2N0YA

Nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Omega XaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/viral protein
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n0yA00
3KSYA 4HAXB 1J0WA 1UPQA 3CXBB 3AU5A 2D4QA 1DDVA 1FOEA 2NZ8B 2RNRB 4HB4B 4HB0B 4KHOA 5CLQB 1XD4A 1UNRA 2CY4A 2LYDA 4HAYB 2BCJA 4MY6A 3PG7A 4DXAB 2DKQA 2OQBA 4YONA 3LJUX 2EJ8A 1FGYA 1X86A 3A98B 4CHMA 4YL8A 2W2XD 3VOQA 1DDWA 3BJIA 3RCPA 1MKEA 1XODA 2RGNB 1W1HA 2MFQA 4GZUA 2P0DA 5JP4A 1WGQA 2UZRA 1GG3A 1U5GA 1M7EA 4Z2MB 2CODA 4H8SA 3TCAA 1ZVRA 4K17A 1PFJA 1OMWA 4HDQA 1X11A 4KVGB 5D3YA 3MPXA 3OANA 3KRXA 4EMOA 2RVBB 3NSUA 5CLLB 3G9WA 1BTKA 1WVHA 2Z0PA 3ODWA 3U7DA 2DYQA 3V5WA 2CRFA 3ODXA 1P6SA 5HE1A 4XWXA 1B55A 1FHOA 3WA0A 3SO6A 2M14A 3X23A 2DX1A 1ISNA 1KZ7A 1U5FA 4K2OA 4TYZA 2YS5A 4HHVA 2L1CA 2R09A 5L81A 5DH9B 4WJ7A 1WI1A 5HE2A 3P6AA 3SNHA 2DKPA 1NTYA 5KQ4A 1DYNA 5EFXA 2HTHB 3WYFB 5DHAB 2M38A 2J59M 4DX90 3FEHA 1OQNA 1U29A 2P8VA 1UNQA 2J0KA 1K5GB 1P3RA 2COFA 3AJ4A 4Y94A 4C0AA 1Z87A 2COAA 2VKIA 1WJMA 5LONB 2D10A 2KUPA 3GYOA 2LULA 1NI2A 1XCGA 2V76A 3PEGA 5J3QA 1I2HA 1MK9B 1GC6A 1XKEA 3TO1A 5FI0A 1NTVA 2QKLA 4IOYX 1MK7B 5KQ1A 2EMSA 4L6EA 1ZC3B 2K2UA 1ZM0A 4A6FB 2RSGA 3HK0A 3HW2B 1QC6A 3UZTA 2R0DA 1W1DA 4HB3B 3SV1A 2DHIA 2YS3A 3D8DA 1UPRA 1XR0B 2DHKA 2ELAA 2YSZA 1TXDA 4K2PA 1I7AA 1U2BA 4A5KA 4DX8A 2L2IA 1M7RA 4ZRIA 2DN6A 1H4RA 2N0YA 1WG7A 2IFSA 3PSCA 1ZC4B 4EJNA 5HE3A 2YT1A 3ULBA 2YRYA 2I5FA 3N7CA 2K00A 1W1GA 2EMTA 4NY0A 1FGZA 1Y19B 3MDBC 5KCVA 5C79A 4KAXB 1U5DA 1TQZA 4HB2B 2DX5A 3QWMA 1MPHA 2PZ1A 3PVUA 1FHWA 2NMBA 4MT7A 1WJ1A 2P0HA 1RRPB 2I1JA 2YT0A 4PQ0A 1IRSA 2DLWA 2H7EA 3PVWA 2GCLA 1FAOA 5HE0A 1PLSA 5D3XA 2ADZA 2DA0A 3DXEA 3SYXA 2JP2A 1MIZB 3SUZA 2D2QA 2J0MA 4GN1A 4GPTB 3HQCA 4WVFB 1EVHA 5JLJB 1K5DB 3QIJA 5C5BA 2DFKA 2LOZA 5J3YA 1NU2A 1EF1A 5JHGA 4CYEA 2DTCA 2I5CA 4BBKA 3ZDTA 4B6HA 4HAVB 1KZGA 3O96A 1XX0A 1GC7A 3AU4A 1V88A 4IFSA 2RUKB 2GCJA 2YF0A 1H10A 1SHCA 2Y8GA 1BAKA 3KZ1A 4A6FA 2DYNA 3F0WA 4DBBA 5D3WA 3U8ZA 1DBHA 2W2WA 2Z0QA 3IVFA 1TJ6A 2MKRA 2OTXA 4ZRJA 1Y5OA 1MIXA 4GMXB 1UNPA 2ELBA 1WGUA 3ML4A 1LB1A 2X18A 5C16A 1V61A 1EGXA 2W2XC 1N3HA 2VSZA 5DIFB 1QQGA 2D11A 2UVMA 2E2XA 1DDMA 4IAPA 1J19A 4PNKA 4A6KA 2VRWB 2LG1A 4F7GA 2D9VA 2YVCA 4MK0A 2IYBA 1EAZA 1V5PA 4HDOA 3P7ZA 2Y8FA 1V5MA 3KRWA 4A6HA 4HAWB 4P7IA 4HAUB 1FHXA 3DXCA 2MWNB 2LKOA 5C5BB 2H7DA 1OY2A 3KY9A 3A8PA 3PZDA 5DHFB 1X05A 2N23A 5D27A 4Z2NA 1KI1B 2Z0OA 2P0FA 2MDXA 1AWEA 3PVLA 4TKNA 3ZVRA 1SGHA 1P5TA 3ULCA 4GMVA 1RJ2A 3FSSA 3VIAA 4D0NB 3T06A 3PP2A 2Y7BA 3TW1A 1DROA 3GYPA 2UZSA 2EC1A 1U27A 2RLOA 4HATB 1BTNA 2J0JA 3M1IB 1LW3A 2KGXB 2K2JA 4NSWA 4CHJA 5C6RA 1U5EA 2HE7A 4F7UP 5JHHA 2AEHA 4HAZB 2KCJA 3CIKA 1MAIA 2ROVA 3D8EA 3D8FA 2Q13A 1X1GA 2YS1A 2COCA 5GOWB 2G35A 3A8QA 2CAYA 2QKMA 5LOPB 2GJYA 2GS0A 2ROZB 3BINA 1V5UA 3ODOA 1V89A 5FI1A 1X1FA 2ZPYA 2FJLA 3FM8C 2DHJA 2D9WA 5D3VA 3DXDA 2LOXA 4WSFA 4KHBB 2CY5A 1FB8A 3F5RA 3QBVB 4EKUA 2D9ZA 1BWNA 4K81A 5DI9B 4ZRKA 2D9XA 2AL6A 1Q67A 1AQCA 4F7HA 4GXBA 1ZSQA 5J3TA 3TFMA 3TVVA 1E5WA 4KHAA 2I1KA 2D9YA 1PMSA 1UEFA 2XQNM
chains in the Genus database with same CATH superfamily
3KSYA 4HAXB 1J0WA 1UPQA 3CXBB 3AU5A 2D4QA 1DDVA 1FOEA 2NZ8B 2RNRB 4HB4B 4HB0B 4KHOA 5CLQB 1XD4A 1UNRA 2CY4A 2LYDA 4HAYB 2BCJA 4MY6A 4GNKB 3PG7A 4DXAB 2DKQA 2OQBA 4YONA 3LJUX 2EJ8A 1FGYA 1X86A 3A98B 4CHMA 4YL8A 2W2XD 3VOQA 1DDWA 3BJIA 3RCPA 1MKEA 1XODA 2RGNB 1W1HA 2MFQA 4GZUA 2P0DA 5JP4A 3NWAA 1WGQA 2UZRA 1GG3A 1U5GA 1M7EA 4Z2MB 2CODA 4H8SA 3TCAA 1ZVRA 4K17A 1PFJA 4CSQA 1OMWA 4HDQA 1X11A 4KVGB 5D3YA 3MPXA 3OANA 4QJ5B 3KRXA 4EMOA 2RVBB 3NSUA 5CLLB 3G9WA 1BTKA 1WVHA 2Z0PA 3ODWA 3U7DA 2DYQA 3V5WA 2CRFA 3ODXA 4L1RA 1P6SA 3NW8A 5HE1A 1T77A 4XWXA 1B55A 1FHOA 3WA0A 3SO6A 2M14A 2FJUB 3X23A 2DX1A 3HSAA 1ISNA 1KZ7A 1U5FA 4K2OA 4TYZA 2YS5A 4HHVA 2L1CA 2R09A 5L81A 5DH9B 4WJ7A 1WI1A 5HE2A 3P6AA 3SNHA 2DKPA 1NTYA 5KQ4A 1DYNA 5EFXA 2HTHB 3WYFB 2K49A 5DHAB 2M38A 2J59M 4DX90 3FEHA 1OQNA 1U29A 2P8VA 1UNQA 2J0KA 1K5GB 1P3RA 2KIGA 2COFA 3AJ4A 4Y94A 2Z13A 2GUMA 4C0AA 1Z87A 2COAA 2VKIA 3DCXA 1WJMA 3A58A 5LONB 2D10A 2KUPA 3GYOA 2LULA 1NI2A 1XCGA 2V76A 3PEGA 5J3QA 1I2HA 2ZKMX 1MK9B 1GC6A 1XKEA 3TO1A 2RRFA 5FI0A 1NTVA 2QKLA 4IOYX 1MK7B 5KQ1A 2EMSA 2NBVA 4L6EA 1ZC3B 2K2UA 1ZM0A 4A6FB 4QJ3B 2RSGA 3HK0A 3HW2B 1QC6A 3UZTA 2KIEA 2R0DA 1MI1A 1W1DA 4HB3B 3SV1A 2DHIA 2YS3A 3D8DA 1UPRA 1XR0B 2DHKA 2ELAA 2YSZA 1TXDA 4K2PA 1I7AA 1U2BA 4A5KA 4DX8A 2L2IA 1M7RA 4ZRIA 2DN6A 1H4RA 2N0YA 1WG7A 2IFSA 3PSCA 1ZC4B 4EJNA 5HE3A 2YT1A 3ULBA 2YRYA 2I5FA 3N7CA 4DIXA 2K00A 3FVCA 1W1GA 2KR0A 2EMTA 4NY0A 1FGZA 1Y19B 3MDBC 5KCVA 5C79A 2Z4DA 4KAXB 1U5DA 2Z59A 1TQZA 4HB2B 2DX5A 3QWMA 1MPHA 2PZ1A 3PVUA 1FHWA 2NMBA 4MT7A 1WJ1A 2P0HA 1RRPB 2I1JA 2YT0A 4PQ0A 1IRSA 2DLWA 2H7EA 3PVWA 2GCLA 4GOUA 5LG4B 1FAOA 5HE0A 1PLSA 5D3XA 2ADZA 2DA0A 3DXEA 3SYXA 2JP2A 1ZYIA 1MIZB 3SUZA 2D2QA 2J0MA 3NWDA 4GN1A 4GPTB 3HQCA 4WVFB 1EVHA 5JLJB 1K5DB 3QIJA 5C5BA 2DFKA 4OSNA 2LOZA 5J3YA 1NU2A 1EF1A 5JHGA 4CYEA 2DTCA 3U12A 2I5CA 4BBKA 3ZDTA 5I2MA 4B6HA 4HAVB 1KZGA 3O96A 1XX0A 1GC7A 3AU4A 1V88A 4IFSA 2RUKB 2Z14A 2GCJA 2YF0A 1H10A 1SHCA 2Y8GA 5I2SA 1BAKA 3KZ1A 4A6FA 2DYNA 3F0WA 4DBBA 5D3WA 3U8ZA 1DBHA 2W2WA 2Z0QA 3IVFA 1TJ6A 2MKRA 2OTXA 4ZRJA 1Y5OA 1MIXA 4GMXB 1UNPA 3HIEA 2ELBA 1WGUA 3ML4A 1LB1A 2X18A 5C16A 1V61A 1EGXA 2W2XC 1N3HA 2VSZA 5DIFB 1QQGA 2D11A 2UVMA 2E2XA 1DDMA 4IAPA 1J19A 4HSIA 4PNKA 4A6KA 2VRWB 2LG1A 4F7GA 4QJ4B 2D9VA 2YVCA 4MK0A 2IYBA 1EAZA 1V5PA 4HDOA 3P7ZA 2Y8FA 1V5MA 3KRWA 4A6HA 4HAWB 4P7IA 4HAUB 1FHXA 3DXCA 2MWNB 2LKOA 5C5BB 2H7DA 1OY2A 3KY9A 3A8PA 3PZDA 5DHFB 1X05A 2N23A 5D27A 4Z2NA 1KI1B 2Z0OA 2P0FA 2MDXA 1AWEA 3PVLA 4TKNA 3ZVRA 1SGHA 1P5TA 3ULCA 4QXAB 4GMVA 1RJ2A 3FSSA 4OT1A 3VIAA 4D0NB 3T06A 3PP2A 2Y7BA 3OHMB 3TW1A 5M4YB 1DROA 3GYPA 2UZSA 2EC1A 1U27A 2RLOA 2KUQA 4HATB 1BTNA 2J0JA 3M1IB 2R2YA 1LW3A 2KGXB 2K2JA 4NSWA 4CHJA 5C6RA 1U5EA 2HE7A 3B77A 4F7UP 5JHHA 2AEHA 3CIKA 2KCJA 4HAZB 1MAIA 2ROVA 3D8EA 3D8FA 2Q13A 1X1GA 2YS1A 5IRSA 2COCA 5GOWB 2G35A 3A8QA 2CAYA 2QKMA 5LOPB 2GJYA 2GS0A 2ROZB 3NWFA 3BINA 1V5UA 3ODOA 1V89A 5FI1A 2K8EA 1X1FA 2ZPYA 2FJLA 3FM8C 2DHJA 2D9WA 5D3VA 3DXDA 2LOXA 4WSFA 4D6WA 4KHBB 2CY5A 1FB8A 3F5RA 3QBVB 4EKUA 2D9ZA 1BWNA 4K81A 5DI9B 4ZRKA 2D9XA 2YT2A 2AL6A 1Q67A 1AQCA 4F7HA 4GXBA 1ZSQA 4KHBA 5J3TA 3TFMA 3TVVA 1E5WA 4KHAA 2I1KA 2D9YA 1PMSA 1UEFA 2XQNM
chains in the Genus database with same CATH topology
3KSYA 4HAXB 1J0WA 1UPQA 3CXBB 3AU5A 2D4QA 1DDVA 1FOEA 2NZ8B 2RNRB 4HB4B 4HB0B 4KHOA 5CLQB 1XD4A 1UNRA 2CY4A 2LYDA 4HAYB 2BCJA 4MY6A 3PG7A 4DXAB 2DKQA 2OQBA 4YONA 3LJUX 2EJ8A 1FGYA 1X86A 3A98B 4CHMA 4YL8A 2W2XD 3VOQA 1DDWA 3BJIA 3RCPA 1MKEA 1XODA 2RGNB 1W1HA 2MFQA 4GZUA 2P0DA 5JP4A 1WGQA 2UZRA 1GG3A 1U5GA 1M7EA 4Z2MB 2CODA 4H8SA 3TCAA 1ZVRA 4K17A 1PFJA 1OMWA 4HDQA 1X11A 4KVGB 5D3YA 3MPXA 3OANA 3KRXA 4EMOA 2RVBB 3NSUA 5CLLB 3G9WA 1BTKA 1WVHA 2Z0PA 3ODWA 3U7DA 2DYQA 3V5WA 2CRFA 3ODXA 1P6SA 5HE1A 4XWXA 1B55A 1FHOA 3WA0A 3SO6A 2M14A 3X23A 2DX1A 1ISNA 1KZ7A 1U5FA 4K2OA 4TYZA 2YS5A 4HHVA 2L1CA 2R09A 5L81A 5DH9B 4WJ7A 1WI1A 5HE2A 3P6AA 3SNHA 2DKPA 1NTYA 5KQ4A 1DYNA 5EFXA 2HTHB 3WYFB 5DHAB 2M38A 2J59M 4DX90 3FEHA 1OQNA 1U29A 2P8VA 1UNQA 2J0KA 1K5GB 1P3RA 2COFA 3AJ4A 4Y94A 4C0AA 1Z87A 2COAA 2VKIA 1WJMA 5LONB 2D10A 2KUPA 3GYOA 2LULA 1NI2A 1XCGA 2V76A 3PEGA 5J3QA 1I2HA 1MK9B 1GC6A 1XKEA 3TO1A 5FI0A 1NTVA 2QKLA 4IOYX 1MK7B 5KQ1A 2EMSA 4L6EA 1ZC3B 2K2UA 1ZM0A 4A6FB 2RSGA 3HK0A 3HW2B 1QC6A 3UZTA 2R0DA 1W1DA 4HB3B 3SV1A 2DHIA 2YS3A 3D8DA 1UPRA 1XR0B 2DHKA 2ELAA 2YSZA 1TXDA 4K2PA 1I7AA 1U2BA 4A5KA 4DX8A 2L2IA 1M7RA 4ZRIA 2DN6A 1H4RA 2N0YA 1WG7A 2IFSA 3PSCA 1ZC4B 4EJNA 5HE3A 2YT1A 3ULBA 2YRYA 2I5FA 3N7CA 2K00A 1W1GA 2EMTA 4NY0A 1FGZA 1Y19B 3MDBC 5KCVA 5C79A 4KAXB 1U5DA 1TQZA 4HB2B 2DX5A 3QWMA 1MPHA 2PZ1A 3PVUA 1FHWA 2NMBA 4MT7A 1WJ1A 2P0HA 1RRPB 2I1JA 2YT0A 4PQ0A 1IRSA 2DLWA 2H7EA 3PVWA 2GCLA 1FAOA 5HE0A 1PLSA 5D3XA 2ADZA 2DA0A 3DXEA 3SYXA 2JP2A 1MIZB 3SUZA 2D2QA 2J0MA 4GN1A 4GPTB 3HQCA 4WVFB 1EVHA 5JLJB 1K5DB 3QIJA 5C5BA 2DFKA 2LOZA 5J3YA 1NU2A 1EF1A 5JHGA 4CYEA 2DTCA 2I5CA 4BBKA 3ZDTA 4B6HA 4HAVB 1KZGA 3O96A 1XX0A 1GC7A 3AU4A 1V88A 4IFSA 2RUKB 2GCJA 2YF0A 1H10A 1SHCA 2Y8GA 1BAKA 3KZ1A 4A6FA 2DYNA 3F0WA 4DBBA 5D3WA 3U8ZA 1DBHA 2W2WA 2Z0QA 3IVFA 1TJ6A 2MKRA 2OTXA 4ZRJA 1Y5OA 1MIXA 4GMXB 1UNPA 2ELBA 1WGUA 3ML4A 1LB1A 2X18A 5C16A 1V61A 1EGXA 2W2XC 1N3HA 2VSZA 5DIFB 1QQGA 2D11A 2UVMA 2E2XA 1DDMA 4IAPA 1J19A 4PNKA 4A6KA 2VRWB 2LG1A 4F7GA 2D9VA 2YVCA 4MK0A 2IYBA 1EAZA 1V5PA 4HDOA 3P7ZA 2Y8FA 1V5MA 3KRWA 4A6HA 4HAWB 4P7IA 4HAUB 1FHXA 3DXCA 2MWNB 2LKOA 5C5BB 2H7DA 1OY2A 3KY9A 3A8PA 3PZDA 5DHFB 1X05A 2N23A 5D27A 4Z2NA 1KI1B 2Z0OA 2P0FA 2MDXA 1AWEA 3PVLA 4TKNA 3ZVRA 1SGHA 1P5TA 3ULCA 4GMVA 1RJ2A 3FSSA 3VIAA 4D0NB 3T06A 3PP2A 2Y7BA 3TW1A 1DROA 3GYPA 2UZSA 2EC1A 1U27A 2RLOA 4HATB 1BTNA 2J0JA 3M1IB 1LW3A 2KGXB 2K2JA 4NSWA 4CHJA 5C6RA 1U5EA 2HE7A 4F7UP 5JHHA 2AEHA 4HAZB 2KCJA 3CIKA 1MAIA 2ROVA 3D8EA 3D8FA 2Q13A 1X1GA 2YS1A 2COCA 5GOWB 2G35A 3A8QA 2CAYA 2QKMA 5LOPB 2GJYA 2GS0A 2ROZB 3BINA 1V5UA 3ODOA 1V89A 5FI1A 1X1FA 2ZPYA 2FJLA 3FM8C 2DHJA 2D9WA 5D3VA 3DXDA 2LOXA 4WSFA 4KHBB 2CY5A 1FB8A 3F5RA 3QBVB 4EKUA 2D9ZA 1BWNA 4K81A 5DI9B 4ZRKA 2D9XA 2AL6A 1Q67A 1AQCA 4F7HA 4GXBA 1ZSQA 5J3TA 3TFMA 3TVVA 1E5WA 4KHAA 2I1KA 2D9YA 1PMSA 1UEFA 2XQNM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  4HAX B;  1J0W A;  1UPQ A;  3CXB B;  3AU5 A;  2D4Q A;  1DDV A;  1FOE A;  2NZ8 B;  2RNR B;  4HB4 B;  4HB0 B;  4KHO A;  5CLQ B;  1XD4 A;  1UNR A;  2CY4 A;  2LYD A;  4HAY B;  2BCJ A;  4MY6 A;  3PG7 A;  4DXA B;  2DKQ A;  2OQB A;  4YON A;  3LJU X;  2EJ8 A;  1FGY A;  1X86 A;  3A98 B;  4CHM A;  4YL8 A;  2W2X D;  3VOQ A;  1DDW A;  3BJI A;  3RCP A;  1MKE A;  1XOD A;  2RGN B;  1W1H A;  2MFQ A;  4GZU A;  2P0D A;  5JP4 A;  1WGQ A;  2UZR A;  1GG3 A;  1U5G A;  1M7E A;  4Z2M B;  2COD A;  4H8S A;  3TCA A;  1ZVR A;  4K17 A;  1PFJ A;  1OMW A;  4HDQ A;  1X11 A;  4KVG B;  5D3Y A;  3MPX A;  3OAN A;  3KRX A;  4EMO A;  2RVB B;  3NSU A;  5CLL B;  3G9W A;  1BTK A;  1WVH A;  2Z0P A;  3ODW A;  3U7D A;  2DYQ A;  3V5W A;  2CRF A;  3ODX A;  1P6S A;  5HE1 A;  4XWX A;  1B55 A;  1FHO A;  3WA0 A;  3SO6 A;  2M14 A;  3X23 A;  2DX1 A;  1ISN A;  1KZ7 A;  1U5F A;  4K2O A;  4TYZ A;  2YS5 A;  4HHV A;  2L1C A;  2R09 A;  5L81 A;  5DH9 B;  4WJ7 A;  1WI1 A;  5HE2 A;  3P6A A;  3SNH A;  2DKP A;  1NTY A;  5KQ4 A;  1DYN A;  5EFX A;  2HTH B;  3WYF B;  5DHA B;  2M38 A;  2J59 M;  4DX9 0;  3FEH A;  1OQN A;  1U29 A;  2P8V A;  1UNQ A;  2J0K A;  1K5G B;  1P3R A;  2COF A;  3AJ4 A;  4Y94 A;  4C0A A;  1Z87 A;  2COA A;  2VKI A;  1WJM A;  5LON B;  2D10 A;  2KUP A;  3GYO A;  2LUL A;  1NI2 A;  1XCG A;  2V76 A;  3PEG A;  5J3Q A;  1I2H A;  1MK9 B;  1GC6 A;  1XKE A;  3TO1 A;  5FI0 A;  1NTV A;  2QKL A;  4IOY X;  1MK7 B;  5KQ1 A;  2EMS A;  4L6E A;  1ZC3 B;  2K2U A;  1ZM0 A;  4A6F B;  2RSG A;  3HK0 A;  3HW2 B;  1QC6 A;  3UZT A;  2R0D A;  1W1D A;  4HB3 B;  3SV1 A;  2DHI A;  2YS3 A;  3D8D A;  1UPR A;  1XR0 B;  2DHK A;  2ELA A;  2YSZ A;  1TXD A;  4K2P A;  1I7A A;  1U2B A;  4A5K A;  4DX8 A;  2L2I A;  1M7R A;  4ZRI A;  2DN6 A;  1H4R A;  2N0Y A;  1WG7 A;  2IFS A;  3PSC A;  1ZC4 B;  4EJN A;  5HE3 A;  2YT1 A;  3ULB A;  2YRY A;  2I5F A;  3N7C A;  2K00 A;  1W1G A;  2EMT A;  4NY0 A;  1FGZ A;  1Y19 B;  3MDB C;  5KCV A;  5C79 A;  4KAX B;  1U5D A;  1TQZ A;  4HB2 B;  2DX5 A;  3QWM A;  1MPH A;  2PZ1 A;  3PVU A;  1FHW A;  2NMB A;  4MT7 A;  1WJ1 A;  2P0H A;  1RRP B;  2I1J A;  2YT0 A;  4PQ0 A;  1IRS A;  2DLW A;  2H7E A;  3PVW A;  2GCL A;  1FAO A;  5HE0 A;  1PLS A;  5D3X A;  2ADZ A;  2DA0 A;  3DXE A;  3SYX A;  2JP2 A;  1MIZ B;  3SUZ A;  2D2Q A;  2J0M A;  4GN1 A;  4GPT B;  3HQC A;  4WVF B;  1EVH A;  5JLJ B;  1K5D B;  3QIJ A;  5C5B A;  2DFK A;  2LOZ A;  5J3Y A;  1NU2 A;  1EF1 A;  5JHG A;  4CYE A;  2DTC A;  2I5C A;  4BBK A;  3ZDT A;  4B6H A;  4HAV B;  1KZG A;  3O96 A;  1XX0 A;  1GC7 A;  3AU4 A;  1V88 A;  4IFS A;  2RUK B;  2GCJ A;  2YF0 A;  1H10 A;  1SHC A;  2Y8G A;  1BAK A;  3KZ1 A;  4A6F A;  2DYN A;  3F0W A;  4DBB A;  5D3W A;  3U8Z A;  1DBH A;  2W2W A;  2Z0Q A;  3IVF A;  1TJ6 A;  2MKR A;  2OTX A;  4ZRJ A;  1Y5O A;  1MIX A;  4GMX B;  1UNP A;  2ELB A;  1WGU A;  3ML4 A;  1LB1 A;  2X18 A;  5C16 A;  1V61 A;  1EGX A;  2W2X C;  1N3H A;  2VSZ A;  5DIF B;  1QQG A;  2D11 A;  2UVM A;  2E2X A;  1DDM A;  4IAP A;  1J19 A;  4PNK A;  4A6K A;  2VRW B;  2LG1 A;  4F7G A;  2D9V A;  2YVC A;  4MK0 A;  2IYB A;  1EAZ A;  1V5P A;  4HDO A;  3P7Z A;  2Y8F A;  1V5M A;  3KRW A;  4A6H A;  4HAW B;  4P7I A;  4HAU B;  1FHX A;  3DXC A;  2MWN B;  2LKO A;  5C5B B;  2H7D A;  1OY2 A;  3KY9 A;  3A8P A;  3PZD A;  5DHF B;  1X05 A;  2N23 A;  5D27 A;  4Z2N A;  1KI1 B;  2Z0O A;  2P0F A;  2MDX A;  1AWE A;  3PVL A;  4TKN A;  3ZVR A;  1SGH A;  1P5T A;  3ULC A;  4GMV A;  1RJ2 A;  3FSS A;  3VIA A;  4D0N B;  3T06 A;  3PP2 A;  2Y7B A;  3TW1 A;  1DRO A;  3GYP A;  2UZS A;  2EC1 A;  1U27 A;  2RLO A;  4HAT B;  1BTN A;  2J0J A;  3M1I B;  1LW3 A;  2KGX B;  2K2J A;  4NSW A;  4CHJ A;  5C6R A;  1U5E A;  2HE7 A;  4F7U P;  5JHH A;  2AEH A;  4HAZ B;  2KCJ A;  3CIK A;  1MAI A;  2ROV A;  3D8E A;  3D8F A;  2Q13 A;  1X1G A;  2YS1 A;  2COC A;  5GOW B;  2G35 A;  3A8Q A;  2CAY A;  2QKM A;  5LOP B;  2GJY A;  2GS0 A;  2ROZ B;  3BIN A;  1V5U A;  3ODO A;  1V89 A;  5FI1 A;  1X1F A;  2ZPY A;  2FJL A;  3FM8 C;  2DHJ A;  2D9W A;  5D3V A;  3DXD A;  2LOX A;  4WSF A;  4KHB B;  2CY5 A;  1FB8 A;  3F5R A;  3QBV B;  4EKU A;  2D9Z A;  1BWN A;  4K81 A;  5DI9 B;  4ZRK A;  2D9X A;  2AL6 A;  1Q67 A;  1AQC A;  4F7H A;  4GXB A;  1ZSQ A;  5J3T A;  3TFM A;  3TVV A;  1E5W A;  4KHA A;  2I1K A;  2D9Y A;  1PMS A;  1UEF A;  2XQN M; 
#chains in the Genus database with same CATH topology
 3KSY A;  4HAX B;  1J0W A;  1UPQ A;  3CXB B;  3AU5 A;  2D4Q A;  1DDV A;  1FOE A;  2NZ8 B;  2RNR B;  4HB4 B;  4HB0 B;  4KHO A;  5CLQ B;  1XD4 A;  1UNR A;  2CY4 A;  2LYD A;  4HAY B;  2BCJ A;  4MY6 A;  4GNK B;  3PG7 A;  4DXA B;  2DKQ A;  2OQB A;  4YON A;  3LJU X;  2EJ8 A;  1FGY A;  1X86 A;  3A98 B;  4CHM A;  4YL8 A;  2W2X D;  3VOQ A;  1DDW A;  3BJI A;  3RCP A;  1MKE A;  1XOD A;  2RGN B;  1W1H A;  2MFQ A;  4GZU A;  2P0D A;  5JP4 A;  3NWA A;  1WGQ A;  2UZR A;  1GG3 A;  1U5G A;  1M7E A;  4Z2M B;  2COD A;  4H8S A;  3TCA A;  1ZVR A;  4K17 A;  1PFJ A;  4CSQ A;  1OMW A;  4HDQ A;  1X11 A;  4KVG B;  5D3Y A;  3MPX A;  3OAN A;  4QJ5 B;  3KRX A;  4EMO A;  2RVB B;  3NSU A;  5CLL B;  3G9W A;  1BTK A;  1WVH A;  2Z0P A;  3ODW A;  3U7D A;  2DYQ A;  3V5W A;  2CRF A;  3ODX A;  4L1R A;  1P6S A;  3NW8 A;  5HE1 A;  1T77 A;  4XWX A;  1B55 A;  1FHO A;  3WA0 A;  3SO6 A;  2M14 A;  2FJU B;  3X23 A;  2DX1 A;  3HSA A;  1ISN A;  1KZ7 A;  1U5F A;  4K2O A;  4TYZ A;  2YS5 A;  4HHV A;  2L1C A;  2R09 A;  5L81 A;  5DH9 B;  4WJ7 A;  1WI1 A;  5HE2 A;  3P6A A;  3SNH A;  2DKP A;  1NTY A;  5KQ4 A;  1DYN A;  5EFX A;  2HTH B;  3WYF B;  2K49 A;  5DHA B;  2M38 A;  2J59 M;  4DX9 0;  3FEH A;  1OQN A;  1U29 A;  2P8V A;  1UNQ A;  2J0K A;  1K5G B;  1P3R A;  2KIG A;  2COF A;  3AJ4 A;  4Y94 A;  2Z13 A;  2GUM A;  4C0A A;  1Z87 A;  2COA A;  2VKI A;  3DCX A;  1WJM A;  3A58 A;  5LON B;  2D10 A;  2KUP A;  3GYO A;  2LUL A;  1NI2 A;  1XCG A;  2V76 A;  3PEG A;  5J3Q A;  1I2H A;  2ZKM X;  1MK9 B;  1GC6 A;  1XKE A;  3TO1 A;  2RRF A;  5FI0 A;  1NTV A;  2QKL A;  4IOY X;  1MK7 B;  5KQ1 A;  2EMS A;  2NBV A;  4L6E A;  1ZC3 B;  2K2U A;  1ZM0 A;  4A6F B;  4QJ3 B;  2RSG A;  3HK0 A;  3HW2 B;  1QC6 A;  3UZT A;  2KIE A;  2R0D A;  1MI1 A;  1W1D A;  4HB3 B;  3SV1 A;  2DHI A;  2YS3 A;  3D8D A;  1UPR A;  1XR0 B;  2DHK A;  2ELA A;  2YSZ A;  1TXD A;  4K2P A;  1I7A A;  1U2B A;  4A5K A;  4DX8 A;  2L2I A;  1M7R A;  4ZRI A;  2DN6 A;  1H4R A;  2N0Y A;  1WG7 A;  2IFS A;  3PSC A;  1ZC4 B;  4EJN A;  5HE3 A;  2YT1 A;  3ULB A;  2YRY A;  2I5F A;  3N7C A;  4DIX A;  2K00 A;  3FVC A;  1W1G A;  2KR0 A;  2EMT A;  4NY0 A;  1FGZ A;  1Y19 B;  3MDB C;  5KCV A;  5C79 A;  2Z4D A;  4KAX B;  1U5D A;  2Z59 A;  1TQZ A;  4HB2 B;  2DX5 A;  3QWM A;  1MPH A;  2PZ1 A;  3PVU A;  1FHW A;  2NMB A;  4MT7 A;  1WJ1 A;  2P0H A;  1RRP B;  2I1J A;  2YT0 A;  4PQ0 A;  1IRS A;  2DLW A;  2H7E A;  3PVW A;  2GCL A;  4GOU A;  5LG4 B;  1FAO A;  5HE0 A;  1PLS A;  5D3X A;  2ADZ A;  2DA0 A;  3DXE A;  3SYX A;  2JP2 A;  1ZYI A;  1MIZ B;  3SUZ A;  2D2Q A;  2J0M A;  3NWD A;  4GN1 A;  4GPT B;  3HQC A;  4WVF B;  1EVH A;  5JLJ B;  1K5D B;  3QIJ A;  5C5B A;  2DFK A;  4OSN A;  2LOZ A;  5J3Y A;  1NU2 A;  1EF1 A;  5JHG A;  4CYE A;  2DTC A;  3U12 A;  2I5C A;  4BBK A;  3ZDT A;  5I2M A;  4B6H A;  4HAV B;  1KZG A;  3O96 A;  1XX0 A;  1GC7 A;  3AU4 A;  1V88 A;  4IFS A;  2RUK B;  2Z14 A;  2GCJ A;  2YF0 A;  1H10 A;  1SHC A;  2Y8G A;  5I2S A;  1BAK A;  3KZ1 A;  4A6F A;  2DYN A;  3F0W A;  4DBB A;  5D3W A;  3U8Z A;  1DBH A;  2W2W A;  2Z0Q A;  3IVF A;  1TJ6 A;  2MKR A;  2OTX A;  4ZRJ A;  1Y5O A;  1MIX A;  4GMX B;  1UNP A;  3HIE A;  2ELB A;  1WGU A;  3ML4 A;  1LB1 A;  2X18 A;  5C16 A;  1V61 A;  1EGX A;  2W2X C;  1N3H A;  2VSZ A;  5DIF B;  1QQG A;  2D11 A;  2UVM A;  2E2X A;  1DDM A;  4IAP A;  1J19 A;  4HSI A;  4PNK A;  4A6K A;  2VRW B;  2LG1 A;  4F7G A;  4QJ4 B;  2D9V A;  2YVC A;  4MK0 A;  2IYB A;  1EAZ A;  1V5P A;  4HDO A;  3P7Z A;  2Y8F A;  1V5M A;  3KRW A;  4A6H A;  4HAW B;  4P7I A;  4HAU B;  1FHX A;  3DXC A;  2MWN B;  2LKO A;  5C5B B;  2H7D A;  1OY2 A;  3KY9 A;  3A8P A;  3PZD A;  5DHF B;  1X05 A;  2N23 A;  5D27 A;  4Z2N A;  1KI1 B;  2Z0O A;  2P0F A;  2MDX A;  1AWE A;  3PVL A;  4TKN A;  3ZVR A;  1SGH A;  1P5T A;  3ULC A;  4QXA B;  4GMV A;  1RJ2 A;  3FSS A;  4OT1 A;  3VIA A;  4D0N B;  3T06 A;  3PP2 A;  2Y7B A;  3OHM B;  3TW1 A;  5M4Y B;  1DRO A;  3GYP A;  2UZS A;  2EC1 A;  1U27 A;  2RLO A;  2KUQ A;  4HAT B;  1BTN A;  2J0J A;  3M1I B;  2R2Y A;  1LW3 A;  2KGX B;  2K2J A;  4NSW A;  4CHJ A;  5C6R A;  1U5E A;  2HE7 A;  3B77 A;  4F7U P;  5JHH A;  2AEH A;  3CIK A;  2KCJ A;  4HAZ B;  1MAI A;  2ROV A;  3D8E A;  3D8F A;  2Q13 A;  1X1G A;  2YS1 A;  5IRS A;  2COC A;  5GOW B;  2G35 A;  3A8Q A;  2CAY A;  2QKM A;  5LOP B;  2GJY A;  2GS0 A;  2ROZ B;  3NWF A;  3BIN A;  1V5U A;  3ODO A;  1V89 A;  5FI1 A;  2K8E A;  1X1F A;  2ZPY A;  2FJL A;  3FM8 C;  2DHJ A;  2D9W A;  5D3V A;  3DXD A;  2LOX A;  4WSF A;  4D6W A;  4KHB B;  2CY5 A;  1FB8 A;  3F5R A;  3QBV B;  4EKU A;  2D9Z A;  1BWN A;  4K81 A;  5DI9 B;  4ZRK A;  2D9X A;  2YT2 A;  2AL6 A;  1Q67 A;  1AQC A;  4F7H A;  4GXB A;  1ZSQ A;  4KHB A;  5J3T A;  3TFM A;  3TVV A;  1E5W A;  4KHA A;  2I1K A;  2D9Y A;  1PMS A;  1UEF A;  2XQN M; 
#chains in the Genus database with same CATH homology
 3KSY A;  4HAX B;  1J0W A;  1UPQ A;  3CXB B;  3AU5 A;  2D4Q A;  1DDV A;  1FOE A;  2NZ8 B;  2RNR B;  4HB4 B;  4HB0 B;  4KHO A;  5CLQ B;  1XD4 A;  1UNR A;  2CY4 A;  2LYD A;  4HAY B;  2BCJ A;  4MY6 A;  3PG7 A;  4DXA B;  2DKQ A;  2OQB A;  4YON A;  3LJU X;  2EJ8 A;  1FGY A;  1X86 A;  3A98 B;  4CHM A;  4YL8 A;  2W2X D;  3VOQ A;  1DDW A;  3BJI A;  3RCP A;  1MKE A;  1XOD A;  2RGN B;  1W1H A;  2MFQ A;  4GZU A;  2P0D A;  5JP4 A;  1WGQ A;  2UZR A;  1GG3 A;  1U5G A;  1M7E A;  4Z2M B;  2COD A;  4H8S A;  3TCA A;  1ZVR A;  4K17 A;  1PFJ A;  1OMW A;  4HDQ A;  1X11 A;  4KVG B;  5D3Y A;  3MPX A;  3OAN A;  3KRX A;  4EMO A;  2RVB B;  3NSU A;  5CLL B;  3G9W A;  1BTK A;  1WVH A;  2Z0P A;  3ODW A;  3U7D A;  2DYQ A;  3V5W A;  2CRF A;  3ODX A;  1P6S A;  5HE1 A;  4XWX A;  1B55 A;  1FHO A;  3WA0 A;  3SO6 A;  2M14 A;  3X23 A;  2DX1 A;  1ISN A;  1KZ7 A;  1U5F A;  4K2O A;  4TYZ A;  2YS5 A;  4HHV A;  2L1C A;  2R09 A;  5L81 A;  5DH9 B;  4WJ7 A;  1WI1 A;  5HE2 A;  3P6A A;  3SNH A;  2DKP A;  1NTY A;  5KQ4 A;  1DYN A;  5EFX A;  2HTH B;  3WYF B;  5DHA B;  2M38 A;  2J59 M;  4DX9 0;  3FEH A;  1OQN A;  1U29 A;  2P8V A;  1UNQ A;  2J0K A;  1K5G B;  1P3R A;  2COF A;  3AJ4 A;  4Y94 A;  4C0A A;  1Z87 A;  2COA A;  2VKI A;  1WJM A;  5LON B;  2D10 A;  2KUP A;  3GYO A;  2LUL A;  1NI2 A;  1XCG A;  2V76 A;  3PEG A;  5J3Q A;  1I2H A;  1MK9 B;  1GC6 A;  1XKE A;  3TO1 A;  5FI0 A;  1NTV A;  2QKL A;  4IOY X;  1MK7 B;  5KQ1 A;  2EMS A;  4L6E A;  1ZC3 B;  2K2U A;  1ZM0 A;  4A6F B;  2RSG A;  3HK0 A;  3HW2 B;  1QC6 A;  3UZT A;  2R0D A;  1W1D A;  4HB3 B;  3SV1 A;  2DHI A;  2YS3 A;  3D8D A;  1UPR A;  1XR0 B;  2DHK A;  2ELA A;  2YSZ A;  1TXD A;  4K2P A;  1I7A A;  1U2B A;  4A5K A;  4DX8 A;  2L2I A;  1M7R A;  4ZRI A;  2DN6 A;  1H4R A;  2N0Y A;  1WG7 A;  2IFS A;  3PSC A;  1ZC4 B;  4EJN A;  5HE3 A;  2YT1 A;  3ULB A;  2YRY A;  2I5F A;  3N7C A;  2K00 A;  1W1G A;  2EMT A;  4NY0 A;  1FGZ A;  1Y19 B;  3MDB C;  5KCV A;  5C79 A;  4KAX B;  1U5D A;  1TQZ A;  4HB2 B;  2DX5 A;  3QWM A;  1MPH A;  2PZ1 A;  3PVU A;  1FHW A;  2NMB A;  4MT7 A;  1WJ1 A;  2P0H A;  1RRP B;  2I1J A;  2YT0 A;  4PQ0 A;  1IRS A;  2DLW A;  2H7E A;  3PVW A;  2GCL A;  1FAO A;  5HE0 A;  1PLS A;  5D3X A;  2ADZ A;  2DA0 A;  3DXE A;  3SYX A;  2JP2 A;  1MIZ B;  3SUZ A;  2D2Q A;  2J0M A;  4GN1 A;  4GPT B;  3HQC A;  4WVF B;  1EVH A;  5JLJ B;  1K5D B;  3QIJ A;  5C5B A;  2DFK A;  2LOZ A;  5J3Y A;  1NU2 A;  1EF1 A;  5JHG A;  4CYE A;  2DTC A;  2I5C A;  4BBK A;  3ZDT A;  4B6H A;  4HAV B;  1KZG A;  3O96 A;  1XX0 A;  1GC7 A;  3AU4 A;  1V88 A;  4IFS A;  2RUK B;  2GCJ A;  2YF0 A;  1H10 A;  1SHC A;  2Y8G A;  1BAK A;  3KZ1 A;  4A6F A;  2DYN A;  3F0W A;  4DBB A;  5D3W A;  3U8Z A;  1DBH A;  2W2W A;  2Z0Q A;  3IVF A;  1TJ6 A;  2MKR A;  2OTX A;  4ZRJ A;  1Y5O A;  1MIX A;  4GMX B;  1UNP A;  2ELB A;  1WGU A;  3ML4 A;  1LB1 A;  2X18 A;  5C16 A;  1V61 A;  1EGX A;  2W2X C;  1N3H A;  2VSZ A;  5DIF B;  1QQG A;  2D11 A;  2UVM A;  2E2X A;  1DDM A;  4IAP A;  1J19 A;  4PNK A;  4A6K A;  2VRW B;  2LG1 A;  4F7G A;  2D9V A;  2YVC A;  4MK0 A;  2IYB A;  1EAZ A;  1V5P A;  4HDO A;  3P7Z A;  2Y8F A;  1V5M A;  3KRW A;  4A6H A;  4HAW B;  4P7I A;  4HAU B;  1FHX A;  3DXC A;  2MWN B;  2LKO A;  5C5B B;  2H7D A;  1OY2 A;  3KY9 A;  3A8P A;  3PZD A;  5DHF B;  1X05 A;  2N23 A;  5D27 A;  4Z2N A;  1KI1 B;  2Z0O A;  2P0F A;  2MDX A;  1AWE A;  3PVL A;  4TKN A;  3ZVR A;  1SGH A;  1P5T A;  3ULC A;  4GMV A;  1RJ2 A;  3FSS A;  3VIA A;  4D0N B;  3T06 A;  3PP2 A;  2Y7B A;  3TW1 A;  1DRO A;  3GYP A;  2UZS A;  2EC1 A;  1U27 A;  2RLO A;  4HAT B;  1BTN A;  2J0J A;  3M1I B;  1LW3 A;  2KGX B;  2K2J A;  4NSW A;  4CHJ A;  5C6R A;  1U5E A;  2HE7 A;  4F7U P;  5JHH A;  2AEH A;  4HAZ B;  2KCJ A;  3CIK A;  1MAI A;  2ROV A;  3D8E A;  3D8F A;  2Q13 A;  1X1G A;  2YS1 A;  2COC A;  5GOW B;  2G35 A;  3A8Q A;  2CAY A;  2QKM A;  5LOP B;  2GJY A;  2GS0 A;  2ROZ B;  3BIN A;  1V5U A;  3ODO A;  1V89 A;  5FI1 A;  1X1F A;  2ZPY A;  2FJL A;  3FM8 C;  2DHJ A;  2D9W A;  5D3V A;  3DXD A;  2LOX A;  4WSF A;  4KHB B;  2CY5 A;  1FB8 A;  3F5R A;  3QBV B;  4EKU A;  2D9Z A;  1BWN A;  4K81 A;  5DI9 B;  4ZRK A;  2D9X A;  2AL6 A;  1Q67 A;  1AQC A;  4F7H A;  4GXB A;  1ZSQ A;  5J3T A;  3TFM A;  3TVV A;  1E5W A;  4KHA A;  2I1K A;  2D9Y A;  1PMS A;  1UEF A;  2XQN M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...