2N0YA

Nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Omega XaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/viral protein
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n0yA00
3VOQA 2YF0A 1FGYA 4ZRKA 4HDQA 1XD4A 2EMSA 3FSSA 2J0KA 4ZRIA 4EMOA 3HQCA 3U8ZA 2DKQA 1EF1A 2AL6A 2DTCA 5HE0A 2FJLA 1DDWA 1LB1A 1MKEA 1NTVA 2CRFA 4HB4B 4CHJA 4HAVB 3M1IB 1I2HA 4DX90 1GG3A 1U5FA 3KY9A 2JP2A 5KQ4A 4F7GA 1FAOA 2YS5A 2N0YA 1RRPB 2DX5A 1QC6A 2MDXA 2D11A 1U5EA 1FHXA 2D9WA 3AU5A 4CYEA 2J0JA 4DBBA 3G9WA 3QWMA 5C6RA 2YS1A 1MPHA 4NY0A 2OTXA 1W1GA 5L81A 4IOYX 4A6HA 1UPRA 3SUZA 3PZDA 3FM8C 3BINA 2DA0A 1PFJA 1V61A 4A6FA 1PLSA 2Q13A 1V5PA 4MT7A 2R0DA 1WGUA 3SV1A 3BJIA 1J19A 2EMTA 4PQ0A 1Q67A 3F5RA 4L6EA 3GYPA 1KI1B 2H7DA 1U5DA 5C5BB 4KHAA 1FGZA 1FB8A 2CY4A 2P0FA 4HAZB 1V5MA 2IYBA 5D3YA 4KHBB 4Y94A 4HHVA 1NU2A 1DROA 2UVMA 4DXAB 1BWNA 1V88A 2M38A 3ML4A 3D8EA 4WVFB 1QQGA 3HK0A 3MDBC 2DHIA 2COAA 1J0WA 2QKMA 1IRSA 1XKEA 3PG7A 2K2UA 3WYFB 1ZC4B 5JHHA 3KZ1A 2CY5A 2DHKA 2W2XD 1X1FA 2QKLA 4C0AA 3ULBA 5DHFB 4P7IA 3CIKA 1BTNA 5DHAB 2GCLA 1XR0B 1ZM0A 3PVUA 2P0DA 5EFXA 2D10A 2VKIA 2ROVA 4K17A 3CXBB 1DDMA 4TKNA 4HAWB 1X1GA 1UNPA 2P8VA 1MAIA 2RSGA 1OQNA 3A98B 2MKRA 3TFMA 4HB0B 3ZDTA 1Z87A 4GMXB 3T06A 4MK0A 1P6SA 1MK9B 3X23A 2K00A 4GXBA 3TO1A 4WJ7A 2LOXA 4NSWA 2W2XC 1B55A 1WJ1A 1H10A 2Y8FA 2M14A 2LULA 2IFSA 4HAUB 2V76A 4IFSA 4A5KA 2D9XA 2COCA 3A8PA 3KSYA 3N7CA 1I7AA 4HAXB 1Y19B 1KZ7A 4H8SA 3ULCA 3UZTA 2LG1A 5D3VA 2GS0A 2MFQA 2CAYA 3O96A 4MY6A 4ZRJA 2COFA 3P6AA 1M7RA 3AJ4A 1EGXA 1X86A 3QIJA 4PNKA 3TW1A 5CLQB 2I5CA 1FOEA 5FI1A 5J3QA 2UZSA 2VRWB 2DLWA 4GPTB 2L2IA 2NMBA 2CODA 5D3WA 3PVLA 1U2BA 2G35A 4K2OA 3ZVRA 2RUKB 5DIFB 2DN6A 4GMVA 1BTKA 5HE3A 1XODA 4YONA 4HAYB 3KRWA 3OANA 1AQCA 1WVHA 4HB2B 2YS3A 2LKOA 2J0MA 1XX0A 1ISNA 3ODXA 2I1JA 2Z0QA 2Z0OA 2I1KA 1X05A 2K2JA 2YVCA 1N3HA 1NTYA 1WI1A 3SYXA 3D8FA 4HATB 5D27A 1H4RA 3ODWA 1E5WA 1PMSA 4KVGB 2UZRA 2X18A 3WA0A 2HE7A 1FHOA 2H7EA 1UNQA 1DBHA 1W1DA 2AEHA 2KUPA 4EKUA 2Y7BA 3NSUA 1EAZA 1GC6A 1BAKA 1UNRA 2Z0PA 1P5TA 4Z2NA 1K5DB 1TJ6A 2L1CA 4YL8A 3D8DA 2RNRB 3PVWA 3TCAA 3RCPA 1W1HA 2YSZA 1SGHA 1GC7A 2ROZB 5C16A 3TVVA 2VSZA 2D9YA 4Z2MB 4GN1A 4WSFA 2R09A 2DFKA 3PSCA 2LYDA 4GZUA 5LOPB 1OY2A 3A8QA 1MIXA 3DXEA 1TQZA 2DX1A 2OQBA 1UPQA 4HB3B 3SO6A 3P7ZA 5J3TA 2XQNM 1U27A 4DX8A 2HTHB 2YT0A 3F0WA 1XCGA 1WG7A 2E2XA 5LONB 5HE1A 2ELBA 2MWNB 5J3YA 2W2WA 1AWEA 1DDVA 5KQ1A 1UEFA 4TYZA 1Y5OA 4IAPA 4HDOA 2J59M 5CLLB 3ODOA 5C5BA 2D9VA 4KAXB 1SHCA 1P3RA 2D2QA 2DHJA 3V5WA 5GOWB 2KCJA 2GJYA 4KHOA 2RGNB 2LOZA 2P0HA 1KZGA 2NZ8B 5JLJB 1LW3A 4K2PA 1V5UA 2GCJA 1WJMA 5C79A 1ZSQA 1V89A 3KRXA 4EJNA 1WGQA 1M7EA 3AU4A 5KCVA 1K5GB 1DYNA 3DXCA 1NI2A 4A6FB 3GYOA 2DYQA 3U7DA 4A6KA 4CHMA 3IVFA 1OMWA 1ZC3B 2D4QA 1MIZB 5DH9B 2D9ZA 5JHGA 1MK7B 5JP4A 2N23A 3PEGA 2ADZA 1TXDA 1EVHA 2DKPA 2KGXB 2YRYA 5D3XA 2RVBB 4B6HA 2I5FA 2EJ8A 3VIAA 3FEHA 2ZPYA 2YT1A 4K81A 1FHWA 3DXDA 3MPXA 3PP2A 2DYNA 5DI9B 2BCJA 1U5GA 2Y8GA 4F7UP 1X11A 5FI0A 2EC1A 4XWXA 4D0NB 2PZ1A 5HE2A 3QBVB 3HW2B 4F7HA 2ELAA 1U29A 1RJ2A 1ZVRA 2RLOA 3SNHA 3LJUX 4BBKA
chains in the Genus database with same CATH superfamily
3VOQA 2YF0A 1FGYA 4ZRKA 4HDQA 1XD4A 2EMSA 3FSSA 5LG4B 2J0KA 4ZRIA 4EMOA 3HQCA 3U8ZA 4QJ3B 3NWDA 2DKQA 1EF1A 4OT1A 2AL6A 2DTCA 5HE0A 2FJLA 1DDWA 1LB1A 1MKEA 1NTVA 2CRFA 4HB4B 2Z59A 4CHJA 4HAVB 3M1IB 1I2HA 4DX90 1GG3A 1U5FA 3KY9A 4DIXA 2JP2A 5KQ4A 4F7GA 1FAOA 2YS5A 2N0YA 1RRPB 2DX5A 1QC6A 2MDXA 1T77A 2D11A 1U5EA 1FHXA 2KR0A 2D9WA 3AU5A 4CYEA 2J0JA 4DBBA 5I2MA 3G9WA 2YT2A 3QWMA 5C6RA 2YS1A 1MPHA 4NY0A 2OTXA 1W1GA 5L81A 4IOYX 4A6HA 1UPRA 3SUZA 3U12A 3PZDA 3FM8C 3BINA 2DA0A 1PFJA 1V61A 4A6FA 1PLSA 2Z13A 2Q13A 4QJ4B 5IRSA 1V5PA 4MT7A 2R0DA 1WGUA 3SV1A 3B77A 3BJIA 3NWAA 1J19A 2EMTA 4PQ0A 1Q67A 3F5RA 4L6EA 3GYPA 1KI1B 2H7DA 1U5DA 5C5BB 4KHAA 1FGZA 1FB8A 2CY4A 2P0FA 4HAZB 1V5MA 2IYBA 5D3YA 4KHBB 4Y94A 2GUMA 4HHVA 1NU2A 1DROA 2UVMA 4DXAB 1BWNA 4HSIA 1V88A 2M38A 3ML4A 2K8EA 3D8EA 4WVFB 1QQGA 3HK0A 3MDBC 1MI1A 2DHIA 2COAA 2FJUB 1J0WA 2QKMA 1IRSA 1XKEA 4D6WA 3PG7A 2K2UA 3WYFB 1ZC4B 5JHHA 3KZ1A 2CY5A 2DHKA 2W2XD 1X1FA 2QKLA 4C0AA 3ULBA 2Z4DA 5DHFB 4P7IA 3CIKA 1BTNA 5DHAB 2GCLA 4CSQA 1XR0B 2R2YA 1ZM0A 3PVUA 2P0DA 5EFXA 2D10A 2VKIA 2ROVA 4K17A 3CXBB 1ZYIA 1DDMA 4TKNA 4HAWB 1X1GA 1UNPA 2P8VA 1MAIA 2RSGA 1OQNA 3A98B 2MKRA 3NWFA 3TFMA 4HB0B 3ZDTA 1Z87A 4GMXB 3T06A 4MK0A 1P6SA 1MK9B 3X23A 2K00A 4GXBA 3TO1A 4QXAB 4QJ5B 4WJ7A 2LOXA 4NSWA 2W2XC 1B55A 1WJ1A 1H10A 2Y8FA 2M14A 2LULA 2IFSA 4HAUB 2V76A 4IFSA 4A5KA 2Z14A 2D9XA 2COCA 3A8PA 3KSYA 3N7CA 1I7AA 4HAXB 1Y19B 1KZ7A 4H8SA 3ULCA 3UZTA 3HSAA 2LG1A 5D3VA 2GS0A 2MFQA 2CAYA 3O96A 4MY6A 4ZRJA 2COFA 3P6AA 1M7RA 3AJ4A 1EGXA 1X86A 3QIJA 4PNKA 3TW1A 5CLQB 2I5CA 1FOEA 5FI1A 5J3QA 2UZSA 2VRWB 2DLWA 4GPTB 2L2IA 2NMBA 2CODA 5D3WA 3PVLA 1U2BA 2G35A 4K2OA 3ZVRA 2RUKB 5DIFB 2DN6A 4GMVA 1BTKA 5HE3A 1XODA 4YONA 4HAYB 3KRWA 3OANA 3DCXA 1AQCA 1WVHA 4HB2B 2YS3A 2LKOA 2J0MA 5M4YB 1XX0A 1ISNA 3ODXA 2I1JA 2Z0QA 2Z0OA 2I1KA 1X05A 2K2JA 2YVCA 1N3HA 1NTYA 1WI1A 3SYXA 3D8FA 4HATB 3OHMB 5D27A 1H4RA 3ODWA 1E5WA 1PMSA 4KVGB 2UZRA 2X18A 3WA0A 2HE7A 1FHOA 2H7EA 1UNQA 1DBHA 2K49A 1W1DA 2AEHA 3NW8A 2KUPA 4EKUA 2Y7BA 3NSUA 1EAZA 1GC6A 1BAKA 1UNRA 2KIGA 2Z0PA 1P5TA 4L1RA 4Z2NA 1K5DB 1TJ6A 2L1CA 4YL8A 3D8DA 2ZKMX 2RNRB 3PVWA 3TCAA 3RCPA 1W1HA 2YSZA 4GNKB 1SGHA 1GC7A 2ROZB 3HIEA 5C16A 3TVVA 2VSZA 2D9YA 4KHBA 4Z2MB 4GN1A 4WSFA 2R09A 2DFKA 3PSCA 2LYDA 4GZUA 5LOPB 1OY2A 3A8QA 5I2SA 1MIXA 3DXEA 1TQZA 2DX1A 2OQBA 1UPQA 4HB3B 3SO6A 3P7ZA 5J3TA 2XQNM 1U27A 4DX8A 4GOUA 3A58A 2HTHB 2YT0A 3F0WA 1XCGA 1WG7A 2E2XA 5LONB 5HE1A 2ELBA 2MWNB 5J3YA 2W2WA 1AWEA 4OSNA 1DDVA 5KQ1A 1UEFA 4TYZA 1Y5OA 4IAPA 4HDOA 2J59M 5CLLB 3ODOA 5C5BA 2D9VA 4KAXB 1SHCA 1P3RA 2D2QA 2DHJA 3V5WA 5GOWB 2KUQA 2GJYA 2KCJA 4KHOA 2RGNB 2LOZA 2P0HA 2RRFA 1KZGA 2NZ8B 5JLJB 1LW3A 1V5UA 2GCJA 1WJMA 4K2PA 5C79A 1ZSQA 1V89A 3KRXA 2NBVA 4EJNA 1WGQA 1M7EA 3AU4A 5KCVA 1K5GB 1DYNA 3DXCA 1NI2A 4A6FB 3GYOA 2DYQA 3U7DA 4A6KA 4CHMA 3IVFA 1OMWA 1ZC3B 2D4QA 1MIZB 5DH9B 2D9ZA 2KIEA 1MK7B 5JHGA 5JP4A 2N23A 3PEGA 2ADZA 1TXDA 1EVHA 2DKPA 2KGXB 2YRYA 5D3XA 2RVBB 4B6HA 2I5FA 2EJ8A 3VIAA 3FEHA 2ZPYA 2YT1A 4K81A 1FHWA 3DXDA 3MPXA 3PP2A 2DYNA 5DI9B 2BCJA 1U5GA 2Y8GA 4F7UP 1X11A 3FVCA 5FI0A 2EC1A 4XWXA 4D0NB 2PZ1A 5HE2A 3QBVB 3HW2B 4F7HA 2ELAA 1U29A 1RJ2A 1ZVRA 2RLOA 3SNHA 3LJUX 4BBKA
chains in the Genus database with same CATH topology
3VOQA 2YF0A 1FGYA 4ZRKA 4HDQA 1XD4A 2EMSA 3FSSA 2J0KA 4ZRIA 4EMOA 3HQCA 3U8ZA 2DKQA 1EF1A 2AL6A 2DTCA 5HE0A 2FJLA 1DDWA 1LB1A 1MKEA 1NTVA 2CRFA 4HB4B 4CHJA 4HAVB 3M1IB 1I2HA 4DX90 1GG3A 1U5FA 3KY9A 2JP2A 5KQ4A 4F7GA 1FAOA 2YS5A 2N0YA 1RRPB 2DX5A 1QC6A 2MDXA 2D11A 1U5EA 1FHXA 2D9WA 3AU5A 4CYEA 2J0JA 4DBBA 3G9WA 3QWMA 5C6RA 2YS1A 1MPHA 4NY0A 2OTXA 1W1GA 5L81A 4IOYX 4A6HA 1UPRA 3SUZA 3PZDA 3FM8C 3BINA 2DA0A 1PFJA 1V61A 4A6FA 1PLSA 2Q13A 1V5PA 4MT7A 2R0DA 1WGUA 3SV1A 3BJIA 1J19A 2EMTA 4PQ0A 1Q67A 3F5RA 4L6EA 3GYPA 1KI1B 2H7DA 1U5DA 5C5BB 4KHAA 1FGZA 1FB8A 2CY4A 2P0FA 4HAZB 1V5MA 2IYBA 5D3YA 4KHBB 4Y94A 4HHVA 1NU2A 1DROA 2UVMA 4DXAB 1BWNA 1V88A 2M38A 3ML4A 3D8EA 4WVFB 1QQGA 3HK0A 3MDBC 2DHIA 2COAA 1J0WA 2QKMA 1IRSA 1XKEA 3PG7A 2K2UA 3WYFB 1ZC4B 5JHHA 3KZ1A 2CY5A 2DHKA 2W2XD 1X1FA 2QKLA 4C0AA 3ULBA 5DHFB 4P7IA 3CIKA 1BTNA 5DHAB 2GCLA 1XR0B 1ZM0A 3PVUA 2P0DA 5EFXA 2D10A 2VKIA 2ROVA 4K17A 3CXBB 1DDMA 4TKNA 4HAWB 1X1GA 1UNPA 2P8VA 1MAIA 2RSGA 1OQNA 3A98B 2MKRA 3TFMA 4HB0B 3ZDTA 1Z87A 4GMXB 3T06A 4MK0A 1P6SA 1MK9B 3X23A 2K00A 4GXBA 3TO1A 4WJ7A 2LOXA 4NSWA 2W2XC 1B55A 1WJ1A 1H10A 2Y8FA 2M14A 2LULA 2IFSA 4HAUB 2V76A 4IFSA 4A5KA 2D9XA 2COCA 3A8PA 3KSYA 3N7CA 1I7AA 4HAXB 1Y19B 1KZ7A 4H8SA 3ULCA 3UZTA 2LG1A 5D3VA 2GS0A 2MFQA 2CAYA 3O96A 4MY6A 4ZRJA 2COFA 3P6AA 1M7RA 3AJ4A 1EGXA 1X86A 3QIJA 4PNKA 3TW1A 5CLQB 2I5CA 1FOEA 5FI1A 5J3QA 2UZSA 2VRWB 2DLWA 4GPTB 2L2IA 2NMBA 2CODA 5D3WA 3PVLA 1U2BA 2G35A 4K2OA 3ZVRA 2RUKB 5DIFB 2DN6A 4GMVA 1BTKA 5HE3A 1XODA 4YONA 4HAYB 3KRWA 3OANA 1AQCA 1WVHA 4HB2B 2YS3A 2LKOA 2J0MA 1XX0A 1ISNA 3ODXA 2I1JA 2Z0QA 2Z0OA 2I1KA 1X05A 2K2JA 2YVCA 1N3HA 1NTYA 1WI1A 3SYXA 3D8FA 4HATB 5D27A 1H4RA 3ODWA 1E5WA 1PMSA 4KVGB 2UZRA 2X18A 3WA0A 2HE7A 1FHOA 2H7EA 1UNQA 1DBHA 1W1DA 2AEHA 2KUPA 4EKUA 2Y7BA 3NSUA 1EAZA 1GC6A 1BAKA 1UNRA 2Z0PA 1P5TA 4Z2NA 1K5DB 1TJ6A 2L1CA 4YL8A 3D8DA 2RNRB 3PVWA 3TCAA 3RCPA 1W1HA 2YSZA 1SGHA 1GC7A 2ROZB 5C16A 3TVVA 2VSZA 2D9YA 4Z2MB 4GN1A 4WSFA 2R09A 2DFKA 3PSCA 2LYDA 4GZUA 5LOPB 1OY2A 3A8QA 1MIXA 3DXEA 1TQZA 2DX1A 2OQBA 1UPQA 4HB3B 3SO6A 3P7ZA 5J3TA 2XQNM 1U27A 4DX8A 2HTHB 2YT0A 3F0WA 1XCGA 1WG7A 2E2XA 5LONB 5HE1A 2ELBA 2MWNB 5J3YA 2W2WA 1AWEA 1DDVA 5KQ1A 1UEFA 4TYZA 1Y5OA 4IAPA 4HDOA 2J59M 5CLLB 3ODOA 5C5BA 2D9VA 4KAXB 1SHCA 1P3RA 2D2QA 2DHJA 3V5WA 5GOWB 2KCJA 2GJYA 4KHOA 2RGNB 2LOZA 2P0HA 1KZGA 2NZ8B 5JLJB 1LW3A 4K2PA 1V5UA 2GCJA 1WJMA 5C79A 1ZSQA 1V89A 3KRXA 4EJNA 1WGQA 1M7EA 3AU4A 5KCVA 1K5GB 1DYNA 3DXCA 1NI2A 4A6FB 3GYOA 2DYQA 3U7DA 4A6KA 4CHMA 3IVFA 1OMWA 1ZC3B 2D4QA 1MIZB 5DH9B 2D9ZA 5JHGA 1MK7B 5JP4A 2N23A 3PEGA 2ADZA 1TXDA 1EVHA 2DKPA 2KGXB 2YRYA 5D3XA 2RVBB 4B6HA 2I5FA 2EJ8A 3VIAA 3FEHA 2ZPYA 2YT1A 4K81A 1FHWA 3DXDA 3MPXA 3PP2A 2DYNA 5DI9B 2BCJA 1U5GA 2Y8GA 4F7UP 1X11A 5FI0A 2EC1A 4XWXA 4D0NB 2PZ1A 5HE2A 3QBVB 3HW2B 4F7HA 2ELAA 1U29A 1RJ2A 1ZVRA 2RLOA 3SNHA 3LJUX 4BBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOQ A;  2YF0 A;  1FGY A;  4ZRK A;  4HDQ A;  1XD4 A;  2EMS A;  3FSS A;  2J0K A;  4ZRI A;  4EMO A;  3HQC A;  3U8Z A;  2DKQ A;  1EF1 A;  2AL6 A;  2DTC A;  5HE0 A;  2FJL A;  1DDW A;  1LB1 A;  1MKE A;  1NTV A;  2CRF A;  4HB4 B;  4CHJ A;  4HAV B;  3M1I B;  1I2H A;  4DX9 0;  1GG3 A;  1U5F A;  3KY9 A;  2JP2 A;  5KQ4 A;  4F7G A;  1FAO A;  2YS5 A;  2N0Y A;  1RRP B;  2DX5 A;  1QC6 A;  2MDX A;  2D11 A;  1U5E A;  1FHX A;  2D9W A;  3AU5 A;  4CYE A;  2J0J A;  4DBB A;  3G9W A;  3QWM A;  5C6R A;  2YS1 A;  1MPH A;  4NY0 A;  2OTX A;  1W1G A;  5L81 A;  4IOY X;  4A6H A;  1UPR A;  3SUZ A;  3PZD A;  3FM8 C;  3BIN A;  2DA0 A;  1PFJ A;  1V61 A;  4A6F A;  1PLS A;  2Q13 A;  1V5P A;  4MT7 A;  2R0D A;  1WGU A;  3SV1 A;  3BJI A;  1J19 A;  2EMT A;  4PQ0 A;  1Q67 A;  3F5R A;  4L6E A;  3GYP A;  1KI1 B;  2H7D A;  1U5D A;  5C5B B;  4KHA A;  1FGZ A;  1FB8 A;  2CY4 A;  2P0F A;  4HAZ B;  1V5M A;  2IYB A;  5D3Y A;  4KHB B;  4Y94 A;  4HHV A;  1NU2 A;  1DRO A;  2UVM A;  4DXA B;  1BWN A;  1V88 A;  2M38 A;  3ML4 A;  3D8E A;  4WVF B;  1QQG A;  3HK0 A;  3MDB C;  2DHI A;  2COA A;  1J0W A;  2QKM A;  1IRS A;  1XKE A;  3PG7 A;  2K2U A;  3WYF B;  1ZC4 B;  5JHH A;  3KZ1 A;  2CY5 A;  2DHK A;  2W2X D;  1X1F A;  2QKL A;  4C0A A;  3ULB A;  5DHF B;  4P7I A;  3CIK A;  1BTN A;  5DHA B;  2GCL A;  1XR0 B;  1ZM0 A;  3PVU A;  2P0D A;  5EFX A;  2D10 A;  2VKI A;  2ROV A;  4K17 A;  3CXB B;  1DDM A;  4TKN A;  4HAW B;  1X1G A;  1UNP A;  2P8V A;  1MAI A;  2RSG A;  1OQN A;  3A98 B;  2MKR A;  3TFM A;  4HB0 B;  3ZDT A;  1Z87 A;  4GMX B;  3T06 A;  4MK0 A;  1P6S A;  1MK9 B;  3X23 A;  2K00 A;  4GXB A;  3TO1 A;  4WJ7 A;  2LOX A;  4NSW A;  2W2X C;  1B55 A;  1WJ1 A;  1H10 A;  2Y8F A;  2M14 A;  2LUL A;  2IFS A;  4HAU B;  2V76 A;  4IFS A;  4A5K A;  2D9X A;  2COC A;  3A8P A;  3KSY A;  3N7C A;  1I7A A;  4HAX B;  1Y19 B;  1KZ7 A;  4H8S A;  3ULC A;  3UZT A;  2LG1 A;  5D3V A;  2GS0 A;  2MFQ A;  2CAY A;  3O96 A;  4MY6 A;  4ZRJ A;  2COF A;  3P6A A;  1M7R A;  3AJ4 A;  1EGX A;  1X86 A;  3QIJ A;  4PNK A;  3TW1 A;  5CLQ B;  2I5C A;  1FOE A;  5FI1 A;  5J3Q A;  2UZS A;  2VRW B;  2DLW A;  4GPT B;  2L2I A;  2NMB A;  2COD A;  5D3W A;  3PVL A;  1U2B A;  2G35 A;  4K2O A;  3ZVR A;  2RUK B;  5DIF B;  2DN6 A;  4GMV A;  1BTK A;  5HE3 A;  1XOD A;  4YON A;  4HAY B;  3KRW A;  3OAN A;  1AQC A;  1WVH A;  4HB2 B;  2YS3 A;  2LKO A;  2J0M A;  1XX0 A;  1ISN A;  3ODX A;  2I1J A;  2Z0Q A;  2Z0O A;  2I1K A;  1X05 A;  2K2J A;  2YVC A;  1N3H A;  1NTY A;  1WI1 A;  3SYX A;  3D8F A;  4HAT B;  5D27 A;  1H4R A;  3ODW A;  1E5W A;  1PMS A;  4KVG B;  2UZR A;  2X18 A;  3WA0 A;  2HE7 A;  1FHO A;  2H7E A;  1UNQ A;  1DBH A;  1W1D A;  2AEH A;  2KUP A;  4EKU A;  2Y7B A;  3NSU A;  1EAZ A;  1GC6 A;  1BAK A;  1UNR A;  2Z0P A;  1P5T A;  4Z2N A;  1K5D B;  1TJ6 A;  2L1C A;  4YL8 A;  3D8D A;  2RNR B;  3PVW A;  3TCA A;  3RCP A;  1W1H A;  2YSZ A;  1SGH A;  1GC7 A;  2ROZ B;  5C16 A;  3TVV A;  2VSZ A;  2D9Y A;  4Z2M B;  4GN1 A;  4WSF A;  2R09 A;  2DFK A;  3PSC A;  2LYD A;  4GZU A;  5LOP B;  1OY2 A;  3A8Q A;  1MIX A;  3DXE A;  1TQZ A;  2DX1 A;  2OQB A;  1UPQ A;  4HB3 B;  3SO6 A;  3P7Z A;  5J3T A;  2XQN M;  1U27 A;  4DX8 A;  2HTH B;  2YT0 A;  3F0W A;  1XCG A;  1WG7 A;  2E2X A;  5LON B;  5HE1 A;  2ELB A;  2MWN B;  5J3Y A;  2W2W A;  1AWE A;  1DDV A;  5KQ1 A;  1UEF A;  4TYZ A;  1Y5O A;  4IAP A;  4HDO A;  2J59 M;  5CLL B;  3ODO A;  5C5B A;  2D9V A;  4KAX B;  1SHC A;  1P3R A;  2D2Q A;  2DHJ A;  3V5W A;  5GOW B;  2KCJ A;  2GJY A;  4KHO A;  2RGN B;  2LOZ A;  2P0H A;  1KZG A;  2NZ8 B;  5JLJ B;  1LW3 A;  4K2P A;  1V5U A;  2GCJ A;  1WJM A;  5C79 A;  1ZSQ A;  1V89 A;  3KRX A;  4EJN A;  1WGQ A;  1M7E A;  3AU4 A;  5KCV A;  1K5G B;  1DYN A;  3DXC A;  1NI2 A;  4A6F B;  3GYO A;  2DYQ A;  3U7D A;  4A6K A;  4CHM A;  3IVF A;  1OMW A;  1ZC3 B;  2D4Q A;  1MIZ B;  5DH9 B;  2D9Z A;  5JHG A;  1MK7 B;  5JP4 A;  2N23 A;  3PEG A;  2ADZ A;  1TXD A;  1EVH A;  2DKP A;  2KGX B;  2YRY A;  5D3X A;  2RVB B;  4B6H A;  2I5F A;  2EJ8 A;  3VIA A;  3FEH A;  2ZPY A;  2YT1 A;  4K81 A;  1FHW A;  3DXD A;  3MPX A;  3PP2 A;  2DYN A;  5DI9 B;  2BCJ A;  1U5G A;  2Y8G A;  4F7U P;  1X11 A;  5FI0 A;  2EC1 A;  4XWX A;  4D0N B;  2PZ1 A;  5HE2 A;  3QBV B;  3HW2 B;  4F7H A;  2ELA A;  1U29 A;  1RJ2 A;  1ZVR A;  2RLO A;  3SNH A;  3LJU X;  4BBK A; 
#chains in the Genus database with same CATH topology
 3VOQ A;  2YF0 A;  1FGY A;  4ZRK A;  4HDQ A;  1XD4 A;  2EMS A;  3FSS A;  5LG4 B;  2J0K A;  4ZRI A;  4EMO A;  3HQC A;  3U8Z A;  4QJ3 B;  3NWD A;  2DKQ A;  1EF1 A;  4OT1 A;  2AL6 A;  2DTC A;  5HE0 A;  2FJL A;  1DDW A;  1LB1 A;  1MKE A;  1NTV A;  2CRF A;  4HB4 B;  2Z59 A;  4CHJ A;  4HAV B;  3M1I B;  1I2H A;  4DX9 0;  1GG3 A;  1U5F A;  3KY9 A;  4DIX A;  2JP2 A;  5KQ4 A;  4F7G A;  1FAO A;  2YS5 A;  2N0Y A;  1RRP B;  2DX5 A;  1QC6 A;  2MDX A;  1T77 A;  2D11 A;  1U5E A;  1FHX A;  2KR0 A;  2D9W A;  3AU5 A;  4CYE A;  2J0J A;  4DBB A;  5I2M A;  3G9W A;  2YT2 A;  3QWM A;  5C6R A;  2YS1 A;  1MPH A;  4NY0 A;  2OTX A;  1W1G A;  5L81 A;  4IOY X;  4A6H A;  1UPR A;  3SUZ A;  3U12 A;  3PZD A;  3FM8 C;  3BIN A;  2DA0 A;  1PFJ A;  1V61 A;  4A6F A;  1PLS A;  2Z13 A;  2Q13 A;  4QJ4 B;  5IRS A;  1V5P A;  4MT7 A;  2R0D A;  1WGU A;  3SV1 A;  3B77 A;  3BJI A;  3NWA A;  1J19 A;  2EMT A;  4PQ0 A;  1Q67 A;  3F5R A;  4L6E A;  3GYP A;  1KI1 B;  2H7D A;  1U5D A;  5C5B B;  4KHA A;  1FGZ A;  1FB8 A;  2CY4 A;  2P0F A;  4HAZ B;  1V5M A;  2IYB A;  5D3Y A;  4KHB B;  4Y94 A;  2GUM A;  4HHV A;  1NU2 A;  1DRO A;  2UVM A;  4DXA B;  1BWN A;  4HSI A;  1V88 A;  2M38 A;  3ML4 A;  2K8E A;  3D8E A;  4WVF B;  1QQG A;  3HK0 A;  3MDB C;  1MI1 A;  2DHI A;  2COA A;  2FJU B;  1J0W A;  2QKM A;  1IRS A;  1XKE A;  4D6W A;  3PG7 A;  2K2U A;  3WYF B;  1ZC4 B;  5JHH A;  3KZ1 A;  2CY5 A;  2DHK A;  2W2X D;  1X1F A;  2QKL A;  4C0A A;  3ULB A;  2Z4D A;  5DHF B;  4P7I A;  3CIK A;  1BTN A;  5DHA B;  2GCL A;  4CSQ A;  1XR0 B;  2R2Y A;  1ZM0 A;  3PVU A;  2P0D A;  5EFX A;  2D10 A;  2VKI A;  2ROV A;  4K17 A;  3CXB B;  1ZYI A;  1DDM A;  4TKN A;  4HAW B;  1X1G A;  1UNP A;  2P8V A;  1MAI A;  2RSG A;  1OQN A;  3A98 B;  2MKR A;  3NWF A;  3TFM A;  4HB0 B;  3ZDT A;  1Z87 A;  4GMX B;  3T06 A;  4MK0 A;  1P6S A;  1MK9 B;  3X23 A;  2K00 A;  4GXB A;  3TO1 A;  4QXA B;  4QJ5 B;  4WJ7 A;  2LOX A;  4NSW A;  2W2X C;  1B55 A;  1WJ1 A;  1H10 A;  2Y8F A;  2M14 A;  2LUL A;  2IFS A;  4HAU B;  2V76 A;  4IFS A;  4A5K A;  2Z14 A;  2D9X A;  2COC A;  3A8P A;  3KSY A;  3N7C A;  1I7A A;  4HAX B;  1Y19 B;  1KZ7 A;  4H8S A;  3ULC A;  3UZT A;  3HSA A;  2LG1 A;  5D3V A;  2GS0 A;  2MFQ A;  2CAY A;  3O96 A;  4MY6 A;  4ZRJ A;  2COF A;  3P6A A;  1M7R A;  3AJ4 A;  1EGX A;  1X86 A;  3QIJ A;  4PNK A;  3TW1 A;  5CLQ B;  2I5C A;  1FOE A;  5FI1 A;  5J3Q A;  2UZS A;  2VRW B;  2DLW A;  4GPT B;  2L2I A;  2NMB A;  2COD A;  5D3W A;  3PVL A;  1U2B A;  2G35 A;  4K2O A;  3ZVR A;  2RUK B;  5DIF B;  2DN6 A;  4GMV A;  1BTK A;  5HE3 A;  1XOD A;  4YON A;  4HAY B;  3KRW A;  3OAN A;  3DCX A;  1AQC A;  1WVH A;  4HB2 B;  2YS3 A;  2LKO A;  2J0M A;  5M4Y B;  1XX0 A;  1ISN A;  3ODX A;  2I1J A;  2Z0Q A;  2Z0O A;  2I1K A;  1X05 A;  2K2J A;  2YVC A;  1N3H A;  1NTY A;  1WI1 A;  3SYX A;  3D8F A;  4HAT B;  3OHM B;  5D27 A;  1H4R A;  3ODW A;  1E5W A;  1PMS A;  4KVG B;  2UZR A;  2X18 A;  3WA0 A;  2HE7 A;  1FHO A;  2H7E A;  1UNQ A;  1DBH A;  2K49 A;  1W1D A;  2AEH A;  3NW8 A;  2KUP A;  4EKU A;  2Y7B A;  3NSU A;  1EAZ A;  1GC6 A;  1BAK A;  1UNR A;  2KIG A;  2Z0P A;  1P5T A;  4L1R A;  4Z2N A;  1K5D B;  1TJ6 A;  2L1C A;  4YL8 A;  3D8D A;  2ZKM X;  2RNR B;  3PVW A;  3TCA A;  3RCP A;  1W1H A;  2YSZ A;  4GNK B;  1SGH A;  1GC7 A;  2ROZ B;  3HIE A;  5C16 A;  3TVV A;  2VSZ A;  2D9Y A;  4KHB A;  4Z2M B;  4GN1 A;  4WSF A;  2R09 A;  2DFK A;  3PSC A;  2LYD A;  4GZU A;  5LOP B;  1OY2 A;  3A8Q A;  5I2S A;  1MIX A;  3DXE A;  1TQZ A;  2DX1 A;  2OQB A;  1UPQ A;  4HB3 B;  3SO6 A;  3P7Z A;  5J3T A;  2XQN M;  1U27 A;  4DX8 A;  4GOU A;  3A58 A;  2HTH B;  2YT0 A;  3F0W A;  1XCG A;  1WG7 A;  2E2X A;  5LON B;  5HE1 A;  2ELB A;  2MWN B;  5J3Y A;  2W2W A;  1AWE A;  4OSN A;  1DDV A;  5KQ1 A;  1UEF A;  4TYZ A;  1Y5O A;  4IAP A;  4HDO A;  2J59 M;  5CLL B;  3ODO A;  5C5B A;  2D9V A;  4KAX B;  1SHC A;  1P3R A;  2D2Q A;  2DHJ A;  3V5W A;  5GOW B;  2KUQ A;  2GJY A;  2KCJ A;  4KHO A;  2RGN B;  2LOZ A;  2P0H A;  2RRF A;  1KZG A;  2NZ8 B;  5JLJ B;  1LW3 A;  1V5U A;  2GCJ A;  1WJM A;  4K2P A;  5C79 A;  1ZSQ A;  1V89 A;  3KRX A;  2NBV A;  4EJN A;  1WGQ A;  1M7E A;  3AU4 A;  5KCV A;  1K5G B;  1DYN A;  3DXC A;  1NI2 A;  4A6F B;  3GYO A;  2DYQ A;  3U7D A;  4A6K A;  4CHM A;  3IVF A;  1OMW A;  1ZC3 B;  2D4Q A;  1MIZ B;  5DH9 B;  2D9Z A;  2KIE A;  1MK7 B;  5JHG A;  5JP4 A;  2N23 A;  3PEG A;  2ADZ A;  1TXD A;  1EVH A;  2DKP A;  2KGX B;  2YRY A;  5D3X A;  2RVB B;  4B6H A;  2I5F A;  2EJ8 A;  3VIA A;  3FEH A;  2ZPY A;  2YT1 A;  4K81 A;  1FHW A;  3DXD A;  3MPX A;  3PP2 A;  2DYN A;  5DI9 B;  2BCJ A;  1U5G A;  2Y8G A;  4F7U P;  1X11 A;  3FVC A;  5FI0 A;  2EC1 A;  4XWX A;  4D0N B;  2PZ1 A;  5HE2 A;  3QBV B;  3HW2 B;  4F7H A;  2ELA A;  1U29 A;  1RJ2 A;  1ZVR A;  2RLO A;  3SNH A;  3LJU X;  4BBK A; 
#chains in the Genus database with same CATH homology
 3VOQ A;  2YF0 A;  1FGY A;  4ZRK A;  4HDQ A;  1XD4 A;  2EMS A;  3FSS A;  2J0K A;  4ZRI A;  4EMO A;  3HQC A;  3U8Z A;  2DKQ A;  1EF1 A;  2AL6 A;  2DTC A;  5HE0 A;  2FJL A;  1DDW A;  1LB1 A;  1MKE A;  1NTV A;  2CRF A;  4HB4 B;  4CHJ A;  4HAV B;  3M1I B;  1I2H A;  4DX9 0;  1GG3 A;  1U5F A;  3KY9 A;  2JP2 A;  5KQ4 A;  4F7G A;  1FAO A;  2YS5 A;  2N0Y A;  1RRP B;  2DX5 A;  1QC6 A;  2MDX A;  2D11 A;  1U5E A;  1FHX A;  2D9W A;  3AU5 A;  4CYE A;  2J0J A;  4DBB A;  3G9W A;  3QWM A;  5C6R A;  2YS1 A;  1MPH A;  4NY0 A;  2OTX A;  1W1G A;  5L81 A;  4IOY X;  4A6H A;  1UPR A;  3SUZ A;  3PZD A;  3FM8 C;  3BIN A;  2DA0 A;  1PFJ A;  1V61 A;  4A6F A;  1PLS A;  2Q13 A;  1V5P A;  4MT7 A;  2R0D A;  1WGU A;  3SV1 A;  3BJI A;  1J19 A;  2EMT A;  4PQ0 A;  1Q67 A;  3F5R A;  4L6E A;  3GYP A;  1KI1 B;  2H7D A;  1U5D A;  5C5B B;  4KHA A;  1FGZ A;  1FB8 A;  2CY4 A;  2P0F A;  4HAZ B;  1V5M A;  2IYB A;  5D3Y A;  4KHB B;  4Y94 A;  4HHV A;  1NU2 A;  1DRO A;  2UVM A;  4DXA B;  1BWN A;  1V88 A;  2M38 A;  3ML4 A;  3D8E A;  4WVF B;  1QQG A;  3HK0 A;  3MDB C;  2DHI A;  2COA A;  1J0W A;  2QKM A;  1IRS A;  1XKE A;  3PG7 A;  2K2U A;  3WYF B;  1ZC4 B;  5JHH A;  3KZ1 A;  2CY5 A;  2DHK A;  2W2X D;  1X1F A;  2QKL A;  4C0A A;  3ULB A;  5DHF B;  4P7I A;  3CIK A;  1BTN A;  5DHA B;  2GCL A;  1XR0 B;  1ZM0 A;  3PVU A;  2P0D A;  5EFX A;  2D10 A;  2VKI A;  2ROV A;  4K17 A;  3CXB B;  1DDM A;  4TKN A;  4HAW B;  1X1G A;  1UNP A;  2P8V A;  1MAI A;  2RSG A;  1OQN A;  3A98 B;  2MKR A;  3TFM A;  4HB0 B;  3ZDT A;  1Z87 A;  4GMX B;  3T06 A;  4MK0 A;  1P6S A;  1MK9 B;  3X23 A;  2K00 A;  4GXB A;  3TO1 A;  4WJ7 A;  2LOX A;  4NSW A;  2W2X C;  1B55 A;  1WJ1 A;  1H10 A;  2Y8F A;  2M14 A;  2LUL A;  2IFS A;  4HAU B;  2V76 A;  4IFS A;  4A5K A;  2D9X A;  2COC A;  3A8P A;  3KSY A;  3N7C A;  1I7A A;  4HAX B;  1Y19 B;  1KZ7 A;  4H8S A;  3ULC A;  3UZT A;  2LG1 A;  5D3V A;  2GS0 A;  2MFQ A;  2CAY A;  3O96 A;  4MY6 A;  4ZRJ A;  2COF A;  3P6A A;  1M7R A;  3AJ4 A;  1EGX A;  1X86 A;  3QIJ A;  4PNK A;  3TW1 A;  5CLQ B;  2I5C A;  1FOE A;  5FI1 A;  5J3Q A;  2UZS A;  2VRW B;  2DLW A;  4GPT B;  2L2I A;  2NMB A;  2COD A;  5D3W A;  3PVL A;  1U2B A;  2G35 A;  4K2O A;  3ZVR A;  2RUK B;  5DIF B;  2DN6 A;  4GMV A;  1BTK A;  5HE3 A;  1XOD A;  4YON A;  4HAY B;  3KRW A;  3OAN A;  1AQC A;  1WVH A;  4HB2 B;  2YS3 A;  2LKO A;  2J0M A;  1XX0 A;  1ISN A;  3ODX A;  2I1J A;  2Z0Q A;  2Z0O A;  2I1K A;  1X05 A;  2K2J A;  2YVC A;  1N3H A;  1NTY A;  1WI1 A;  3SYX A;  3D8F A;  4HAT B;  5D27 A;  1H4R A;  3ODW A;  1E5W A;  1PMS A;  4KVG B;  2UZR A;  2X18 A;  3WA0 A;  2HE7 A;  1FHO A;  2H7E A;  1UNQ A;  1DBH A;  1W1D A;  2AEH A;  2KUP A;  4EKU A;  2Y7B A;  3NSU A;  1EAZ A;  1GC6 A;  1BAK A;  1UNR A;  2Z0P A;  1P5T A;  4Z2N A;  1K5D B;  1TJ6 A;  2L1C A;  4YL8 A;  3D8D A;  2RNR B;  3PVW A;  3TCA A;  3RCP A;  1W1H A;  2YSZ A;  1SGH A;  1GC7 A;  2ROZ B;  5C16 A;  3TVV A;  2VSZ A;  2D9Y A;  4Z2M B;  4GN1 A;  4WSF A;  2R09 A;  2DFK A;  3PSC A;  2LYD A;  4GZU A;  5LOP B;  1OY2 A;  3A8Q A;  1MIX A;  3DXE A;  1TQZ A;  2DX1 A;  2OQB A;  1UPQ A;  4HB3 B;  3SO6 A;  3P7Z A;  5J3T A;  2XQN M;  1U27 A;  4DX8 A;  2HTH B;  2YT0 A;  3F0W A;  1XCG A;  1WG7 A;  2E2X A;  5LON B;  5HE1 A;  2ELB A;  2MWN B;  5J3Y A;  2W2W A;  1AWE A;  1DDV A;  5KQ1 A;  1UEF A;  4TYZ A;  1Y5O A;  4IAP A;  4HDO A;  2J59 M;  5CLL B;  3ODO A;  5C5B A;  2D9V A;  4KAX B;  1SHC A;  1P3R A;  2D2Q A;  2DHJ A;  3V5W A;  5GOW B;  2KCJ A;  2GJY A;  4KHO A;  2RGN B;  2LOZ A;  2P0H A;  1KZG A;  2NZ8 B;  5JLJ B;  1LW3 A;  4K2P A;  1V5U A;  2GCJ A;  1WJM A;  5C79 A;  1ZSQ A;  1V89 A;  3KRX A;  4EJN A;  1WGQ A;  1M7E A;  3AU4 A;  5KCV A;  1K5G B;  1DYN A;  3DXC A;  1NI2 A;  4A6F B;  3GYO A;  2DYQ A;  3U7D A;  4A6K A;  4CHM A;  3IVF A;  1OMW A;  1ZC3 B;  2D4Q A;  1MIZ B;  5DH9 B;  2D9Z A;  5JHG A;  1MK7 B;  5JP4 A;  2N23 A;  3PEG A;  2ADZ A;  1TXD A;  1EVH A;  2DKP A;  2KGX B;  2YRY A;  5D3X A;  2RVB B;  4B6H A;  2I5F A;  2EJ8 A;  3VIA A;  3FEH A;  2ZPY A;  2YT1 A;  4K81 A;  1FHW A;  3DXD A;  3MPX A;  3PP2 A;  2DYN A;  5DI9 B;  2BCJ A;  1U5G A;  2Y8G A;  4F7U P;  1X11 A;  5FI0 A;  2EC1 A;  4XWX A;  4D0N B;  2PZ1 A;  5HE2 A;  3QBV B;  3HW2 B;  4F7H A;  2ELA A;  1U29 A;  1RJ2 A;  1ZVR A;  2RLO A;  3SNH A;  3LJU X;  4BBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...