2N0YA

Nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/viral protein
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title A Omega XaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n0yA00
5JLJB 2ZPYA 1XCGA 2N0YA 3VIAA 1V89A 4ZRIA 1XKEA 2D9YA 3D8EA 2D11A 2MWNB 1WGQA 2HTHB 1P3RA 2ROVA 4GXBA 4A6FA 2EC1A 3MPXA 1X11A 1X05A 1EF1A 2W2XC 3DXCA 3IVFA 1P6SA 3MDBC 2CY5A 3GYOA 2YSZA 2DX1A 5D3XA 1DDVA 1BTNA 5JHGA 3FM8C 1SGHA 2YS5A 2LULA 3P7ZA 3F5RA 1Y5OA 1J0WA 4NY0A 2CODA 2NZ8B 3PVLA 4IOYX 2I1KA 3HK0A 1QC6A 3TW1A 4HDQA 2Y7BA 1XD4A 2I5CA 5JHHA 2DA0A 4ZRJA 1E5WA 3LJUX 2RSGA 3DXEA 2EMSA 4CYEA 3KZ1A 2J0KA 4MK0A 1XX0A 1ZSQA 1XR0B 4BBKA 1I2HA 3U7DA 5CLLB 1PFJA 2Y8GA 1H10A 1N3HA 1NTVA 2E2XA 2K2JA 1NTYA 4A6KA 2ADZA 1FOEA 3CIKA 1V61A 3X23A 5C6RA 2EMTA 4D0NB 2DKQA 4A6FB 2P0FA 2P8VA 4PQ0A 4HB2B 1V5MA 1DBHA 4DX8A 1FAOA 1X1FA 2DHKA 2K00A 4GZUA 4KAXB 2KCJA 1AWEA 1PMSA 4MY6A 3ZDTA 4L6EA 3TCAA 2D10A 1PLSA 2GS0A 4GMXB 4B6HA 4GMVA 4CHJA 2D2QA 4TKNA 4Y94A 5DI9B 1RJ2A 3VOQA 3ZVRA 3U8ZA 1W1GA 2BCJA 2X18A 1RRPB 3ULCA 1K5DB 3N7CA 3QIJA 2H7DA 2M14A 2P0HA 5D3VA 4HAXB 2CRFA 5HE3A 1MIXA 1M7EA 4EKUA 2COAA 2QKMA 2XQNM 2YS3A 3DXDA 1IRSA 2UVMA 3WYFB 2J0MA 2DX5A 2K2UA 4EJNA 1MKEA 3V5WA 5JP4A 4WVFB 5DH9B 2GJYA 2DHJA 3CXBB 4DXAB 1WJ1A 2V76A 1KZ7A 3D8FA 1MPHA 1U2BA 4F7UP 1MK9B 3AU4A 4HB4B 1BWNA 2EJ8A 2YF0A 4HAVB 1LW3A 3KY9A 2D9ZA 5HE2A 2GCJA 2LKOA 4KVGB 4WSFA 2CAYA 1FB8A 1TJ6A 2VKIA 3SO6A 1W1DA 4F7GA 1TXDA 2RLOA 3QWMA 5D3WA 4H8SA 3TVVA 1MIZB 1ZVRA 2M38A 2OQBA 2PZ1A 3A8PA 2D4QA 1M7RA 4NSWA 5DHFB 1NI2A 2OTXA 4KHOA 5KQ4A 1BAKA 2D9VA 1OY2A 2R0DA 4K2OA 2UZRA 3ODXA 5EFXA 2ROZB 1U5EA 2COFA 3BINA 1W1HA 1P5TA 1UNRA 4HHVA 1U5DA 2IYBA 4KHBB 1K5GB 2P0DA 4HATB 2H7EA 4Z2NA 3OANA 2N23A 2ELBA 2IFSA 2LOXA 4GN1A 1ISNA 3PP2A 3UZTA 1UNQA 2D9WA 1XODA 4EMOA 3PVUA 5J3YA 1V5UA 1V88A 2W2XD 2CY4A 2L1CA 2MDXA 1GC7A 1FHWA 3TO1A 3ODOA 2R09A 3NSUA 2L2IA 3HQCA 4PNKA 3T06A 5C79A 2DLWA 1LB1A 3PEGA 2HE7A 3SNHA 1TQZA 4K17A 4P7IA 3ULBA 4A6HA 1Z87A 3TFMA 1U5GA 5KCVA 4HB0B 4YONA 4CHMA 3FSSA 4YL8A 3SYXA 3KSYA 1WG7A 1ZC3B 3G9WA 1U29A 2AL6A 1UEFA 2AEHA 2DYNA 3M1IB 2I5FA 2J0JA 1QQGA 4HDOA 5DIFB 1UNPA 4TYZA 1AQCA 5J3TA 4KHAA 3PG7A 2ELAA 3A98B 1DDMA 5C5BA 5D27A 3AU5A 3SV1A 2RUKB 2RVBB 3PZDA 2GCLA 3O96A 1FHOA 5CLQB 2Z0QA 5HE0A 5GOWB 1OQNA 5FI0A 3BJIA 2I1JA 1SHCA 3PVWA 4HB3B 2LYDA 4HAZB 3P6AA 2Z0OA 1X1GA 1WJMA 1WVHA 3F0WA 2KGXB 1Q67A 4K2PA 4HAYB 5KQ1A 1BTKA 1ZM0A 2W2WA 1FGYA 4IFSA 4HAWB 3RCPA 2RNRB 3KRXA 4F7HA 2YS1A 3HW2B 1H4RA 4K81A 5L81A 1B55A 1KI1B 4HAUB 2MFQA 2Q13A 4XWXA 2DHIA 3GYPA 3KRWA 4A5KA 3AJ4A 1X86A 1GG3A 2FJLA 2VRWB 2YT1A 1UPRA 3SUZA 2D9XA 1DDWA 2LG1A 5C5BB 2YT0A 3QBVB 1NU2A 3PSCA 3D8DA 5LOPB 1MAIA 2DKPA 3WA0A 4MT7A 2G35A 2Y8FA 1EVHA 1U27A 1UPQA 4DBBA 4WJ7A 1KZGA 1FGZA 5DHAB 2DYQA 2YVCA 1DROA 5D3YA 1DYNA 1FHXA 4IAPA 1EGXA 1Y19B 5HE1A 2NMBA 4ZRKA 1GC6A 2UZSA 2KUPA 3FEHA 1V5PA 5J3QA 2LOZA 2Z0PA 5FI1A 2DN6A 1I7AA 2JP2A 1MK7B 2J59M 2RGNB 5LONB 1EAZA 2DTCA 3A8QA 2MKRA 1WGUA 5C16A 2COCA 3ML4A 4C0AA 1U5FA 4GPTB 2QKLA 2YRYA 1OMWA 4Z2MB 1J19A 2VSZA 2DFKA 1ZC4B 4DX90 3ODWA 1WI1A
chains in the Genus database with same CATH superfamily
5JLJB 2KIGA 2ZPYA 1XCGA 2N0YA 3VIAA 1V89A 4ZRIA 2KR0A 1XKEA 2D9YA 3D8EA 2D11A 2MWNB 1WGQA 2HTHB 1P3RA 2ROVA 4GXBA 4A6FA 2EC1A 3MPXA 1X11A 1X05A 1EF1A 2W2XC 3DXCA 3IVFA 1P6SA 3MDBC 2CY5A 3GYOA 2YSZA 2DX1A 5D3XA 1DDVA 1BTNA 5JHGA 3FM8C 1SGHA 2YS5A 2LULA 3P7ZA 3F5RA 1Y5OA 1J0WA 4NY0A 2CODA 2NZ8B 3PVLA 4IOYX 2I1KA 3HK0A 1QC6A 3TW1A 4HDQA 2Y7BA 1XD4A 2I5CA 5JHHA 2DA0A 2K8EA 4ZRJA 1E5WA 3LJUX 2RSGA 3DXEA 2EMSA 4CYEA 5I2MA 4DIXA 3KZ1A 2J0KA 4MK0A 1XX0A 1ZSQA 1XR0B 4BBKA 1I2HA 3U7DA 5CLLB 1PFJA 2Y8GA 1H10A 1N3HA 1NTVA 2E2XA 2K2JA 1NTYA 4A6KA 2ADZA 1FOEA 4QJ5B 3CIKA 1V61A 3X23A 5C6RA 2EMTA 4D0NB 2DKQA 4A6FB 2P0FA 2P8VA 4OT1A 4PQ0A 4HB2B 1V5MA 1DBHA 4DX8A 2Z4DA 1FAOA 1X1FA 2DHKA 2K00A 4GZUA 4KAXB 2KCJA 1AWEA 1PMSA 4MY6A 3ZDTA 4L6EA 3TCAA 2D10A 1PLSA 2GS0A 4GMXB 5IRSA 4B6HA 4GMVA 4CHJA 2D2QA 4TKNA 4Y94A 5DI9B 1RJ2A 3VOQA 3ZVRA 3U8ZA 1W1GA 2BCJA 3U12A 2X18A 1RRPB 3ULCA 1K5DB 3OHMB 3N7CA 3QIJA 2H7DA 2M14A 2P0HA 5D3VA 4HAXB 2CRFA 5HE3A 1MIXA 2Z59A 1M7EA 4EKUA 2COAA 2QKMA 2XQNM 2YS3A 3DXDA 1IRSA 2UVMA 3WYFB 2J0MA 2DX5A 2K2UA 4EJNA 1MKEA 3V5WA 5JP4A 4WVFB 5DH9B 2GJYA 3NWFA 2DHJA 2YT2A 3CXBB 4DXAB 1WJ1A 2V76A 1KZ7A 3D8FA 1MPHA 1U2BA 4F7UP 1MK9B 3AU4A 4HB4B 2K49A 1BWNA 2EJ8A 2YF0A 3NW8A 4HAVB 1LW3A 3KY9A 2D9ZA 5HE2A 2GCJA 2LKOA 4KVGB 4WSFA 2CAYA 4OSNA 1FB8A 1TJ6A 3NWDA 2VKIA 3SO6A 1W1DA 4F7GA 1TXDA 2RLOA 3QWMA 5D3WA 4H8SA 4QXAB 3TVVA 1MIZB 1ZVRA 2M38A 2OQBA 3FVCA 2PZ1A 3A8PA 3DCXA 2D4QA 1M7RA 2R2YA 4NSWA 5DHFB 1NI2A 2OTXA 4KHOA 5KQ4A 1BAKA 2D9VA 1OY2A 2R0DA 4K2OA 2UZRA 3ODXA 5EFXA 2ROZB 2FJUB 1U5EA 2COFA 3BINA 1W1HA 1P5TA 1UNRA 4HHVA 1U5DA 2IYBA 4KHBB 1K5GB 2P0DA 4HATB 2H7EA 4Z2NA 3OANA 2N23A 2ELBA 2IFSA 2LOXA 4GN1A 4CSQA 1ISNA 3PP2A 3UZTA 1UNQA 4QJ4B 2D9WA 1XODA 4EMOA 3PVUA 5J3YA 1V5UA 1V88A 2W2XD 2CY4A 2L1CA 2MDXA 1GC7A 1FHWA 2RRFA 3TO1A 3ODOA 2R09A 3NSUA 2L2IA 3HQCA 4PNKA 3T06A 5C79A 2DLWA 1LB1A 5LG4B 3PEGA 2HE7A 3SNHA 1TQZA 4K17A 4P7IA 3ULBA 4A6HA 1Z87A 3TFMA 3NWAA 1U5GA 5KCVA 4HB0B 4YONA 4CHMA 3FSSA 4YL8A 3SYXA 3KSYA 1WG7A 1ZC3B 3G9WA 4L1RA 1U29A 2AL6A 1UEFA 2AEHA 2DYNA 3M1IB 2I5FA 2J0JA 1QQGA 3HIEA 4HDOA 5DIFB 1UNPA 4TYZA 1AQCA 5J3TA 4KHBA 4KHAA 3PG7A 2ELAA 4D6WA 1ZYIA 3A98B 1DDMA 5C5BA 5D27A 3AU5A 5I2SA 3SV1A 2RUKB 2RVBB 3PZDA 2GCLA 2GUMA 3O96A 1FHOA 1T77A 5CLQB 2Z0QA 5HE0A 5GOWB 1OQNA 5FI0A 3BJIA 2I1JA 1SHCA 3PVWA 4HB3B 2LYDA 4HAZB 3P6AA 2Z0OA 1X1GA 1WJMA 1WVHA 4HSIA 3F0WA 2KGXB 1Q67A 4K2PA 4HAYB 2NBVA 1BTKA 5KQ1A 1ZM0A 2W2WA 3B77A 1FGYA 4IFSA 4HAWB 3RCPA 2Z13A 2RNRB 3KRXA 4F7HA 2YS1A 3HW2B 1H4RA 4K81A 5L81A 1B55A 1KI1B 4HAUB 2MFQA 2Q13A 4XWXA 2DHIA 3GYPA 3KRWA 4A5KA 3AJ4A 1X86A 1GG3A 2FJLA 2VRWB 2YT1A 1UPRA 3SUZA 2D9XA 1DDWA 2LG1A 5C5BB 2YT0A 3QBVB 5M4YB 1NU2A 3PSCA 3D8DA 5LOPB 1MAIA 2DKPA 3WA0A 4MT7A 2G35A 2Y8FA 1EVHA 1U27A 1UPQA 4DBBA 4WJ7A 1KZGA 1FGZA 5DHAB 2DYQA 2YVCA 1DROA 5D3YA 1DYNA 1FHXA 4IAPA 2Z14A 1EGXA 1Y19B 5HE1A 2NMBA 4ZRKA 1GC6A 2UZSA 2KUPA 4GOUA 1MI1A 3FEHA 1V5PA 5J3QA 2LOZA 2Z0PA 5FI1A 4GNKB 2DN6A 2KIEA 3HSAA 1I7AA 3A58A 2JP2A 1MK7B 2J59M 2RGNB 5LONB 1EAZA 2DTCA 3A8QA 2MKRA 1WGUA 5C16A 2COCA 2ZKMX 3ML4A 4C0AA 1U5FA 4GPTB 2QKLA 2KUQA 2YRYA 1OMWA 4Z2MB 1J19A 2VSZA 4QJ3B 2DFKA 1ZC4B 4DX90 3ODWA 1WI1A
chains in the Genus database with same CATH topology
5JLJB 2ZPYA 1XCGA 2N0YA 3VIAA 1V89A 4ZRIA 1XKEA 2D9YA 3D8EA 2D11A 2MWNB 1WGQA 2HTHB 1P3RA 2ROVA 4GXBA 4A6FA 2EC1A 3MPXA 1X11A 1X05A 1EF1A 2W2XC 3DXCA 3IVFA 1P6SA 3MDBC 2CY5A 3GYOA 2YSZA 2DX1A 5D3XA 1DDVA 1BTNA 5JHGA 3FM8C 1SGHA 2YS5A 2LULA 3P7ZA 3F5RA 1Y5OA 1J0WA 4NY0A 2CODA 2NZ8B 3PVLA 4IOYX 2I1KA 3HK0A 1QC6A 3TW1A 4HDQA 2Y7BA 1XD4A 2I5CA 5JHHA 2DA0A 4ZRJA 1E5WA 3LJUX 2RSGA 3DXEA 2EMSA 4CYEA 3KZ1A 2J0KA 4MK0A 1XX0A 1ZSQA 1XR0B 4BBKA 1I2HA 3U7DA 5CLLB 1PFJA 2Y8GA 1H10A 1N3HA 1NTVA 2E2XA 2K2JA 1NTYA 4A6KA 2ADZA 1FOEA 3CIKA 1V61A 3X23A 5C6RA 2EMTA 4D0NB 2DKQA 4A6FB 2P0FA 2P8VA 4PQ0A 4HB2B 1V5MA 1DBHA 4DX8A 1FAOA 1X1FA 2DHKA 2K00A 4GZUA 4KAXB 2KCJA 1AWEA 1PMSA 4MY6A 3ZDTA 4L6EA 3TCAA 2D10A 1PLSA 2GS0A 4GMXB 4B6HA 4GMVA 4CHJA 2D2QA 4TKNA 4Y94A 5DI9B 1RJ2A 3VOQA 3ZVRA 3U8ZA 1W1GA 2BCJA 2X18A 1RRPB 3ULCA 1K5DB 3N7CA 3QIJA 2H7DA 2M14A 2P0HA 5D3VA 4HAXB 2CRFA 5HE3A 1MIXA 1M7EA 4EKUA 2COAA 2QKMA 2XQNM 2YS3A 3DXDA 1IRSA 2UVMA 3WYFB 2J0MA 2DX5A 2K2UA 4EJNA 1MKEA 3V5WA 5JP4A 4WVFB 5DH9B 2GJYA 2DHJA 3CXBB 4DXAB 1WJ1A 2V76A 1KZ7A 3D8FA 1MPHA 1U2BA 4F7UP 1MK9B 3AU4A 4HB4B 1BWNA 2EJ8A 2YF0A 4HAVB 1LW3A 3KY9A 2D9ZA 5HE2A 2GCJA 2LKOA 4KVGB 4WSFA 2CAYA 1FB8A 1TJ6A 2VKIA 3SO6A 1W1DA 4F7GA 1TXDA 2RLOA 3QWMA 5D3WA 4H8SA 3TVVA 1MIZB 1ZVRA 2M38A 2OQBA 2PZ1A 3A8PA 2D4QA 1M7RA 4NSWA 5DHFB 1NI2A 2OTXA 4KHOA 5KQ4A 1BAKA 2D9VA 1OY2A 2R0DA 4K2OA 2UZRA 3ODXA 5EFXA 2ROZB 1U5EA 2COFA 3BINA 1W1HA 1P5TA 1UNRA 4HHVA 1U5DA 2IYBA 4KHBB 1K5GB 2P0DA 4HATB 2H7EA 4Z2NA 3OANA 2N23A 2ELBA 2IFSA 2LOXA 4GN1A 1ISNA 3PP2A 3UZTA 1UNQA 2D9WA 1XODA 4EMOA 3PVUA 5J3YA 1V5UA 1V88A 2W2XD 2CY4A 2L1CA 2MDXA 1GC7A 1FHWA 3TO1A 3ODOA 2R09A 3NSUA 2L2IA 3HQCA 4PNKA 3T06A 5C79A 2DLWA 1LB1A 3PEGA 2HE7A 3SNHA 1TQZA 4K17A 4P7IA 3ULBA 4A6HA 1Z87A 3TFMA 1U5GA 5KCVA 4HB0B 4YONA 4CHMA 3FSSA 4YL8A 3SYXA 3KSYA 1WG7A 1ZC3B 3G9WA 1U29A 2AL6A 1UEFA 2AEHA 2DYNA 3M1IB 2I5FA 2J0JA 1QQGA 4HDOA 5DIFB 1UNPA 4TYZA 1AQCA 5J3TA 4KHAA 3PG7A 2ELAA 3A98B 1DDMA 5C5BA 5D27A 3AU5A 3SV1A 2RUKB 2RVBB 3PZDA 2GCLA 3O96A 1FHOA 5CLQB 2Z0QA 5HE0A 5GOWB 1OQNA 5FI0A 3BJIA 2I1JA 1SHCA 3PVWA 4HB3B 2LYDA 4HAZB 3P6AA 2Z0OA 1X1GA 1WJMA 1WVHA 3F0WA 2KGXB 1Q67A 4K2PA 4HAYB 5KQ1A 1BTKA 1ZM0A 2W2WA 1FGYA 4IFSA 4HAWB 3RCPA 2RNRB 3KRXA 4F7HA 2YS1A 3HW2B 1H4RA 4K81A 5L81A 1B55A 1KI1B 4HAUB 2MFQA 2Q13A 4XWXA 2DHIA 3GYPA 3KRWA 4A5KA 3AJ4A 1X86A 1GG3A 2FJLA 2VRWB 2YT1A 1UPRA 3SUZA 2D9XA 1DDWA 2LG1A 5C5BB 2YT0A 3QBVB 1NU2A 3PSCA 3D8DA 5LOPB 1MAIA 2DKPA 3WA0A 4MT7A 2G35A 2Y8FA 1EVHA 1U27A 1UPQA 4DBBA 4WJ7A 1KZGA 1FGZA 5DHAB 2DYQA 2YVCA 1DROA 5D3YA 1DYNA 1FHXA 4IAPA 1EGXA 1Y19B 5HE1A 2NMBA 4ZRKA 1GC6A 2UZSA 2KUPA 3FEHA 1V5PA 5J3QA 2LOZA 2Z0PA 5FI1A 2DN6A 1I7AA 2JP2A 1MK7B 2J59M 2RGNB 5LONB 1EAZA 2DTCA 3A8QA 2MKRA 1WGUA 5C16A 2COCA 3ML4A 4C0AA 1U5FA 4GPTB 2QKLA 2YRYA 1OMWA 4Z2MB 1J19A 2VSZA 2DFKA 1ZC4B 4DX90 3ODWA 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLJ B;  2ZPY A;  1XCG A;  2N0Y A;  3VIA A;  1V89 A;  4ZRI A;  1XKE A;  2D9Y A;  3D8E A;  2D11 A;  2MWN B;  1WGQ A;  2HTH B;  1P3R A;  2ROV A;  4GXB A;  4A6F A;  2EC1 A;  3MPX A;  1X11 A;  1X05 A;  1EF1 A;  2W2X C;  3DXC A;  3IVF A;  1P6S A;  3MDB C;  2CY5 A;  3GYO A;  2YSZ A;  2DX1 A;  5D3X A;  1DDV A;  1BTN A;  5JHG A;  3FM8 C;  1SGH A;  2YS5 A;  2LUL A;  3P7Z A;  3F5R A;  1Y5O A;  1J0W A;  4NY0 A;  2COD A;  2NZ8 B;  3PVL A;  4IOY X;  2I1K A;  3HK0 A;  1QC6 A;  3TW1 A;  4HDQ A;  2Y7B A;  1XD4 A;  2I5C A;  5JHH A;  2DA0 A;  4ZRJ A;  1E5W A;  3LJU X;  2RSG A;  3DXE A;  2EMS A;  4CYE A;  3KZ1 A;  2J0K A;  4MK0 A;  1XX0 A;  1ZSQ A;  1XR0 B;  4BBK A;  1I2H A;  3U7D A;  5CLL B;  1PFJ A;  2Y8G A;  1H10 A;  1N3H A;  1NTV A;  2E2X A;  2K2J A;  1NTY A;  4A6K A;  2ADZ A;  1FOE A;  3CIK A;  1V61 A;  3X23 A;  5C6R A;  2EMT A;  4D0N B;  2DKQ A;  4A6F B;  2P0F A;  2P8V A;  4PQ0 A;  4HB2 B;  1V5M A;  1DBH A;  4DX8 A;  1FAO A;  1X1F A;  2DHK A;  2K00 A;  4GZU A;  4KAX B;  2KCJ A;  1AWE A;  1PMS A;  4MY6 A;  3ZDT A;  4L6E A;  3TCA A;  2D10 A;  1PLS A;  2GS0 A;  4GMX B;  4B6H A;  4GMV A;  4CHJ A;  2D2Q A;  4TKN A;  4Y94 A;  5DI9 B;  1RJ2 A;  3VOQ A;  3ZVR A;  3U8Z A;  1W1G A;  2BCJ A;  2X18 A;  1RRP B;  3ULC A;  1K5D B;  3N7C A;  3QIJ A;  2H7D A;  2M14 A;  2P0H A;  5D3V A;  4HAX B;  2CRF A;  5HE3 A;  1MIX A;  1M7E A;  4EKU A;  2COA A;  2QKM A;  2XQN M;  2YS3 A;  3DXD A;  1IRS A;  2UVM A;  3WYF B;  2J0M A;  2DX5 A;  2K2U A;  4EJN A;  1MKE A;  3V5W A;  5JP4 A;  4WVF B;  5DH9 B;  2GJY A;  2DHJ A;  3CXB B;  4DXA B;  1WJ1 A;  2V76 A;  1KZ7 A;  3D8F A;  1MPH A;  1U2B A;  4F7U P;  1MK9 B;  3AU4 A;  4HB4 B;  1BWN A;  2EJ8 A;  2YF0 A;  4HAV B;  1LW3 A;  3KY9 A;  2D9Z A;  5HE2 A;  2GCJ A;  2LKO A;  4KVG B;  4WSF A;  2CAY A;  1FB8 A;  1TJ6 A;  2VKI A;  3SO6 A;  1W1D A;  4F7G A;  1TXD A;  2RLO A;  3QWM A;  5D3W A;  4H8S A;  3TVV A;  1MIZ B;  1ZVR A;  2M38 A;  2OQB A;  2PZ1 A;  3A8P A;  2D4Q A;  1M7R A;  4NSW A;  5DHF B;  1NI2 A;  2OTX A;  4KHO A;  5KQ4 A;  1BAK A;  2D9V A;  1OY2 A;  2R0D A;  4K2O A;  2UZR A;  3ODX A;  5EFX A;  2ROZ B;  1U5E A;  2COF A;  3BIN A;  1W1H A;  1P5T A;  1UNR A;  4HHV A;  1U5D A;  2IYB A;  4KHB B;  1K5G B;  2P0D A;  4HAT B;  2H7E A;  4Z2N A;  3OAN A;  2N23 A;  2ELB A;  2IFS A;  2LOX A;  4GN1 A;  1ISN A;  3PP2 A;  3UZT A;  1UNQ A;  2D9W A;  1XOD A;  4EMO A;  3PVU A;  5J3Y A;  1V5U A;  1V88 A;  2W2X D;  2CY4 A;  2L1C A;  2MDX A;  1GC7 A;  1FHW A;  3TO1 A;  3ODO A;  2R09 A;  3NSU A;  2L2I A;  3HQC A;  4PNK A;  3T06 A;  5C79 A;  2DLW A;  1LB1 A;  3PEG A;  2HE7 A;  3SNH A;  1TQZ A;  4K17 A;  4P7I A;  3ULB A;  4A6H A;  1Z87 A;  3TFM A;  1U5G A;  5KCV A;  4HB0 B;  4YON A;  4CHM A;  3FSS A;  4YL8 A;  3SYX A;  3KSY A;  1WG7 A;  1ZC3 B;  3G9W A;  1U29 A;  2AL6 A;  1UEF A;  2AEH A;  2DYN A;  3M1I B;  2I5F A;  2J0J A;  1QQG A;  4HDO A;  5DIF B;  1UNP A;  4TYZ A;  1AQC A;  5J3T A;  4KHA A;  3PG7 A;  2ELA A;  3A98 B;  1DDM A;  5C5B A;  5D27 A;  3AU5 A;  3SV1 A;  2RUK B;  2RVB B;  3PZD A;  2GCL A;  3O96 A;  1FHO A;  5CLQ B;  2Z0Q A;  5HE0 A;  5GOW B;  1OQN A;  5FI0 A;  3BJI A;  2I1J A;  1SHC A;  3PVW A;  4HB3 B;  2LYD A;  4HAZ B;  3P6A A;  2Z0O A;  1X1G A;  1WJM A;  1WVH A;  3F0W A;  2KGX B;  1Q67 A;  4K2P A;  4HAY B;  5KQ1 A;  1BTK A;  1ZM0 A;  2W2W A;  1FGY A;  4IFS A;  4HAW B;  3RCP A;  2RNR B;  3KRX A;  4F7H A;  2YS1 A;  3HW2 B;  1H4R A;  4K81 A;  5L81 A;  1B55 A;  1KI1 B;  4HAU B;  2MFQ A;  2Q13 A;  4XWX A;  2DHI A;  3GYP A;  3KRW A;  4A5K A;  3AJ4 A;  1X86 A;  1GG3 A;  2FJL A;  2VRW B;  2YT1 A;  1UPR A;  3SUZ A;  2D9X A;  1DDW A;  2LG1 A;  5C5B B;  2YT0 A;  3QBV B;  1NU2 A;  3PSC A;  3D8D A;  5LOP B;  1MAI A;  2DKP A;  3WA0 A;  4MT7 A;  2G35 A;  2Y8F A;  1EVH A;  1U27 A;  1UPQ A;  4DBB A;  4WJ7 A;  1KZG A;  1FGZ A;  5DHA B;  2DYQ A;  2YVC A;  1DRO A;  5D3Y A;  1DYN A;  1FHX A;  4IAP A;  1EGX A;  1Y19 B;  5HE1 A;  2NMB A;  4ZRK A;  1GC6 A;  2UZS A;  2KUP A;  3FEH A;  1V5P A;  5J3Q A;  2LOZ A;  2Z0P A;  5FI1 A;  2DN6 A;  1I7A A;  2JP2 A;  1MK7 B;  2J59 M;  2RGN B;  5LON B;  1EAZ A;  2DTC A;  3A8Q A;  2MKR A;  1WGU A;  5C16 A;  2COC A;  3ML4 A;  4C0A A;  1U5F A;  4GPT B;  2QKL A;  2YRY A;  1OMW A;  4Z2M B;  1J19 A;  2VSZ A;  2DFK A;  1ZC4 B;  4DX9 0;  3ODW A;  1WI1 A; 
#chains in the Genus database with same CATH topology
 5JLJ B;  2KIG A;  2ZPY A;  1XCG A;  2N0Y A;  3VIA A;  1V89 A;  4ZRI A;  2KR0 A;  1XKE A;  2D9Y A;  3D8E A;  2D11 A;  2MWN B;  1WGQ A;  2HTH B;  1P3R A;  2ROV A;  4GXB A;  4A6F A;  2EC1 A;  3MPX A;  1X11 A;  1X05 A;  1EF1 A;  2W2X C;  3DXC A;  3IVF A;  1P6S A;  3MDB C;  2CY5 A;  3GYO A;  2YSZ A;  2DX1 A;  5D3X A;  1DDV A;  1BTN A;  5JHG A;  3FM8 C;  1SGH A;  2YS5 A;  2LUL A;  3P7Z A;  3F5R A;  1Y5O A;  1J0W A;  4NY0 A;  2COD A;  2NZ8 B;  3PVL A;  4IOY X;  2I1K A;  3HK0 A;  1QC6 A;  3TW1 A;  4HDQ A;  2Y7B A;  1XD4 A;  2I5C A;  5JHH A;  2DA0 A;  2K8E A;  4ZRJ A;  1E5W A;  3LJU X;  2RSG A;  3DXE A;  2EMS A;  4CYE A;  5I2M A;  4DIX A;  3KZ1 A;  2J0K A;  4MK0 A;  1XX0 A;  1ZSQ A;  1XR0 B;  4BBK A;  1I2H A;  3U7D A;  5CLL B;  1PFJ A;  2Y8G A;  1H10 A;  1N3H A;  1NTV A;  2E2X A;  2K2J A;  1NTY A;  4A6K A;  2ADZ A;  1FOE A;  4QJ5 B;  3CIK A;  1V61 A;  3X23 A;  5C6R A;  2EMT A;  4D0N B;  2DKQ A;  4A6F B;  2P0F A;  2P8V A;  4OT1 A;  4PQ0 A;  4HB2 B;  1V5M A;  1DBH A;  4DX8 A;  2Z4D A;  1FAO A;  1X1F A;  2DHK A;  2K00 A;  4GZU A;  4KAX B;  2KCJ A;  1AWE A;  1PMS A;  4MY6 A;  3ZDT A;  4L6E A;  3TCA A;  2D10 A;  1PLS A;  2GS0 A;  4GMX B;  5IRS A;  4B6H A;  4GMV A;  4CHJ A;  2D2Q A;  4TKN A;  4Y94 A;  5DI9 B;  1RJ2 A;  3VOQ A;  3ZVR A;  3U8Z A;  1W1G A;  2BCJ A;  3U12 A;  2X18 A;  1RRP B;  3ULC A;  1K5D B;  3OHM B;  3N7C A;  3QIJ A;  2H7D A;  2M14 A;  2P0H A;  5D3V A;  4HAX B;  2CRF A;  5HE3 A;  1MIX A;  2Z59 A;  1M7E A;  4EKU A;  2COA A;  2QKM A;  2XQN M;  2YS3 A;  3DXD A;  1IRS A;  2UVM A;  3WYF B;  2J0M A;  2DX5 A;  2K2U A;  4EJN A;  1MKE A;  3V5W A;  5JP4 A;  4WVF B;  5DH9 B;  2GJY A;  3NWF A;  2DHJ A;  2YT2 A;  3CXB B;  4DXA B;  1WJ1 A;  2V76 A;  1KZ7 A;  3D8F A;  1MPH A;  1U2B A;  4F7U P;  1MK9 B;  3AU4 A;  4HB4 B;  2K49 A;  1BWN A;  2EJ8 A;  2YF0 A;  3NW8 A;  4HAV B;  1LW3 A;  3KY9 A;  2D9Z A;  5HE2 A;  2GCJ A;  2LKO A;  4KVG B;  4WSF A;  2CAY A;  4OSN A;  1FB8 A;  1TJ6 A;  3NWD A;  2VKI A;  3SO6 A;  1W1D A;  4F7G A;  1TXD A;  2RLO A;  3QWM A;  5D3W A;  4H8S A;  4QXA B;  3TVV A;  1MIZ B;  1ZVR A;  2M38 A;  2OQB A;  3FVC A;  2PZ1 A;  3A8P A;  3DCX A;  2D4Q A;  1M7R A;  2R2Y A;  4NSW A;  5DHF B;  1NI2 A;  2OTX A;  4KHO A;  5KQ4 A;  1BAK A;  2D9V A;  1OY2 A;  2R0D A;  4K2O A;  2UZR A;  3ODX A;  5EFX A;  2ROZ B;  2FJU B;  1U5E A;  2COF A;  3BIN A;  1W1H A;  1P5T A;  1UNR A;  4HHV A;  1U5D A;  2IYB A;  4KHB B;  1K5G B;  2P0D A;  4HAT B;  2H7E A;  4Z2N A;  3OAN A;  2N23 A;  2ELB A;  2IFS A;  2LOX A;  4GN1 A;  4CSQ A;  1ISN A;  3PP2 A;  3UZT A;  1UNQ A;  4QJ4 B;  2D9W A;  1XOD A;  4EMO A;  3PVU A;  5J3Y A;  1V5U A;  1V88 A;  2W2X D;  2CY4 A;  2L1C A;  2MDX A;  1GC7 A;  1FHW A;  2RRF A;  3TO1 A;  3ODO A;  2R09 A;  3NSU A;  2L2I A;  3HQC A;  4PNK A;  3T06 A;  5C79 A;  2DLW A;  1LB1 A;  5LG4 B;  3PEG A;  2HE7 A;  3SNH A;  1TQZ A;  4K17 A;  4P7I A;  3ULB A;  4A6H A;  1Z87 A;  3TFM A;  3NWA A;  1U5G A;  5KCV A;  4HB0 B;  4YON A;  4CHM A;  3FSS A;  4YL8 A;  3SYX A;  3KSY A;  1WG7 A;  1ZC3 B;  3G9W A;  4L1R A;  1U29 A;  2AL6 A;  1UEF A;  2AEH A;  2DYN A;  3M1I B;  2I5F A;  2J0J A;  1QQG A;  3HIE A;  4HDO A;  5DIF B;  1UNP A;  4TYZ A;  1AQC A;  5J3T A;  4KHB A;  4KHA A;  3PG7 A;  2ELA A;  4D6W A;  1ZYI A;  3A98 B;  1DDM A;  5C5B A;  5D27 A;  3AU5 A;  5I2S A;  3SV1 A;  2RUK B;  2RVB B;  3PZD A;  2GCL A;  2GUM A;  3O96 A;  1FHO A;  1T77 A;  5CLQ B;  2Z0Q A;  5HE0 A;  5GOW B;  1OQN A;  5FI0 A;  3BJI A;  2I1J A;  1SHC A;  3PVW A;  4HB3 B;  2LYD A;  4HAZ B;  3P6A A;  2Z0O A;  1X1G A;  1WJM A;  1WVH A;  4HSI A;  3F0W A;  2KGX B;  1Q67 A;  4K2P A;  4HAY B;  2NBV A;  1BTK A;  5KQ1 A;  1ZM0 A;  2W2W A;  3B77 A;  1FGY A;  4IFS A;  4HAW B;  3RCP A;  2Z13 A;  2RNR B;  3KRX A;  4F7H A;  2YS1 A;  3HW2 B;  1H4R A;  4K81 A;  5L81 A;  1B55 A;  1KI1 B;  4HAU B;  2MFQ A;  2Q13 A;  4XWX A;  2DHI A;  3GYP A;  3KRW A;  4A5K A;  3AJ4 A;  1X86 A;  1GG3 A;  2FJL A;  2VRW B;  2YT1 A;  1UPR A;  3SUZ A;  2D9X A;  1DDW A;  2LG1 A;  5C5B B;  2YT0 A;  3QBV B;  5M4Y B;  1NU2 A;  3PSC A;  3D8D A;  5LOP B;  1MAI A;  2DKP A;  3WA0 A;  4MT7 A;  2G35 A;  2Y8F A;  1EVH A;  1U27 A;  1UPQ A;  4DBB A;  4WJ7 A;  1KZG A;  1FGZ A;  5DHA B;  2DYQ A;  2YVC A;  1DRO A;  5D3Y A;  1DYN A;  1FHX A;  4IAP A;  2Z14 A;  1EGX A;  1Y19 B;  5HE1 A;  2NMB A;  4ZRK A;  1GC6 A;  2UZS A;  2KUP A;  4GOU A;  1MI1 A;  3FEH A;  1V5P A;  5J3Q A;  2LOZ A;  2Z0P A;  5FI1 A;  4GNK B;  2DN6 A;  2KIE A;  3HSA A;  1I7A A;  3A58 A;  2JP2 A;  1MK7 B;  2J59 M;  2RGN B;  5LON B;  1EAZ A;  2DTC A;  3A8Q A;  2MKR A;  1WGU A;  5C16 A;  2COC A;  2ZKM X;  3ML4 A;  4C0A A;  1U5F A;  4GPT B;  2QKL A;  2KUQ A;  2YRY A;  1OMW A;  4Z2M B;  1J19 A;  2VSZ A;  4QJ3 B;  2DFK A;  1ZC4 B;  4DX9 0;  3ODW A;  1WI1 A; 
#chains in the Genus database with same CATH homology
 5JLJ B;  2ZPY A;  1XCG A;  2N0Y A;  3VIA A;  1V89 A;  4ZRI A;  1XKE A;  2D9Y A;  3D8E A;  2D11 A;  2MWN B;  1WGQ A;  2HTH B;  1P3R A;  2ROV A;  4GXB A;  4A6F A;  2EC1 A;  3MPX A;  1X11 A;  1X05 A;  1EF1 A;  2W2X C;  3DXC A;  3IVF A;  1P6S A;  3MDB C;  2CY5 A;  3GYO A;  2YSZ A;  2DX1 A;  5D3X A;  1DDV A;  1BTN A;  5JHG A;  3FM8 C;  1SGH A;  2YS5 A;  2LUL A;  3P7Z A;  3F5R A;  1Y5O A;  1J0W A;  4NY0 A;  2COD A;  2NZ8 B;  3PVL A;  4IOY X;  2I1K A;  3HK0 A;  1QC6 A;  3TW1 A;  4HDQ A;  2Y7B A;  1XD4 A;  2I5C A;  5JHH A;  2DA0 A;  4ZRJ A;  1E5W A;  3LJU X;  2RSG A;  3DXE A;  2EMS A;  4CYE A;  3KZ1 A;  2J0K A;  4MK0 A;  1XX0 A;  1ZSQ A;  1XR0 B;  4BBK A;  1I2H A;  3U7D A;  5CLL B;  1PFJ A;  2Y8G A;  1H10 A;  1N3H A;  1NTV A;  2E2X A;  2K2J A;  1NTY A;  4A6K A;  2ADZ A;  1FOE A;  3CIK A;  1V61 A;  3X23 A;  5C6R A;  2EMT A;  4D0N B;  2DKQ A;  4A6F B;  2P0F A;  2P8V A;  4PQ0 A;  4HB2 B;  1V5M A;  1DBH A;  4DX8 A;  1FAO A;  1X1F A;  2DHK A;  2K00 A;  4GZU A;  4KAX B;  2KCJ A;  1AWE A;  1PMS A;  4MY6 A;  3ZDT A;  4L6E A;  3TCA A;  2D10 A;  1PLS A;  2GS0 A;  4GMX B;  4B6H A;  4GMV A;  4CHJ A;  2D2Q A;  4TKN A;  4Y94 A;  5DI9 B;  1RJ2 A;  3VOQ A;  3ZVR A;  3U8Z A;  1W1G A;  2BCJ A;  2X18 A;  1RRP B;  3ULC A;  1K5D B;  3N7C A;  3QIJ A;  2H7D A;  2M14 A;  2P0H A;  5D3V A;  4HAX B;  2CRF A;  5HE3 A;  1MIX A;  1M7E A;  4EKU A;  2COA A;  2QKM A;  2XQN M;  2YS3 A;  3DXD A;  1IRS A;  2UVM A;  3WYF B;  2J0M A;  2DX5 A;  2K2U A;  4EJN A;  1MKE A;  3V5W A;  5JP4 A;  4WVF B;  5DH9 B;  2GJY A;  2DHJ A;  3CXB B;  4DXA B;  1WJ1 A;  2V76 A;  1KZ7 A;  3D8F A;  1MPH A;  1U2B A;  4F7U P;  1MK9 B;  3AU4 A;  4HB4 B;  1BWN A;  2EJ8 A;  2YF0 A;  4HAV B;  1LW3 A;  3KY9 A;  2D9Z A;  5HE2 A;  2GCJ A;  2LKO A;  4KVG B;  4WSF A;  2CAY A;  1FB8 A;  1TJ6 A;  2VKI A;  3SO6 A;  1W1D A;  4F7G A;  1TXD A;  2RLO A;  3QWM A;  5D3W A;  4H8S A;  3TVV A;  1MIZ B;  1ZVR A;  2M38 A;  2OQB A;  2PZ1 A;  3A8P A;  2D4Q A;  1M7R A;  4NSW A;  5DHF B;  1NI2 A;  2OTX A;  4KHO A;  5KQ4 A;  1BAK A;  2D9V A;  1OY2 A;  2R0D A;  4K2O A;  2UZR A;  3ODX A;  5EFX A;  2ROZ B;  1U5E A;  2COF A;  3BIN A;  1W1H A;  1P5T A;  1UNR A;  4HHV A;  1U5D A;  2IYB A;  4KHB B;  1K5G B;  2P0D A;  4HAT B;  2H7E A;  4Z2N A;  3OAN A;  2N23 A;  2ELB A;  2IFS A;  2LOX A;  4GN1 A;  1ISN A;  3PP2 A;  3UZT A;  1UNQ A;  2D9W A;  1XOD A;  4EMO A;  3PVU A;  5J3Y A;  1V5U A;  1V88 A;  2W2X D;  2CY4 A;  2L1C A;  2MDX A;  1GC7 A;  1FHW A;  3TO1 A;  3ODO A;  2R09 A;  3NSU A;  2L2I A;  3HQC A;  4PNK A;  3T06 A;  5C79 A;  2DLW A;  1LB1 A;  3PEG A;  2HE7 A;  3SNH A;  1TQZ A;  4K17 A;  4P7I A;  3ULB A;  4A6H A;  1Z87 A;  3TFM A;  1U5G A;  5KCV A;  4HB0 B;  4YON A;  4CHM A;  3FSS A;  4YL8 A;  3SYX A;  3KSY A;  1WG7 A;  1ZC3 B;  3G9W A;  1U29 A;  2AL6 A;  1UEF A;  2AEH A;  2DYN A;  3M1I B;  2I5F A;  2J0J A;  1QQG A;  4HDO A;  5DIF B;  1UNP A;  4TYZ A;  1AQC A;  5J3T A;  4KHA A;  3PG7 A;  2ELA A;  3A98 B;  1DDM A;  5C5B A;  5D27 A;  3AU5 A;  3SV1 A;  2RUK B;  2RVB B;  3PZD A;  2GCL A;  3O96 A;  1FHO A;  5CLQ B;  2Z0Q A;  5HE0 A;  5GOW B;  1OQN A;  5FI0 A;  3BJI A;  2I1J A;  1SHC A;  3PVW A;  4HB3 B;  2LYD A;  4HAZ B;  3P6A A;  2Z0O A;  1X1G A;  1WJM A;  1WVH A;  3F0W A;  2KGX B;  1Q67 A;  4K2P A;  4HAY B;  5KQ1 A;  1BTK A;  1ZM0 A;  2W2W A;  1FGY A;  4IFS A;  4HAW B;  3RCP A;  2RNR B;  3KRX A;  4F7H A;  2YS1 A;  3HW2 B;  1H4R A;  4K81 A;  5L81 A;  1B55 A;  1KI1 B;  4HAU B;  2MFQ A;  2Q13 A;  4XWX A;  2DHI A;  3GYP A;  3KRW A;  4A5K A;  3AJ4 A;  1X86 A;  1GG3 A;  2FJL A;  2VRW B;  2YT1 A;  1UPR A;  3SUZ A;  2D9X A;  1DDW A;  2LG1 A;  5C5B B;  2YT0 A;  3QBV B;  1NU2 A;  3PSC A;  3D8D A;  5LOP B;  1MAI A;  2DKP A;  3WA0 A;  4MT7 A;  2G35 A;  2Y8F A;  1EVH A;  1U27 A;  1UPQ A;  4DBB A;  4WJ7 A;  1KZG A;  1FGZ A;  5DHA B;  2DYQ A;  2YVC A;  1DRO A;  5D3Y A;  1DYN A;  1FHX A;  4IAP A;  1EGX A;  1Y19 B;  5HE1 A;  2NMB A;  4ZRK A;  1GC6 A;  2UZS A;  2KUP A;  3FEH A;  1V5P A;  5J3Q A;  2LOZ A;  2Z0P A;  5FI1 A;  2DN6 A;  1I7A A;  2JP2 A;  1MK7 B;  2J59 M;  2RGN B;  5LON B;  1EAZ A;  2DTC A;  3A8Q A;  2MKR A;  1WGU A;  5C16 A;  2COC A;  3ML4 A;  4C0A A;  1U5F A;  4GPT B;  2QKL A;  2YRY A;  1OMW A;  4Z2M B;  1J19 A;  2VSZ A;  2DFK A;  1ZC4 B;  4DX9 0;  3ODW A;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...