2N0YA

Nmr structure of the complex between the c-terminal domain of the rift valley fever virus protein nss and the ph domain of the tfb1 subunit of tfiih
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title A Omega XaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/viral protein
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2n0yA00
4GMXB 2CRFA 2YSZA 2FJLA 1GC6A 5J3QA 2DA0A 1U5FA 5C5BA 5JHGA 2AL6A 3O96A 5D3XA 1RJ2A 3G9WA 2HE7A 1LB1A 3WA0A 4HAXB 5CLQB 2ZPYA 3ZDTA 4EMOA 5D3WA 2MKRA 4HATB 3UZTA 1B55A 5HE3A 2Z0QA 2LKOA 3ULBA 2DHKA 2YVCA 4F7UP 3PZDA 2DX1A 2IFSA 1I7AA 1QC6A 2VSZA 3TCAA 1V5PA 4K17A 1M7EA 5D27A 1N3HA 2P0HA 5JHHA 1K5GB 3PSCA 2J59M 2J0KA 2XQNM 5FI1A 1ZC3B 4HAZB 1U5EA 1PLSA 1Q67A 1AQCA 4H8SA 2UZRA 4CHMA 1OQNA 1V88A 3D8FA 4K2PA 2UZSA 2DHJA 3KZ1A 5J3YA 2DYQA 3IVFA 3QBVB 2MFQA 4KVGB 1WI1A 3N7CA 2N0YA 1W1GA 2HTHB 4D0NB 2YS1A 2R0DA 3RCPA 4HB3B 1ZC4B 3D8EA 1XX0A 2J0MA 4DBBA 1EAZA 4KHBB 2RGNB 2D9ZA 1FAOA 3P7ZA 5D3VA 3TFMA 1XKEA 1V89A 1P6SA 2H7DA 4HB2B 2ROVA 3SNHA 4NSWA 5KQ1A 3TW1A 3CIKA 2DHIA 1KZGA 1I2HA 5DHAB 1UNPA 5JLJB 4MT7A 1V61A 1P5TA 1ZVRA 2I5FA 3A98B 2JP2A 1Y19B 4Z2MB 1H4RA 1V5MA 2VKIA 3X23A 2W2WA 1X11A 2YS3A 2GJYA 2P0DA 4GXBA 3V5WA 1XODA 3FM8C 4A5KA 2X18A 2D2QA 5D3YA 2D11A 1DBHA 2ADZA 1MK9B 1K5DB 3LJUX 1OMWA 2I1JA 1TJ6A 2H7EA 2Y8FA 2P8VA 2RUKB 2YT0A 3PG7A 1IRSA 1DDVA 4MK0A 2I5CA 2DKQA 1M7RA 4IAPA 2L1CA 4A6HA 2EC1A 2QKLA 5L81A 4HDQA 3WYFB 1X1FA 4NY0A 5C79A 3U7DA 1Z87A 2G35A 2Z0PA 4PNKA 1WVHA 3SUZA 3PVUA 4C0AA 2DX5A 1X05A 2EMTA 3DXDA 3KRWA 4L6EA 2QKMA 2AEHA 3AJ4A 3DXCA 4IFSA 2P0FA 2RSGA 5J3TA 1MKEA 1FGZA 1MIZB 1DYNA 5CLLB 1MAIA 4HAUB 4K2OA 1FHWA 5DHFB 2UVMA 2EJ8A 1UPQA 3PVLA 2VRWB 3VOQA 1BTNA 1KZ7A 4WJ7A 1ISNA 2YF0A 2Z0OA 5DI9B 2OQBA 2COFA 1FHXA 4TYZA 1ZM0A 1H10A 2ELAA 3DXEA 1NU2A 2L2IA 1WG7A 1OY2A 2W2XD 3A8PA 3NSUA 2LG1A 4HDOA 2ELBA 2RVBB 4WSFA 3CXBB 1DDWA 1X86A 2BCJA 4YONA 4EJNA 2PZ1A 2W2XC 1MIXA 2V76A 4CHJA 1FGYA 3T06A 2MWNB 1J0WA 1LW3A 1FB8A 3TO1A 1UEFA 1AWEA 2GS0A 1EVHA 4PQ0A 1XR0B 4DX90 1W1HA 3GYOA 3HK0A 4ZRIA 2OTXA 4A6KA 1XCGA 3D8DA 1E5WA 3QWMA 1XD4A 2D4QA 2Q13A 1WGUA 2M14A 2YRYA 5C6RA 3SV1A 1NTVA 1SGHA 2Y7BA 4HAYB 1TQZA 5DH9B 3A8QA 3SYXA 3MDBC 4YL8A 1U2BA 3SO6A 4B6HA 2D10A 3P6AA 4GZUA 4F7GA 2GCJA 3GYPA 1PMSA 2I1KA 2D9VA 1NTYA 1FHOA 3U8ZA 5JP4A 1BTKA 5DIFB 2KUPA 3ODOA 2KCJA 2NZ8B 4MY6A 1X1GA 1Y5OA 3KY9A 1FOEA 4TKNA 1P3RA 2CY5A 2Y8GA 4A6FB 2DFKA 4WVFB 3HQCA 5GOWB 3ODXA 2M38A 4K81A 2DN6A 3QIJA 1MK7B 3KRXA 3ML4A 3PP2A 3ODWA 2D9XA 2K2JA 1BAKA 2KGXB 3MPXA 4KAXB 1SHCA 2CODA 3AU4A 1RRPB 5EFXA 2E2XA 4HB4B 2DKPA 1U5DA 4CYEA 1EF1A 2K00A 3ZVRA 1BWNA 1EGXA 1WGQA 2RNRB 5HE2A 4KHAA 5HE0A 1UNQA 1UNRA 2LYDA 3VIAA 2ROZB 5C5BB 2RLOA 3FEHA 1DROA 2CAYA 4HAWB 2EMSA 4EKUA 1V5UA 1W1DA 1U29A 4F7HA 2YS5A 2DLWA 3AU5A 4GMVA 5LONB 4HHVA 4DX8A 4IOYX 1PFJA 3OANA 1TXDA 1KI1B 2LULA 3BINA 2N23A 1J19A 3HW2B 1U27A 2COCA 4Y94A 3ULCA 2DYNA 3F0WA 3M1IB 4GPTB 1NI2A 3PEGA 5C16A 5KCVA 1GC7A 1UPRA 1GG3A 2MDXA 4KHOA 2R09A 1MPHA 4ZRKA 5FI0A 4A6FA 3FSSA 2IYBA 5HE1A 2DTCA 4HAVB 2GCLA 2LOZA 1DDMA 3F5RA 4DXAB 5KQ4A 4BBKA 2COAA 2D9WA 4ZRJA 3PVWA 2J0JA 2NMBA 2K2UA 1ZSQA 3BJIA 2CY4A 2D9YA 4Z2NA 4P7IA 1U5GA 3TVVA 1QQGA 4GN1A 1WJ1A 1WJMA 5LOPB 4HB0B 2LOXA 4XWXA 3KSYA 2YT1A
chains in the Genus database with same CATH superfamily
4GMXB 2CRFA 2KR0A 2FJLA 2YSZA 1GC6A 5J3QA 2DA0A 1U5FA 5C5BA 5JHGA 2R2YA 2AL6A 3O96A 5D3XA 5M4YB 1RJ2A 3G9WA 2HE7A 1LB1A 3WA0A 4HAXB 5CLQB 2ZPYA 3ZDTA 4EMOA 5D3WA 2MKRA 4HATB 3UZTA 1B55A 5HE3A 2Z0QA 2LKOA 3ULBA 2DHKA 2YVCA 4F7UP 3PZDA 2DX1A 2IFSA 1I7AA 1QC6A 5LG4B 2VSZA 3TCAA 1V5PA 4K17A 5I2MA 1M7EA 5D27A 1N3HA 4KHBA 2P0HA 5JHHA 1K5GB 2K49A 3PSCA 2J59M 5IRSA 2J0KA 2XQNM 5FI1A 1ZC3B 4HAZB 1U5EA 1PLSA 1Q67A 1AQCA 4H8SA 2UZRA 4CHMA 1OQNA 1V88A 2Z59A 3D8FA 4OSNA 4K2PA 2UZSA 2DHJA 3KZ1A 5J3YA 2DYQA 3IVFA 3QBVB 2MFQA 4KVGB 1WI1A 3N7CA 2N0YA 2ZKMX 1W1GA 2HTHB 4D0NB 2YS1A 2R0DA 2Z13A 3RCPA 3HSAA 4HB3B 1ZC4B 3D8EA 2YT2A 4D6WA 1XX0A 2J0MA 4DBBA 2KIEA 4OT1A 5I2SA 1EAZA 4KHBB 2RGNB 2D9ZA 1FAOA 3P7ZA 5D3VA 3TFMA 3DCXA 1XKEA 4CSQA 1V89A 1P6SA 2H7DA 4HB2B 2ROVA 3SNHA 1MI1A 4NSWA 5KQ1A 3TW1A 3CIKA 2DHIA 1KZGA 1I2HA 5DHAB 4QJ3B 1UNPA 5JLJB 4MT7A 1V61A 1P5TA 1ZVRA 2I5FA 3A98B 3FVCA 2JP2A 3A58A 1Y19B 4Z2MB 1H4RA 1V5MA 2VKIA 3X23A 2W2WA 1X11A 2YS3A 2GJYA 2P0DA 4GXBA 3V5WA 1XODA 3FM8C 4A5KA 2X18A 2D2QA 5D3YA 2D11A 2NBVA 1DBHA 2ADZA 1MK9B 1K5DB 3LJUX 1OMWA 2I1JA 1TJ6A 2H7EA 2Y8FA 2P8VA 2RUKB 2YT0A 3PG7A 1IRSA 1DDVA 4MK0A 2I5CA 2DKQA 1M7RA 4IAPA 2L1CA 4A6HA 2EC1A 2QKLA 3NWAA 5L81A 4HDQA 3WYFB 1X1FA 4NY0A 5C79A 3U7DA 1Z87A 2G35A 2Z0PA 4PNKA 1WVHA 3SUZA 3PVUA 4C0AA 2DX5A 1X05A 2EMTA 1ZYIA 3DXDA 4QJ4B 3KRWA 4L6EA 2QKMA 2AEHA 3AJ4A 3DXCA 4IFSA 2P0FA 2RSGA 5J3TA 1MKEA 1FGZA 1MIZB 1DYNA 5CLLB 1MAIA 4HAUB 4K2OA 1FHWA 5DHFB 2UVMA 2EJ8A 1UPQA 3PVLA 2VRWB 3VOQA 1BTNA 1KZ7A 4WJ7A 1ISNA 2YF0A 2Z0OA 1T77A 5DI9B 2OQBA 2COFA 1FHXA 4TYZA 1ZM0A 1H10A 2ELAA 2K8EA 3DXEA 1NU2A 2L2IA 1WG7A 1OY2A 2W2XD 3A8PA 3NSUA 2LG1A 4HDOA 2ELBA 2RVBB 4WSFA 3CXBB 1DDWA 1X86A 2BCJA 4HSIA 4YONA 3OHMB 4EJNA 2PZ1A 2W2XC 1MIXA 2V76A 4CHJA 1FGYA 3T06A 2MWNB 1J0WA 3HIEA 1LW3A 1FB8A 3TO1A 1UEFA 1AWEA 2GS0A 1EVHA 4PQ0A 1XR0B 4DX90 1W1HA 3GYOA 3HK0A 4ZRIA 2OTXA 4A6KA 1XCGA 3D8DA 2KIGA 1E5WA 3QWMA 1XD4A 2D4QA 2Q13A 1WGUA 2M14A 2YRYA 4GOUA 2RRFA 5C6RA 3SV1A 1NTVA 1SGHA 2Y7BA 4HAYB 1TQZA 5DH9B 3A8QA 3SYXA 3MDBC 4YL8A 1U2BA 3SO6A 4B6HA 2D10A 3P6AA 4GZUA 4F7GA 2GCJA 3GYPA 1PMSA 2I1KA 2D9VA 1NTYA 1FHOA 3U8ZA 5JP4A 2GUMA 1BTKA 5DIFB 2KUPA 3ODOA 2KCJA 4L1RA 2NZ8B 4MY6A 1X1GA 1Y5OA 3KY9A 1FOEA 4TKNA 1P3RA 2CY5A 2Y8GA 4A6FB 2DFKA 4QXAB 4WVFB 3HQCA 5GOWB 3ODXA 2M38A 4K81A 2Z4DA 2DN6A 3QIJA 1MK7B 3KRXA 3ML4A 3PP2A 2KUQA 3ODWA 2D9XA 2K2JA 1BAKA 2KGXB 3MPXA 4KAXB 1SHCA 2CODA 3AU4A 1RRPB 5EFXA 2E2XA 4HB4B 2DKPA 1U5DA 4CYEA 1EF1A 2K00A 3ZVRA 1BWNA 1EGXA 1WGQA 2RNRB 5HE2A 4KHAA 5HE0A 4GNKB 1UNQA 1UNRA 2LYDA 3VIAA 2ROZB 5C5BB 2RLOA 3FEHA 1DROA 2CAYA 4HAWB 2EMSA 4EKUA 1V5UA 1W1DA 1U29A 4F7HA 2YS5A 2DLWA 3AU5A 4GMVA 5LONB 4HHVA 4DX8A 4IOYX 1PFJA 3OANA 1TXDA 1KI1B 4DIXA 2LULA 3BINA 2N23A 3B77A 1J19A 3HW2B 1U27A 2COCA 4Y94A 3ULCA 2DYNA 3F0WA 3M1IB 4GPTB 1NI2A 3PEGA 5C16A 5KCVA 1GC7A 1UPRA 1GG3A 2MDXA 4KHOA 2R09A 1MPHA 4ZRKA 5FI0A 4A6FA 3FSSA 2IYBA 5HE1A 2DTCA 3NWDA 4HAVB 2GCLA 2LOZA 1DDMA 3F5RA 4DXAB 5KQ4A 4BBKA 4QJ5B 2COAA 2Z14A 2D9WA 4ZRJA 3PVWA 2J0JA 2NMBA 2K2UA 1ZSQA 3NWFA 3BJIA 2CY4A 2D9YA 4Z2NA 3U12A 4P7IA 1U5GA 3TVVA 1QQGA 2FJUB 4GN1A 1WJ1A 1WJMA 5LOPB 4HB0B 2LOXA 4XWXA 3KSYA 2YT1A 3NW8A
chains in the Genus database with same CATH topology
4GMXB 2CRFA 2YSZA 2FJLA 1GC6A 5J3QA 2DA0A 1U5FA 5C5BA 5JHGA 2AL6A 3O96A 5D3XA 1RJ2A 3G9WA 2HE7A 1LB1A 3WA0A 4HAXB 5CLQB 2ZPYA 3ZDTA 4EMOA 5D3WA 2MKRA 4HATB 3UZTA 1B55A 5HE3A 2Z0QA 2LKOA 3ULBA 2DHKA 2YVCA 4F7UP 3PZDA 2DX1A 2IFSA 1I7AA 1QC6A 2VSZA 3TCAA 1V5PA 4K17A 1M7EA 5D27A 1N3HA 2P0HA 5JHHA 1K5GB 3PSCA 2J59M 2J0KA 2XQNM 5FI1A 1ZC3B 4HAZB 1U5EA 1PLSA 1Q67A 1AQCA 4H8SA 2UZRA 4CHMA 1OQNA 1V88A 3D8FA 4K2PA 2UZSA 2DHJA 3KZ1A 5J3YA 2DYQA 3IVFA 3QBVB 2MFQA 4KVGB 1WI1A 3N7CA 2N0YA 1W1GA 2HTHB 4D0NB 2YS1A 2R0DA 3RCPA 4HB3B 1ZC4B 3D8EA 1XX0A 2J0MA 4DBBA 1EAZA 4KHBB 2RGNB 2D9ZA 1FAOA 3P7ZA 5D3VA 3TFMA 1XKEA 1V89A 1P6SA 2H7DA 4HB2B 2ROVA 3SNHA 4NSWA 5KQ1A 3TW1A 3CIKA 2DHIA 1KZGA 1I2HA 5DHAB 1UNPA 5JLJB 4MT7A 1V61A 1P5TA 1ZVRA 2I5FA 3A98B 2JP2A 1Y19B 4Z2MB 1H4RA 1V5MA 2VKIA 3X23A 2W2WA 1X11A 2YS3A 2GJYA 2P0DA 4GXBA 3V5WA 1XODA 3FM8C 4A5KA 2X18A 2D2QA 5D3YA 2D11A 1DBHA 2ADZA 1MK9B 1K5DB 3LJUX 1OMWA 2I1JA 1TJ6A 2H7EA 2Y8FA 2P8VA 2RUKB 2YT0A 3PG7A 1IRSA 1DDVA 4MK0A 2I5CA 2DKQA 1M7RA 4IAPA 2L1CA 4A6HA 2EC1A 2QKLA 5L81A 4HDQA 3WYFB 1X1FA 4NY0A 5C79A 3U7DA 1Z87A 2G35A 2Z0PA 4PNKA 1WVHA 3SUZA 3PVUA 4C0AA 2DX5A 1X05A 2EMTA 3DXDA 3KRWA 4L6EA 2QKMA 2AEHA 3AJ4A 3DXCA 4IFSA 2P0FA 2RSGA 5J3TA 1MKEA 1FGZA 1MIZB 1DYNA 5CLLB 1MAIA 4HAUB 4K2OA 1FHWA 5DHFB 2UVMA 2EJ8A 1UPQA 3PVLA 2VRWB 3VOQA 1BTNA 1KZ7A 4WJ7A 1ISNA 2YF0A 2Z0OA 5DI9B 2OQBA 2COFA 1FHXA 4TYZA 1ZM0A 1H10A 2ELAA 3DXEA 1NU2A 2L2IA 1WG7A 1OY2A 2W2XD 3A8PA 3NSUA 2LG1A 4HDOA 2ELBA 2RVBB 4WSFA 3CXBB 1DDWA 1X86A 2BCJA 4YONA 4EJNA 2PZ1A 2W2XC 1MIXA 2V76A 4CHJA 1FGYA 3T06A 2MWNB 1J0WA 1LW3A 1FB8A 3TO1A 1UEFA 1AWEA 2GS0A 1EVHA 4PQ0A 1XR0B 4DX90 1W1HA 3GYOA 3HK0A 4ZRIA 2OTXA 4A6KA 1XCGA 3D8DA 1E5WA 3QWMA 1XD4A 2D4QA 2Q13A 1WGUA 2M14A 2YRYA 5C6RA 3SV1A 1NTVA 1SGHA 2Y7BA 4HAYB 1TQZA 5DH9B 3A8QA 3SYXA 3MDBC 4YL8A 1U2BA 3SO6A 4B6HA 2D10A 3P6AA 4GZUA 4F7GA 2GCJA 3GYPA 1PMSA 2I1KA 2D9VA 1NTYA 1FHOA 3U8ZA 5JP4A 1BTKA 5DIFB 2KUPA 3ODOA 2KCJA 2NZ8B 4MY6A 1X1GA 1Y5OA 3KY9A 1FOEA 4TKNA 1P3RA 2CY5A 2Y8GA 4A6FB 2DFKA 4WVFB 3HQCA 5GOWB 3ODXA 2M38A 4K81A 2DN6A 3QIJA 1MK7B 3KRXA 3ML4A 3PP2A 3ODWA 2D9XA 2K2JA 1BAKA 2KGXB 3MPXA 4KAXB 1SHCA 2CODA 3AU4A 1RRPB 5EFXA 2E2XA 4HB4B 2DKPA 1U5DA 4CYEA 1EF1A 2K00A 3ZVRA 1BWNA 1EGXA 1WGQA 2RNRB 5HE2A 4KHAA 5HE0A 1UNQA 1UNRA 2LYDA 3VIAA 2ROZB 5C5BB 2RLOA 3FEHA 1DROA 2CAYA 4HAWB 2EMSA 4EKUA 1V5UA 1W1DA 1U29A 4F7HA 2YS5A 2DLWA 3AU5A 4GMVA 5LONB 4HHVA 4DX8A 4IOYX 1PFJA 3OANA 1TXDA 1KI1B 2LULA 3BINA 2N23A 1J19A 3HW2B 1U27A 2COCA 4Y94A 3ULCA 2DYNA 3F0WA 3M1IB 4GPTB 1NI2A 3PEGA 5C16A 5KCVA 1GC7A 1UPRA 1GG3A 2MDXA 4KHOA 2R09A 1MPHA 4ZRKA 5FI0A 4A6FA 3FSSA 2IYBA 5HE1A 2DTCA 4HAVB 2GCLA 2LOZA 1DDMA 3F5RA 4DXAB 5KQ4A 4BBKA 2COAA 2D9WA 4ZRJA 3PVWA 2J0JA 2NMBA 2K2UA 1ZSQA 3BJIA 2CY4A 2D9YA 4Z2NA 4P7IA 1U5GA 3TVVA 1QQGA 4GN1A 1WJ1A 1WJMA 5LOPB 4HB0B 2LOXA 4XWXA 3KSYA 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMX B;  2CRF A;  2YSZ A;  2FJL A;  1GC6 A;  5J3Q A;  2DA0 A;  1U5F A;  5C5B A;  5JHG A;  2AL6 A;  3O96 A;  5D3X A;  1RJ2 A;  3G9W A;  2HE7 A;  1LB1 A;  3WA0 A;  4HAX B;  5CLQ B;  2ZPY A;  3ZDT A;  4EMO A;  5D3W A;  2MKR A;  4HAT B;  3UZT A;  1B55 A;  5HE3 A;  2Z0Q A;  2LKO A;  3ULB A;  2DHK A;  2YVC A;  4F7U P;  3PZD A;  2DX1 A;  2IFS A;  1I7A A;  1QC6 A;  2VSZ A;  3TCA A;  1V5P A;  4K17 A;  1M7E A;  5D27 A;  1N3H A;  2P0H A;  5JHH A;  1K5G B;  3PSC A;  2J59 M;  2J0K A;  2XQN M;  5FI1 A;  1ZC3 B;  4HAZ B;  1U5E A;  1PLS A;  1Q67 A;  1AQC A;  4H8S A;  2UZR A;  4CHM A;  1OQN A;  1V88 A;  3D8F A;  4K2P A;  2UZS A;  2DHJ A;  3KZ1 A;  5J3Y A;  2DYQ A;  3IVF A;  3QBV B;  2MFQ A;  4KVG B;  1WI1 A;  3N7C A;  2N0Y A;  1W1G A;  2HTH B;  4D0N B;  2YS1 A;  2R0D A;  3RCP A;  4HB3 B;  1ZC4 B;  3D8E A;  1XX0 A;  2J0M A;  4DBB A;  1EAZ A;  4KHB B;  2RGN B;  2D9Z A;  1FAO A;  3P7Z A;  5D3V A;  3TFM A;  1XKE A;  1V89 A;  1P6S A;  2H7D A;  4HB2 B;  2ROV A;  3SNH A;  4NSW A;  5KQ1 A;  3TW1 A;  3CIK A;  2DHI A;  1KZG A;  1I2H A;  5DHA B;  1UNP A;  5JLJ B;  4MT7 A;  1V61 A;  1P5T A;  1ZVR A;  2I5F A;  3A98 B;  2JP2 A;  1Y19 B;  4Z2M B;  1H4R A;  1V5M A;  2VKI A;  3X23 A;  2W2W A;  1X11 A;  2YS3 A;  2GJY A;  2P0D A;  4GXB A;  3V5W A;  1XOD A;  3FM8 C;  4A5K A;  2X18 A;  2D2Q A;  5D3Y A;  2D11 A;  1DBH A;  2ADZ A;  1MK9 B;  1K5D B;  3LJU X;  1OMW A;  2I1J A;  1TJ6 A;  2H7E A;  2Y8F A;  2P8V A;  2RUK B;  2YT0 A;  3PG7 A;  1IRS A;  1DDV A;  4MK0 A;  2I5C A;  2DKQ A;  1M7R A;  4IAP A;  2L1C A;  4A6H A;  2EC1 A;  2QKL A;  5L81 A;  4HDQ A;  3WYF B;  1X1F A;  4NY0 A;  5C79 A;  3U7D A;  1Z87 A;  2G35 A;  2Z0P A;  4PNK A;  1WVH A;  3SUZ A;  3PVU A;  4C0A A;  2DX5 A;  1X05 A;  2EMT A;  3DXD A;  3KRW A;  4L6E A;  2QKM A;  2AEH A;  3AJ4 A;  3DXC A;  4IFS A;  2P0F A;  2RSG A;  5J3T A;  1MKE A;  1FGZ A;  1MIZ B;  1DYN A;  5CLL B;  1MAI A;  4HAU B;  4K2O A;  1FHW A;  5DHF B;  2UVM A;  2EJ8 A;  1UPQ A;  3PVL A;  2VRW B;  3VOQ A;  1BTN A;  1KZ7 A;  4WJ7 A;  1ISN A;  2YF0 A;  2Z0O A;  5DI9 B;  2OQB A;  2COF A;  1FHX A;  4TYZ A;  1ZM0 A;  1H10 A;  2ELA A;  3DXE A;  1NU2 A;  2L2I A;  1WG7 A;  1OY2 A;  2W2X D;  3A8P A;  3NSU A;  2LG1 A;  4HDO A;  2ELB A;  2RVB B;  4WSF A;  3CXB B;  1DDW A;  1X86 A;  2BCJ A;  4YON A;  4EJN A;  2PZ1 A;  2W2X C;  1MIX A;  2V76 A;  4CHJ A;  1FGY A;  3T06 A;  2MWN B;  1J0W A;  1LW3 A;  1FB8 A;  3TO1 A;  1UEF A;  1AWE A;  2GS0 A;  1EVH A;  4PQ0 A;  1XR0 B;  4DX9 0;  1W1H A;  3GYO A;  3HK0 A;  4ZRI A;  2OTX A;  4A6K A;  1XCG A;  3D8D A;  1E5W A;  3QWM A;  1XD4 A;  2D4Q A;  2Q13 A;  1WGU A;  2M14 A;  2YRY A;  5C6R A;  3SV1 A;  1NTV A;  1SGH A;  2Y7B A;  4HAY B;  1TQZ A;  5DH9 B;  3A8Q A;  3SYX A;  3MDB C;  4YL8 A;  1U2B A;  3SO6 A;  4B6H A;  2D10 A;  3P6A A;  4GZU A;  4F7G A;  2GCJ A;  3GYP A;  1PMS A;  2I1K A;  2D9V A;  1NTY A;  1FHO A;  3U8Z A;  5JP4 A;  1BTK A;  5DIF B;  2KUP A;  3ODO A;  2KCJ A;  2NZ8 B;  4MY6 A;  1X1G A;  1Y5O A;  3KY9 A;  1FOE A;  4TKN A;  1P3R A;  2CY5 A;  2Y8G A;  4A6F B;  2DFK A;  4WVF B;  3HQC A;  5GOW B;  3ODX A;  2M38 A;  4K81 A;  2DN6 A;  3QIJ A;  1MK7 B;  3KRX A;  3ML4 A;  3PP2 A;  3ODW A;  2D9X A;  2K2J A;  1BAK A;  2KGX B;  3MPX A;  4KAX B;  1SHC A;  2COD A;  3AU4 A;  1RRP B;  5EFX A;  2E2X A;  4HB4 B;  2DKP A;  1U5D A;  4CYE A;  1EF1 A;  2K00 A;  3ZVR A;  1BWN A;  1EGX A;  1WGQ A;  2RNR B;  5HE2 A;  4KHA A;  5HE0 A;  1UNQ A;  1UNR A;  2LYD A;  3VIA A;  2ROZ B;  5C5B B;  2RLO A;  3FEH A;  1DRO A;  2CAY A;  4HAW B;  2EMS A;  4EKU A;  1V5U A;  1W1D A;  1U29 A;  4F7H A;  2YS5 A;  2DLW A;  3AU5 A;  4GMV A;  5LON B;  4HHV A;  4DX8 A;  4IOY X;  1PFJ A;  3OAN A;  1TXD A;  1KI1 B;  2LUL A;  3BIN A;  2N23 A;  1J19 A;  3HW2 B;  1U27 A;  2COC A;  4Y94 A;  3ULC A;  2DYN A;  3F0W A;  3M1I B;  4GPT B;  1NI2 A;  3PEG A;  5C16 A;  5KCV A;  1GC7 A;  1UPR A;  1GG3 A;  2MDX A;  4KHO A;  2R09 A;  1MPH A;  4ZRK A;  5FI0 A;  4A6F A;  3FSS A;  2IYB A;  5HE1 A;  2DTC A;  4HAV B;  2GCL A;  2LOZ A;  1DDM A;  3F5R A;  4DXA B;  5KQ4 A;  4BBK A;  2COA A;  2D9W A;  4ZRJ A;  3PVW A;  2J0J A;  2NMB A;  2K2U A;  1ZSQ A;  3BJI A;  2CY4 A;  2D9Y A;  4Z2N A;  4P7I A;  1U5G A;  3TVV A;  1QQG A;  4GN1 A;  1WJ1 A;  1WJM A;  5LOP B;  4HB0 B;  2LOX A;  4XWX A;  3KSY A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 4GMX B;  2CRF A;  2KR0 A;  2FJL A;  2YSZ A;  1GC6 A;  5J3Q A;  2DA0 A;  1U5F A;  5C5B A;  5JHG A;  2R2Y A;  2AL6 A;  3O96 A;  5D3X A;  5M4Y B;  1RJ2 A;  3G9W A;  2HE7 A;  1LB1 A;  3WA0 A;  4HAX B;  5CLQ B;  2ZPY A;  3ZDT A;  4EMO A;  5D3W A;  2MKR A;  4HAT B;  3UZT A;  1B55 A;  5HE3 A;  2Z0Q A;  2LKO A;  3ULB A;  2DHK A;  2YVC A;  4F7U P;  3PZD A;  2DX1 A;  2IFS A;  1I7A A;  1QC6 A;  5LG4 B;  2VSZ A;  3TCA A;  1V5P A;  4K17 A;  5I2M A;  1M7E A;  5D27 A;  1N3H A;  4KHB A;  2P0H A;  5JHH A;  1K5G B;  2K49 A;  3PSC A;  2J59 M;  5IRS A;  2J0K A;  2XQN M;  5FI1 A;  1ZC3 B;  4HAZ B;  1U5E A;  1PLS A;  1Q67 A;  1AQC A;  4H8S A;  2UZR A;  4CHM A;  1OQN A;  1V88 A;  2Z59 A;  3D8F A;  4OSN A;  4K2P A;  2UZS A;  2DHJ A;  3KZ1 A;  5J3Y A;  2DYQ A;  3IVF A;  3QBV B;  2MFQ A;  4KVG B;  1WI1 A;  3N7C A;  2N0Y A;  2ZKM X;  1W1G A;  2HTH B;  4D0N B;  2YS1 A;  2R0D A;  2Z13 A;  3RCP A;  3HSA A;  4HB3 B;  1ZC4 B;  3D8E A;  2YT2 A;  4D6W A;  1XX0 A;  2J0M A;  4DBB A;  2KIE A;  4OT1 A;  5I2S A;  1EAZ A;  4KHB B;  2RGN B;  2D9Z A;  1FAO A;  3P7Z A;  5D3V A;  3TFM A;  3DCX A;  1XKE A;  4CSQ A;  1V89 A;  1P6S A;  2H7D A;  4HB2 B;  2ROV A;  3SNH A;  1MI1 A;  4NSW A;  5KQ1 A;  3TW1 A;  3CIK A;  2DHI A;  1KZG A;  1I2H A;  5DHA B;  4QJ3 B;  1UNP A;  5JLJ B;  4MT7 A;  1V61 A;  1P5T A;  1ZVR A;  2I5F A;  3A98 B;  3FVC A;  2JP2 A;  3A58 A;  1Y19 B;  4Z2M B;  1H4R A;  1V5M A;  2VKI A;  3X23 A;  2W2W A;  1X11 A;  2YS3 A;  2GJY A;  2P0D A;  4GXB A;  3V5W A;  1XOD A;  3FM8 C;  4A5K A;  2X18 A;  2D2Q A;  5D3Y A;  2D11 A;  2NBV A;  1DBH A;  2ADZ A;  1MK9 B;  1K5D B;  3LJU X;  1OMW A;  2I1J A;  1TJ6 A;  2H7E A;  2Y8F A;  2P8V A;  2RUK B;  2YT0 A;  3PG7 A;  1IRS A;  1DDV A;  4MK0 A;  2I5C A;  2DKQ A;  1M7R A;  4IAP A;  2L1C A;  4A6H A;  2EC1 A;  2QKL A;  3NWA A;  5L81 A;  4HDQ A;  3WYF B;  1X1F A;  4NY0 A;  5C79 A;  3U7D A;  1Z87 A;  2G35 A;  2Z0P A;  4PNK A;  1WVH A;  3SUZ A;  3PVU A;  4C0A A;  2DX5 A;  1X05 A;  2EMT A;  1ZYI A;  3DXD A;  4QJ4 B;  3KRW A;  4L6E A;  2QKM A;  2AEH A;  3AJ4 A;  3DXC A;  4IFS A;  2P0F A;  2RSG A;  5J3T A;  1MKE A;  1FGZ A;  1MIZ B;  1DYN A;  5CLL B;  1MAI A;  4HAU B;  4K2O A;  1FHW A;  5DHF B;  2UVM A;  2EJ8 A;  1UPQ A;  3PVL A;  2VRW B;  3VOQ A;  1BTN A;  1KZ7 A;  4WJ7 A;  1ISN A;  2YF0 A;  2Z0O A;  1T77 A;  5DI9 B;  2OQB A;  2COF A;  1FHX A;  4TYZ A;  1ZM0 A;  1H10 A;  2ELA A;  2K8E A;  3DXE A;  1NU2 A;  2L2I A;  1WG7 A;  1OY2 A;  2W2X D;  3A8P A;  3NSU A;  2LG1 A;  4HDO A;  2ELB A;  2RVB B;  4WSF A;  3CXB B;  1DDW A;  1X86 A;  2BCJ A;  4HSI A;  4YON A;  3OHM B;  4EJN A;  2PZ1 A;  2W2X C;  1MIX A;  2V76 A;  4CHJ A;  1FGY A;  3T06 A;  2MWN B;  1J0W A;  3HIE A;  1LW3 A;  1FB8 A;  3TO1 A;  1UEF A;  1AWE A;  2GS0 A;  1EVH A;  4PQ0 A;  1XR0 B;  4DX9 0;  1W1H A;  3GYO A;  3HK0 A;  4ZRI A;  2OTX A;  4A6K A;  1XCG A;  3D8D A;  2KIG A;  1E5W A;  3QWM A;  1XD4 A;  2D4Q A;  2Q13 A;  1WGU A;  2M14 A;  2YRY A;  4GOU A;  2RRF A;  5C6R A;  3SV1 A;  1NTV A;  1SGH A;  2Y7B A;  4HAY B;  1TQZ A;  5DH9 B;  3A8Q A;  3SYX A;  3MDB C;  4YL8 A;  1U2B A;  3SO6 A;  4B6H A;  2D10 A;  3P6A A;  4GZU A;  4F7G A;  2GCJ A;  3GYP A;  1PMS A;  2I1K A;  2D9V A;  1NTY A;  1FHO A;  3U8Z A;  5JP4 A;  2GUM A;  1BTK A;  5DIF B;  2KUP A;  3ODO A;  2KCJ A;  4L1R A;  2NZ8 B;  4MY6 A;  1X1G A;  1Y5O A;  3KY9 A;  1FOE A;  4TKN A;  1P3R A;  2CY5 A;  2Y8G A;  4A6F B;  2DFK A;  4QXA B;  4WVF B;  3HQC A;  5GOW B;  3ODX A;  2M38 A;  4K81 A;  2Z4D A;  2DN6 A;  3QIJ A;  1MK7 B;  3KRX A;  3ML4 A;  3PP2 A;  2KUQ A;  3ODW A;  2D9X A;  2K2J A;  1BAK A;  2KGX B;  3MPX A;  4KAX B;  1SHC A;  2COD A;  3AU4 A;  1RRP B;  5EFX A;  2E2X A;  4HB4 B;  2DKP A;  1U5D A;  4CYE A;  1EF1 A;  2K00 A;  3ZVR A;  1BWN A;  1EGX A;  1WGQ A;  2RNR B;  5HE2 A;  4KHA A;  5HE0 A;  4GNK B;  1UNQ A;  1UNR A;  2LYD A;  3VIA A;  2ROZ B;  5C5B B;  2RLO A;  3FEH A;  1DRO A;  2CAY A;  4HAW B;  2EMS A;  4EKU A;  1V5U A;  1W1D A;  1U29 A;  4F7H A;  2YS5 A;  2DLW A;  3AU5 A;  4GMV A;  5LON B;  4HHV A;  4DX8 A;  4IOY X;  1PFJ A;  3OAN A;  1TXD A;  1KI1 B;  4DIX A;  2LUL A;  3BIN A;  2N23 A;  3B77 A;  1J19 A;  3HW2 B;  1U27 A;  2COC A;  4Y94 A;  3ULC A;  2DYN A;  3F0W A;  3M1I B;  4GPT B;  1NI2 A;  3PEG A;  5C16 A;  5KCV A;  1GC7 A;  1UPR A;  1GG3 A;  2MDX A;  4KHO A;  2R09 A;  1MPH A;  4ZRK A;  5FI0 A;  4A6F A;  3FSS A;  2IYB A;  5HE1 A;  2DTC A;  3NWD A;  4HAV B;  2GCL A;  2LOZ A;  1DDM A;  3F5R A;  4DXA B;  5KQ4 A;  4BBK A;  4QJ5 B;  2COA A;  2Z14 A;  2D9W A;  4ZRJ A;  3PVW A;  2J0J A;  2NMB A;  2K2U A;  1ZSQ A;  3NWF A;  3BJI A;  2CY4 A;  2D9Y A;  4Z2N A;  3U12 A;  4P7I A;  1U5G A;  3TVV A;  1QQG A;  2FJU B;  4GN1 A;  1WJ1 A;  1WJM A;  5LOP B;  4HB0 B;  2LOX A;  4XWX A;  3KSY A;  2YT1 A;  3NW8 A; 
#chains in the Genus database with same CATH homology
 4GMX B;  2CRF A;  2YSZ A;  2FJL A;  1GC6 A;  5J3Q A;  2DA0 A;  1U5F A;  5C5B A;  5JHG A;  2AL6 A;  3O96 A;  5D3X A;  1RJ2 A;  3G9W A;  2HE7 A;  1LB1 A;  3WA0 A;  4HAX B;  5CLQ B;  2ZPY A;  3ZDT A;  4EMO A;  5D3W A;  2MKR A;  4HAT B;  3UZT A;  1B55 A;  5HE3 A;  2Z0Q A;  2LKO A;  3ULB A;  2DHK A;  2YVC A;  4F7U P;  3PZD A;  2DX1 A;  2IFS A;  1I7A A;  1QC6 A;  2VSZ A;  3TCA A;  1V5P A;  4K17 A;  1M7E A;  5D27 A;  1N3H A;  2P0H A;  5JHH A;  1K5G B;  3PSC A;  2J59 M;  2J0K A;  2XQN M;  5FI1 A;  1ZC3 B;  4HAZ B;  1U5E A;  1PLS A;  1Q67 A;  1AQC A;  4H8S A;  2UZR A;  4CHM A;  1OQN A;  1V88 A;  3D8F A;  4K2P A;  2UZS A;  2DHJ A;  3KZ1 A;  5J3Y A;  2DYQ A;  3IVF A;  3QBV B;  2MFQ A;  4KVG B;  1WI1 A;  3N7C A;  2N0Y A;  1W1G A;  2HTH B;  4D0N B;  2YS1 A;  2R0D A;  3RCP A;  4HB3 B;  1ZC4 B;  3D8E A;  1XX0 A;  2J0M A;  4DBB A;  1EAZ A;  4KHB B;  2RGN B;  2D9Z A;  1FAO A;  3P7Z A;  5D3V A;  3TFM A;  1XKE A;  1V89 A;  1P6S A;  2H7D A;  4HB2 B;  2ROV A;  3SNH A;  4NSW A;  5KQ1 A;  3TW1 A;  3CIK A;  2DHI A;  1KZG A;  1I2H A;  5DHA B;  1UNP A;  5JLJ B;  4MT7 A;  1V61 A;  1P5T A;  1ZVR A;  2I5F A;  3A98 B;  2JP2 A;  1Y19 B;  4Z2M B;  1H4R A;  1V5M A;  2VKI A;  3X23 A;  2W2W A;  1X11 A;  2YS3 A;  2GJY A;  2P0D A;  4GXB A;  3V5W A;  1XOD A;  3FM8 C;  4A5K A;  2X18 A;  2D2Q A;  5D3Y A;  2D11 A;  1DBH A;  2ADZ A;  1MK9 B;  1K5D B;  3LJU X;  1OMW A;  2I1J A;  1TJ6 A;  2H7E A;  2Y8F A;  2P8V A;  2RUK B;  2YT0 A;  3PG7 A;  1IRS A;  1DDV A;  4MK0 A;  2I5C A;  2DKQ A;  1M7R A;  4IAP A;  2L1C A;  4A6H A;  2EC1 A;  2QKL A;  5L81 A;  4HDQ A;  3WYF B;  1X1F A;  4NY0 A;  5C79 A;  3U7D A;  1Z87 A;  2G35 A;  2Z0P A;  4PNK A;  1WVH A;  3SUZ A;  3PVU A;  4C0A A;  2DX5 A;  1X05 A;  2EMT A;  3DXD A;  3KRW A;  4L6E A;  2QKM A;  2AEH A;  3AJ4 A;  3DXC A;  4IFS A;  2P0F A;  2RSG A;  5J3T A;  1MKE A;  1FGZ A;  1MIZ B;  1DYN A;  5CLL B;  1MAI A;  4HAU B;  4K2O A;  1FHW A;  5DHF B;  2UVM A;  2EJ8 A;  1UPQ A;  3PVL A;  2VRW B;  3VOQ A;  1BTN A;  1KZ7 A;  4WJ7 A;  1ISN A;  2YF0 A;  2Z0O A;  5DI9 B;  2OQB A;  2COF A;  1FHX A;  4TYZ A;  1ZM0 A;  1H10 A;  2ELA A;  3DXE A;  1NU2 A;  2L2I A;  1WG7 A;  1OY2 A;  2W2X D;  3A8P A;  3NSU A;  2LG1 A;  4HDO A;  2ELB A;  2RVB B;  4WSF A;  3CXB B;  1DDW A;  1X86 A;  2BCJ A;  4YON A;  4EJN A;  2PZ1 A;  2W2X C;  1MIX A;  2V76 A;  4CHJ A;  1FGY A;  3T06 A;  2MWN B;  1J0W A;  1LW3 A;  1FB8 A;  3TO1 A;  1UEF A;  1AWE A;  2GS0 A;  1EVH A;  4PQ0 A;  1XR0 B;  4DX9 0;  1W1H A;  3GYO A;  3HK0 A;  4ZRI A;  2OTX A;  4A6K A;  1XCG A;  3D8D A;  1E5W A;  3QWM A;  1XD4 A;  2D4Q A;  2Q13 A;  1WGU A;  2M14 A;  2YRY A;  5C6R A;  3SV1 A;  1NTV A;  1SGH A;  2Y7B A;  4HAY B;  1TQZ A;  5DH9 B;  3A8Q A;  3SYX A;  3MDB C;  4YL8 A;  1U2B A;  3SO6 A;  4B6H A;  2D10 A;  3P6A A;  4GZU A;  4F7G A;  2GCJ A;  3GYP A;  1PMS A;  2I1K A;  2D9V A;  1NTY A;  1FHO A;  3U8Z A;  5JP4 A;  1BTK A;  5DIF B;  2KUP A;  3ODO A;  2KCJ A;  2NZ8 B;  4MY6 A;  1X1G A;  1Y5O A;  3KY9 A;  1FOE A;  4TKN A;  1P3R A;  2CY5 A;  2Y8G A;  4A6F B;  2DFK A;  4WVF B;  3HQC A;  5GOW B;  3ODX A;  2M38 A;  4K81 A;  2DN6 A;  3QIJ A;  1MK7 B;  3KRX A;  3ML4 A;  3PP2 A;  3ODW A;  2D9X A;  2K2J A;  1BAK A;  2KGX B;  3MPX A;  4KAX B;  1SHC A;  2COD A;  3AU4 A;  1RRP B;  5EFX A;  2E2X A;  4HB4 B;  2DKP A;  1U5D A;  4CYE A;  1EF1 A;  2K00 A;  3ZVR A;  1BWN A;  1EGX A;  1WGQ A;  2RNR B;  5HE2 A;  4KHA A;  5HE0 A;  1UNQ A;  1UNR A;  2LYD A;  3VIA A;  2ROZ B;  5C5B B;  2RLO A;  3FEH A;  1DRO A;  2CAY A;  4HAW B;  2EMS A;  4EKU A;  1V5U A;  1W1D A;  1U29 A;  4F7H A;  2YS5 A;  2DLW A;  3AU5 A;  4GMV A;  5LON B;  4HHV A;  4DX8 A;  4IOY X;  1PFJ A;  3OAN A;  1TXD A;  1KI1 B;  2LUL A;  3BIN A;  2N23 A;  1J19 A;  3HW2 B;  1U27 A;  2COC A;  4Y94 A;  3ULC A;  2DYN A;  3F0W A;  3M1I B;  4GPT B;  1NI2 A;  3PEG A;  5C16 A;  5KCV A;  1GC7 A;  1UPR A;  1GG3 A;  2MDX A;  4KHO A;  2R09 A;  1MPH A;  4ZRK A;  5FI0 A;  4A6F A;  3FSS A;  2IYB A;  5HE1 A;  2DTC A;  4HAV B;  2GCL A;  2LOZ A;  1DDM A;  3F5R A;  4DXA B;  5KQ4 A;  4BBK A;  2COA A;  2D9W A;  4ZRJ A;  3PVW A;  2J0J A;  2NMB A;  2K2U A;  1ZSQ A;  3BJI A;  2CY4 A;  2D9Y A;  4Z2N A;  4P7I A;  1U5G A;  3TVV A;  1QQG A;  4GN1 A;  1WJ1 A;  1WJM A;  5LOP B;  4HB0 B;  2LOX A;  4XWX A;  3KSY A;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...