4HAVB

Crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4havB00
1WJ1A 2DYNA 3A8PA 1XKEA 2V76A 1FAOA 4K2PA 4HATB 1X11A 1H4RA 3QBVB 4K17A 1WVHA 1X86A 2DHJA 4HB4B 2D9ZA 5HE0A 4CHJA 4D0NB 1DDMA 2MKRA 1V89A 1NTVA 2DN6A 4YL8A 1FOEA 1V61A 4EJNA 1XCGA 2DKPA 4HAZB 1U5DA 3KZ1A 4MT7A 1DYNA 4A6FA 1FGZA 1EGXA 2FJLA 3SNHA 2COAA 2COFA 2GS0A 1K5DB 2MDXA 1X1GA 3MPXA 1Y5OA 1W1HA 3MDBC 1MKEA 2Z0PA 1RRPB 1AQCA 3ZVRA 3CXBB 4HB0B 2I5CA 4Y94A 3LJUX 2YS3A 2J0JA 3TCAA 4BBKA 1MAIA 2LYDA 3TFMA 3PSCA 2D9YA 3AJ4A 3SYXA 2UZSA 2Y7BA 1GG3A 1ZC3B 2GCJA 5C5BA 1MK7B 5KQ1A 1DBHA 2Z0OA 4HHVA 2P8VA 3CIKA 4CHMA 1I2HA 1XD4A 1RJ2A 1FHWA 3FM8C 1P6SA 3RCPA 5HE1A 1UEFA 2L2IA 2BCJA 4GMVA 3PEGA 4WVFB 4PQ0A 2D10A 2ZPYA 4KVGB 5DI9B 3SO6A 1M7EA 1X1FA 2CY4A 5FI1A 1V5MA 2J0MA 4L6EA 2L1CA 5DIFB 3SV1A 2ROZB 2HE7A 1OY2A 4ZRJA 3TVVA 3FEHA 1FB8A 1P3RA 3O96A 3GYOA 3ODXA 1XODA 2M14A 3PP2A 2D11A 4A5KA 4DX8A 2J0KA 3X23A 5C16A 4K81A 2KUPA 3TW1A 5D3VA 1I7AA 5J3QA 1BWNA 4NSWA 1NU2A 3ODWA 4CYEA 1BTKA 1TQZA 4GMXB 1U5GA 2RSGA 2OQBA 4HB3B 2D4QA 5L81A 3TO1A 1M7RA 4HAYB 2YRYA 2J59M 1V5PA 1MIZB 1WJMA 2KGXB 3ML4A 4TYZA 5DHAB 3PVLA 2QKMA 5D3XA 3A8QA 3BINA 2DA0A 2MFQA 1FGYA 1EVHA 4KHOA 2DTCA 3ZDTA 2YT1A 4HAUB 5KCVA 5KQ4A 1TXDA 2DHIA 4GXBA 4HDQA 4HB2B 2DHKA 4HAVB 1WGQA 4B6HA 2CRFA 2W2XC 5D3YA 1DDVA 1MIXA 1GC6A 1W1GA 5C79A 4GZUA 1N3HA 2MWNB 1PMSA 4GN1A 2W2XD 1WGUA 1AWEA 1P5TA 2P0FA 2DLWA 3ULCA 1KZGA 1ISNA 3HW2B 5D27A 1X05A 3ULBA 1Z87A 1OMWA 3DXDA 2COCA 1EAZA 2P0DA 3FSSA 1ZSQA 2CODA 5DH9B 2RGNB 5CLLB 4F7GA 1J0WA 2VSZA 3WA0A 4HAWB 1K5GB 4Z2NA 4MK0A 2K2JA 2LOXA 3D8EA 2M38A 1XX0A 1LW3A 3UZTA 4EKUA 2JP2A 2RNRB 5LOPB 2RUKB 3F0WA 5EFXA 5JLJB 4WSFA 1H10A 4A6FB 2N0YA 4IAPA 1B55A 4P7IA 2DFKA 1PFJA 4WJ7A 1U29A 1U5FA 4IFSA 2ELAA 4K2OA 3PZDA 4F7UP 1NI2A 2YF0A 4GPTB 1WI1A 2X18A 2EC1A 1WG7A 2ADZA 1MPHA 1W1DA 3SUZA 4HAXB 2I1KA 2UVMA 2AL6A 2EJ8A 3U8ZA 4HDOA 2N23A 2EMTA 2DX5A 2ELBA 3KRWA 3KY9A 1FHXA 1ZC4B 2XQNM 5C5BB 2NMBA 3PVUA 5JP4A 1BAKA 3U7DA 1E5WA 2KCJA 3IVFA 2Z0QA 2CY5A 1V88A 5D3WA 4KHAA 1OQNA 3DXCA 1ZM0A 3HK0A 2QKLA 1QQGA 4IOYX 1U2BA 4YONA 3A98B 2GCLA 4DX90 3G9WA 1NTYA 2YS5A 1UPQA 3AU4A 3T06A 4A6KA 3GYPA 4ZRIA 2DYQA 3M1IB 3NSUA 2K00A 1U27A 2H7DA 1DROA 1PLSA 1ZVRA 1QC6A 1XR0B 2YSZA 3V5WA 2Q13A 3F5RA 2I1JA 3N7CA 3BJIA 2D9VA 2RLOA 5J3YA 2K2UA 2LG1A 4F7HA 3KSYA 2P0HA 4H8SA 2W2WA 3QWMA 3P6AA 2PZ1A 1BTNA 4Z2MB 2DKQA 2D9XA 2HTHB 4DXAB 1TJ6A 1V5UA 1SGHA 1Q67A 1UPRA 1UNRA 3HQCA 1UNPA 5JHGA 5DHFB 2E2XA 1MK9B 2DX1A 2H7EA 1U5EA 1EF1A 5J3TA 4C0AA 5GOWB 2VRWB 1KZ7A 2G35A 2YT0A 2Y8FA 4EMOA 3PVWA 4ZRKA 2AEHA 3VIAA 4A6HA 4DBBA 5LONB 1GC7A 2ROVA 2Y8GA 3D8DA 2R09A 4KAXB 4PNKA 2YS1A 3KRXA 1KI1B 2D9WA 5HE3A 5JHHA 2R0DA 2I5FA 2NZ8B 1FHOA 2VKIA 2GJYA 1LB1A 3PG7A 1Y19B 2OTXA 2LKOA 3D8FA 4XWXA 1DDWA 4TKNA 2CAYA 3AU5A 1UNQA 2IYBA 2D2QA 2EMSA 5FI0A 3VOQA 2LOZA 5HE2A 2IFSA 1IRSA 5C6RA 2YVCA 3WYFB 4KHBB 1J19A 4MY6A 2RVBB 3P7ZA 3ODOA 3OANA 1SHCA 4NY0A 2UZRA 3DXEA 2LULA 3QIJA 5CLQB
chains in the Genus database with same CATH superfamily
1WJ1A 3U12A 2DYNA 3A8PA 1XKEA 2V76A 1FAOA 4K2PA 4HATB 1X11A 1H4RA 3QBVB 2ZKMX 4K17A 5LG4B 4HSIA 1WVHA 1X86A 2DHJA 4HB4B 2D9ZA 5HE0A 4CHJA 4D0NB 1DDMA 2MKRA 1V89A 1NTVA 2DN6A 4GNKB 4YL8A 1FOEA 1V61A 4EJNA 1XCGA 2DKPA 4HAZB 1U5DA 3KZ1A 4MT7A 1DYNA 4A6FA 1FGZA 1EGXA 2FJLA 3SNHA 2COAA 2COFA 2GS0A 1K5DB 2MDXA 1X1GA 3MPXA 1Y5OA 1W1HA 1MI1A 3MDBC 1MKEA 2Z0PA 1RRPB 1AQCA 3ZVRA 3CXBB 4HB0B 2I5CA 4Y94A 3LJUX 2YS3A 2J0JA 3TCAA 4BBKA 1MAIA 2RRFA 2LYDA 3TFMA 3PSCA 2D9YA 3AJ4A 3SYXA 2UZSA 2Y7BA 5I2MA 1GG3A 4QJ4B 1ZC3B 2GCJA 5C5BA 1MK7B 5KQ1A 1DBHA 2Z0OA 4HHVA 2P8VA 3CIKA 3NWDA 4CHMA 2Z13A 1I2HA 1XD4A 1RJ2A 1FHWA 3FM8C 1P6SA 3RCPA 5HE1A 1UEFA 2L2IA 2BCJA 5I2SA 4GMVA 3PEGA 4WVFB 4PQ0A 2D10A 4L1RA 2ZPYA 4KVGB 5DI9B 3SO6A 1M7EA 1X1FA 2CY4A 5FI1A 3B77A 1V5MA 2J0MA 4L6EA 2L1CA 5DIFB 3SV1A 2ROZB 2HE7A 1OY2A 4ZRJA 3TVVA 3FEHA 1FB8A 1P3RA 3O96A 3GYOA 2GUMA 3ODXA 1XODA 2M14A 3PP2A 2D11A 4A5KA 4DX8A 2J0KA 4D6WA 3X23A 5C16A 4K81A 2KUPA 3TW1A 5D3VA 1I7AA 5J3QA 1BWNA 4NSWA 1NU2A 3ODWA 5IRSA 4CYEA 1BTKA 3FVCA 2KUQA 1TQZA 4GMXB 1U5GA 2RSGA 2OQBA 4HB3B 4GOUA 2D4QA 5L81A 3TO1A 1M7RA 2NBVA 4HAYB 2YRYA 2J59M 4OSNA 1V5PA 1MIZB 1WJMA 2KGXB 3ML4A 4TYZA 5DHAB 3PVLA 2QKMA 5D3XA 3A8QA 3BINA 2DA0A 2MFQA 5M4YB 1FGYA 1EVHA 4KHOA 2DTCA 3ZDTA 3HSAA 1T77A 2YT1A 4HAUB 4QJ3B 5KCVA 5KQ4A 1TXDA 2DHIA 4GXBA 4HDQA 4HB2B 2DHKA 4HAVB 2KIEA 1WGQA 4B6HA 2CRFA 2W2XC 5D3YA 1DDVA 1MIXA 1GC6A 1W1GA 4QJ5B 5C79A 4GZUA 2Z14A 1N3HA 2MWNB 1PMSA 4GN1A 2W2XD 1WGUA 1AWEA 1P5TA 2P0FA 2DLWA 4KHBA 3ULCA 1KZGA 1ISNA 3HW2B 5D27A 1X05A 3ULBA 1Z87A 1OMWA 2R2YA 2COCA 3DXDA 1EAZA 2P0DA 3FSSA 1ZSQA 2CODA 5DH9B 2RGNB 5CLLB 4F7GA 1J0WA 2VSZA 3WA0A 4HAWB 1K5GB 4Z2NA 4MK0A 2K2JA 2LOXA 3D8EA 2M38A 2YT2A 1XX0A 1LW3A 3UZTA 4EKUA 2JP2A 2RNRB 5LOPB 2RUKB 3F0WA 5EFXA 5JLJB 4WSFA 1H10A 4A6FB 2N0YA 4IAPA 1B55A 4P7IA 2DFKA 1PFJA 4WJ7A 1U29A 1U5FA 3A58A 4IFSA 2ELAA 3HIEA 4K2OA 3PZDA 2KR0A 4F7UP 1NI2A 2YF0A 4GPTB 1WI1A 2X18A 2EC1A 1WG7A 2ADZA 1MPHA 1W1DA 3SUZA 4HAXB 2I1KA 2UVMA 2AL6A 3OHMB 2EJ8A 3U8ZA 4HDOA 2N23A 2EMTA 4CSQA 2DX5A 2Z59A 2ELBA 3KRWA 3KY9A 1FHXA 1ZC4B 2FJUB 2XQNM 5C5BB 2NMBA 3PVUA 5JP4A 1BAKA 3U7DA 1E5WA 2KCJA 3IVFA 2Z0QA 2CY5A 1V88A 5D3WA 4KHAA 2K8EA 1OQNA 3DXCA 1ZM0A 3HK0A 2QKLA 1QQGA 4IOYX 1U2BA 4YONA 3A98B 1ZYIA 2GCLA 4DX90 3G9WA 1NTYA 2YS5A 1UPQA 3AU4A 3T06A 4A6KA 3GYPA 4ZRIA 2DYQA 3M1IB 3NSUA 2K00A 1U27A 2H7DA 1DROA 1PLSA 1ZVRA 2Z4DA 1QC6A 1XR0B 2YSZA 3V5WA 2Q13A 3F5RA 2I1JA 3N7CA 3BJIA 2D9VA 2RLOA 5J3YA 2K2UA 2LG1A 4F7HA 3KSYA 2P0HA 3NW8A 2W2WA 4H8SA 3QWMA 3P6AA 2PZ1A 1BTNA 4Z2MB 2DKQA 2D9XA 2HTHB 4DXAB 1TJ6A 1V5UA 1SGHA 1Q67A 1UPRA 1UNRA 3HQCA 1UNPA 5JHGA 5DHFB 2E2XA 1MK9B 2DX1A 2H7EA 1U5EA 1EF1A 5J3TA 2K49A 5GOWB 4C0AA 2VRWB 1KZ7A 2G35A 2YT0A 2Y8FA 3NWFA 4EMOA 3PVWA 4ZRKA 2AEHA 3VIAA 4A6HA 4DBBA 5LONB 1GC7A 2ROVA 2Y8GA 3D8DA 2R09A 4KAXB 4PNKA 2YS1A 3KRXA 4DIXA 1KI1B 2D9WA 4OT1A 5HE3A 5JHHA 2R0DA 2I5FA 2NZ8B 3NWAA 4QXAB 1FHOA 2VKIA 2GJYA 1LB1A 3PG7A 1Y19B 2OTXA 2LKOA 3D8FA 3DCXA 4XWXA 1DDWA 4TKNA 2CAYA 3AU5A 1UNQA 2IYBA 2D2QA 2EMSA 5FI0A 2KIGA 3VOQA 2LOZA 5HE2A 2IFSA 1IRSA 5C6RA 2YVCA 3WYFB 4KHBB 1J19A 4MY6A 2RVBB 3P7ZA 3ODOA 3OANA 1SHCA 4NY0A 2UZRA 3DXEA 2LULA 3QIJA 5CLQB
chains in the Genus database with same CATH topology
1WJ1A 2DYNA 3A8PA 1XKEA 2V76A 1FAOA 4K2PA 4HATB 1X11A 1H4RA 3QBVB 4K17A 1WVHA 1X86A 2DHJA 4HB4B 2D9ZA 5HE0A 4CHJA 4D0NB 1DDMA 2MKRA 1V89A 1NTVA 2DN6A 4YL8A 1FOEA 1V61A 4EJNA 1XCGA 2DKPA 4HAZB 1U5DA 3KZ1A 4MT7A 1DYNA 4A6FA 1FGZA 1EGXA 2FJLA 3SNHA 2COAA 2COFA 2GS0A 1K5DB 2MDXA 1X1GA 3MPXA 1Y5OA 1W1HA 3MDBC 1MKEA 2Z0PA 1RRPB 1AQCA 3ZVRA 3CXBB 4HB0B 2I5CA 4Y94A 3LJUX 2YS3A 2J0JA 3TCAA 4BBKA 1MAIA 2LYDA 3TFMA 3PSCA 2D9YA 3AJ4A 3SYXA 2UZSA 2Y7BA 1GG3A 1ZC3B 2GCJA 5C5BA 1MK7B 5KQ1A 1DBHA 2Z0OA 4HHVA 2P8VA 3CIKA 4CHMA 1I2HA 1XD4A 1RJ2A 1FHWA 3FM8C 1P6SA 3RCPA 5HE1A 1UEFA 2L2IA 2BCJA 4GMVA 3PEGA 4WVFB 4PQ0A 2D10A 2ZPYA 4KVGB 5DI9B 3SO6A 1M7EA 1X1FA 2CY4A 5FI1A 1V5MA 2J0MA 4L6EA 2L1CA 5DIFB 3SV1A 2ROZB 2HE7A 1OY2A 4ZRJA 3TVVA 3FEHA 1FB8A 1P3RA 3O96A 3GYOA 3ODXA 1XODA 2M14A 3PP2A 2D11A 4A5KA 4DX8A 2J0KA 3X23A 5C16A 4K81A 2KUPA 3TW1A 5D3VA 1I7AA 5J3QA 1BWNA 4NSWA 1NU2A 3ODWA 4CYEA 1BTKA 1TQZA 4GMXB 1U5GA 2RSGA 2OQBA 4HB3B 2D4QA 5L81A 3TO1A 1M7RA 4HAYB 2YRYA 2J59M 1V5PA 1MIZB 1WJMA 2KGXB 3ML4A 4TYZA 5DHAB 3PVLA 2QKMA 5D3XA 3A8QA 3BINA 2DA0A 2MFQA 1FGYA 1EVHA 4KHOA 2DTCA 3ZDTA 2YT1A 4HAUB 5KCVA 5KQ4A 1TXDA 2DHIA 4GXBA 4HDQA 4HB2B 2DHKA 4HAVB 1WGQA 4B6HA 2CRFA 2W2XC 5D3YA 1DDVA 1MIXA 1GC6A 1W1GA 5C79A 4GZUA 1N3HA 2MWNB 1PMSA 4GN1A 2W2XD 1WGUA 1AWEA 1P5TA 2P0FA 2DLWA 3ULCA 1KZGA 1ISNA 3HW2B 5D27A 1X05A 3ULBA 1Z87A 1OMWA 3DXDA 2COCA 1EAZA 2P0DA 3FSSA 1ZSQA 2CODA 5DH9B 2RGNB 5CLLB 4F7GA 1J0WA 2VSZA 3WA0A 4HAWB 1K5GB 4Z2NA 4MK0A 2K2JA 2LOXA 3D8EA 2M38A 1XX0A 1LW3A 3UZTA 4EKUA 2JP2A 2RNRB 5LOPB 2RUKB 3F0WA 5EFXA 5JLJB 4WSFA 1H10A 4A6FB 2N0YA 4IAPA 1B55A 4P7IA 2DFKA 1PFJA 4WJ7A 1U29A 1U5FA 4IFSA 2ELAA 4K2OA 3PZDA 4F7UP 1NI2A 2YF0A 4GPTB 1WI1A 2X18A 2EC1A 1WG7A 2ADZA 1MPHA 1W1DA 3SUZA 4HAXB 2I1KA 2UVMA 2AL6A 2EJ8A 3U8ZA 4HDOA 2N23A 2EMTA 2DX5A 2ELBA 3KRWA 3KY9A 1FHXA 1ZC4B 2XQNM 5C5BB 2NMBA 3PVUA 5JP4A 1BAKA 3U7DA 1E5WA 2KCJA 3IVFA 2Z0QA 2CY5A 1V88A 5D3WA 4KHAA 1OQNA 3DXCA 1ZM0A 3HK0A 2QKLA 1QQGA 4IOYX 1U2BA 4YONA 3A98B 2GCLA 4DX90 3G9WA 1NTYA 2YS5A 1UPQA 3AU4A 3T06A 4A6KA 3GYPA 4ZRIA 2DYQA 3M1IB 3NSUA 2K00A 1U27A 2H7DA 1DROA 1PLSA 1ZVRA 1QC6A 1XR0B 2YSZA 3V5WA 2Q13A 3F5RA 2I1JA 3N7CA 3BJIA 2D9VA 2RLOA 5J3YA 2K2UA 2LG1A 4F7HA 3KSYA 2P0HA 4H8SA 2W2WA 3QWMA 3P6AA 2PZ1A 1BTNA 4Z2MB 2DKQA 2D9XA 2HTHB 4DXAB 1TJ6A 1V5UA 1SGHA 1Q67A 1UPRA 1UNRA 3HQCA 1UNPA 5JHGA 5DHFB 2E2XA 1MK9B 2DX1A 2H7EA 1U5EA 1EF1A 5J3TA 4C0AA 5GOWB 2VRWB 1KZ7A 2G35A 2YT0A 2Y8FA 4EMOA 3PVWA 4ZRKA 2AEHA 3VIAA 4A6HA 4DBBA 5LONB 1GC7A 2ROVA 2Y8GA 3D8DA 2R09A 4KAXB 4PNKA 2YS1A 3KRXA 1KI1B 2D9WA 5HE3A 5JHHA 2R0DA 2I5FA 2NZ8B 1FHOA 2VKIA 2GJYA 1LB1A 3PG7A 1Y19B 2OTXA 2LKOA 3D8FA 4XWXA 1DDWA 4TKNA 2CAYA 3AU5A 1UNQA 2IYBA 2D2QA 2EMSA 5FI0A 3VOQA 2LOZA 5HE2A 2IFSA 1IRSA 5C6RA 2YVCA 3WYFB 4KHBB 1J19A 4MY6A 2RVBB 3P7ZA 3ODOA 3OANA 1SHCA 4NY0A 2UZRA 3DXEA 2LULA 3QIJA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ1 A;  2DYN A;  3A8P A;  1XKE A;  2V76 A;  1FAO A;  4K2P A;  4HAT B;  1X11 A;  1H4R A;  3QBV B;  4K17 A;  1WVH A;  1X86 A;  2DHJ A;  4HB4 B;  2D9Z A;  5HE0 A;  4CHJ A;  4D0N B;  1DDM A;  2MKR A;  1V89 A;  1NTV A;  2DN6 A;  4YL8 A;  1FOE A;  1V61 A;  4EJN A;  1XCG A;  2DKP A;  4HAZ B;  1U5D A;  3KZ1 A;  4MT7 A;  1DYN A;  4A6F A;  1FGZ A;  1EGX A;  2FJL A;  3SNH A;  2COA A;  2COF A;  2GS0 A;  1K5D B;  2MDX A;  1X1G A;  3MPX A;  1Y5O A;  1W1H A;  3MDB C;  1MKE A;  2Z0P A;  1RRP B;  1AQC A;  3ZVR A;  3CXB B;  4HB0 B;  2I5C A;  4Y94 A;  3LJU X;  2YS3 A;  2J0J A;  3TCA A;  4BBK A;  1MAI A;  2LYD A;  3TFM A;  3PSC A;  2D9Y A;  3AJ4 A;  3SYX A;  2UZS A;  2Y7B A;  1GG3 A;  1ZC3 B;  2GCJ A;  5C5B A;  1MK7 B;  5KQ1 A;  1DBH A;  2Z0O A;  4HHV A;  2P8V A;  3CIK A;  4CHM A;  1I2H A;  1XD4 A;  1RJ2 A;  1FHW A;  3FM8 C;  1P6S A;  3RCP A;  5HE1 A;  1UEF A;  2L2I A;  2BCJ A;  4GMV A;  3PEG A;  4WVF B;  4PQ0 A;  2D10 A;  2ZPY A;  4KVG B;  5DI9 B;  3SO6 A;  1M7E A;  1X1F A;  2CY4 A;  5FI1 A;  1V5M A;  2J0M A;  4L6E A;  2L1C A;  5DIF B;  3SV1 A;  2ROZ B;  2HE7 A;  1OY2 A;  4ZRJ A;  3TVV A;  3FEH A;  1FB8 A;  1P3R A;  3O96 A;  3GYO A;  3ODX A;  1XOD A;  2M14 A;  3PP2 A;  2D11 A;  4A5K A;  4DX8 A;  2J0K A;  3X23 A;  5C16 A;  4K81 A;  2KUP A;  3TW1 A;  5D3V A;  1I7A A;  5J3Q A;  1BWN A;  4NSW A;  1NU2 A;  3ODW A;  4CYE A;  1BTK A;  1TQZ A;  4GMX B;  1U5G A;  2RSG A;  2OQB A;  4HB3 B;  2D4Q A;  5L81 A;  3TO1 A;  1M7R A;  4HAY B;  2YRY A;  2J59 M;  1V5P A;  1MIZ B;  1WJM A;  2KGX B;  3ML4 A;  4TYZ A;  5DHA B;  3PVL A;  2QKM A;  5D3X A;  3A8Q A;  3BIN A;  2DA0 A;  2MFQ A;  1FGY A;  1EVH A;  4KHO A;  2DTC A;  3ZDT A;  2YT1 A;  4HAU B;  5KCV A;  5KQ4 A;  1TXD A;  2DHI A;  4GXB A;  4HDQ A;  4HB2 B;  2DHK A;  4HAV B;  1WGQ A;  4B6H A;  2CRF A;  2W2X C;  5D3Y A;  1DDV A;  1MIX A;  1GC6 A;  1W1G A;  5C79 A;  4GZU A;  1N3H A;  2MWN B;  1PMS A;  4GN1 A;  2W2X D;  1WGU A;  1AWE A;  1P5T A;  2P0F A;  2DLW A;  3ULC A;  1KZG A;  1ISN A;  3HW2 B;  5D27 A;  1X05 A;  3ULB A;  1Z87 A;  1OMW A;  3DXD A;  2COC A;  1EAZ A;  2P0D A;  3FSS A;  1ZSQ A;  2COD A;  5DH9 B;  2RGN B;  5CLL B;  4F7G A;  1J0W A;  2VSZ A;  3WA0 A;  4HAW B;  1K5G B;  4Z2N A;  4MK0 A;  2K2J A;  2LOX A;  3D8E A;  2M38 A;  1XX0 A;  1LW3 A;  3UZT A;  4EKU A;  2JP2 A;  2RNR B;  5LOP B;  2RUK B;  3F0W A;  5EFX A;  5JLJ B;  4WSF A;  1H10 A;  4A6F B;  2N0Y A;  4IAP A;  1B55 A;  4P7I A;  2DFK A;  1PFJ A;  4WJ7 A;  1U29 A;  1U5F A;  4IFS A;  2ELA A;  4K2O A;  3PZD A;  4F7U P;  1NI2 A;  2YF0 A;  4GPT B;  1WI1 A;  2X18 A;  2EC1 A;  1WG7 A;  2ADZ A;  1MPH A;  1W1D A;  3SUZ A;  4HAX B;  2I1K A;  2UVM A;  2AL6 A;  2EJ8 A;  3U8Z A;  4HDO A;  2N23 A;  2EMT A;  2DX5 A;  2ELB A;  3KRW A;  3KY9 A;  1FHX A;  1ZC4 B;  2XQN M;  5C5B B;  2NMB A;  3PVU A;  5JP4 A;  1BAK A;  3U7D A;  1E5W A;  2KCJ A;  3IVF A;  2Z0Q A;  2CY5 A;  1V88 A;  5D3W A;  4KHA A;  1OQN A;  3DXC A;  1ZM0 A;  3HK0 A;  2QKL A;  1QQG A;  4IOY X;  1U2B A;  4YON A;  3A98 B;  2GCL A;  4DX9 0;  3G9W A;  1NTY A;  2YS5 A;  1UPQ A;  3AU4 A;  3T06 A;  4A6K A;  3GYP A;  4ZRI A;  2DYQ A;  3M1I B;  3NSU A;  2K00 A;  1U27 A;  2H7D A;  1DRO A;  1PLS A;  1ZVR A;  1QC6 A;  1XR0 B;  2YSZ A;  3V5W A;  2Q13 A;  3F5R A;  2I1J A;  3N7C A;  3BJI A;  2D9V A;  2RLO A;  5J3Y A;  2K2U A;  2LG1 A;  4F7H A;  3KSY A;  2P0H A;  4H8S A;  2W2W A;  3QWM A;  3P6A A;  2PZ1 A;  1BTN A;  4Z2M B;  2DKQ A;  2D9X A;  2HTH B;  4DXA B;  1TJ6 A;  1V5U A;  1SGH A;  1Q67 A;  1UPR A;  1UNR A;  3HQC A;  1UNP A;  5JHG A;  5DHF B;  2E2X A;  1MK9 B;  2DX1 A;  2H7E A;  1U5E A;  1EF1 A;  5J3T A;  4C0A A;  5GOW B;  2VRW B;  1KZ7 A;  2G35 A;  2YT0 A;  2Y8F A;  4EMO A;  3PVW A;  4ZRK A;  2AEH A;  3VIA A;  4A6H A;  4DBB A;  5LON B;  1GC7 A;  2ROV A;  2Y8G A;  3D8D A;  2R09 A;  4KAX B;  4PNK A;  2YS1 A;  3KRX A;  1KI1 B;  2D9W A;  5HE3 A;  5JHH A;  2R0D A;  2I5F A;  2NZ8 B;  1FHO A;  2VKI A;  2GJY A;  1LB1 A;  3PG7 A;  1Y19 B;  2OTX A;  2LKO A;  3D8F A;  4XWX A;  1DDW A;  4TKN A;  2CAY A;  3AU5 A;  1UNQ A;  2IYB A;  2D2Q A;  2EMS A;  5FI0 A;  3VOQ A;  2LOZ A;  5HE2 A;  2IFS A;  1IRS A;  5C6R A;  2YVC A;  3WYF B;  4KHB B;  1J19 A;  4MY6 A;  2RVB B;  3P7Z A;  3ODO A;  3OAN A;  1SHC A;  4NY0 A;  2UZR A;  3DXE A;  2LUL A;  3QIJ A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 1WJ1 A;  3U12 A;  2DYN A;  3A8P A;  1XKE A;  2V76 A;  1FAO A;  4K2P A;  4HAT B;  1X11 A;  1H4R A;  3QBV B;  2ZKM X;  4K17 A;  5LG4 B;  4HSI A;  1WVH A;  1X86 A;  2DHJ A;  4HB4 B;  2D9Z A;  5HE0 A;  4CHJ A;  4D0N B;  1DDM A;  2MKR A;  1V89 A;  1NTV A;  2DN6 A;  4GNK B;  4YL8 A;  1FOE A;  1V61 A;  4EJN A;  1XCG A;  2DKP A;  4HAZ B;  1U5D A;  3KZ1 A;  4MT7 A;  1DYN A;  4A6F A;  1FGZ A;  1EGX A;  2FJL A;  3SNH A;  2COA A;  2COF A;  2GS0 A;  1K5D B;  2MDX A;  1X1G A;  3MPX A;  1Y5O A;  1W1H A;  1MI1 A;  3MDB C;  1MKE A;  2Z0P A;  1RRP B;  1AQC A;  3ZVR A;  3CXB B;  4HB0 B;  2I5C A;  4Y94 A;  3LJU X;  2YS3 A;  2J0J A;  3TCA A;  4BBK A;  1MAI A;  2RRF A;  2LYD A;  3TFM A;  3PSC A;  2D9Y A;  3AJ4 A;  3SYX A;  2UZS A;  2Y7B A;  5I2M A;  1GG3 A;  4QJ4 B;  1ZC3 B;  2GCJ A;  5C5B A;  1MK7 B;  5KQ1 A;  1DBH A;  2Z0O A;  4HHV A;  2P8V A;  3CIK A;  3NWD A;  4CHM A;  2Z13 A;  1I2H A;  1XD4 A;  1RJ2 A;  1FHW A;  3FM8 C;  1P6S A;  3RCP A;  5HE1 A;  1UEF A;  2L2I A;  2BCJ A;  5I2S A;  4GMV A;  3PEG A;  4WVF B;  4PQ0 A;  2D10 A;  4L1R A;  2ZPY A;  4KVG B;  5DI9 B;  3SO6 A;  1M7E A;  1X1F A;  2CY4 A;  5FI1 A;  3B77 A;  1V5M A;  2J0M A;  4L6E A;  2L1C A;  5DIF B;  3SV1 A;  2ROZ B;  2HE7 A;  1OY2 A;  4ZRJ A;  3TVV A;  3FEH A;  1FB8 A;  1P3R A;  3O96 A;  3GYO A;  2GUM A;  3ODX A;  1XOD A;  2M14 A;  3PP2 A;  2D11 A;  4A5K A;  4DX8 A;  2J0K A;  4D6W A;  3X23 A;  5C16 A;  4K81 A;  2KUP A;  3TW1 A;  5D3V A;  1I7A A;  5J3Q A;  1BWN A;  4NSW A;  1NU2 A;  3ODW A;  5IRS A;  4CYE A;  1BTK A;  3FVC A;  2KUQ A;  1TQZ A;  4GMX B;  1U5G A;  2RSG A;  2OQB A;  4HB3 B;  4GOU A;  2D4Q A;  5L81 A;  3TO1 A;  1M7R A;  2NBV A;  4HAY B;  2YRY A;  2J59 M;  4OSN A;  1V5P A;  1MIZ B;  1WJM A;  2KGX B;  3ML4 A;  4TYZ A;  5DHA B;  3PVL A;  2QKM A;  5D3X A;  3A8Q A;  3BIN A;  2DA0 A;  2MFQ A;  5M4Y B;  1FGY A;  1EVH A;  4KHO A;  2DTC A;  3ZDT A;  3HSA A;  1T77 A;  2YT1 A;  4HAU B;  4QJ3 B;  5KCV A;  5KQ4 A;  1TXD A;  2DHI A;  4GXB A;  4HDQ A;  4HB2 B;  2DHK A;  4HAV B;  2KIE A;  1WGQ A;  4B6H A;  2CRF A;  2W2X C;  5D3Y A;  1DDV A;  1MIX A;  1GC6 A;  1W1G A;  4QJ5 B;  5C79 A;  4GZU A;  2Z14 A;  1N3H A;  2MWN B;  1PMS A;  4GN1 A;  2W2X D;  1WGU A;  1AWE A;  1P5T A;  2P0F A;  2DLW A;  4KHB A;  3ULC A;  1KZG A;  1ISN A;  3HW2 B;  5D27 A;  1X05 A;  3ULB A;  1Z87 A;  1OMW A;  2R2Y A;  2COC A;  3DXD A;  1EAZ A;  2P0D A;  3FSS A;  1ZSQ A;  2COD A;  5DH9 B;  2RGN B;  5CLL B;  4F7G A;  1J0W A;  2VSZ A;  3WA0 A;  4HAW B;  1K5G B;  4Z2N A;  4MK0 A;  2K2J A;  2LOX A;  3D8E A;  2M38 A;  2YT2 A;  1XX0 A;  1LW3 A;  3UZT A;  4EKU A;  2JP2 A;  2RNR B;  5LOP B;  2RUK B;  3F0W A;  5EFX A;  5JLJ B;  4WSF A;  1H10 A;  4A6F B;  2N0Y A;  4IAP A;  1B55 A;  4P7I A;  2DFK A;  1PFJ A;  4WJ7 A;  1U29 A;  1U5F A;  3A58 A;  4IFS A;  2ELA A;  3HIE A;  4K2O A;  3PZD A;  2KR0 A;  4F7U P;  1NI2 A;  2YF0 A;  4GPT B;  1WI1 A;  2X18 A;  2EC1 A;  1WG7 A;  2ADZ A;  1MPH A;  1W1D A;  3SUZ A;  4HAX B;  2I1K A;  2UVM A;  2AL6 A;  3OHM B;  2EJ8 A;  3U8Z A;  4HDO A;  2N23 A;  2EMT A;  4CSQ A;  2DX5 A;  2Z59 A;  2ELB A;  3KRW A;  3KY9 A;  1FHX A;  1ZC4 B;  2FJU B;  2XQN M;  5C5B B;  2NMB A;  3PVU A;  5JP4 A;  1BAK A;  3U7D A;  1E5W A;  2KCJ A;  3IVF A;  2Z0Q A;  2CY5 A;  1V88 A;  5D3W A;  4KHA A;  2K8E A;  1OQN A;  3DXC A;  1ZM0 A;  3HK0 A;  2QKL A;  1QQG A;  4IOY X;  1U2B A;  4YON A;  3A98 B;  1ZYI A;  2GCL A;  4DX9 0;  3G9W A;  1NTY A;  2YS5 A;  1UPQ A;  3AU4 A;  3T06 A;  4A6K A;  3GYP A;  4ZRI A;  2DYQ A;  3M1I B;  3NSU A;  2K00 A;  1U27 A;  2H7D A;  1DRO A;  1PLS A;  1ZVR A;  2Z4D A;  1QC6 A;  1XR0 B;  2YSZ A;  3V5W A;  2Q13 A;  3F5R A;  2I1J A;  3N7C A;  3BJI A;  2D9V A;  2RLO A;  5J3Y A;  2K2U A;  2LG1 A;  4F7H A;  3KSY A;  2P0H A;  3NW8 A;  2W2W A;  4H8S A;  3QWM A;  3P6A A;  2PZ1 A;  1BTN A;  4Z2M B;  2DKQ A;  2D9X A;  2HTH B;  4DXA B;  1TJ6 A;  1V5U A;  1SGH A;  1Q67 A;  1UPR A;  1UNR A;  3HQC A;  1UNP A;  5JHG A;  5DHF B;  2E2X A;  1MK9 B;  2DX1 A;  2H7E A;  1U5E A;  1EF1 A;  5J3T A;  2K49 A;  5GOW B;  4C0A A;  2VRW B;  1KZ7 A;  2G35 A;  2YT0 A;  2Y8F A;  3NWF A;  4EMO A;  3PVW A;  4ZRK A;  2AEH A;  3VIA A;  4A6H A;  4DBB A;  5LON B;  1GC7 A;  2ROV A;  2Y8G A;  3D8D A;  2R09 A;  4KAX B;  4PNK A;  2YS1 A;  3KRX A;  4DIX A;  1KI1 B;  2D9W A;  4OT1 A;  5HE3 A;  5JHH A;  2R0D A;  2I5F A;  2NZ8 B;  3NWA A;  4QXA B;  1FHO A;  2VKI A;  2GJY A;  1LB1 A;  3PG7 A;  1Y19 B;  2OTX A;  2LKO A;  3D8F A;  3DCX A;  4XWX A;  1DDW A;  4TKN A;  2CAY A;  3AU5 A;  1UNQ A;  2IYB A;  2D2Q A;  2EMS A;  5FI0 A;  2KIG A;  3VOQ A;  2LOZ A;  5HE2 A;  2IFS A;  1IRS A;  5C6R A;  2YVC A;  3WYF B;  4KHB B;  1J19 A;  4MY6 A;  2RVB B;  3P7Z A;  3ODO A;  3OAN A;  1SHC A;  4NY0 A;  2UZR A;  3DXE A;  2LUL A;  3QIJ A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 1WJ1 A;  2DYN A;  3A8P A;  1XKE A;  2V76 A;  1FAO A;  4K2P A;  4HAT B;  1X11 A;  1H4R A;  3QBV B;  4K17 A;  1WVH A;  1X86 A;  2DHJ A;  4HB4 B;  2D9Z A;  5HE0 A;  4CHJ A;  4D0N B;  1DDM A;  2MKR A;  1V89 A;  1NTV A;  2DN6 A;  4YL8 A;  1FOE A;  1V61 A;  4EJN A;  1XCG A;  2DKP A;  4HAZ B;  1U5D A;  3KZ1 A;  4MT7 A;  1DYN A;  4A6F A;  1FGZ A;  1EGX A;  2FJL A;  3SNH A;  2COA A;  2COF A;  2GS0 A;  1K5D B;  2MDX A;  1X1G A;  3MPX A;  1Y5O A;  1W1H A;  3MDB C;  1MKE A;  2Z0P A;  1RRP B;  1AQC A;  3ZVR A;  3CXB B;  4HB0 B;  2I5C A;  4Y94 A;  3LJU X;  2YS3 A;  2J0J A;  3TCA A;  4BBK A;  1MAI A;  2LYD A;  3TFM A;  3PSC A;  2D9Y A;  3AJ4 A;  3SYX A;  2UZS A;  2Y7B A;  1GG3 A;  1ZC3 B;  2GCJ A;  5C5B A;  1MK7 B;  5KQ1 A;  1DBH A;  2Z0O A;  4HHV A;  2P8V A;  3CIK A;  4CHM A;  1I2H A;  1XD4 A;  1RJ2 A;  1FHW A;  3FM8 C;  1P6S A;  3RCP A;  5HE1 A;  1UEF A;  2L2I A;  2BCJ A;  4GMV A;  3PEG A;  4WVF B;  4PQ0 A;  2D10 A;  2ZPY A;  4KVG B;  5DI9 B;  3SO6 A;  1M7E A;  1X1F A;  2CY4 A;  5FI1 A;  1V5M A;  2J0M A;  4L6E A;  2L1C A;  5DIF B;  3SV1 A;  2ROZ B;  2HE7 A;  1OY2 A;  4ZRJ A;  3TVV A;  3FEH A;  1FB8 A;  1P3R A;  3O96 A;  3GYO A;  3ODX A;  1XOD A;  2M14 A;  3PP2 A;  2D11 A;  4A5K A;  4DX8 A;  2J0K A;  3X23 A;  5C16 A;  4K81 A;  2KUP A;  3TW1 A;  5D3V A;  1I7A A;  5J3Q A;  1BWN A;  4NSW A;  1NU2 A;  3ODW A;  4CYE A;  1BTK A;  1TQZ A;  4GMX B;  1U5G A;  2RSG A;  2OQB A;  4HB3 B;  2D4Q A;  5L81 A;  3TO1 A;  1M7R A;  4HAY B;  2YRY A;  2J59 M;  1V5P A;  1MIZ B;  1WJM A;  2KGX B;  3ML4 A;  4TYZ A;  5DHA B;  3PVL A;  2QKM A;  5D3X A;  3A8Q A;  3BIN A;  2DA0 A;  2MFQ A;  1FGY A;  1EVH A;  4KHO A;  2DTC A;  3ZDT A;  2YT1 A;  4HAU B;  5KCV A;  5KQ4 A;  1TXD A;  2DHI A;  4GXB A;  4HDQ A;  4HB2 B;  2DHK A;  4HAV B;  1WGQ A;  4B6H A;  2CRF A;  2W2X C;  5D3Y A;  1DDV A;  1MIX A;  1GC6 A;  1W1G A;  5C79 A;  4GZU A;  1N3H A;  2MWN B;  1PMS A;  4GN1 A;  2W2X D;  1WGU A;  1AWE A;  1P5T A;  2P0F A;  2DLW A;  3ULC A;  1KZG A;  1ISN A;  3HW2 B;  5D27 A;  1X05 A;  3ULB A;  1Z87 A;  1OMW A;  3DXD A;  2COC A;  1EAZ A;  2P0D A;  3FSS A;  1ZSQ A;  2COD A;  5DH9 B;  2RGN B;  5CLL B;  4F7G A;  1J0W A;  2VSZ A;  3WA0 A;  4HAW B;  1K5G B;  4Z2N A;  4MK0 A;  2K2J A;  2LOX A;  3D8E A;  2M38 A;  1XX0 A;  1LW3 A;  3UZT A;  4EKU A;  2JP2 A;  2RNR B;  5LOP B;  2RUK B;  3F0W A;  5EFX A;  5JLJ B;  4WSF A;  1H10 A;  4A6F B;  2N0Y A;  4IAP A;  1B55 A;  4P7I A;  2DFK A;  1PFJ A;  4WJ7 A;  1U29 A;  1U5F A;  4IFS A;  2ELA A;  4K2O A;  3PZD A;  4F7U P;  1NI2 A;  2YF0 A;  4GPT B;  1WI1 A;  2X18 A;  2EC1 A;  1WG7 A;  2ADZ A;  1MPH A;  1W1D A;  3SUZ A;  4HAX B;  2I1K A;  2UVM A;  2AL6 A;  2EJ8 A;  3U8Z A;  4HDO A;  2N23 A;  2EMT A;  2DX5 A;  2ELB A;  3KRW A;  3KY9 A;  1FHX A;  1ZC4 B;  2XQN M;  5C5B B;  2NMB A;  3PVU A;  5JP4 A;  1BAK A;  3U7D A;  1E5W A;  2KCJ A;  3IVF A;  2Z0Q A;  2CY5 A;  1V88 A;  5D3W A;  4KHA A;  1OQN A;  3DXC A;  1ZM0 A;  3HK0 A;  2QKL A;  1QQG A;  4IOY X;  1U2B A;  4YON A;  3A98 B;  2GCL A;  4DX9 0;  3G9W A;  1NTY A;  2YS5 A;  1UPQ A;  3AU4 A;  3T06 A;  4A6K A;  3GYP A;  4ZRI A;  2DYQ A;  3M1I B;  3NSU A;  2K00 A;  1U27 A;  2H7D A;  1DRO A;  1PLS A;  1ZVR A;  1QC6 A;  1XR0 B;  2YSZ A;  3V5W A;  2Q13 A;  3F5R A;  2I1J A;  3N7C A;  3BJI A;  2D9V A;  2RLO A;  5J3Y A;  2K2U A;  2LG1 A;  4F7H A;  3KSY A;  2P0H A;  4H8S A;  2W2W A;  3QWM A;  3P6A A;  2PZ1 A;  1BTN A;  4Z2M B;  2DKQ A;  2D9X A;  2HTH B;  4DXA B;  1TJ6 A;  1V5U A;  1SGH A;  1Q67 A;  1UPR A;  1UNR A;  3HQC A;  1UNP A;  5JHG A;  5DHF B;  2E2X A;  1MK9 B;  2DX1 A;  2H7E A;  1U5E A;  1EF1 A;  5J3T A;  4C0A A;  5GOW B;  2VRW B;  1KZ7 A;  2G35 A;  2YT0 A;  2Y8F A;  4EMO A;  3PVW A;  4ZRK A;  2AEH A;  3VIA A;  4A6H A;  4DBB A;  5LON B;  1GC7 A;  2ROV A;  2Y8G A;  3D8D A;  2R09 A;  4KAX B;  4PNK A;  2YS1 A;  3KRX A;  1KI1 B;  2D9W A;  5HE3 A;  5JHH A;  2R0D A;  2I5F A;  2NZ8 B;  1FHO A;  2VKI A;  2GJY A;  1LB1 A;  3PG7 A;  1Y19 B;  2OTX A;  2LKO A;  3D8F A;  4XWX A;  1DDW A;  4TKN A;  2CAY A;  3AU5 A;  1UNQ A;  2IYB A;  2D2Q A;  2EMS A;  5FI0 A;  3VOQ A;  2LOZ A;  5HE2 A;  2IFS A;  1IRS A;  5C6R A;  2YVC A;  3WYF B;  4KHB B;  1J19 A;  4MY6 A;  2RVB B;  3P7Z A;  3ODO A;  3OAN A;  1SHC A;  4NY0 A;  2UZR A;  3DXE A;  2LUL A;  3QIJ A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...