2N0YA

Nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title A Omega XaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/viral protein
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n0yA00
1K5GB 3QWMA 2DX1A 2CY4A 1NU2A 2DKQA 1FB8A 4KAXB 1N3HA 2DA0A 2Q13A 4DX90 2LOZA 1X11A 2YT1A 5D3XA 4HB3B 1EGXA 1ZVRA 2CY5A 5D27A 3TW1A 1SHCA 5FI0A 4TKNA 4HAWB 3V5WA 1NI2A 1UPRA 1V88A 5HE1A 2EC1A 1U29A 4A5KA 3SNHA 1QC6A 1QQGA 1Y5OA 1FHOA 4F7GA 3PVLA 4HAZB 1XD4A 3M1IB 4ZRJA 3KRXA 2DTCA 1IRSA 5JHGA 4NSWA 4HDQA 3GYOA 2Y7BA 1XX0A 2I5CA 3MDBC 2EMTA 2IFSA 2GCJA 1OY2A 4HB4B 2Y8GA 4Y94A 4F7UP 1GG3A 3D8FA 2RLOA 2RSGA 4HAYB 5J3TA 2MWNB 1UPQA 3D8EA 3PZDA 1W1DA 4TYZA 2GS0A 2LG1A 1DDVA 4A6FA 4A6FB 3P7ZA 1J19A 3KZ1A 3U7DA 4PNKA 4MK0A 1UNPA 2AL6A 4ZRKA 2EJ8A 3A98B 2MFQA 4KVGB 2D9YA 3KY9A 3CXBB 3TVVA 2JP2A 3CIKA 2I5FA 2HTHB 5D3WA 1P5TA 1TXDA 4HATB 3ZVRA 5J3QA 2COAA 2D9XA 2D9VA 1RJ2A 5C16A 5D3YA 2NZ8B 5C79A 1FGYA 5C5BB 1KZGA 2VKIA 3DXCA 2N23A 3TCAA 4DBBA 3HK0A 3ODOA 2FJLA 4GZUA 1XCGA 1AQCA 5DH9B 4NY0A 1BWNA 5EFXA 2VRWB 5KQ4A 1V5UA 4HAVB 2RGNB 1V5PA 1EF1A 1PFJA 4L6EA 2OTXA 3T06A 1M7RA 2COFA 2COCA 1B55A 2YT0A 2ELAA 1WJ1A 2XQNM 4HB0B 1X86A 1U2BA 5C6RA 5LOPB 1BAKA 4CYEA 3O96A 3LJUX 3FEHA 3ZDTA 4F7HA 1U5FA 2G35A 5CLQB 2YVCA 2R0DA 5KQ1A 1UNRA 4KHAA 1OMWA 3DXDA 1DYNA 3QIJA 2UVMA 3IVFA 1XKEA 2YS3A 3G9WA 3A8QA 4MT7A 3NSUA 2I1JA 2CODA 2J0KA 5DI9B 1FAOA 3AJ4A 5CLLB 2MDXA 2DHKA 2P8VA 2YS1A 3ODXA 4EJNA 3F5RA 3PSCA 4WJ7A 1I2HA 4A6KA 2DHIA 2MKRA 2K2UA 3P6AA 3TO1A 2Z0OA 2YSZA 1E5WA 4HDOA 1Z87A 1LB1A 4GMVA 4K81A 2K00A 2J59M 3KRWA 1W1GA 5FI1A 2I1KA 2RVBB 4EMOA 1V89A 1KI1B 2QKMA 3ODWA 2D9ZA 3VIAA 4KHOA 1X1GA 4EKUA 1WGQA 2DN6A 3BINA 2BCJA 1EVHA 5LONB 2CAYA 4GMXB 3KSYA 3PEGA 1U27A 1EAZA 1MK9B 3OANA 4DXAB 4YONA 2R09A 2D9WA 2H7DA 5HE0A 2CRFA 1AWEA 2DLWA 2UZRA 5GOWB 3UZTA 1DBHA 2ELBA 2RUKB 2AEHA 1DDWA 5DHFB 4HAXB 4C0AA 1MPHA 1XODA 3PVUA 2D10A 4HHVA 3RCPA 2L1CA 2M14A 4KHBB 1NTYA 1PLSA 3QBVB 2D4QA 2Z0PA 2W2XC 4GXBA 4A6HA 1ZC3B 1ZSQA 4IOYX 2K2JA 1X1FA 2J0JA 1UEFA 1P3RA 4D0NB 1TJ6A 5DIFB 2QKLA 4WVFB 1XR0B 4HB2B 4HAUB 4IFSA 2HE7A 2LKOA 2KUPA 4B6HA 1FOEA 3D8DA 1BTKA 1ZM0A 2J0MA 1X05A 3WYFB 1TQZA 1OQNA 1BTNA 5JLJB 3SYXA 2DYNA 1MIZB 4K2OA 1WVHA 4K17A 5DHAB 1WI1A 1MAIA 1P6SA 4YL8A 1GC6A 2DFKA 1MKEA 4WSFA 2D2QA 2W2WA 3DXEA 1GC7A 1H4RA 1U5GA 2OQBA 2P0DA 3SUZA 4BBKA 2P0HA 5HE3A 2ADZA 4GN1A 4K2PA 1WG7A 3AU5A 1WJMA 3GYPA 4DX8A 1U5DA 1J0WA 2LULA 2YS5A 3WA0A 3PP2A 5D3VA 3FM8C 2DKPA 3HW2B 2DHJA 5JP4A 2ROZB 3HQCA 3VOQA 1RRPB 3PG7A 3PVWA 4Z2MB 1M7EA 2VSZA 1K5DB 5L81A 2GJYA 4CHMA 2DX5A 5HE2A 3A8PA 1WGUA 5J3YA 1DDMA 1H10A 2KCJA 4XWXA 3X23A 1KZ7A 2NMBA 1ZC4B 2ZPYA 1V61A 4MY6A 2L2IA 3ULBA 4IAPA 5KCVA 1U5EA 1NTVA 1FGZA 1MIXA 1UNQA 4H8SA 3F0WA 3SO6A 2X18A 1FHWA 1ISNA 2LOXA 1SGHA 3SV1A 2LYDA 5JHHA 2EMSA 2Y8FA 3AU4A 3ML4A 4Z2NA 3U8ZA 3ULCA 2YRYA 4GPTB 1PMSA 2ROVA 3TFMA 2E2XA 1V5MA 2IYBA 2W2XD 2KGXB 1FHXA 2UZSA 5C5BA 4P7IA 2D11A 2GCLA 1Q67A 2M38A 3FSSA 4CHJA 1DROA 1LW3A 1W1HA 2YF0A 2H7EA 2V76A 1I7AA 2N0YA 2DYQA 1Y19B 3MPXA 2Z0QA 3BJIA 3N7CA 2PZ1A 1MK7B 2P0FA 4ZRIA 2RNRB 4PQ0A
chains in the Genus database with same CATH superfamily
1K5GB 3QWMA 2DX1A 2CY4A 1NU2A 2DKQA 4OSNA 1FB8A 4KAXB 1N3HA 1T77A 2DA0A 4HSIA 2Q13A 4DX90 2FJUB 2LOZA 1X11A 2YT1A 5D3XA 4HB3B 1EGXA 1ZVRA 2CY5A 5D27A 3TW1A 1SHCA 5FI0A 4TKNA 4HAWB 3V5WA 1NI2A 1UPRA 1V88A 5HE1A 2EC1A 2KR0A 1U29A 4A5KA 3SNHA 1QC6A 4L1RA 1QQGA 1Y5OA 1FHOA 4F7GA 3PVLA 4HAZB 1XD4A 3M1IB 4ZRJA 3KRXA 2DTCA 1IRSA 5JHGA 4NSWA 4HDQA 3GYOA 2Y7BA 1XX0A 2I5CA 3MDBC 2EMTA 2IFSA 2GCJA 1OY2A 4HB4B 2Y8GA 4Y94A 4F7UP 1GG3A 3D8FA 2RLOA 2RSGA 4HAYB 5J3TA 2MWNB 1UPQA 3D8EA 3PZDA 1W1DA 4TYZA 2GS0A 2LG1A 1DDVA 4A6FA 4A6FB 3P7ZA 1J19A 3KZ1A 3U7DA 4PNKA 4MK0A 1UNPA 2AL6A 4ZRKA 2EJ8A 3A98B 2MFQA 4KVGB 2D9YA 3KY9A 3CXBB 3TVVA 2JP2A 3CIKA 2I5FA 2HTHB 5D3WA 3HIEA 1P5TA 1TXDA 4HATB 3ZVRA 5J3QA 2R2YA 2COAA 2D9XA 2GUMA 2D9VA 1RJ2A 5C16A 5D3YA 2NZ8B 5C79A 1FGYA 5C5BB 1KZGA 2VKIA 4QXAB 3DXCA 2N23A 3TCAA 4DBBA 3HK0A 3ODOA 2FJLA 4GZUA 1XCGA 1AQCA 5DH9B 4NY0A 5IRSA 1BWNA 5EFXA 2VRWB 5I2SA 5KQ4A 3HSAA 1V5UA 4HAVB 2RGNB 1V5PA 1EF1A 1PFJA 4L6EA 2OTXA 3T06A 1M7RA 2COFA 2COCA 5LG4B 1B55A 2YT0A 2ELAA 1WJ1A 2XQNM 4HB0B 1X86A 3U12A 1U2BA 2KUQA 5C6RA 5LOPB 1BAKA 4CYEA 3O96A 3LJUX 4GNKB 3FEHA 3ZDTA 4F7HA 3OHMB 1U5FA 2G35A 5CLQB 2YVCA 2R0DA 5KQ1A 1UNRA 4KHAA 3NWFA 1OMWA 3DXDA 2KIEA 1DYNA 3QIJA 2UVMA 1XKEA 2YS3A 3G9WA 3IVFA 3A8QA 4MT7A 3NSUA 2I1JA 2CODA 2J0KA 5DI9B 4QJ4B 1FAOA 3AJ4A 5CLLB 2MDXA 2DHKA 2P8VA 2YS1A 3ODXA 4OT1A 4EJNA 3F5RA 3PSCA 4WJ7A 1I2HA 4A6KA 2DHIA 2MKRA 2K2UA 3P6AA 3TO1A 2Z0OA 2YSZA 1E5WA 2KIGA 4HDOA 1Z87A 1LB1A 2K8EA 4GMVA 4K81A 2K00A 2J59M 3KRWA 1W1GA 5FI1A 2I1KA 2RVBB 4EMOA 1V89A 1KI1B 2QKMA 3ODWA 2D9ZA 4CSQA 3VIAA 4KHOA 1X1GA 5M4YB 4EKUA 1WGQA 2DN6A 1ZYIA 3BINA 2BCJA 1EVHA 5LONB 2CAYA 4GMXB 2NBVA 3KSYA 3PEGA 1U27A 4GOUA 1EAZA 1MK9B 3OANA 4DXAB 4YONA 2R09A 2D9WA 2ZKMX 2H7DA 5HE0A 2CRFA 2RRFA 1AWEA 2Z4DA 2DLWA 2UZRA 5GOWB 3UZTA 1DBHA 2ELBA 2RUKB 2AEHA 1DDWA 5DHFB 4HAXB 4C0AA 1MPHA 1XODA 3PVUA 2Z13A 2D10A 4HHVA 3RCPA 2L1CA 4KHBA 2M14A 4KHBB 1NTYA 1PLSA 4D6WA 3QBVB 2D4QA 2Z0PA 2W2XC 4GXBA 4A6HA 1ZC3B 1ZSQA 4IOYX 2K2JA 1X1FA 2J0JA 1UEFA 1P3RA 4D0NB 1TJ6A 5DIFB 2QKLA 3DCXA 2YT2A 4WVFB 1XR0B 4HB2B 4HAUB 4IFSA 2HE7A 2LKOA 2KUPA 4B6HA 1FOEA 3D8DA 1BTKA 2Z59A 1ZM0A 2J0MA 1X05A 3WYFB 1TQZA 1OQNA 1BTNA 5JLJB 3SYXA 2DYNA 1MIZB 4K2OA 1WVHA 4K17A 5DHAB 1WI1A 1MAIA 2Z14A 1MI1A 1P6SA 4YL8A 1GC6A 2DFKA 1MKEA 4WSFA 2D2QA 2W2WA 3DXEA 1GC7A 1H4RA 1U5GA 2OQBA 2P0DA 3SUZA 4BBKA 2P0HA 5HE3A 2ADZA 4GN1A 4K2PA 1WG7A 3AU5A 1WJMA 3GYPA 4DX8A 1U5DA 1J0WA 2LULA 2YS5A 3NWDA 5I2MA 3WA0A 3NW8A 3PP2A 5D3VA 3FM8C 2DKPA 3HW2B 2DHJA 5JP4A 2ROZB 3HQCA 3VOQA 1RRPB 3PG7A 4QJ3B 3PVWA 4Z2MB 1M7EA 2VSZA 1K5DB 5L81A 2GJYA 4CHMA 2DX5A 5HE2A 3A8PA 1WGUA 5J3YA 1DDMA 1H10A 2KCJA 4XWXA 3X23A 1KZ7A 2NMBA 1ZC4B 2ZPYA 1V61A 3NWAA 4MY6A 4DIXA 2L2IA 3ULBA 4IAPA 5KCVA 1U5EA 3A58A 1NTVA 1FGZA 1MIXA 4QJ5B 1UNQA 4H8SA 3F0WA 3SO6A 2X18A 1FHWA 1ISNA 3FVCA 3B77A 2LOXA 1SGHA 3SV1A 2LYDA 5JHHA 2EMSA 2Y8FA 3AU4A 3ML4A 4Z2NA 3U8ZA 3ULCA 2YRYA 4GPTB 1PMSA 2ROVA 3TFMA 2E2XA 1V5MA 2IYBA 2W2XD 2KGXB 1FHXA 2UZSA 5C5BA 4P7IA 2D11A 2GCLA 1Q67A 2M38A 3FSSA 4CHJA 1DROA 1LW3A 1W1HA 2YF0A 2V76A 2H7EA 1I7AA 2N0YA 2DYQA 1Y19B 2K49A 3MPXA 2Z0QA 3BJIA 3N7CA 2PZ1A 1MK7B 2P0FA 4ZRIA 2RNRB 4PQ0A
chains in the Genus database with same CATH topology
1K5GB 3QWMA 2DX1A 2CY4A 1NU2A 2DKQA 1FB8A 4KAXB 1N3HA 2DA0A 2Q13A 4DX90 2LOZA 1X11A 2YT1A 5D3XA 4HB3B 1EGXA 1ZVRA 2CY5A 5D27A 3TW1A 1SHCA 5FI0A 4TKNA 4HAWB 3V5WA 1NI2A 1UPRA 1V88A 5HE1A 2EC1A 1U29A 4A5KA 3SNHA 1QC6A 1QQGA 1Y5OA 1FHOA 4F7GA 3PVLA 4HAZB 1XD4A 3M1IB 4ZRJA 3KRXA 2DTCA 1IRSA 5JHGA 4NSWA 4HDQA 3GYOA 2Y7BA 1XX0A 2I5CA 3MDBC 2EMTA 2IFSA 2GCJA 1OY2A 4HB4B 2Y8GA 4Y94A 4F7UP 1GG3A 3D8FA 2RLOA 2RSGA 4HAYB 5J3TA 2MWNB 1UPQA 3D8EA 3PZDA 1W1DA 4TYZA 2GS0A 2LG1A 1DDVA 4A6FA 4A6FB 3P7ZA 1J19A 3KZ1A 3U7DA 4PNKA 4MK0A 1UNPA 2AL6A 4ZRKA 2EJ8A 3A98B 2MFQA 4KVGB 2D9YA 3KY9A 3CXBB 3TVVA 2JP2A 3CIKA 2I5FA 2HTHB 5D3WA 1P5TA 1TXDA 4HATB 3ZVRA 5J3QA 2COAA 2D9XA 2D9VA 1RJ2A 5C16A 5D3YA 2NZ8B 5C79A 1FGYA 5C5BB 1KZGA 2VKIA 3DXCA 2N23A 3TCAA 4DBBA 3HK0A 3ODOA 2FJLA 4GZUA 1XCGA 1AQCA 5DH9B 4NY0A 1BWNA 5EFXA 2VRWB 5KQ4A 1V5UA 4HAVB 2RGNB 1V5PA 1EF1A 1PFJA 4L6EA 2OTXA 3T06A 1M7RA 2COFA 2COCA 1B55A 2YT0A 2ELAA 1WJ1A 2XQNM 4HB0B 1X86A 1U2BA 5C6RA 5LOPB 1BAKA 4CYEA 3O96A 3LJUX 3FEHA 3ZDTA 4F7HA 1U5FA 2G35A 5CLQB 2YVCA 2R0DA 5KQ1A 1UNRA 4KHAA 1OMWA 3DXDA 1DYNA 3QIJA 2UVMA 3IVFA 1XKEA 2YS3A 3G9WA 3A8QA 4MT7A 3NSUA 2I1JA 2CODA 2J0KA 5DI9B 1FAOA 3AJ4A 5CLLB 2MDXA 2DHKA 2P8VA 2YS1A 3ODXA 4EJNA 3F5RA 3PSCA 4WJ7A 1I2HA 4A6KA 2DHIA 2MKRA 2K2UA 3P6AA 3TO1A 2Z0OA 2YSZA 1E5WA 4HDOA 1Z87A 1LB1A 4GMVA 4K81A 2K00A 2J59M 3KRWA 1W1GA 5FI1A 2I1KA 2RVBB 4EMOA 1V89A 1KI1B 2QKMA 3ODWA 2D9ZA 3VIAA 4KHOA 1X1GA 4EKUA 1WGQA 2DN6A 3BINA 2BCJA 1EVHA 5LONB 2CAYA 4GMXB 3KSYA 3PEGA 1U27A 1EAZA 1MK9B 3OANA 4DXAB 4YONA 2R09A 2D9WA 2H7DA 5HE0A 2CRFA 1AWEA 2DLWA 2UZRA 5GOWB 3UZTA 1DBHA 2ELBA 2RUKB 2AEHA 1DDWA 5DHFB 4HAXB 4C0AA 1MPHA 1XODA 3PVUA 2D10A 4HHVA 3RCPA 2L1CA 2M14A 4KHBB 1NTYA 1PLSA 3QBVB 2D4QA 2Z0PA 2W2XC 4GXBA 4A6HA 1ZC3B 1ZSQA 4IOYX 2K2JA 1X1FA 2J0JA 1UEFA 1P3RA 4D0NB 1TJ6A 5DIFB 2QKLA 4WVFB 1XR0B 4HB2B 4HAUB 4IFSA 2HE7A 2LKOA 2KUPA 4B6HA 1FOEA 3D8DA 1BTKA 1ZM0A 2J0MA 1X05A 3WYFB 1TQZA 1OQNA 1BTNA 5JLJB 3SYXA 2DYNA 1MIZB 4K2OA 1WVHA 4K17A 5DHAB 1WI1A 1MAIA 1P6SA 4YL8A 1GC6A 2DFKA 1MKEA 4WSFA 2D2QA 2W2WA 3DXEA 1GC7A 1H4RA 1U5GA 2OQBA 2P0DA 3SUZA 4BBKA 2P0HA 5HE3A 2ADZA 4GN1A 4K2PA 1WG7A 3AU5A 1WJMA 3GYPA 4DX8A 1U5DA 1J0WA 2LULA 2YS5A 3WA0A 3PP2A 5D3VA 3FM8C 2DKPA 3HW2B 2DHJA 5JP4A 2ROZB 3HQCA 3VOQA 1RRPB 3PG7A 3PVWA 4Z2MB 1M7EA 2VSZA 1K5DB 5L81A 2GJYA 4CHMA 2DX5A 5HE2A 3A8PA 1WGUA 5J3YA 1DDMA 1H10A 2KCJA 4XWXA 3X23A 1KZ7A 2NMBA 1ZC4B 2ZPYA 1V61A 4MY6A 2L2IA 3ULBA 4IAPA 5KCVA 1U5EA 1NTVA 1FGZA 1MIXA 1UNQA 4H8SA 3F0WA 3SO6A 2X18A 1FHWA 1ISNA 2LOXA 1SGHA 3SV1A 2LYDA 5JHHA 2EMSA 2Y8FA 3AU4A 3ML4A 4Z2NA 3U8ZA 3ULCA 2YRYA 4GPTB 1PMSA 2ROVA 3TFMA 2E2XA 1V5MA 2IYBA 2W2XD 2KGXB 1FHXA 2UZSA 5C5BA 4P7IA 2D11A 2GCLA 1Q67A 2M38A 3FSSA 4CHJA 1DROA 1LW3A 1W1HA 2YF0A 2H7EA 2V76A 1I7AA 2N0YA 2DYQA 1Y19B 3MPXA 2Z0QA 3BJIA 3N7CA 2PZ1A 1MK7B 2P0FA 4ZRIA 2RNRB 4PQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5G B;  3QWM A;  2DX1 A;  2CY4 A;  1NU2 A;  2DKQ A;  1FB8 A;  4KAX B;  1N3H A;  2DA0 A;  2Q13 A;  4DX9 0;  2LOZ A;  1X11 A;  2YT1 A;  5D3X A;  4HB3 B;  1EGX A;  1ZVR A;  2CY5 A;  5D27 A;  3TW1 A;  1SHC A;  5FI0 A;  4TKN A;  4HAW B;  3V5W A;  1NI2 A;  1UPR A;  1V88 A;  5HE1 A;  2EC1 A;  1U29 A;  4A5K A;  3SNH A;  1QC6 A;  1QQG A;  1Y5O A;  1FHO A;  4F7G A;  3PVL A;  4HAZ B;  1XD4 A;  3M1I B;  4ZRJ A;  3KRX A;  2DTC A;  1IRS A;  5JHG A;  4NSW A;  4HDQ A;  3GYO A;  2Y7B A;  1XX0 A;  2I5C A;  3MDB C;  2EMT A;  2IFS A;  2GCJ A;  1OY2 A;  4HB4 B;  2Y8G A;  4Y94 A;  4F7U P;  1GG3 A;  3D8F A;  2RLO A;  2RSG A;  4HAY B;  5J3T A;  2MWN B;  1UPQ A;  3D8E A;  3PZD A;  1W1D A;  4TYZ A;  2GS0 A;  2LG1 A;  1DDV A;  4A6F A;  4A6F B;  3P7Z A;  1J19 A;  3KZ1 A;  3U7D A;  4PNK A;  4MK0 A;  1UNP A;  2AL6 A;  4ZRK A;  2EJ8 A;  3A98 B;  2MFQ A;  4KVG B;  2D9Y A;  3KY9 A;  3CXB B;  3TVV A;  2JP2 A;  3CIK A;  2I5F A;  2HTH B;  5D3W A;  1P5T A;  1TXD A;  4HAT B;  3ZVR A;  5J3Q A;  2COA A;  2D9X A;  2D9V A;  1RJ2 A;  5C16 A;  5D3Y A;  2NZ8 B;  5C79 A;  1FGY A;  5C5B B;  1KZG A;  2VKI A;  3DXC A;  2N23 A;  3TCA A;  4DBB A;  3HK0 A;  3ODO A;  2FJL A;  4GZU A;  1XCG A;  1AQC A;  5DH9 B;  4NY0 A;  1BWN A;  5EFX A;  2VRW B;  5KQ4 A;  1V5U A;  4HAV B;  2RGN B;  1V5P A;  1EF1 A;  1PFJ A;  4L6E A;  2OTX A;  3T06 A;  1M7R A;  2COF A;  2COC A;  1B55 A;  2YT0 A;  2ELA A;  1WJ1 A;  2XQN M;  4HB0 B;  1X86 A;  1U2B A;  5C6R A;  5LOP B;  1BAK A;  4CYE A;  3O96 A;  3LJU X;  3FEH A;  3ZDT A;  4F7H A;  1U5F A;  2G35 A;  5CLQ B;  2YVC A;  2R0D A;  5KQ1 A;  1UNR A;  4KHA A;  1OMW A;  3DXD A;  1DYN A;  3QIJ A;  2UVM A;  3IVF A;  1XKE A;  2YS3 A;  3G9W A;  3A8Q A;  4MT7 A;  3NSU A;  2I1J A;  2COD A;  2J0K A;  5DI9 B;  1FAO A;  3AJ4 A;  5CLL B;  2MDX A;  2DHK A;  2P8V A;  2YS1 A;  3ODX A;  4EJN A;  3F5R A;  3PSC A;  4WJ7 A;  1I2H A;  4A6K A;  2DHI A;  2MKR A;  2K2U A;  3P6A A;  3TO1 A;  2Z0O A;  2YSZ A;  1E5W A;  4HDO A;  1Z87 A;  1LB1 A;  4GMV A;  4K81 A;  2K00 A;  2J59 M;  3KRW A;  1W1G A;  5FI1 A;  2I1K A;  2RVB B;  4EMO A;  1V89 A;  1KI1 B;  2QKM A;  3ODW A;  2D9Z A;  3VIA A;  4KHO A;  1X1G A;  4EKU A;  1WGQ A;  2DN6 A;  3BIN A;  2BCJ A;  1EVH A;  5LON B;  2CAY A;  4GMX B;  3KSY A;  3PEG A;  1U27 A;  1EAZ A;  1MK9 B;  3OAN A;  4DXA B;  4YON A;  2R09 A;  2D9W A;  2H7D A;  5HE0 A;  2CRF A;  1AWE A;  2DLW A;  2UZR A;  5GOW B;  3UZT A;  1DBH A;  2ELB A;  2RUK B;  2AEH A;  1DDW A;  5DHF B;  4HAX B;  4C0A A;  1MPH A;  1XOD A;  3PVU A;  2D10 A;  4HHV A;  3RCP A;  2L1C A;  2M14 A;  4KHB B;  1NTY A;  1PLS A;  3QBV B;  2D4Q A;  2Z0P A;  2W2X C;  4GXB A;  4A6H A;  1ZC3 B;  1ZSQ A;  4IOY X;  2K2J A;  1X1F A;  2J0J A;  1UEF A;  1P3R A;  4D0N B;  1TJ6 A;  5DIF B;  2QKL A;  4WVF B;  1XR0 B;  4HB2 B;  4HAU B;  4IFS A;  2HE7 A;  2LKO A;  2KUP A;  4B6H A;  1FOE A;  3D8D A;  1BTK A;  1ZM0 A;  2J0M A;  1X05 A;  3WYF B;  1TQZ A;  1OQN A;  1BTN A;  5JLJ B;  3SYX A;  2DYN A;  1MIZ B;  4K2O A;  1WVH A;  4K17 A;  5DHA B;  1WI1 A;  1MAI A;  1P6S A;  4YL8 A;  1GC6 A;  2DFK A;  1MKE A;  4WSF A;  2D2Q A;  2W2W A;  3DXE A;  1GC7 A;  1H4R A;  1U5G A;  2OQB A;  2P0D A;  3SUZ A;  4BBK A;  2P0H A;  5HE3 A;  2ADZ A;  4GN1 A;  4K2P A;  1WG7 A;  3AU5 A;  1WJM A;  3GYP A;  4DX8 A;  1U5D A;  1J0W A;  2LUL A;  2YS5 A;  3WA0 A;  3PP2 A;  5D3V A;  3FM8 C;  2DKP A;  3HW2 B;  2DHJ A;  5JP4 A;  2ROZ B;  3HQC A;  3VOQ A;  1RRP B;  3PG7 A;  3PVW A;  4Z2M B;  1M7E A;  2VSZ A;  1K5D B;  5L81 A;  2GJY A;  4CHM A;  2DX5 A;  5HE2 A;  3A8P A;  1WGU A;  5J3Y A;  1DDM A;  1H10 A;  2KCJ A;  4XWX A;  3X23 A;  1KZ7 A;  2NMB A;  1ZC4 B;  2ZPY A;  1V61 A;  4MY6 A;  2L2I A;  3ULB A;  4IAP A;  5KCV A;  1U5E A;  1NTV A;  1FGZ A;  1MIX A;  1UNQ A;  4H8S A;  3F0W A;  3SO6 A;  2X18 A;  1FHW A;  1ISN A;  2LOX A;  1SGH A;  3SV1 A;  2LYD A;  5JHH A;  2EMS A;  2Y8F A;  3AU4 A;  3ML4 A;  4Z2N A;  3U8Z A;  3ULC A;  2YRY A;  4GPT B;  1PMS A;  2ROV A;  3TFM A;  2E2X A;  1V5M A;  2IYB A;  2W2X D;  2KGX B;  1FHX A;  2UZS A;  5C5B A;  4P7I A;  2D11 A;  2GCL A;  1Q67 A;  2M38 A;  3FSS A;  4CHJ A;  1DRO A;  1LW3 A;  1W1H A;  2YF0 A;  2H7E A;  2V76 A;  1I7A A;  2N0Y A;  2DYQ A;  1Y19 B;  3MPX A;  2Z0Q A;  3BJI A;  3N7C A;  2PZ1 A;  1MK7 B;  2P0F A;  4ZRI A;  2RNR B;  4PQ0 A; 
#chains in the Genus database with same CATH topology
 1K5G B;  3QWM A;  2DX1 A;  2CY4 A;  1NU2 A;  2DKQ A;  4OSN A;  1FB8 A;  4KAX B;  1N3H A;  1T77 A;  2DA0 A;  4HSI A;  2Q13 A;  4DX9 0;  2FJU B;  2LOZ A;  1X11 A;  2YT1 A;  5D3X A;  4HB3 B;  1EGX A;  1ZVR A;  2CY5 A;  5D27 A;  3TW1 A;  1SHC A;  5FI0 A;  4TKN A;  4HAW B;  3V5W A;  1NI2 A;  1UPR A;  1V88 A;  5HE1 A;  2EC1 A;  2KR0 A;  1U29 A;  4A5K A;  3SNH A;  1QC6 A;  4L1R A;  1QQG A;  1Y5O A;  1FHO A;  4F7G A;  3PVL A;  4HAZ B;  1XD4 A;  3M1I B;  4ZRJ A;  3KRX A;  2DTC A;  1IRS A;  5JHG A;  4NSW A;  4HDQ A;  3GYO A;  2Y7B A;  1XX0 A;  2I5C A;  3MDB C;  2EMT A;  2IFS A;  2GCJ A;  1OY2 A;  4HB4 B;  2Y8G A;  4Y94 A;  4F7U P;  1GG3 A;  3D8F A;  2RLO A;  2RSG A;  4HAY B;  5J3T A;  2MWN B;  1UPQ A;  3D8E A;  3PZD A;  1W1D A;  4TYZ A;  2GS0 A;  2LG1 A;  1DDV A;  4A6F A;  4A6F B;  3P7Z A;  1J19 A;  3KZ1 A;  3U7D A;  4PNK A;  4MK0 A;  1UNP A;  2AL6 A;  4ZRK A;  2EJ8 A;  3A98 B;  2MFQ A;  4KVG B;  2D9Y A;  3KY9 A;  3CXB B;  3TVV A;  2JP2 A;  3CIK A;  2I5F A;  2HTH B;  5D3W A;  3HIE A;  1P5T A;  1TXD A;  4HAT B;  3ZVR A;  5J3Q A;  2R2Y A;  2COA A;  2D9X A;  2GUM A;  2D9V A;  1RJ2 A;  5C16 A;  5D3Y A;  2NZ8 B;  5C79 A;  1FGY A;  5C5B B;  1KZG A;  2VKI A;  4QXA B;  3DXC A;  2N23 A;  3TCA A;  4DBB A;  3HK0 A;  3ODO A;  2FJL A;  4GZU A;  1XCG A;  1AQC A;  5DH9 B;  4NY0 A;  5IRS A;  1BWN A;  5EFX A;  2VRW B;  5I2S A;  5KQ4 A;  3HSA A;  1V5U A;  4HAV B;  2RGN B;  1V5P A;  1EF1 A;  1PFJ A;  4L6E A;  2OTX A;  3T06 A;  1M7R A;  2COF A;  2COC A;  5LG4 B;  1B55 A;  2YT0 A;  2ELA A;  1WJ1 A;  2XQN M;  4HB0 B;  1X86 A;  3U12 A;  1U2B A;  2KUQ A;  5C6R A;  5LOP B;  1BAK A;  4CYE A;  3O96 A;  3LJU X;  4GNK B;  3FEH A;  3ZDT A;  4F7H A;  3OHM B;  1U5F A;  2G35 A;  5CLQ B;  2YVC A;  2R0D A;  5KQ1 A;  1UNR A;  4KHA A;  3NWF A;  1OMW A;  3DXD A;  2KIE A;  1DYN A;  3QIJ A;  2UVM A;  1XKE A;  2YS3 A;  3G9W A;  3IVF A;  3A8Q A;  4MT7 A;  3NSU A;  2I1J A;  2COD A;  2J0K A;  5DI9 B;  4QJ4 B;  1FAO A;  3AJ4 A;  5CLL B;  2MDX A;  2DHK A;  2P8V A;  2YS1 A;  3ODX A;  4OT1 A;  4EJN A;  3F5R A;  3PSC A;  4WJ7 A;  1I2H A;  4A6K A;  2DHI A;  2MKR A;  2K2U A;  3P6A A;  3TO1 A;  2Z0O A;  2YSZ A;  1E5W A;  2KIG A;  4HDO A;  1Z87 A;  1LB1 A;  2K8E A;  4GMV A;  4K81 A;  2K00 A;  2J59 M;  3KRW A;  1W1G A;  5FI1 A;  2I1K A;  2RVB B;  4EMO A;  1V89 A;  1KI1 B;  2QKM A;  3ODW A;  2D9Z A;  4CSQ A;  3VIA A;  4KHO A;  1X1G A;  5M4Y B;  4EKU A;  1WGQ A;  2DN6 A;  1ZYI A;  3BIN A;  2BCJ A;  1EVH A;  5LON B;  2CAY A;  4GMX B;  2NBV A;  3KSY A;  3PEG A;  1U27 A;  4GOU A;  1EAZ A;  1MK9 B;  3OAN A;  4DXA B;  4YON A;  2R09 A;  2D9W A;  2ZKM X;  2H7D A;  5HE0 A;  2CRF A;  2RRF A;  1AWE A;  2Z4D A;  2DLW A;  2UZR A;  5GOW B;  3UZT A;  1DBH A;  2ELB A;  2RUK B;  2AEH A;  1DDW A;  5DHF B;  4HAX B;  4C0A A;  1MPH A;  1XOD A;  3PVU A;  2Z13 A;  2D10 A;  4HHV A;  3RCP A;  2L1C A;  4KHB A;  2M14 A;  4KHB B;  1NTY A;  1PLS A;  4D6W A;  3QBV B;  2D4Q A;  2Z0P A;  2W2X C;  4GXB A;  4A6H A;  1ZC3 B;  1ZSQ A;  4IOY X;  2K2J A;  1X1F A;  2J0J A;  1UEF A;  1P3R A;  4D0N B;  1TJ6 A;  5DIF B;  2QKL A;  3DCX A;  2YT2 A;  4WVF B;  1XR0 B;  4HB2 B;  4HAU B;  4IFS A;  2HE7 A;  2LKO A;  2KUP A;  4B6H A;  1FOE A;  3D8D A;  1BTK A;  2Z59 A;  1ZM0 A;  2J0M A;  1X05 A;  3WYF B;  1TQZ A;  1OQN A;  1BTN A;  5JLJ B;  3SYX A;  2DYN A;  1MIZ B;  4K2O A;  1WVH A;  4K17 A;  5DHA B;  1WI1 A;  1MAI A;  2Z14 A;  1MI1 A;  1P6S A;  4YL8 A;  1GC6 A;  2DFK A;  1MKE A;  4WSF A;  2D2Q A;  2W2W A;  3DXE A;  1GC7 A;  1H4R A;  1U5G A;  2OQB A;  2P0D A;  3SUZ A;  4BBK A;  2P0H A;  5HE3 A;  2ADZ A;  4GN1 A;  4K2P A;  1WG7 A;  3AU5 A;  1WJM A;  3GYP A;  4DX8 A;  1U5D A;  1J0W A;  2LUL A;  2YS5 A;  3NWD A;  5I2M A;  3WA0 A;  3NW8 A;  3PP2 A;  5D3V A;  3FM8 C;  2DKP A;  3HW2 B;  2DHJ A;  5JP4 A;  2ROZ B;  3HQC A;  3VOQ A;  1RRP B;  3PG7 A;  4QJ3 B;  3PVW A;  4Z2M B;  1M7E A;  2VSZ A;  1K5D B;  5L81 A;  2GJY A;  4CHM A;  2DX5 A;  5HE2 A;  3A8P A;  1WGU A;  5J3Y A;  1DDM A;  1H10 A;  2KCJ A;  4XWX A;  3X23 A;  1KZ7 A;  2NMB A;  1ZC4 B;  2ZPY A;  1V61 A;  3NWA A;  4MY6 A;  4DIX A;  2L2I A;  3ULB A;  4IAP A;  5KCV A;  1U5E A;  3A58 A;  1NTV A;  1FGZ A;  1MIX A;  4QJ5 B;  1UNQ A;  4H8S A;  3F0W A;  3SO6 A;  2X18 A;  1FHW A;  1ISN A;  3FVC A;  3B77 A;  2LOX A;  1SGH A;  3SV1 A;  2LYD A;  5JHH A;  2EMS A;  2Y8F A;  3AU4 A;  3ML4 A;  4Z2N A;  3U8Z A;  3ULC A;  2YRY A;  4GPT B;  1PMS A;  2ROV A;  3TFM A;  2E2X A;  1V5M A;  2IYB A;  2W2X D;  2KGX B;  1FHX A;  2UZS A;  5C5B A;  4P7I A;  2D11 A;  2GCL A;  1Q67 A;  2M38 A;  3FSS A;  4CHJ A;  1DRO A;  1LW3 A;  1W1H A;  2YF0 A;  2V76 A;  2H7E A;  1I7A A;  2N0Y A;  2DYQ A;  1Y19 B;  2K49 A;  3MPX A;  2Z0Q A;  3BJI A;  3N7C A;  2PZ1 A;  1MK7 B;  2P0F A;  4ZRI A;  2RNR B;  4PQ0 A; 
#chains in the Genus database with same CATH homology
 1K5G B;  3QWM A;  2DX1 A;  2CY4 A;  1NU2 A;  2DKQ A;  1FB8 A;  4KAX B;  1N3H A;  2DA0 A;  2Q13 A;  4DX9 0;  2LOZ A;  1X11 A;  2YT1 A;  5D3X A;  4HB3 B;  1EGX A;  1ZVR A;  2CY5 A;  5D27 A;  3TW1 A;  1SHC A;  5FI0 A;  4TKN A;  4HAW B;  3V5W A;  1NI2 A;  1UPR A;  1V88 A;  5HE1 A;  2EC1 A;  1U29 A;  4A5K A;  3SNH A;  1QC6 A;  1QQG A;  1Y5O A;  1FHO A;  4F7G A;  3PVL A;  4HAZ B;  1XD4 A;  3M1I B;  4ZRJ A;  3KRX A;  2DTC A;  1IRS A;  5JHG A;  4NSW A;  4HDQ A;  3GYO A;  2Y7B A;  1XX0 A;  2I5C A;  3MDB C;  2EMT A;  2IFS A;  2GCJ A;  1OY2 A;  4HB4 B;  2Y8G A;  4Y94 A;  4F7U P;  1GG3 A;  3D8F A;  2RLO A;  2RSG A;  4HAY B;  5J3T A;  2MWN B;  1UPQ A;  3D8E A;  3PZD A;  1W1D A;  4TYZ A;  2GS0 A;  2LG1 A;  1DDV A;  4A6F A;  4A6F B;  3P7Z A;  1J19 A;  3KZ1 A;  3U7D A;  4PNK A;  4MK0 A;  1UNP A;  2AL6 A;  4ZRK A;  2EJ8 A;  3A98 B;  2MFQ A;  4KVG B;  2D9Y A;  3KY9 A;  3CXB B;  3TVV A;  2JP2 A;  3CIK A;  2I5F A;  2HTH B;  5D3W A;  1P5T A;  1TXD A;  4HAT B;  3ZVR A;  5J3Q A;  2COA A;  2D9X A;  2D9V A;  1RJ2 A;  5C16 A;  5D3Y A;  2NZ8 B;  5C79 A;  1FGY A;  5C5B B;  1KZG A;  2VKI A;  3DXC A;  2N23 A;  3TCA A;  4DBB A;  3HK0 A;  3ODO A;  2FJL A;  4GZU A;  1XCG A;  1AQC A;  5DH9 B;  4NY0 A;  1BWN A;  5EFX A;  2VRW B;  5KQ4 A;  1V5U A;  4HAV B;  2RGN B;  1V5P A;  1EF1 A;  1PFJ A;  4L6E A;  2OTX A;  3T06 A;  1M7R A;  2COF A;  2COC A;  1B55 A;  2YT0 A;  2ELA A;  1WJ1 A;  2XQN M;  4HB0 B;  1X86 A;  1U2B A;  5C6R A;  5LOP B;  1BAK A;  4CYE A;  3O96 A;  3LJU X;  3FEH A;  3ZDT A;  4F7H A;  1U5F A;  2G35 A;  5CLQ B;  2YVC A;  2R0D A;  5KQ1 A;  1UNR A;  4KHA A;  1OMW A;  3DXD A;  1DYN A;  3QIJ A;  2UVM A;  3IVF A;  1XKE A;  2YS3 A;  3G9W A;  3A8Q A;  4MT7 A;  3NSU A;  2I1J A;  2COD A;  2J0K A;  5DI9 B;  1FAO A;  3AJ4 A;  5CLL B;  2MDX A;  2DHK A;  2P8V A;  2YS1 A;  3ODX A;  4EJN A;  3F5R A;  3PSC A;  4WJ7 A;  1I2H A;  4A6K A;  2DHI A;  2MKR A;  2K2U A;  3P6A A;  3TO1 A;  2Z0O A;  2YSZ A;  1E5W A;  4HDO A;  1Z87 A;  1LB1 A;  4GMV A;  4K81 A;  2K00 A;  2J59 M;  3KRW A;  1W1G A;  5FI1 A;  2I1K A;  2RVB B;  4EMO A;  1V89 A;  1KI1 B;  2QKM A;  3ODW A;  2D9Z A;  3VIA A;  4KHO A;  1X1G A;  4EKU A;  1WGQ A;  2DN6 A;  3BIN A;  2BCJ A;  1EVH A;  5LON B;  2CAY A;  4GMX B;  3KSY A;  3PEG A;  1U27 A;  1EAZ A;  1MK9 B;  3OAN A;  4DXA B;  4YON A;  2R09 A;  2D9W A;  2H7D A;  5HE0 A;  2CRF A;  1AWE A;  2DLW A;  2UZR A;  5GOW B;  3UZT A;  1DBH A;  2ELB A;  2RUK B;  2AEH A;  1DDW A;  5DHF B;  4HAX B;  4C0A A;  1MPH A;  1XOD A;  3PVU A;  2D10 A;  4HHV A;  3RCP A;  2L1C A;  2M14 A;  4KHB B;  1NTY A;  1PLS A;  3QBV B;  2D4Q A;  2Z0P A;  2W2X C;  4GXB A;  4A6H A;  1ZC3 B;  1ZSQ A;  4IOY X;  2K2J A;  1X1F A;  2J0J A;  1UEF A;  1P3R A;  4D0N B;  1TJ6 A;  5DIF B;  2QKL A;  4WVF B;  1XR0 B;  4HB2 B;  4HAU B;  4IFS A;  2HE7 A;  2LKO A;  2KUP A;  4B6H A;  1FOE A;  3D8D A;  1BTK A;  1ZM0 A;  2J0M A;  1X05 A;  3WYF B;  1TQZ A;  1OQN A;  1BTN A;  5JLJ B;  3SYX A;  2DYN A;  1MIZ B;  4K2O A;  1WVH A;  4K17 A;  5DHA B;  1WI1 A;  1MAI A;  1P6S A;  4YL8 A;  1GC6 A;  2DFK A;  1MKE A;  4WSF A;  2D2Q A;  2W2W A;  3DXE A;  1GC7 A;  1H4R A;  1U5G A;  2OQB A;  2P0D A;  3SUZ A;  4BBK A;  2P0H A;  5HE3 A;  2ADZ A;  4GN1 A;  4K2P A;  1WG7 A;  3AU5 A;  1WJM A;  3GYP A;  4DX8 A;  1U5D A;  1J0W A;  2LUL A;  2YS5 A;  3WA0 A;  3PP2 A;  5D3V A;  3FM8 C;  2DKP A;  3HW2 B;  2DHJ A;  5JP4 A;  2ROZ B;  3HQC A;  3VOQ A;  1RRP B;  3PG7 A;  3PVW A;  4Z2M B;  1M7E A;  2VSZ A;  1K5D B;  5L81 A;  2GJY A;  4CHM A;  2DX5 A;  5HE2 A;  3A8P A;  1WGU A;  5J3Y A;  1DDM A;  1H10 A;  2KCJ A;  4XWX A;  3X23 A;  1KZ7 A;  2NMB A;  1ZC4 B;  2ZPY A;  1V61 A;  4MY6 A;  2L2I A;  3ULB A;  4IAP A;  5KCV A;  1U5E A;  1NTV A;  1FGZ A;  1MIX A;  1UNQ A;  4H8S A;  3F0W A;  3SO6 A;  2X18 A;  1FHW A;  1ISN A;  2LOX A;  1SGH A;  3SV1 A;  2LYD A;  5JHH A;  2EMS A;  2Y8F A;  3AU4 A;  3ML4 A;  4Z2N A;  3U8Z A;  3ULC A;  2YRY A;  4GPT B;  1PMS A;  2ROV A;  3TFM A;  2E2X A;  1V5M A;  2IYB A;  2W2X D;  2KGX B;  1FHX A;  2UZS A;  5C5B A;  4P7I A;  2D11 A;  2GCL A;  1Q67 A;  2M38 A;  3FSS A;  4CHJ A;  1DRO A;  1LW3 A;  1W1H A;  2YF0 A;  2H7E A;  2V76 A;  1I7A A;  2N0Y A;  2DYQ A;  1Y19 B;  3MPX A;  2Z0Q A;  3BJI A;  3N7C A;  2PZ1 A;  1MK7 B;  2P0F A;  4ZRI A;  2RNR B;  4PQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...