GB 4HDQA 5L81A 4HB4B 5C79A 1U2BA 1SHCA 2YF0A 1OQNA 1Y19B 2LG1A 1Q67A 3HK0A 1GC6A 3G9WA 1BAKA 5CLQB 2UZRA 5C16A 2R0DA 2D4QA 1FHWA 3SO6A 1MIXA 1J19A 1MK7B 3ULCA 1GG3A 4Z2MB 4Y94A 4YL8A 2W2XD 2EMSA 5HE2A 3TW1A 4KHAA 4EMOA 2BCJA 3P7ZA 2X18A 1PFJA 1ZSQA 5JHGA 5D3WA 2I5FA 2M38A 1UNPA 1UPRA 2D9WA 2D9VA 2K2UA 2CRFA 3ODOA 1WG7A 2QKLA 1NTVA 1V88A 3KY9A 2KGXB 2ROZB 5CLLB 5DH9B 1ZVRA 5HE0A 2J0KA 3SUZA 5DI9B 2CAYA 2W2XC 1H4RA 5C5BA 4KVGB 1LB1A 1X05A 3OANA 2YSZA 5FI1A 1KZ7A 1EVHA 4D0NB 3PVLA 4K81A 5EFXA 3TO1A 2L1CA 1U5EA 4CYEA 4HAUB 1U27A 1H10A 1U5DA 4TYZA 4ZRIA 1ZM0A 1AQCA 2GS0A 4BBKA 5C5BB 1K5DB 4PNKA 4CHMA 2VKIA 3PVUA 3KSYA 5JHHA 1TJ6A 3VOQA 3A98B 2N23A 2RLOA 1UNQA 1KZGA 4HAVB 4YONA 1DBHA 1V5UA 3MDBC 2CY5A 4C0AA 3ODXA 2K00A 2H7EA 2YS1A 3ML4A
chains in the Genus database with same CATH superfamily
4F7HA 3DCXA 1OMWA 2Z4DA 3SYXA 2COCA 1W1GA 5C6RA 2KUPA 1XX0A 1EGXA 2GJYA 1DYNA 3DXDA 3M1IB 2K49A 5JLJB 3U8ZA 1RRPB 4K2OA 5D27A 2D2QA 3OHMB 1MPHA 2W2WA 1XODA 2EC1A 4A6HA 2H7DA 3A58A 4NY0A 2R2YA 1N3HA 1X11A 2DKPA 1J0WA 3U7DA 5JP4A 3PZDA 1WVHA 4HATB 1V61A 5DHAB 4MT7A 2ELAA 3DXCA 5LOPB 3GYPA 4QJ3B 1UPQA 4WVFB 2Z0QA 5D3YA 4GXBA 2RNRB 2RGNB 1FHXA 1UEFA 2DA0A 2COFA 4HAWB 1FGYA 4HHVA 2XQNM 4HB2B 3NSUA 3ULBA 3FM8C 3D8FA 3PG7A 2K2JA 4DXAB 1RJ2A 4B6HA 1DROA 4HAYB 2D9YA 3VIAA 2MFQA 3PSCA 2GCLA 2DKQA 2EMTA 2I5CA 3HQCA 1NI2A 1MK9B 2RVBB 4KHOA 2KCJA 5LG4B 3A8PA 4OT1A 4A6FA 1MI1A 3PEGA 2MWNB 2LYDA 3MPXA 1EAZA 2KIEA 3PVWA 3IVFA 2Y8FA 5IRSA 5DIFB 1W1DA 3GYOA 3O96A 2KIGA 4DX90 2DN6A 1P5TA 1X1FA 1FAOA 1EF1A 2AEHA 4HAXB 2DHJA 4DX8A 2YT0A 1BWNA 3HW2B 4A6FB 2J0JA 1NU2A 1TXDA 2OQBA 2P0FA 4A6KA 1WJ1A 2J59M 3FEHA 2MDXA 2DFKA 1WGUA 2UZSA 3KRXA 4QJ4B 4ZRKA 1QQGA 2HTHB 1XD4A 2LKOA 4EKUA 2FJLA 4ZRJA 1FB8A 2RRFA 4IFSA 4GOUA 1NTYA 3D8EA 5J3QA 1X86A 5FI0A 2ELBA 1FGZA 2P8VA 4GN1A 1LW3A 2ADZA 4H8SA 5KCVA 3QWMA 2CY4A 4MK0A 3WYFB 4A5KA 3P6AA 1MAIA 2AL6A 3AJ4A 2IYBA 2NBVA 2D10A 1P6SA 4GZUA 2IFSA 1BTKA 1X1GA 3BJIA 5LONB 4WJ7A 1PLSA 4IAPA 1M7RA 1U5FA 4Z2NA 3FVCA 2DX1A 2KR0A 5DHFB 2D9ZA 2P0HA 1XKEA 2QKMA 5GOWB 1FHOA 4TKNA 2I1JA 4XWXA 1I7AA 5J3YA 2YS5A 2DHKA 4GMVA 1FOEA 2RUKB 2YRYA 4HDOA 1DDVA 1Y5OA 1DDWA 5D3XA 1MKEA 2HE7A 1Z87A 3LJUX 3SNHA 2Z14A 2CODA 2EJ8A 2PZ1A 3KZ1A 4GNKB 2I1KA 4CHJA 4F7UP 1I2HA 1KI1B 2DYNA 2DX5A 3FSSA 3BINA 3PP2A 2NMBA 2G35A 1TQZA 2DTCA 3NW8A 3QBVB 2YT1A 3T06A 2VSZA 3TVVA 5I2MA 2D11A 2KUQA 3N7CA 1MIZB 2YS3A 2DYQA 2YT2A 2L2IA 4HB3B 2Z0OA 1V5PA 4L1RA 1UNRA 4KHBA 4HB0B 3UZTA 1PMSA 4L6EA 1ZC3B 2DLWA 3KRWA 3HSAA 1V5MA 2P0DA 4P7IA 1U5GA 5KQ4A 4OSNA 1W1HA 3DXEA 2Z0PA 4HSIA 2M14A 3TFMA 2UVMA 2Y7BA 3ZDTA 2ZKMX 1U29A 1IRSA 1XR0B 1DDMA 4GPTB 1WJMA 4KHBB 4K2PA 3A8QA 2VRWB 3NWFA 4DIXA 4HAZB 1GC7A 2LOZA 5HE1A 3AU4A 1M7EA 4EJNA 1WGQA 1AWEA 4F7GA 4NSWA 2OTXA 4WSFA 4QXAB 4CSQA 3F5RA 3D8DA 3WA0A 3ODWA 2MKRA 1XCGA 3CIKA 2Y8GA 4PQ0A 2D9XA 3SV1A 1QC6A 3AU5A 1P3RA 2V76A 2ROVA 2RSGA 2J0MA 5D3VA 1OY2A 3QIJA 3ZVRA 4IOYX 2DHIA 2R09A 1E5WA 2YVCA 2GCJA 2LULA 3F0WA 3X23A 1SGHA 1V89A 3TCAA 2JP2A 3HIEA 4KAXB 5KQ1A 1ZC4B 5J3TA 4DBBA 1WI1A 1BTNA 2ZPYA 1ISNA 2Z59A 5M4YB 2E2XA 2LOXA 3CXBB 4MY6A 5HE3A 3V5WA 3RCPA 4D6WA 2Q13A 2COAA 4K17A 4GMXB 2NZ8B 2N0YA 1B55A 1K5GB 4HDQA 5L81A 4HB4B 5C79A 1U2BA 1SHCA 2YF0A 1OQNA 1Y19B 2LG1A 3U12A 1Q67A 3HK0A 2K8EA 1GC6A 3G9WA 1BAKA 5CLQB 2UZRA 5C16A 2R0DA 2D4QA 1FHWA 3SO6A 1MIXA 1J19A 1MK7B 3NWAA 3ULCA 1GG3A 4Z2MB 4Y94A 4YL8A 2W2XD 2EMSA 5HE2A 3TW1A 4KHAA 4EMOA 2BCJA 3P7ZA 2X18A 1PFJA 1ZSQA 5JHGA 5D3WA 3NWDA 2I5FA 2M38A 1UNPA 1UPRA 2GUMA 2D9WA 2D9VA 2K2UA 2CRFA 3ODOA 1WG7A 3B77A 2QKLA 1NTVA 1V88A 3KY9A 1T77A 2KGXB 2ROZB 5CLLB 5DH9B 1ZVRA 5HE0A 2J0KA 3SUZA 2FJUB 2CAYA 5DI9B 2W2XC 1H4RA 5C5BA 4KVGB 2Z13A 1LB1A 1X05A 3OANA 2YSZA 5FI1A 1KZ7A 1EVHA 4D0NB 3PVLA 4K81A 5EFXA 3TO1A 2L1CA 1ZYIA 1U5EA 4CYEA 4HAUB 1U27A 1H10A 1U5DA 4TYZA 4ZRIA 1ZM0A 1AQCA 2GS0A 4BBKA 5C5BB 1K5DB 4PNKA 4CHMA 2VKIA 3PVUA 3KSYA 5JHHA 1TJ6A 3VOQA 3A98B 4QJ5B 2N23A 2RLOA 1UNQA 1KZGA 4HAVB 4YONA 1DBHA 1V5UA 3MDBC 2CY5A 4C0AA 5I2SA 3ODXA 2K00A 2H7EA 2YS1A 3ML4A
chains in the Genus database with same CATH topology
4F7HA 1OMWA 3SYXA 2COCA 1W1GA 5C6RA 2KUPA 1XX0A 1EGXA 2GJYA 1DYNA 3DXDA 3M1IB 5JLJB 3U8ZA 1RRPB 4K2OA 5D27A 2D2QA 1MPHA 2W2WA 1XODA 2EC1A 4A6HA 2H7DA 4NY0A 1N3HA 1X11A 2DKPA 1J0WA 3U7DA 5JP4A 3PZDA 1WVHA 4HATB 1V61A 5DHAB 4MT7A 2ELAA 3DXCA 5LOPB 3GYPA 1UPQA 4WVFB 2Z0QA 5D3YA 4GXBA 2RNRB 2RGNB 1FHXA 1UEFA 2DA0A 2COFA 4HAWB 1FGYA 4HHVA 2XQNM 4HB2B 3NSUA 3ULBA 3FM8C 3D8FA 3PG7A 2K2JA 4DXAB 1RJ2A 4B6HA 1DROA 4HAYB 2D9YA 3VIAA 2MFQA 3PSCA 2GCLA 2DKQA 2EMTA 2I5CA 1NI2A 1MK9B 2RVBB 3HQCA 4KHOA 2KCJA 3A8PA 4A6FA 3PEGA 2MWNB 2LYDA 3MPXA 1EAZA 3PVWA 3IVFA 2Y8FA 5DIFB 1W1DA 3GYOA 3O96A 4DX90 2DN6A 1P5TA 1X1FA 1FAOA 1EF1A 2AEHA 4HAXB 2DHJA 4DX8A 2YT0A 1BWNA 3HW2B 4A6FB 2J0JA 1NU2A 1TXDA 2OQBA 2P0FA 4A6KA 1WJ1A 2J59M 3FEHA 2MDXA 2DFKA 1WGUA 2UZSA 3KRXA 4ZRKA 1QQGA 2HTHB 1XD4A 2LKOA 4EKUA 2FJLA 4ZRJA 1FB8A 4IFSA 1NTYA 3D8EA 5J3QA 1X86A 5FI0A 2ELBA 1FGZA 2P8VA 4GN1A 1LW3A 2ADZA 4H8SA 5KCVA 3QWMA 2CY4A 4MK0A 3WYFB 4A5KA 3P6AA 1MAIA 2AL6A 3AJ4A 2IYBA 2D10A 1P6SA 4GZUA 2IFSA 1BTKA 1X1GA 3BJIA 5LONB 4WJ7A 1PLSA 4IAPA 1M7RA 1U5FA 4Z2NA 2DX1A 5DHFB 2D9ZA 2P0HA 1XKEA 2QKMA 5GOWB 1FHOA 4TKNA 2I1JA 4XWXA 1I7AA 5J3YA 2YS5A 2DHKA 4GMVA 1FOEA 2RUKB 2YRYA 4HDOA 1DDVA 1Y5OA 1DDWA 5D3XA 1MKEA 2HE7A 1Z87A 3LJUX 3SNHA 2CODA 2EJ8A 2PZ1A 3KZ1A 4CHJA 2I1KA 4F7UP 1I2HA 1KI1B 2DYNA 2DX5A 3FSSA 3BINA 3PP2A 2NMBA 2G35A 1TQZA 2DTCA 3QBVB 2YT1A 3T06A 2VSZA 3TVVA 2D11A 3N7CA 1MIZB 2YS3A 2DYQA 2L2IA 4HB3B 2Z0OA 1V5PA 1UNRA 4HB0B 3UZTA 1PMSA 4L6EA 1ZC3B 2DLWA 3KRWA 1V5MA 2P0DA 4P7IA 1U5GA 5KQ4A 1W1HA 3DXEA 2Z0PA 2M14A 3TFMA 2UVMA 2Y7BA 3ZDTA 1U29A 1IRSA 1XR0B 1DDMA 4GPTB 1WJMA 4KHBB 4K2PA 3A8QA 2VRWB 4HAZB 1GC7A 2LOZA 5HE1A 3AU4A 1M7EA 4EJNA 1WGQA 1AWEA 4F7GA 4NSWA 2OTXA 4WSFA 3F5RA 3D8DA 3WA0A 3ODWA 2MKRA 1XCGA 3CIKA 2Y8GA 4PQ0A 2D9XA 3SV1A 1QC6A 3AU5A 1P3RA 2V76A 2ROVA 2RSGA 2J0MA 5D3VA 1OY2A 3QIJA 3ZVRA 4IOYX 2DHIA 2R09A 1E5WA 2YVCA 2GCJA 2LULA 3F0WA 3X23A 1SGHA 1V89A 3TCAA 2JP2A 4KAXB 5KQ1A 1ZC4B 5J3TA 4DBBA 1WI1A 1BTNA 2ZPYA 1ISNA 2E2XA 2LOXA 3CXBB 4MY6A 5HE3A 3V5WA 3RCPA 2Q13A 2COAA 4K17A 4GMXB 2NZ8B 2N0YA 1B55A 1K5GB 4HDQA 5L81A 4HB4B 5C79A 1U2BA 1SHCA 2YF0A 1OQNA 1Y19B 2LG1A 1Q67A 3HK0A 1GC6A 3G9WA 1BAKA 5CLQB 2UZRA 5C16A 2R0DA 2D4QA 1FHWA 3SO6A 1MIXA 1J19A 1MK7B 3ULCA 1GG3A 4Z2MB 4Y94A 4YL8A 2W2XD 2EMSA 5HE2A 3TW1A 4KHAA 4EMOA 2BCJA 3P7ZA 2X18A 1PFJA 1ZSQA 5JHGA 5D3WA 2I5FA 2M38A 1UNPA 1UPRA 2D9WA 2D9VA 2K2UA 2CRFA 3ODOA 1WG7A 2QKLA 1NTVA 1V88A 3KY9A 2KGXB 2ROZB 5CLLB 5DH9B 1ZVRA 5HE0A 2J0KA 3SUZA 5DI9B 2CAYA 2W2XC 1H4RA 5C5BA 4KVGB 1LB1A 1X05A 3OANA 2YSZA 5FI1A 1KZ7A 1EVHA 4D0NB 3PVLA 4K81A 5EFXA 3TO1A 2L1CA 1U5EA 4CYEA 4HAUB 1U27A 1H10A 1U5DA 4TYZA 4ZRIA 1ZM0A 1AQCA 2GS0A 4BBKA 5C5BB 1K5DB 4PNKA 4CHMA 2VKIA 3PVUA 3KSYA 5JHHA 1TJ6A 3VOQA 3A98B 2N23A 2RLOA 1UNQA 1KZGA 4HAVB 4YONA 1DBHA 1V5UA 3MDBC 2CY5A 4C0AA 3ODXA 2K00A 2H7EA 2YS1A 3ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7H A;  1OMW A;  3SYX A;  2COC A;  1W1G A;  5C6R A;  2KUP A;  1XX0 A;  1EGX A;  2GJY A;  1DYN A;  3DXD A;  3M1I B;  5JLJ B;  3U8Z A;  1RRP B;  4K2O A;  5D27 A;  2D2Q A;  1MPH A;  2W2W A;  1XOD A;  2EC1 A;  4A6H A;  2H7D A;  4NY0 A;  1N3H A;  1X11 A;  2DKP A;  1J0W A;  3U7D A;  5JP4 A;  3PZD A;  1WVH A;  4HAT B;  1V61 A;  5DHA B;  4MT7 A;  2ELA A;  3DXC A;  5LOP B;  3GYP A;  1UPQ A;  4WVF B;  2Z0Q A;  5D3Y A;  4GXB A;  2RNR B;  2RGN B;  1FHX A;  1UEF A;  2DA0 A;  2COF A;  4HAW B;  1FGY A;  4HHV A;  2XQN M;  4HB2 B;  3NSU A;  3ULB A;  3FM8 C;  3D8F A;  3PG7 A;  2K2J A;  4DXA B;  1RJ2 A;  4B6H A;  1DRO A;  4HAY B;  2D9Y A;  3VIA A;  2MFQ A;  3PSC A;  2GCL A;  2DKQ A;  2EMT A;  2I5C A;  1NI2 A;  1MK9 B;  2RVB B;  3HQC A;  4KHO A;  2KCJ A;  3A8P A;  4A6F A;  3PEG A;  2MWN B;  2LYD A;  3MPX A;  1EAZ A;  3PVW A;  3IVF A;  2Y8F A;  5DIF B;  1W1D A;  3GYO A;  3O96 A;  4DX9 0;  2DN6 A;  1P5T A;  1X1F A;  1FAO A;  1EF1 A;  2AEH A;  4HAX B;  2DHJ A;  4DX8 A;  2YT0 A;  1BWN A;  3HW2 B;  4A6F B;  2J0J A;  1NU2 A;  1TXD A;  2OQB A;  2P0F A;  4A6K A;  1WJ1 A;  2J59 M;  3FEH A;  2MDX A;  2DFK A;  1WGU A;  2UZS A;  3KRX A;  4ZRK A;  1QQG A;  2HTH B;  1XD4 A;  2LKO A;  4EKU A;  2FJL A;  4ZRJ A;  1FB8 A;  4IFS A;  1NTY A;  3D8E A;  5J3Q A;  1X86 A;  5FI0 A;  2ELB A;  1FGZ A;  2P8V A;  4GN1 A;  1LW3 A;  2ADZ A;  4H8S A;  5KCV A;  3QWM A;  2CY4 A;  4MK0 A;  3WYF B;  4A5K A;  3P6A A;  1MAI A;  2AL6 A;  3AJ4 A;  2IYB A;  2D10 A;  1P6S A;  4GZU A;  2IFS A;  1BTK A;  1X1G A;  3BJI A;  5LON B;  4WJ7 A;  1PLS A;  4IAP A;  1M7R A;  1U5F A;  4Z2N A;  2DX1 A;  5DHF B;  2D9Z A;  2P0H A;  1XKE A;  2QKM A;  5GOW B;  1FHO A;  4TKN A;  2I1J A;  4XWX A;  1I7A A;  5J3Y A;  2YS5 A;  2DHK A;  4GMV A;  1FOE A;  2RUK B;  2YRY A;  4HDO A;  1DDV A;  1Y5O A;  1DDW A;  5D3X A;  1MKE A;  2HE7 A;  1Z87 A;  3LJU X;  3SNH A;  2COD A;  2EJ8 A;  2PZ1 A;  3KZ1 A;  4CHJ A;  2I1K A;  4F7U P;  1I2H A;  1KI1 B;  2DYN A;  2DX5 A;  3FSS A;  3BIN A;  3PP2 A;  2NMB A;  2G35 A;  1TQZ A;  2DTC A;  3QBV B;  2YT1 A;  3T06 A;  2VSZ A;  3TVV A;  2D11 A;  3N7C A;  1MIZ B;  2YS3 A;  2DYQ A;  2L2I A;  4HB3 B;  2Z0O A;  1V5P A;  1UNR A;  4HB0 B;  3UZT A;  1PMS A;  4L6E A;  1ZC3 B;  2DLW A;  3KRW A;  1V5M A;  2P0D A;  4P7I A;  1U5G A;  5KQ4 A;  1W1H A;  3DXE A;  2Z0P A;  2M14 A;  3TFM A;  2UVM A;  2Y7B A;  3ZDT A;  1U29 A;  1IRS A;  1XR0 B;  1DDM A;  4GPT B;  1WJM A;  4KHB B;  4K2P A;  3A8Q A;  2VRW B;  4HAZ B;  1GC7 A;  2LOZ A;  5HE1 A;  3AU4 A;  1M7E A;  4EJN A;  1WGQ A;  1AWE A;  4F7G A;  4NSW A;  2OTX A;  4WSF A;  3F5R A;  3D8D A;  3WA0 A;  3ODW A;  2MKR A;  1XCG A;  3CIK A;  2Y8G A;  4PQ0 A;  2D9X A;  3SV1 A;  1QC6 A;  3AU5 A;  1P3R A;  2V76 A;  2ROV A;  2RSG A;  2J0M A;  5D3V A;  1OY2 A;  3QIJ A;  3ZVR A;  4IOY X;  2DHI A;  2R09 A;  1E5W A;  2YVC A;  2GCJ A;  2LUL A;  3F0W A;  3X23 A;  1SGH A;  1V89 A;  3TCA A;  2JP2 A;  4KAX B;  5KQ1 A;  1ZC4 B;  5J3T A;  4DBB A;  1WI1 A;  1BTN A;  2ZPY A;  1ISN A;  2E2X A;  2LOX A;  3CXB B;  4MY6 A;  5HE3 A;  3V5W A;  3RCP A;  2Q13 A;  2COA A;  4K17 A;  4GMX B;  2NZ8 B;  2N0Y A;  1B55 A;  1K5G B;  4HDQ A;  5L81 A;  4HB4 B;  5C79 A;  1U2B A;  1SHC A;  2YF0 A;  1OQN A;  1Y19 B;  2LG1 A;  1Q67 A;  3HK0 A;  1GC6 A;  3G9W A;  1BAK A;  5CLQ B;  2UZR A;  5C16 A;  2R0D A;  2D4Q A;  1FHW A;  3SO6 A;  1MIX A;  1J19 A;  1MK7 B;  3ULC A;  1GG3 A;  4Z2M B;  4Y94 A;  4YL8 A;  2W2X D;  2EMS A;  5HE2 A;  3TW1 A;  4KHA A;  4EMO A;  2BCJ A;  3P7Z A;  2X18 A;  1PFJ A;  1ZSQ A;  5JHG A;  5D3W A;  2I5F A;  2M38 A;  1UNP A;  1UPR A;  2D9W A;  2D9V A;  2K2U A;  2CRF A;  3ODO A;  1WG7 A;  2QKL A;  1NTV A;  1V88 A;  3KY9 A;  2KGX B;  2ROZ B;  5CLL B;  5DH9 B;  1ZVR A;  5HE0 A;  2J0K A;  3SUZ A;  5DI9 B;  2CAY A;  2W2X C;  1H4R A;  5C5B A;  4KVG B;  1LB1 A;  1X05 A;  3OAN A;  2YSZ A;  5FI1 A;  1KZ7 A;  1EVH A;  4D0N B;  3PVL A;  4K81 A;  5EFX A;  3TO1 A;  2L1C A;  1U5E A;  4CYE A;  4HAU B;  1U27 A;  1H10 A;  1U5D A;  4TYZ A;  4ZRI A;  1ZM0 A;  1AQC A;  2GS0 A;  4BBK A;  5C5B B;  1K5D B;  4PNK A;  4CHM A;  2VKI A;  3PVU A;  3KSY A;  5JHH A;  1TJ6 A;  3VOQ A;  3A98 B;  2N23 A;  2RLO A;  1UNQ A;  1KZG A;  4HAV B;  4YON A;  1DBH A;  1V5U A;  3MDB C;  2CY5 A;  4C0A A;  3ODX A;  2K00 A;  2H7E A;  2YS1 A;  3ML4 A; 
#chains in the Genus database with same CATH topology
 4F7H A;  3DCX A;  1OMW A;  2Z4D A;  3SYX A;  2COC A;  1W1G A;  5C6R A;  2KUP A;  1XX0 A;  1EGX A;  2GJY A;  1DYN A;  3DXD A;  3M1I B;  2K49 A;  5JLJ B;  3U8Z A;  1RRP B;  4K2O A;  5D27 A;  2D2Q A;  3OHM B;  1MPH A;  2W2W A;  1XOD A;  2EC1 A;  4A6H A;  2H7D A;  3A58 A;  4NY0 A;  2R2Y A;  1N3H A;  1X11 A;  2DKP A;  1J0W A;  3U7D A;  5JP4 A;  3PZD A;  1WVH A;  4HAT B;  1V61 A;  5DHA B;  4MT7 A;  2ELA A;  3DXC A;  5LOP B;  3GYP A;  4QJ3 B;  1UPQ A;  4WVF B;  2Z0Q A;  5D3Y A;  4GXB A;  2RNR B;  2RGN B;  1FHX A;  1UEF A;  2DA0 A;  2COF A;  4HAW B;  1FGY A;  4HHV A;  2XQN M;  4HB2 B;  3NSU A;  3ULB A;  3FM8 C;  3D8F A;  3PG7 A;  2K2J A;  4DXA B;  1RJ2 A;  4B6H A;  1DRO A;  4HAY B;  2D9Y A;  3VIA A;  2MFQ A;  3PSC A;  2GCL A;  2DKQ A;  2EMT A;  2I5C A;  3HQC A;  1NI2 A;  1MK9 B;  2RVB B;  4KHO A;  2KCJ A;  5LG4 B;  3A8P A;  4OT1 A;  4A6F A;  1MI1 A;  3PEG A;  2MWN B;  2LYD A;  3MPX A;  1EAZ A;  2KIE A;  3PVW A;  3IVF A;  2Y8F A;  5IRS A;  5DIF B;  1W1D A;  3GYO A;  3O96 A;  2KIG A;  4DX9 0;  2DN6 A;  1P5T A;  1X1F A;  1FAO A;  1EF1 A;  2AEH A;  4HAX B;  2DHJ A;  4DX8 A;  2YT0 A;  1BWN A;  3HW2 B;  4A6F B;  2J0J A;  1NU2 A;  1TXD A;  2OQB A;  2P0F A;  4A6K A;  1WJ1 A;  2J59 M;  3FEH A;  2MDX A;  2DFK A;  1WGU A;  2UZS A;  3KRX A;  4QJ4 B;  4ZRK A;  1QQG A;  2HTH B;  1XD4 A;  2LKO A;  4EKU A;  2FJL A;  4ZRJ A;  1FB8 A;  2RRF A;  4IFS A;  4GOU A;  1NTY A;  3D8E A;  5J3Q A;  1X86 A;  5FI0 A;  2ELB A;  1FGZ A;  2P8V A;  4GN1 A;  1LW3 A;  2ADZ A;  4H8S A;  5KCV A;  3QWM A;  2CY4 A;  4MK0 A;  3WYF B;  4A5K A;  3P6A A;  1MAI A;  2AL6 A;  3AJ4 A;  2IYB A;  2NBV A;  2D10 A;  1P6S A;  4GZU A;  2IFS A;  1BTK A;  1X1G A;  3BJI A;  5LON B;  4WJ7 A;  1PLS A;  4IAP A;  1M7R A;  1U5F A;  4Z2N A;  3FVC A;  2DX1 A;  2KR0 A;  5DHF B;  2D9Z A;  2P0H A;  1XKE A;  2QKM A;  5GOW B;  1FHO A;  4TKN A;  2I1J A;  4XWX A;  1I7A A;  5J3Y A;  2YS5 A;  2DHK A;  4GMV A;  1FOE A;  2RUK B;  2YRY A;  4HDO A;  1DDV A;  1Y5O A;  1DDW A;  5D3X A;  1MKE A;  2HE7 A;  1Z87 A;  3LJU X;  3SNH A;  2Z14 A;  2COD A;  2EJ8 A;  2PZ1 A;  3KZ1 A;  4GNK B;  2I1K A;  4CHJ A;  4F7U P;  1I2H A;  1KI1 B;  2DYN A;  2DX5 A;  3FSS A;  3BIN A;  3PP2 A;  2NMB A;  2G35 A;  1TQZ A;  2DTC A;  3NW8 A;  3QBV B;  2YT1 A;  3T06 A;  2VSZ A;  3TVV A;  5I2M A;  2D11 A;  2KUQ A;  3N7C A;  1MIZ B;  2YS3 A;  2DYQ A;  2YT2 A;  2L2I A;  4HB3 B;  2Z0O A;  1V5P A;  4L1R A;  1UNR A;  4KHB A;  4HB0 B;  3UZT A;  1PMS A;  4L6E A;  1ZC3 B;  2DLW A;  3KRW A;  3HSA A;  1V5M A;  2P0D A;  4P7I A;  1U5G A;  5KQ4 A;  4OSN A;  1W1H A;  3DXE A;  2Z0P A;  4HSI A;  2M14 A;  3TFM A;  2UVM A;  2Y7B A;  3ZDT A;  2ZKM X;  1U29 A;  1IRS A;  1XR0 B;  1DDM A;  4GPT B;  1WJM A;  4KHB B;  4K2P A;  3A8Q A;  2VRW B;  3NWF A;  4DIX A;  4HAZ B;  1GC7 A;  2LOZ A;  5HE1 A;  3AU4 A;  1M7E A;  4EJN A;  1WGQ A;  1AWE A;  4F7G A;  4NSW A;  2OTX A;  4WSF A;  4QXA B;  4CSQ A;  3F5R A;  3D8D A;  3WA0 A;  3ODW A;  2MKR A;  1XCG A;  3CIK A;  2Y8G A;  4PQ0 A;  2D9X A;  3SV1 A;  1QC6 A;  3AU5 A;  1P3R A;  2V76 A;  2ROV A;  2RSG A;  2J0M A;  5D3V A;  1OY2 A;  3QIJ A;  3ZVR A;  4IOY X;  2DHI A;  2R09 A;  1E5W A;  2YVC A;  2GCJ A;  2LUL A;  3F0W A;  3X23 A;  1SGH A;  1V89 A;  3TCA A;  2JP2 A;  3HIE A;  4KAX B;  5KQ1 A;  1ZC4 B;  5J3T A;  4DBB A;  1WI1 A;  1BTN A;  2ZPY A;  1ISN A;  2Z59 A;  5M4Y B;  2E2X A;  2LOX A;  3CXB B;  4MY6 A;  5HE3 A;  3V5W A;  3RCP A;  4D6W A;  2Q13 A;  2COA A;  4K17 A;  4GMX B;  2NZ8 B;  2N0Y A;  1B55 A;  1K5G B;  4HDQ A;  5L81 A;  4HB4 B;  5C79 A;  1U2B A;  1SHC A;  2YF0 A;  1OQN A;  1Y19 B;  2LG1 A;  3U12 A;  1Q67 A;  3HK0 A;  2K8E A;  1GC6 A;  3G9W A;  1BAK A;  5CLQ B;  2UZR A;  5C16 A;  2R0D A;  2D4Q A;  1FHW A;  3SO6 A;  1MIX A;  1J19 A;  1MK7 B;  3NWA A;  3ULC A;  1GG3 A;  4Z2M B;  4Y94 A;  4YL8 A;  2W2X D;  2EMS A;  5HE2 A;  3TW1 A;  4KHA A;  4EMO A;  2BCJ A;  3P7Z A;  2X18 A;  1PFJ A;  1ZSQ A;  5JHG A;  5D3W A;  3NWD A;  2I5F A;  2M38 A;  1UNP A;  1UPR A;  2GUM A;  2D9W A;  2D9V A;  2K2U A;  2CRF A;  3ODO A;  1WG7 A;  3B77 A;  2QKL A;  1NTV A;  1V88 A;  3KY9 A;  1T77 A;  2KGX B;  2ROZ B;  5CLL B;  5DH9 B;  1ZVR A;  5HE0 A;  2J0K A;  3SUZ A;  2FJU B;  2CAY A;  5DI9 B;  2W2X C;  1H4R A;  5C5B A;  4KVG B;  2Z13 A;  1LB1 A;  1X05 A;  3OAN A;  2YSZ A;  5FI1 A;  1KZ7 A;  1EVH A;  4D0N B;  3PVL A;  4K81 A;  5EFX A;  3TO1 A;  2L1C A;  1ZYI A;  1U5E A;  4CYE A;  4HAU B;  1U27 A;  1H10 A;  1U5D A;  4TYZ A;  4ZRI A;  1ZM0 A;  1AQC A;  2GS0 A;  4BBK A;  5C5B B;  1K5D B;  4PNK A;  4CHM A;  2VKI A;  3PVU A;  3KSY A;  5JHH A;  1TJ6 A;  3VOQ A;  3A98 B;  4QJ5 B;  2N23 A;  2RLO A;  1UNQ A;  1KZG A;  4HAV B;  4YON A;  1DBH A;  1V5U A;  3MDB C;  2CY5 A;  4C0A A;  5I2S A;  3ODX A;  2K00 A;  2H7E A;  2YS1 A;  3ML4 A; 
#chains in the Genus database with same CATH homology
 4F7H A;  1OMW A;  3SYX A;  2COC A;  1W1G A;  5C6R A;  2KUP A;  1XX0 A;  1EGX A;  2GJY A;  1DYN A;  3DXD A;  3M1I B;  5JLJ B;  3U8Z A;  1RRP B;  4K2O A;  5D27 A;  2D2Q A;  1MPH A;  2W2W A;  1XOD A;  2EC1 A;  4A6H A;  2H7D A;  4NY0 A;  1N3H A;  1X11 A;  2DKP A;  1J0W A;  3U7D A;  5JP4 A;  3PZD A;  1WVH A;  4HAT B;  1V61 A;  5DHA B;  4MT7 A;  2ELA A;  3DXC A;  5LOP B;  3GYP A;  1UPQ A;  4WVF B;  2Z0Q A;  5D3Y A;  4GXB A;  2RNR B;  2RGN B;  1FHX A;  1UEF A;  2DA0 A;  2COF A;  4HAW B;  1FGY A;  4HHV A;  2XQN M;  4HB2 B;  3NSU A;  3ULB A;  3FM8 C;  3D8F A;  3PG7 A;  2K2J A;  4DXA B;  1RJ2 A;  4B6H A;  1DRO A;  4HAY B;  2D9Y A;  3VIA A;  2MFQ A;  3PSC A;  2GCL A;  2DKQ A;  2EMT A;  2I5C A;  1NI2 A;  1MK9 B;  2RVB B;  3HQC A;  4KHO A;  2KCJ A;  3A8P A;  4A6F A;  3PEG A;  2MWN B;  2LYD A;  3MPX A;  1EAZ A;  3PVW A;  3IVF A;  2Y8F A;  5DIF B;  1W1D A;  3GYO A;  3O96 A;  4DX9 0;  2DN6 A;  1P5T A;  1X1F A;  1FAO A;  1EF1 A;  2AEH A;  4HAX B;  2DHJ A;  4DX8 A;  2YT0 A;  1BWN A;  3HW2 B;  4A6F B;  2J0J A;  1NU2 A;  1TXD A;  2OQB A;  2P0F A;  4A6K A;  1WJ1 A;  2J59 M;  3FEH A;  2MDX A;  2DFK A;  1WGU A;  2UZS A;  3KRX A;  4ZRK A;  1QQG A;  2HTH B;  1XD4 A;  2LKO A;  4EKU A;  2FJL A;  4ZRJ A;  1FB8 A;  4IFS A;  1NTY A;  3D8E A;  5J3Q A;  1X86 A;  5FI0 A;  2ELB A;  1FGZ A;  2P8V A;  4GN1 A;  1LW3 A;  2ADZ A;  4H8S A;  5KCV A;  3QWM A;  2CY4 A;  4MK0 A;  3WYF B;  4A5K A;  3P6A A;  1MAI A;  2AL6 A;  3AJ4 A;  2IYB A;  2D10 A;  1P6S A;  4GZU A;  2IFS A;  1BTK A;  1X1G A;  3BJI A;  5LON B;  4WJ7 A;  1PLS A;  4IAP A;  1M7R A;  1U5F A;  4Z2N A;  2DX1 A;  5DHF B;  2D9Z A;  2P0H A;  1XKE A;  2QKM A;  5GOW B;  1FHO A;  4TKN A;  2I1J A;  4XWX A;  1I7A A;  5J3Y A;  2YS5 A;  2DHK A;  4GMV A;  1FOE A;  2RUK B;  2YRY A;  4HDO A;  1DDV A;  1Y5O A;  1DDW A;  5D3X A;  1MKE A;  2HE7 A;  1Z87 A;  3LJU X;  3SNH A;  2COD A;  2EJ8 A;  2PZ1 A;  3KZ1 A;  4CHJ A;  2I1K A;  4F7U P;  1I2H A;  1KI1 B;  2DYN A;  2DX5 A;  3FSS A;  3BIN A;  3PP2 A;  2NMB A;  2G35 A;  1TQZ A;  2DTC A;  3QBV B;  2YT1 A;  3T06 A;  2VSZ A;  3TVV A;  2D11 A;  3N7C A;  1MIZ B;  2YS3 A;  2DYQ A;  2L2I A;  4HB3 B;  2Z0O A;  1V5P A;  1UNR A;  4HB0 B;  3UZT A;  1PMS A;  4L6E A;  1ZC3 B;  2DLW A;  3KRW A;  1V5M A;  2P0D A;  4P7I A;  1U5G A;  5KQ4 A;  1W1H A;  3DXE A;  2Z0P A;  2M14 A;  3TFM A;  2UVM A;  2Y7B A;  3ZDT A;  1U29 A;  1IRS A;  1XR0 B;  1DDM A;  4GPT B;  1WJM A;  4KHB B;  4K2P A;  3A8Q A;  2VRW B;  4HAZ B;  1GC7 A;  2LOZ A;  5HE1 A;  3AU4 A;  1M7E A;  4EJN A;  1WGQ A;  1AWE A;  4F7G A;  4NSW A;  2OTX A;  4WSF A;  3F5R A;  3D8D A;  3WA0 A;  3ODW A;  2MKR A;  1XCG A;  3CIK A;  2Y8G A;  4PQ0 A;  2D9X A;  3SV1 A;  1QC6 A;  3AU5 A;  1P3R A;  2V76 A;  2ROV A;  2RSG A;  2J0M A;  5D3V A;  1OY2 A;  3QIJ A;  3ZVR A;  4IOY X;  2DHI A;  2R09 A;  1E5W A;  2YVC A;  2GCJ A;  2LUL A;  3F0W A;  3X23 A;  1SGH A;  1V89 A;  3TCA A;  2JP2 A;  4KAX B;  5KQ1 A;  1ZC4 B;  5J3T A;  4DBB A;  1WI1 A;  1BTN A;  2ZPY A;  1ISN A;  2E2X A;  2LOX A;  3CXB B;  4MY6 A;  5HE3 A;  3V5W A;  3RCP A;  2Q13 A;  2COA A;  4K17 A;  4GMX B;  2NZ8 B;  2N0Y A;  1B55 A;  1K5G B;  4HDQ A;  5L81 A;  4HB4 B;  5C79 A;  1U2B A;  1SHC A;  2YF0 A;  1OQN A;  1Y19 B;  2LG1 A;  1Q67 A;  3HK0 A;  1GC6 A;  3G9W A;  1BAK A;  5CLQ B;  2UZR A;  5C16 A;  2R0D A;  2D4Q A;  1FHW A;  3SO6 A;  1MIX A;  1J19 A;  1MK7 B;  3ULC A;  1GG3 A;  4Z2M B;  4Y94 A;  4YL8 A;  2W2X D;  2EMS A;  5HE2 A;  3TW1 A;  4KHA A;  4EMO A;  2BCJ A;  3P7Z A;  2X18 A;  1PFJ A;  1ZSQ A;  5JHG A;  5D3W A;  2I5F A;  2M38 A;  1UNP A;  1UPR A;  2D9W A;  2D9V A;  2K2U A;  2CRF A;  3ODO A;  1WG7 A;  2QKL A;  1NTV A;  1V88 A;  3KY9 A;  2KGX B;  2ROZ B;  5CLL B;  5DH9 B;  1ZVR A;  5HE0 A;  2J0K A;  3SUZ A;  5DI9 B;  2CAY A;  2W2X C;  1H4R A;  5C5B A;  4KVG B;  1LB1 A;  1X05 A;  3OAN A;  2YSZ A;  5FI1 A;  1KZ7 A;  1EVH A;  4D0N B;  3PVL A;  4K81 A;  5EFX A;  3TO1 A;  2L1C A;  1U5E A;  4CYE A;  4HAU B;  1U27 A;  1H10 A;  1U5D A;  4TYZ A;  4ZRI A;  1ZM0 A;  1AQC A;  2GS0 A;  4BBK A;  5C5B B;  1K5D B;  4PNK A;  4CHM A;  2VKI A;  3PVU A;  3KSY A;  5JHH A;  1TJ6 A;  3VOQ A;  3A98 B;  2N23 A;  2RLO A;  1UNQ A;  1KZG A;  4HAV B;  4YON A;  1DBH A;  1V5U A;  3MDB C;  2CY5 A;  4C0A A;  3ODX A;  2K00 A;  2H7E A;  2YS1 A;  3ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...