2OQBA

Crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
GSHMATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase,gene regulation
molecule keywords Histone-arginine methyltransferase CARM1
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2oqbA00
2COCA 5C5BA 1SHCA 1U5GA 1OY2A 1UPRA 4ZRIA 2DHJA 2I1KA 1DDVA 2YT0A 2VSZA 5L81A 4PQ0A 1DDWA 4F7UP 2AL6A 2W2XC 1FHOA 1QQGA 1ZC4B 1RJ2A 3HK0A 2K2UA 2V76A 2M14A 3PVWA 2MDXA 3KZ1A 4A6HA 2DX5A 5CLLB 5D3VA 1U29A 3PSCA 1XCGA 2H7DA 3D8EA 3ZVRA 2R0DA 2D9WA 2N0YA 3ODWA 1Y19B 1TXDA 2KUPA 2X18A 2COAA 2HTHB 1WJ1A 3FSSA 2YF0A 5JHHA 4B6HA 4BBKA 3U8ZA 1GC6A 2L2IA 2IYBA 2Z0PA 1AQCA 2GCJA 1K5DB 2CRFA 2DX1A 1V5MA 3AU4A 5JP4A 2UZSA 1NU2A 1UNPA 1KI1B 1FAOA 1AWEA 3QIJA 3F5RA 3SNHA 3CXBB 1J0WA 1UPQA 2YT1A 2NMBA 5D27A 4Z2MB 2J0JA 4D0NB 1DBHA 1MK7B 2D9XA 4HAZB 4GZUA 4DBBA 2KGXB 3SUZA 2BCJA 2HE7A 2MWNB 3AU5A 2G35A 3BJIA 2RUKB 5J3YA 2CAYA 2NZ8B 2DTCA 3AJ4A 3CIKA 2Z0OA 5LONB 1BWNA 2VRWB 2Z0QA 1X86A 4DX90 4DXAB 2M38A 4HB3B 1LB1A 2D10A 2YS1A 3NSUA 3G9WA 1XKEA 5HE1A 1GG3A 2LOXA 4HAYB 1FB8A 4KVGB 5D3XA 3ZDTA 5GOWB 2RSGA 1XR0B 2UZRA 4GN1A 5KCVA 2I5CA 3PVUA 4HB0B 2D11A 4HB4B 1U5EA 1NTYA 1UNQA 1EGXA 3ML4A 4C0AA 4HATB 1MPHA 3IVFA 3KSYA 1DROA 1TQZA 1U27A 5J3QA 2CODA 1FOEA 1V5PA 2LOZA 3DXEA 3A98B 1B55A 2ELAA 2W2XD 1I2HA 3OANA 3SO6A 4A6FA 2D9ZA 2MFQA 4HAUB 1J19A 2OTXA 4K81A 3M1IB 1N3HA 2LG1A 1ZSQA 4KHAA 2J59M 1Y5OA 1E5WA 5JHGA 1TJ6A 2EMTA 1DYNA 2FJLA 4IOYX 5CLQB 1M7EA 3ODOA 1EAZA 4IAPA 3QWMA 1U5FA 4P7IA 4NSWA 4Z2NA 1X1GA 4HAVB 1V88A 4HAWB 3TCAA 4XWXA 1RRPB 2PZ1A 2ELBA 3TW1A 1WGQA 4F7HA 1FHWA 5DH9B 1MIZB 1W1HA 2GCLA 1ZM0A 2W2WA 4YL8A 2D2QA 3FM8C 4NY0A 1V5UA 4EMOA 2KCJA 1XODA 2DA0A 2YS5A 2RVBB 2EMSA 1DDMA 4K2PA 5C79A 2P0FA 2UVMA 4WSFA 3TO1A 4L6EA 4IFSA 1U2BA 4K17A 4GMXB 3O96A 1V89A 3F0WA 4H8SA 3DXCA 5J3TA 4DX8A 4GXBA 4KAXB 1FGZA 2J0MA 3PVLA 3BINA 2RGNB 1UEFA 1BTNA 1W1DA 3HQCA 1WGUA 1LW3A 3QBVB 1P3RA 3PEGA 4HHVA 3VOQA 4WJ7A 2LYDA 1WVHA 3P6AA 1MIXA 1W1GA 2YS3A 3TVVA 2EC1A 1NTVA 1UNRA 3PP2A 1X05A 3N7CA 2H7EA 2ZPYA 3RCPA 2YSZA 4YONA 3KRXA 1BAKA 4HDQA 3LJUX 1QC6A 2XQNM 5KQ1A 5DHFB 5C5BB 4PNKA 2ROZB 3GYOA 3ODXA 2VKIA 5DHAB 2E2XA 2DYNA 5FI0A 4A6KA 2RLOA 3MDBC 2EJ8A 2DKQA 2D4QA 1X11A 3U7DA 3D8FA 3DXDA 2YVCA 1OMWA 2DFKA 4F7GA 5LOPB 4GMVA 2GJYA 2N23A 3PG7A 1GC7A 3SV1A 5EFXA 2R09A 1XX0A 2Y7BA 4HAXB 2I1JA 3SYXA 1EF1A 1XD4A 2IFSA 1P5TA 3HW2B 2QKLA 2COFA 4TKNA 2K2JA 1WJMA 2GS0A 1MKEA 1ISNA 4WVFB 2QKMA 3VIAA 5HE3A 5HE2A 2AEHA 2DN6A 4ZRKA 4KHBB 3D8DA 3KY9A 1KZ7A 1PMSA 2P0HA 2DHIA 2YRYA 2LULA 4KHOA 3X23A 5C6RA 2Y8GA 1V61A 2L1CA 2ROVA 5D3YA 1FHXA 4HDOA 2P8VA 2JP2A 3ULCA 3KRWA 1ZVRA 2K00A 3FEHA 5C16A 1Z87A 4Y94A 5HE0A 3T06A 1Q67A 2CY4A 5KQ4A 1FGYA 4EKUA 1X1FA 1M7RA 1IRSA 1SGHA 2DLWA 1EVHA 4CHJA 3A8QA 4EJNA 2Y8FA 3WA0A 1P6SA 2I5FA 5JLJB 2D9YA 3V5WA 1MK9B 4MT7A 3PZDA 4MK0A 1I7AA 3MPXA 1PFJA 2LKOA 2P0DA 2D9VA 1BTKA 1K5GB 2MKRA 3WYFB 2DKPA 4GPTB 1KZGA 3GYPA 1OQNA 4A5KA 2OQBA 4MY6A 3TFMA 4CYEA 1H10A 1U5DA 5DI9B 2ADZA 1MAIA 3UZTA 2DHKA 4ZRJA 4CHMA 5DIFB 1WG7A 5FI1A 3ULBA 1NI2A 2Q13A 4TYZA 2J0KA 1PLSA 4A6FB 5D3WA 2DYQA 3P7ZA 4K2OA 3A8PA 2CY5A 1WI1A 1ZC3B 1H4RA 4HB2B 2RNRB
chains in the Genus database with same CATH superfamily
2COCA 5C5BA 1SHCA 1U5GA 1OY2A 1UPRA 4ZRIA 2DHJA 2I1KA 1DDVA 5I2MA 2RRFA 2YT0A 2YT2A 2VSZA 3HIEA 5L81A 4PQ0A 1DDWA 4KHBA 4F7UP 2AL6A 2W2XC 1FHOA 1QQGA 1ZC4B 4GOUA 1RJ2A 4QJ3B 3HK0A 2K2UA 2V76A 4L1RA 2M14A 3PVWA 2MDXA 3KZ1A 4OT1A 4A6HA 2DX5A 5CLLB 5D3VA 1U29A 1T77A 3PSCA 1XCGA 2H7DA 3D8EA 3ZVRA 2R0DA 2K49A 2D9WA 2N0YA 3ODWA 1Y19B 1TXDA 2KUPA 2X18A 2COAA 2HTHB 1WJ1A 3FSSA 2YF0A 5JHHA 4B6HA 4BBKA 3U8ZA 1GC6A 2L2IA 2IYBA 2Z0PA 1AQCA 2GCJA 1K5DB 2CRFA 2DX1A 2Z14A 1V5MA 3AU4A 5JP4A 2UZSA 1NU2A 1UNPA 1KI1B 1FAOA 1AWEA 3QIJA 3F5RA 3SNHA 2KUQA 3CXBB 1J0WA 1UPQA 2YT1A 2NMBA 5D27A 4Z2MB 2J0JA 4D0NB 1DBHA 1MK7B 2D9XA 4HAZB 4GZUA 4DBBA 2K8EA 2KGXB 3SUZA 2BCJA 2HE7A 2MWNB 3HSAA 3AU5A 2G35A 2GUMA 3BJIA 2RUKB 5J3YA 2CAYA 2NZ8B 2DTCA 3AJ4A 3CIKA 2Z0OA 5LONB 1BWNA 2VRWB 2Z0QA 1X86A 2ZKMX 4DX90 4DXAB 2M38A 4HB3B 1LB1A 2D10A 2YS1A 3NSUA 3G9WA 1XKEA 4CSQA 5HE1A 1GG3A 2LOXA 4HAYB 1FB8A 4KVGB 5D3XA 3ZDTA 5GOWB 2RSGA 1XR0B 2UZRA 4GN1A 5KCVA 2I5CA 3PVUA 4HB0B 4QXAB 2D11A 4HB4B 1U5EA 1MI1A 1NTYA 1UNQA 1EGXA 3ML4A 4C0AA 4HATB 1MPHA 3IVFA 3KSYA 1DROA 1TQZA 1U27A 5J3QA 2CODA 1FOEA 1V5PA 2LOZA 3DXEA 3A98B 1B55A 2ELAA 2W2XD 1I2HA 3B77A 3OANA 3SO6A 4A6FA 2D9ZA 3NWDA 2MFQA 2OTXA 1J19A 4HAUB 4K81A 3M1IB 1N3HA 2Z4DA 2LG1A 1ZSQA 4KHAA 1ZYIA 2J59M 1Y5OA 1E5WA 5JHGA 1TJ6A 2EMTA 1DYNA 2FJLA 4IOYX 5CLQB 1M7EA 3ODOA 1EAZA 4IAPA 3QWMA 1U5FA 4P7IA 4NSWA 4Z2NA 1X1GA 4HAVB 1V88A 4HAWB 3TCAA 4XWXA 1RRPB 2PZ1A 4OSNA 2ELBA 3TW1A 1WGQA 4F7HA 1FHWA 5DH9B 1MIZB 1W1HA 2GCLA 1ZM0A 2W2WA 3NWAA 4YL8A 2D2QA 3FM8C 4NY0A 1V5UA 4EMOA 2KCJA 1XODA 2DA0A 2YS5A 2RVBB 2EMSA 1DDMA 4K2PA 2FJUB 5C79A 2P0FA 2UVMA 4HSIA 4WSFA 3TO1A 4L6EA 4IFSA 1U2BA 4K17A 4GMXB 3O96A 4QJ5B 1V89A 3F0WA 4H8SA 3DXCA 3DCXA 5J3TA 4DX8A 4GXBA 4KAXB 1FGZA 2J0MA 3PVLA 3BINA 2RGNB 1UEFA 1BTNA 1W1DA 3A58A 3HQCA 1WGUA 4DIXA 1LW3A 3QBVB 1P3RA 3PEGA 4HHVA 3VOQA 4WJ7A 5IRSA 2LYDA 1WVHA 3P6AA 1MIXA 1W1GA 2YS3A 3TVVA 2EC1A 1NTVA 1UNRA 2KIEA 3PP2A 1X05A 3N7CA 2H7EA 2Z13A 2ZPYA 3RCPA 2YSZA 2KIGA 4YONA 3KRXA 1BAKA 4HDQA 3LJUX 1QC6A 2XQNM 5KQ1A 5DHFB 5C5BB 4PNKA 2ROZB 3GYOA 3ODXA 2VKIA 5DHAB 2E2XA 2DYNA 5FI0A 4A6KA 2RLOA 3MDBC 2EJ8A 2DKQA 2D4QA 1X11A 3U7DA 3D8FA 3DXDA 2YVCA 1OMWA 2DFKA 4F7GA 5LOPB 4GMVA 2GJYA 2N23A 3PG7A 1GC7A 2NBVA 3SV1A 5EFXA 2R09A 1XX0A 2Y7BA 4HAXB 2I1JA 5LG4B 3SYXA 1EF1A 1XD4A 2IFSA 1P5TA 3HW2B 2QKLA 2COFA 3FVCA 4TKNA 2K2JA 1WJMA 2GS0A 1MKEA 1ISNA 4WVFB 2QKMA 3VIAA 5HE3A 5HE2A 2AEHA 2DN6A 4ZRKA 4KHBB 3D8DA 3KY9A 1KZ7A 1PMSA 3U12A 2P0HA 3OHMB 2DHIA 2YRYA 2LULA 4KHOA 3X23A 5C6RA 2Y8GA 1V61A 2L1CA 2ROVA 5D3YA 1FHXA 4HDOA 2P8VA 2JP2A 3ULCA 3KRWA 1ZVRA 2K00A 3FEHA 5C16A 1Z87A 2R2YA 4Y94A 5HE0A 3T06A 1Q67A 2CY4A 5KQ4A 1FGYA 3NWFA 4EKUA 1X1FA 4QJ4B 1M7RA 1IRSA 4GNKB 1SGHA 2DLWA 1EVHA 3NW8A 4CHJA 3A8QA 4EJNA 2Y8FA 3WA0A 1P6SA 2Z59A 2I5FA 5JLJB 2D9YA 3V5WA 1MK9B 4MT7A 4D6WA 3PZDA 4MK0A 1I7AA 3MPXA 1PFJA 2LKOA 2P0DA 2D9VA 1BTKA 1K5GB 2MKRA 5M4YB 3WYFB 2DKPA 4GPTB 1KZGA 3GYPA 1OQNA 4A5KA 2OQBA 4MY6A 3TFMA 4CYEA 1H10A 1U5DA 5DI9B 2ADZA 1MAIA 3UZTA 2DHKA 4ZRJA 4CHMA 5DIFB 1WG7A 5FI1A 3ULBA 1NI2A 2Q13A 4TYZA 2J0KA 2KR0A 1PLSA 4A6FB 5D3WA 2DYQA 3P7ZA 5I2SA 4K2OA 3A8PA 2CY5A 1WI1A 1ZC3B 1H4RA 4HB2B 2RNRB
chains in the Genus database with same CATH topology
2COCA 5C5BA 1SHCA 1U5GA 1OY2A 1UPRA 4ZRIA 2DHJA 2I1KA 1DDVA 2YT0A 2VSZA 5L81A 4PQ0A 1DDWA 4F7UP 2AL6A 2W2XC 1FHOA 1QQGA 1ZC4B 1RJ2A 3HK0A 2K2UA 2V76A 2M14A 3PVWA 2MDXA 3KZ1A 4A6HA 2DX5A 5CLLB 5D3VA 1U29A 3PSCA 1XCGA 2H7DA 3D8EA 3ZVRA 2R0DA 2D9WA 2N0YA 3ODWA 1Y19B 1TXDA 2KUPA 2X18A 2COAA 2HTHB 1WJ1A 3FSSA 2YF0A 5JHHA 4B6HA 4BBKA 3U8ZA 1GC6A 2L2IA 2IYBA 2Z0PA 1AQCA 2GCJA 1K5DB 2CRFA 2DX1A 1V5MA 3AU4A 5JP4A 2UZSA 1NU2A 1UNPA 1KI1B 1FAOA 1AWEA 3QIJA 3F5RA 3SNHA 3CXBB 1J0WA 1UPQA 2YT1A 2NMBA 5D27A 4Z2MB 2J0JA 4D0NB 1DBHA 1MK7B 2D9XA 4HAZB 4GZUA 4DBBA 2KGXB 3SUZA 2BCJA 2HE7A 2MWNB 3AU5A 2G35A 3BJIA 2RUKB 5J3YA 2CAYA 2NZ8B 2DTCA 3AJ4A 3CIKA 2Z0OA 5LONB 1BWNA 2VRWB 2Z0QA 1X86A 4DX90 4DXAB 2M38A 4HB3B 1LB1A 2D10A 2YS1A 3NSUA 3G9WA 1XKEA 5HE1A 1GG3A 2LOXA 4HAYB 1FB8A 4KVGB 5D3XA 3ZDTA 5GOWB 2RSGA 1XR0B 2UZRA 4GN1A 5KCVA 2I5CA 3PVUA 4HB0B 2D11A 4HB4B 1U5EA 1NTYA 1UNQA 1EGXA 3ML4A 4C0AA 4HATB 1MPHA 3IVFA 3KSYA 1DROA 1TQZA 1U27A 5J3QA 2CODA 1FOEA 1V5PA 2LOZA 3DXEA 3A98B 1B55A 2ELAA 2W2XD 1I2HA 3OANA 3SO6A 4A6FA 2D9ZA 2MFQA 4HAUB 1J19A 2OTXA 4K81A 3M1IB 1N3HA 2LG1A 1ZSQA 4KHAA 2J59M 1Y5OA 1E5WA 5JHGA 1TJ6A 2EMTA 1DYNA 2FJLA 4IOYX 5CLQB 1M7EA 3ODOA 1EAZA 4IAPA 3QWMA 1U5FA 4P7IA 4NSWA 4Z2NA 1X1GA 4HAVB 1V88A 4HAWB 3TCAA 4XWXA 1RRPB 2PZ1A 2ELBA 3TW1A 1WGQA 4F7HA 1FHWA 5DH9B 1MIZB 1W1HA 2GCLA 1ZM0A 2W2WA 4YL8A 2D2QA 3FM8C 4NY0A 1V5UA 4EMOA 2KCJA 1XODA 2DA0A 2YS5A 2RVBB 2EMSA 1DDMA 4K2PA 5C79A 2P0FA 2UVMA 4WSFA 3TO1A 4L6EA 4IFSA 1U2BA 4K17A 4GMXB 3O96A 1V89A 3F0WA 4H8SA 3DXCA 5J3TA 4DX8A 4GXBA 4KAXB 1FGZA 2J0MA 3PVLA 3BINA 2RGNB 1UEFA 1BTNA 1W1DA 3HQCA 1WGUA 1LW3A 3QBVB 1P3RA 3PEGA 4HHVA 3VOQA 4WJ7A 2LYDA 1WVHA 3P6AA 1MIXA 1W1GA 2YS3A 3TVVA 2EC1A 1NTVA 1UNRA 3PP2A 1X05A 3N7CA 2H7EA 2ZPYA 3RCPA 2YSZA 4YONA 3KRXA 1BAKA 4HDQA 3LJUX 1QC6A 2XQNM 5KQ1A 5DHFB 5C5BB 4PNKA 2ROZB 3GYOA 3ODXA 2VKIA 5DHAB 2E2XA 2DYNA 5FI0A 4A6KA 2RLOA 3MDBC 2EJ8A 2DKQA 2D4QA 1X11A 3U7DA 3D8FA 3DXDA 2YVCA 1OMWA 2DFKA 4F7GA 5LOPB 4GMVA 2GJYA 2N23A 3PG7A 1GC7A 3SV1A 5EFXA 2R09A 1XX0A 2Y7BA 4HAXB 2I1JA 3SYXA 1EF1A 1XD4A 2IFSA 1P5TA 3HW2B 2QKLA 2COFA 4TKNA 2K2JA 1WJMA 2GS0A 1MKEA 1ISNA 4WVFB 2QKMA 3VIAA 5HE3A 5HE2A 2AEHA 2DN6A 4ZRKA 4KHBB 3D8DA 3KY9A 1KZ7A 1PMSA 2P0HA 2DHIA 2YRYA 2LULA 4KHOA 3X23A 5C6RA 2Y8GA 1V61A 2L1CA 2ROVA 5D3YA 1FHXA 4HDOA 2P8VA 2JP2A 3ULCA 3KRWA 1ZVRA 2K00A 3FEHA 5C16A 1Z87A 4Y94A 5HE0A 3T06A 1Q67A 2CY4A 5KQ4A 1FGYA 4EKUA 1X1FA 1M7RA 1IRSA 1SGHA 2DLWA 1EVHA 4CHJA 3A8QA 4EJNA 2Y8FA 3WA0A 1P6SA 2I5FA 5JLJB 2D9YA 3V5WA 1MK9B 4MT7A 3PZDA 4MK0A 1I7AA 3MPXA 1PFJA 2LKOA 2P0DA 2D9VA 1BTKA 1K5GB 2MKRA 3WYFB 2DKPA 4GPTB 1KZGA 3GYPA 1OQNA 4A5KA 2OQBA 4MY6A 3TFMA 4CYEA 1H10A 1U5DA 5DI9B 2ADZA 1MAIA 3UZTA 2DHKA 4ZRJA 4CHMA 5DIFB 1WG7A 5FI1A 3ULBA 1NI2A 2Q13A 4TYZA 2J0KA 1PLSA 4A6FB 5D3WA 2DYQA 3P7ZA 4K2OA 3A8PA 2CY5A 1WI1A 1ZC3B 1H4RA 4HB2B 2RNRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  5C5B A;  1SHC A;  1U5G A;  1OY2 A;  1UPR A;  4ZRI A;  2DHJ A;  2I1K A;  1DDV A;  2YT0 A;  2VSZ A;  5L81 A;  4PQ0 A;  1DDW A;  4F7U P;  2AL6 A;  2W2X C;  1FHO A;  1QQG A;  1ZC4 B;  1RJ2 A;  3HK0 A;  2K2U A;  2V76 A;  2M14 A;  3PVW A;  2MDX A;  3KZ1 A;  4A6H A;  2DX5 A;  5CLL B;  5D3V A;  1U29 A;  3PSC A;  1XCG A;  2H7D A;  3D8E A;  3ZVR A;  2R0D A;  2D9W A;  2N0Y A;  3ODW A;  1Y19 B;  1TXD A;  2KUP A;  2X18 A;  2COA A;  2HTH B;  1WJ1 A;  3FSS A;  2YF0 A;  5JHH A;  4B6H A;  4BBK A;  3U8Z A;  1GC6 A;  2L2I A;  2IYB A;  2Z0P A;  1AQC A;  2GCJ A;  1K5D B;  2CRF A;  2DX1 A;  1V5M A;  3AU4 A;  5JP4 A;  2UZS A;  1NU2 A;  1UNP A;  1KI1 B;  1FAO A;  1AWE A;  3QIJ A;  3F5R A;  3SNH A;  3CXB B;  1J0W A;  1UPQ A;  2YT1 A;  2NMB A;  5D27 A;  4Z2M B;  2J0J A;  4D0N B;  1DBH A;  1MK7 B;  2D9X A;  4HAZ B;  4GZU A;  4DBB A;  2KGX B;  3SUZ A;  2BCJ A;  2HE7 A;  2MWN B;  3AU5 A;  2G35 A;  3BJI A;  2RUK B;  5J3Y A;  2CAY A;  2NZ8 B;  2DTC A;  3AJ4 A;  3CIK A;  2Z0O A;  5LON B;  1BWN A;  2VRW B;  2Z0Q A;  1X86 A;  4DX9 0;  4DXA B;  2M38 A;  4HB3 B;  1LB1 A;  2D10 A;  2YS1 A;  3NSU A;  3G9W A;  1XKE A;  5HE1 A;  1GG3 A;  2LOX A;  4HAY B;  1FB8 A;  4KVG B;  5D3X A;  3ZDT A;  5GOW B;  2RSG A;  1XR0 B;  2UZR A;  4GN1 A;  5KCV A;  2I5C A;  3PVU A;  4HB0 B;  2D11 A;  4HB4 B;  1U5E A;  1NTY A;  1UNQ A;  1EGX A;  3ML4 A;  4C0A A;  4HAT B;  1MPH A;  3IVF A;  3KSY A;  1DRO A;  1TQZ A;  1U27 A;  5J3Q A;  2COD A;  1FOE A;  1V5P A;  2LOZ A;  3DXE A;  3A98 B;  1B55 A;  2ELA A;  2W2X D;  1I2H A;  3OAN A;  3SO6 A;  4A6F A;  2D9Z A;  2MFQ A;  4HAU B;  1J19 A;  2OTX A;  4K81 A;  3M1I B;  1N3H A;  2LG1 A;  1ZSQ A;  4KHA A;  2J59 M;  1Y5O A;  1E5W A;  5JHG A;  1TJ6 A;  2EMT A;  1DYN A;  2FJL A;  4IOY X;  5CLQ B;  1M7E A;  3ODO A;  1EAZ A;  4IAP A;  3QWM A;  1U5F A;  4P7I A;  4NSW A;  4Z2N A;  1X1G A;  4HAV B;  1V88 A;  4HAW B;  3TCA A;  4XWX A;  1RRP B;  2PZ1 A;  2ELB A;  3TW1 A;  1WGQ A;  4F7H A;  1FHW A;  5DH9 B;  1MIZ B;  1W1H A;  2GCL A;  1ZM0 A;  2W2W A;  4YL8 A;  2D2Q A;  3FM8 C;  4NY0 A;  1V5U A;  4EMO A;  2KCJ A;  1XOD A;  2DA0 A;  2YS5 A;  2RVB B;  2EMS A;  1DDM A;  4K2P A;  5C79 A;  2P0F A;  2UVM A;  4WSF A;  3TO1 A;  4L6E A;  4IFS A;  1U2B A;  4K17 A;  4GMX B;  3O96 A;  1V89 A;  3F0W A;  4H8S A;  3DXC A;  5J3T A;  4DX8 A;  4GXB A;  4KAX B;  1FGZ A;  2J0M A;  3PVL A;  3BIN A;  2RGN B;  1UEF A;  1BTN A;  1W1D A;  3HQC A;  1WGU A;  1LW3 A;  3QBV B;  1P3R A;  3PEG A;  4HHV A;  3VOQ A;  4WJ7 A;  2LYD A;  1WVH A;  3P6A A;  1MIX A;  1W1G A;  2YS3 A;  3TVV A;  2EC1 A;  1NTV A;  1UNR A;  3PP2 A;  1X05 A;  3N7C A;  2H7E A;  2ZPY A;  3RCP A;  2YSZ A;  4YON A;  3KRX A;  1BAK A;  4HDQ A;  3LJU X;  1QC6 A;  2XQN M;  5KQ1 A;  5DHF B;  5C5B B;  4PNK A;  2ROZ B;  3GYO A;  3ODX A;  2VKI A;  5DHA B;  2E2X A;  2DYN A;  5FI0 A;  4A6K A;  2RLO A;  3MDB C;  2EJ8 A;  2DKQ A;  2D4Q A;  1X11 A;  3U7D A;  3D8F A;  3DXD A;  2YVC A;  1OMW A;  2DFK A;  4F7G A;  5LOP B;  4GMV A;  2GJY A;  2N23 A;  3PG7 A;  1GC7 A;  3SV1 A;  5EFX A;  2R09 A;  1XX0 A;  2Y7B A;  4HAX B;  2I1J A;  3SYX A;  1EF1 A;  1XD4 A;  2IFS A;  1P5T A;  3HW2 B;  2QKL A;  2COF A;  4TKN A;  2K2J A;  1WJM A;  2GS0 A;  1MKE A;  1ISN A;  4WVF B;  2QKM A;  3VIA A;  5HE3 A;  5HE2 A;  2AEH A;  2DN6 A;  4ZRK A;  4KHB B;  3D8D A;  3KY9 A;  1KZ7 A;  1PMS A;  2P0H A;  2DHI A;  2YRY A;  2LUL A;  4KHO A;  3X23 A;  5C6R A;  2Y8G A;  1V61 A;  2L1C A;  2ROV A;  5D3Y A;  1FHX A;  4HDO A;  2P8V A;  2JP2 A;  3ULC A;  3KRW A;  1ZVR A;  2K00 A;  3FEH A;  5C16 A;  1Z87 A;  4Y94 A;  5HE0 A;  3T06 A;  1Q67 A;  2CY4 A;  5KQ4 A;  1FGY A;  4EKU A;  1X1F A;  1M7R A;  1IRS A;  1SGH A;  2DLW A;  1EVH A;  4CHJ A;  3A8Q A;  4EJN A;  2Y8F A;  3WA0 A;  1P6S A;  2I5F A;  5JLJ B;  2D9Y A;  3V5W A;  1MK9 B;  4MT7 A;  3PZD A;  4MK0 A;  1I7A A;  3MPX A;  1PFJ A;  2LKO A;  2P0D A;  2D9V A;  1BTK A;  1K5G B;  2MKR A;  3WYF B;  2DKP A;  4GPT B;  1KZG A;  3GYP A;  1OQN A;  4A5K A;  2OQB A;  4MY6 A;  3TFM A;  4CYE A;  1H10 A;  1U5D A;  5DI9 B;  2ADZ A;  1MAI A;  3UZT A;  2DHK A;  4ZRJ A;  4CHM A;  5DIF B;  1WG7 A;  5FI1 A;  3ULB A;  1NI2 A;  2Q13 A;  4TYZ A;  2J0K A;  1PLS A;  4A6F B;  5D3W A;  2DYQ A;  3P7Z A;  4K2O A;  3A8P A;  2CY5 A;  1WI1 A;  1ZC3 B;  1H4R A;  4HB2 B;  2RNR B; 
#chains in the Genus database with same CATH topology
 2COC A;  5C5B A;  1SHC A;  1U5G A;  1OY2 A;  1UPR A;  4ZRI A;  2DHJ A;  2I1K A;  1DDV A;  5I2M A;  2RRF A;  2YT0 A;  2YT2 A;  2VSZ A;  3HIE A;  5L81 A;  4PQ0 A;  1DDW A;  4KHB A;  4F7U P;  2AL6 A;  2W2X C;  1FHO A;  1QQG A;  1ZC4 B;  4GOU A;  1RJ2 A;  4QJ3 B;  3HK0 A;  2K2U A;  2V76 A;  4L1R A;  2M14 A;  3PVW A;  2MDX A;  3KZ1 A;  4OT1 A;  4A6H A;  2DX5 A;  5CLL B;  5D3V A;  1U29 A;  1T77 A;  3PSC A;  1XCG A;  2H7D A;  3D8E A;  3ZVR A;  2R0D A;  2K49 A;  2D9W A;  2N0Y A;  3ODW A;  1Y19 B;  1TXD A;  2KUP A;  2X18 A;  2COA A;  2HTH B;  1WJ1 A;  3FSS A;  2YF0 A;  5JHH A;  4B6H A;  4BBK A;  3U8Z A;  1GC6 A;  2L2I A;  2IYB A;  2Z0P A;  1AQC A;  2GCJ A;  1K5D B;  2CRF A;  2DX1 A;  2Z14 A;  1V5M A;  3AU4 A;  5JP4 A;  2UZS A;  1NU2 A;  1UNP A;  1KI1 B;  1FAO A;  1AWE A;  3QIJ A;  3F5R A;  3SNH A;  2KUQ A;  3CXB B;  1J0W A;  1UPQ A;  2YT1 A;  2NMB A;  5D27 A;  4Z2M B;  2J0J A;  4D0N B;  1DBH A;  1MK7 B;  2D9X A;  4HAZ B;  4GZU A;  4DBB A;  2K8E A;  2KGX B;  3SUZ A;  2BCJ A;  2HE7 A;  2MWN B;  3HSA A;  3AU5 A;  2G35 A;  2GUM A;  3BJI A;  2RUK B;  5J3Y A;  2CAY A;  2NZ8 B;  2DTC A;  3AJ4 A;  3CIK A;  2Z0O A;  5LON B;  1BWN A;  2VRW B;  2Z0Q A;  1X86 A;  2ZKM X;  4DX9 0;  4DXA B;  2M38 A;  4HB3 B;  1LB1 A;  2D10 A;  2YS1 A;  3NSU A;  3G9W A;  1XKE A;  4CSQ A;  5HE1 A;  1GG3 A;  2LOX A;  4HAY B;  1FB8 A;  4KVG B;  5D3X A;  3ZDT A;  5GOW B;  2RSG A;  1XR0 B;  2UZR A;  4GN1 A;  5KCV A;  2I5C A;  3PVU A;  4HB0 B;  4QXA B;  2D11 A;  4HB4 B;  1U5E A;  1MI1 A;  1NTY A;  1UNQ A;  1EGX A;  3ML4 A;  4C0A A;  4HAT B;  1MPH A;  3IVF A;  3KSY A;  1DRO A;  1TQZ A;  1U27 A;  5J3Q A;  2COD A;  1FOE A;  1V5P A;  2LOZ A;  3DXE A;  3A98 B;  1B55 A;  2ELA A;  2W2X D;  1I2H A;  3B77 A;  3OAN A;  3SO6 A;  4A6F A;  2D9Z A;  3NWD A;  2MFQ A;  2OTX A;  1J19 A;  4HAU B;  4K81 A;  3M1I B;  1N3H A;  2Z4D A;  2LG1 A;  1ZSQ A;  4KHA A;  1ZYI A;  2J59 M;  1Y5O A;  1E5W A;  5JHG A;  1TJ6 A;  2EMT A;  1DYN A;  2FJL A;  4IOY X;  5CLQ B;  1M7E A;  3ODO A;  1EAZ A;  4IAP A;  3QWM A;  1U5F A;  4P7I A;  4NSW A;  4Z2N A;  1X1G A;  4HAV B;  1V88 A;  4HAW B;  3TCA A;  4XWX A;  1RRP B;  2PZ1 A;  4OSN A;  2ELB A;  3TW1 A;  1WGQ A;  4F7H A;  1FHW A;  5DH9 B;  1MIZ B;  1W1H A;  2GCL A;  1ZM0 A;  2W2W A;  3NWA A;  4YL8 A;  2D2Q A;  3FM8 C;  4NY0 A;  1V5U A;  4EMO A;  2KCJ A;  1XOD A;  2DA0 A;  2YS5 A;  2RVB B;  2EMS A;  1DDM A;  4K2P A;  2FJU B;  5C79 A;  2P0F A;  2UVM A;  4HSI A;  4WSF A;  3TO1 A;  4L6E A;  4IFS A;  1U2B A;  4K17 A;  4GMX B;  3O96 A;  4QJ5 B;  1V89 A;  3F0W A;  4H8S A;  3DXC A;  3DCX A;  5J3T A;  4DX8 A;  4GXB A;  4KAX B;  1FGZ A;  2J0M A;  3PVL A;  3BIN A;  2RGN B;  1UEF A;  1BTN A;  1W1D A;  3A58 A;  3HQC A;  1WGU A;  4DIX A;  1LW3 A;  3QBV B;  1P3R A;  3PEG A;  4HHV A;  3VOQ A;  4WJ7 A;  5IRS A;  2LYD A;  1WVH A;  3P6A A;  1MIX A;  1W1G A;  2YS3 A;  3TVV A;  2EC1 A;  1NTV A;  1UNR A;  2KIE A;  3PP2 A;  1X05 A;  3N7C A;  2H7E A;  2Z13 A;  2ZPY A;  3RCP A;  2YSZ A;  2KIG A;  4YON A;  3KRX A;  1BAK A;  4HDQ A;  3LJU X;  1QC6 A;  2XQN M;  5KQ1 A;  5DHF B;  5C5B B;  4PNK A;  2ROZ B;  3GYO A;  3ODX A;  2VKI A;  5DHA B;  2E2X A;  2DYN A;  5FI0 A;  4A6K A;  2RLO A;  3MDB C;  2EJ8 A;  2DKQ A;  2D4Q A;  1X11 A;  3U7D A;  3D8F A;  3DXD A;  2YVC A;  1OMW A;  2DFK A;  4F7G A;  5LOP B;  4GMV A;  2GJY A;  2N23 A;  3PG7 A;  1GC7 A;  2NBV A;  3SV1 A;  5EFX A;  2R09 A;  1XX0 A;  2Y7B A;  4HAX B;  2I1J A;  5LG4 B;  3SYX A;  1EF1 A;  1XD4 A;  2IFS A;  1P5T A;  3HW2 B;  2QKL A;  2COF A;  3FVC A;  4TKN A;  2K2J A;  1WJM A;  2GS0 A;  1MKE A;  1ISN A;  4WVF B;  2QKM A;  3VIA A;  5HE3 A;  5HE2 A;  2AEH A;  2DN6 A;  4ZRK A;  4KHB B;  3D8D A;  3KY9 A;  1KZ7 A;  1PMS A;  3U12 A;  2P0H A;  3OHM B;  2DHI A;  2YRY A;  2LUL A;  4KHO A;  3X23 A;  5C6R A;  2Y8G A;  1V61 A;  2L1C A;  2ROV A;  5D3Y A;  1FHX A;  4HDO A;  2P8V A;  2JP2 A;  3ULC A;  3KRW A;  1ZVR A;  2K00 A;  3FEH A;  5C16 A;  1Z87 A;  2R2Y A;  4Y94 A;  5HE0 A;  3T06 A;  1Q67 A;  2CY4 A;  5KQ4 A;  1FGY A;  3NWF A;  4EKU A;  1X1F A;  4QJ4 B;  1M7R A;  1IRS A;  4GNK B;  1SGH A;  2DLW A;  1EVH A;  3NW8 A;  4CHJ A;  3A8Q A;  4EJN A;  2Y8F A;  3WA0 A;  1P6S A;  2Z59 A;  2I5F A;  5JLJ B;  2D9Y A;  3V5W A;  1MK9 B;  4MT7 A;  4D6W A;  3PZD A;  4MK0 A;  1I7A A;  3MPX A;  1PFJ A;  2LKO A;  2P0D A;  2D9V A;  1BTK A;  1K5G B;  2MKR A;  5M4Y B;  3WYF B;  2DKP A;  4GPT B;  1KZG A;  3GYP A;  1OQN A;  4A5K A;  2OQB A;  4MY6 A;  3TFM A;  4CYE A;  1H10 A;  1U5D A;  5DI9 B;  2ADZ A;  1MAI A;  3UZT A;  2DHK A;  4ZRJ A;  4CHM A;  5DIF B;  1WG7 A;  5FI1 A;  3ULB A;  1NI2 A;  2Q13 A;  4TYZ A;  2J0K A;  2KR0 A;  1PLS A;  4A6F B;  5D3W A;  2DYQ A;  3P7Z A;  5I2S A;  4K2O A;  3A8P A;  2CY5 A;  1WI1 A;  1ZC3 B;  1H4R A;  4HB2 B;  2RNR B; 
#chains in the Genus database with same CATH homology
 2COC A;  5C5B A;  1SHC A;  1U5G A;  1OY2 A;  1UPR A;  4ZRI A;  2DHJ A;  2I1K A;  1DDV A;  2YT0 A;  2VSZ A;  5L81 A;  4PQ0 A;  1DDW A;  4F7U P;  2AL6 A;  2W2X C;  1FHO A;  1QQG A;  1ZC4 B;  1RJ2 A;  3HK0 A;  2K2U A;  2V76 A;  2M14 A;  3PVW A;  2MDX A;  3KZ1 A;  4A6H A;  2DX5 A;  5CLL B;  5D3V A;  1U29 A;  3PSC A;  1XCG A;  2H7D A;  3D8E A;  3ZVR A;  2R0D A;  2D9W A;  2N0Y A;  3ODW A;  1Y19 B;  1TXD A;  2KUP A;  2X18 A;  2COA A;  2HTH B;  1WJ1 A;  3FSS A;  2YF0 A;  5JHH A;  4B6H A;  4BBK A;  3U8Z A;  1GC6 A;  2L2I A;  2IYB A;  2Z0P A;  1AQC A;  2GCJ A;  1K5D B;  2CRF A;  2DX1 A;  1V5M A;  3AU4 A;  5JP4 A;  2UZS A;  1NU2 A;  1UNP A;  1KI1 B;  1FAO A;  1AWE A;  3QIJ A;  3F5R A;  3SNH A;  3CXB B;  1J0W A;  1UPQ A;  2YT1 A;  2NMB A;  5D27 A;  4Z2M B;  2J0J A;  4D0N B;  1DBH A;  1MK7 B;  2D9X A;  4HAZ B;  4GZU A;  4DBB A;  2KGX B;  3SUZ A;  2BCJ A;  2HE7 A;  2MWN B;  3AU5 A;  2G35 A;  3BJI A;  2RUK B;  5J3Y A;  2CAY A;  2NZ8 B;  2DTC A;  3AJ4 A;  3CIK A;  2Z0O A;  5LON B;  1BWN A;  2VRW B;  2Z0Q A;  1X86 A;  4DX9 0;  4DXA B;  2M38 A;  4HB3 B;  1LB1 A;  2D10 A;  2YS1 A;  3NSU A;  3G9W A;  1XKE A;  5HE1 A;  1GG3 A;  2LOX A;  4HAY B;  1FB8 A;  4KVG B;  5D3X A;  3ZDT A;  5GOW B;  2RSG A;  1XR0 B;  2UZR A;  4GN1 A;  5KCV A;  2I5C A;  3PVU A;  4HB0 B;  2D11 A;  4HB4 B;  1U5E A;  1NTY A;  1UNQ A;  1EGX A;  3ML4 A;  4C0A A;  4HAT B;  1MPH A;  3IVF A;  3KSY A;  1DRO A;  1TQZ A;  1U27 A;  5J3Q A;  2COD A;  1FOE A;  1V5P A;  2LOZ A;  3DXE A;  3A98 B;  1B55 A;  2ELA A;  2W2X D;  1I2H A;  3OAN A;  3SO6 A;  4A6F A;  2D9Z A;  2MFQ A;  4HAU B;  1J19 A;  2OTX A;  4K81 A;  3M1I B;  1N3H A;  2LG1 A;  1ZSQ A;  4KHA A;  2J59 M;  1Y5O A;  1E5W A;  5JHG A;  1TJ6 A;  2EMT A;  1DYN A;  2FJL A;  4IOY X;  5CLQ B;  1M7E A;  3ODO A;  1EAZ A;  4IAP A;  3QWM A;  1U5F A;  4P7I A;  4NSW A;  4Z2N A;  1X1G A;  4HAV B;  1V88 A;  4HAW B;  3TCA A;  4XWX A;  1RRP B;  2PZ1 A;  2ELB A;  3TW1 A;  1WGQ A;  4F7H A;  1FHW A;  5DH9 B;  1MIZ B;  1W1H A;  2GCL A;  1ZM0 A;  2W2W A;  4YL8 A;  2D2Q A;  3FM8 C;  4NY0 A;  1V5U A;  4EMO A;  2KCJ A;  1XOD A;  2DA0 A;  2YS5 A;  2RVB B;  2EMS A;  1DDM A;  4K2P A;  5C79 A;  2P0F A;  2UVM A;  4WSF A;  3TO1 A;  4L6E A;  4IFS A;  1U2B A;  4K17 A;  4GMX B;  3O96 A;  1V89 A;  3F0W A;  4H8S A;  3DXC A;  5J3T A;  4DX8 A;  4GXB A;  4KAX B;  1FGZ A;  2J0M A;  3PVL A;  3BIN A;  2RGN B;  1UEF A;  1BTN A;  1W1D A;  3HQC A;  1WGU A;  1LW3 A;  3QBV B;  1P3R A;  3PEG A;  4HHV A;  3VOQ A;  4WJ7 A;  2LYD A;  1WVH A;  3P6A A;  1MIX A;  1W1G A;  2YS3 A;  3TVV A;  2EC1 A;  1NTV A;  1UNR A;  3PP2 A;  1X05 A;  3N7C A;  2H7E A;  2ZPY A;  3RCP A;  2YSZ A;  4YON A;  3KRX A;  1BAK A;  4HDQ A;  3LJU X;  1QC6 A;  2XQN M;  5KQ1 A;  5DHF B;  5C5B B;  4PNK A;  2ROZ B;  3GYO A;  3ODX A;  2VKI A;  5DHA B;  2E2X A;  2DYN A;  5FI0 A;  4A6K A;  2RLO A;  3MDB C;  2EJ8 A;  2DKQ A;  2D4Q A;  1X11 A;  3U7D A;  3D8F A;  3DXD A;  2YVC A;  1OMW A;  2DFK A;  4F7G A;  5LOP B;  4GMV A;  2GJY A;  2N23 A;  3PG7 A;  1GC7 A;  3SV1 A;  5EFX A;  2R09 A;  1XX0 A;  2Y7B A;  4HAX B;  2I1J A;  3SYX A;  1EF1 A;  1XD4 A;  2IFS A;  1P5T A;  3HW2 B;  2QKL A;  2COF A;  4TKN A;  2K2J A;  1WJM A;  2GS0 A;  1MKE A;  1ISN A;  4WVF B;  2QKM A;  3VIA A;  5HE3 A;  5HE2 A;  2AEH A;  2DN6 A;  4ZRK A;  4KHB B;  3D8D A;  3KY9 A;  1KZ7 A;  1PMS A;  2P0H A;  2DHI A;  2YRY A;  2LUL A;  4KHO A;  3X23 A;  5C6R A;  2Y8G A;  1V61 A;  2L1C A;  2ROV A;  5D3Y A;  1FHX A;  4HDO A;  2P8V A;  2JP2 A;  3ULC A;  3KRW A;  1ZVR A;  2K00 A;  3FEH A;  5C16 A;  1Z87 A;  4Y94 A;  5HE0 A;  3T06 A;  1Q67 A;  2CY4 A;  5KQ4 A;  1FGY A;  4EKU A;  1X1F A;  1M7R A;  1IRS A;  1SGH A;  2DLW A;  1EVH A;  4CHJ A;  3A8Q A;  4EJN A;  2Y8F A;  3WA0 A;  1P6S A;  2I5F A;  5JLJ B;  2D9Y A;  3V5W A;  1MK9 B;  4MT7 A;  3PZD A;  4MK0 A;  1I7A A;  3MPX A;  1PFJ A;  2LKO A;  2P0D A;  2D9V A;  1BTK A;  1K5G B;  2MKR A;  3WYF B;  2DKP A;  4GPT B;  1KZG A;  3GYP A;  1OQN A;  4A5K A;  2OQB A;  4MY6 A;  3TFM A;  4CYE A;  1H10 A;  1U5D A;  5DI9 B;  2ADZ A;  1MAI A;  3UZT A;  2DHK A;  4ZRJ A;  4CHM A;  5DIF B;  1WG7 A;  5FI1 A;  3ULB A;  1NI2 A;  2Q13 A;  4TYZ A;  2J0K A;  1PLS A;  4A6F B;  5D3W A;  2DYQ A;  3P7Z A;  4K2O A;  3A8P A;  2CY5 A;  1WI1 A;  1ZC3 B;  1H4R A;  4HB2 B;  2RNR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...