4HAVB

Crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 32
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4havB00
4B6HA 4ZRKA 2LULA 5J3YA 2CODA 3HW2B 4TYZA 1NTVA 4HAYB 2DYQA 3CXBB 2X18A 5JHGA 4F7UP 2D10A 5LOPB 3U8ZA 1J19A 1XCGA 2J59M 5L81A 2DA0A 3KRXA 2ROVA 1DDWA 2MWNB 4MY6A 4DBBA 1NI2A 3HQCA 4DXAB 1QQGA 1DDMA 2P0FA 4A6FB 1W1DA 2UZSA 2R0DA 1N3HA 1GG3A 3N7CA 1WGUA 1XD4A 3D8EA 5KCVA 2CAYA 4A6FA 2YT1A 4K2OA 2CY4A 4MT7A 1H10A 1FB8A 2Z0OA 3DXDA 3WA0A 2MFQA 1U29A 2OQBA 5EFXA 5D3WA 1X1GA 1FHOA 2KCJA 4K17A 1MIZB 5C5BA 3PP2A 2I5FA 3P6AA 2RNRB 4WVFB 1U5FA 1I2HA 2COAA 2YVCA 2RVBB 2D2QA 1DDVA 2Z0QA 3BJIA 1SHCA 3T06A 4IAPA 2L2IA 2I1JA 1OY2A 1NU2A 1XX0A 3TO1A 5LONB 1TJ6A 2QKMA 3FSSA 1EGXA 2D9WA 1GC7A 2W2WA 2COCA 4HB0B 2ROZB 1KZGA 2HTHB 1E5WA 1ZC3B 1BWNA 1UPRA 3ODWA 5GOWB 1K5DB 3LJUX 2G35A 3PVLA 4F7GA 3DXEA 2L1CA 3V5WA 3FEHA 4KVGB 2N23A 4GZUA 3PSCA 3KZ1A 4GN1A 2LOZA 2DLWA 4DX8A 5JP4A 3G9WA 4HAVB 2RLOA 4CHMA 4HHVA 2ZPYA 2D9YA 3SNHA 2D9VA 1ZVRA 2D11A 2VKIA 3ODXA 2ELBA 3OANA 2GCLA 2Y8GA 2YT0A 1PLSA 2Y7BA 1FHXA 2KGXB 4Z2NA 1V5UA 1XR0B 2YS3A 2V76A 3VIAA 1WG7A 5D27A 1U5GA 1BAKA 1W1GA 2DHKA 4F7HA 1V88A 3A8PA 1WJMA 2CY5A 4NY0A 1GC6A 1FOEA 1K5GB 3KRWA 1P5TA 4C0AA 2J0KA 1J0WA 4H8SA 2K2UA 5KQ4A 2Z0PA 1ISNA 2GCJA 2RSGA 1OMWA 2VRWB 1OQNA 1DROA 2DHIA 1DBHA 1UEFA 3PVUA 1U5EA 1LB1A 2M14A 3PZDA 5C5BB 2E2XA 1X1FA 3U7DA 2W2XC 1TXDA 2K00A 2UZRA 1MK7B 4HAWB 1B55A 1Y5OA 5D3VA 5C16A 1MKEA 4HB2B 2COFA 1V5MA 2LKOA 3GYOA 3VOQA 5HE1A 2N0YA 4HDOA 4A6KA 2YS1A 4ZRIA 4EKUA 2D9ZA 3PVWA 1XODA 3ZDTA 3SUZA 3TFMA 2H7EA 5HE2A 1PMSA 4WSFA 1U27A 1UNRA 2RGNB 2IYBA 3IVFA 4ZRJA 4YONA 1UNQA 3ZVRA 2RUKB 1Y19B 2DX5A 3NSUA 1EF1A 2Q13A 2LOXA 4XWXA 3D8DA 2P0DA 2KUPA 5C6RA 2DTCA 4IOYX 2I5CA 1ZM0A 1I7AA 2PZ1A 2BCJA 3QWMA 1X86A 4KHAA 3KSYA 1U2BA 1BTKA 5D3XA 2W2XD 2J0MA 5DHFB 5JHHA 1EVHA 4GXBA 4L6EA 4EJNA 3AU5A 4YL8A 5HE3A 3QBVB 1P6SA 3RCPA 5J3QA 4EMOA 4KAXB 2DN6A 2I1KA 2NZ8B 4HAZB 3MDBC 2LYDA 2ADZA 1WI1A 3F5RA 2R09A 1UNPA 4WJ7A 1TQZA 3P7ZA 1X05A 2FJLA 5J3TA 1FGYA 1EAZA 1BTNA 4HDQA 3HK0A 4K81A 4BBKA 3O96A 1AQCA 3ODOA 2GJYA 1M7RA 3CIKA 3FM8C 2QKLA 4KHOA 1NTYA 4IFSA 1W1HA 1LW3A 4NSWA 1V5PA 2DHJA 1WVHA 1P3RA 1WJ1A 5DH9B 1MIXA 2YS5A 3SO6A 1X11A 4CYEA 2HE7A 1ZSQA 3PEGA 5DIFB 1XKEA 2P0HA 2AEHA 4KHBB 3X23A 3ML4A 5HE0A 1WGQA 2DKQA 2DX1A 3A98B 1MAIA 3QIJA 1KI1B 1H4RA 2YF0A 3WYFB 2M38A 1V61A 3F0WA 1PFJA 4A5KA 3DXCA 2DKPA 3TW1A 3PG7A 5JLJB 2JP2A 2YRYA 4PNKA 5KQ1A 2YSZA 3AJ4A 1MPHA 1Q67A 4A6HA 3TVVA 2CRFA 2VSZA 3SV1A 4GPTB 4Y94A 1DYNA 3KY9A 4GMVA 3ULCA 3MPXA 2DFKA 2OTXA 5DHAB 4GMXB 1M7EA 3SYXA 4DX90 4D0NB 4CHJA 5FI0A 1RJ2A 5DI9B 2LG1A 2Y8FA 2NMBA 3TCAA 5D3YA 2D4QA 4MK0A 3M1IB 2P8VA 4Z2MB 5C79A 2K2JA 2EMTA 1KZ7A 1V89A 2H7DA 1IRSA 4TKNA 2ELAA 3AU4A 4HB4B 2EJ8A 1FAOA 2IFSA 3A8QA 1AWEA 2UVMA 1QC6A 1UPQA 2MDXA 4HAXB 1FHWA 1SGHA 1U5DA 2EMSA 1MK9B 5CLLB 1ZC4B 2J0JA 5CLQB 4HB3B 2EC1A 2D9XA 2MKRA 3UZTA 3GYPA 1RRPB 2GS0A 4HAUB 4HATB 2AL6A 3ULBA 3D8FA 2DYNA 4K2PA 1Z87A 4PQ0A 1FGZA 2XQNM 5FI1A 4P7IA 3BINA
chains in the Genus database with same CATH superfamily
4B6HA 4ZRKA 2LULA 5J3YA 2CODA 3HW2B 1MI1A 4TYZA 2ZKMX 1NTVA 4HAYB 2DYQA 4QJ3B 3CXBB 2X18A 5JHGA 4F7UP 2D10A 5LOPB 3U8ZA 1J19A 1XCGA 2J59M 5L81A 2DA0A 3KRXA 2ROVA 2FJUB 1DDWA 2MWNB 4MY6A 4DBBA 1NI2A 3HQCA 4DXAB 1QQGA 1DDMA 2P0FA 4A6FB 1W1DA 2UZSA 2R0DA 1N3HA 1GG3A 3N7CA 1WGUA 1XD4A 3HIEA 3D8EA 3NWDA 5KCVA 2CAYA 2K49A 2YT1A 4A6FA 4K2OA 2CY4A 4MT7A 1H10A 1FB8A 4GOUA 2Z0OA 3DXDA 3WA0A 2MFQA 1U29A 2OQBA 5EFXA 5D3WA 1X1GA 4DIXA 1FHOA 2KCJA 4K17A 1MIZB 5C5BA 2I5FA 3P6AA 3PP2A 2RNRB 4WVFB 1U5FA 1I2HA 2COAA 2YVCA 2RVBB 2D2QA 1DDVA 2Z0QA 3BJIA 1SHCA 3T06A 4IAPA 2L2IA 2I1JA 1OY2A 1NU2A 1XX0A 3TO1A 5LONB 1TJ6A 2QKMA 3FSSA 1EGXA 2D9WA 3OHMB 1GC7A 3U12A 2W2WA 4CSQA 2COCA 4HB0B 4QJ5B 2GUMA 1T77A 2ROZB 1KZGA 4OSNA 2HTHB 1E5WA 1ZC3B 1BWNA 1UPRA 3ODWA 5GOWB 1K5DB 3LJUX 2G35A 3PVLA 4F7GA 3DXEA 2L1CA 3V5WA 3FEHA 4KVGB 2N23A 4GZUA 3PSCA 3KZ1A 4GN1A 2LOZA 2DLWA 4DX8A 1ZYIA 5JP4A 3G9WA 4HAVB 2RLOA 4CHMA 4HHVA 2ZPYA 2D9YA 3SNHA 2D9VA 1ZVRA 2D11A 2VKIA 3ODXA 2ELBA 3OANA 2GCLA 2Y8GA 2YT0A 1PLSA 2Y7BA 1FHXA 2KGXB 4Z2NA 3FVCA 1V5UA 1XR0B 2YS3A 2V76A 3VIAA 1WG7A 5D27A 1U5GA 1BAKA 2KIGA 1W1GA 2DHKA 4F7HA 1V88A 3A58A 3A8PA 1WJMA 2CY5A 4NY0A 1GC6A 1FOEA 1K5GB 3KRWA 1P5TA 4C0AA 2J0KA 1J0WA 4H8SA 2K2UA 5KQ4A 2Z0PA 1ISNA 4OT1A 2GCJA 3NW8A 2RSGA 1OMWA 2VRWB 1OQNA 1DROA 2DHIA 1DBHA 1UEFA 3PVUA 1U5EA 1LB1A 2M14A 3PZDA 5C5BB 2E2XA 1X1FA 3U7DA 2W2XC 1TXDA 2K00A 2UZRA 1MK7B 4HAWB 1B55A 1Y5OA 5D3VA 5C16A 1MKEA 4HB2B 2COFA 1V5MA 2LKOA 3GYOA 3VOQA 2RRFA 5HE1A 2N0YA 4HDOA 4A6KA 2YS1A 4ZRIA 4QJ4B 4EKUA 2D9ZA 3PVWA 1XODA 4L1RA 3ZDTA 3SUZA 3TFMA 2H7EA 5HE2A 1PMSA 4D6WA 4WSFA 1U27A 1UNRA 2RGNB 2IYBA 3IVFA 4ZRJA 4QXAB 4YONA 2Z13A 1UNQA 3ZVRA 2RUKB 1Y19B 2DX5A 3NSUA 1EF1A 2Q13A 2LOXA 4XWXA 3D8DA 2P0DA 2KUPA 5C6RA 2DTCA 4IOYX 2NBVA 2I5CA 1ZM0A 1I7AA 2PZ1A 2Z59A 2BCJA 3QWMA 3NWAA 1X86A 4KHAA 3KSYA 1U2BA 1BTKA 5D3XA 2W2XD 2J0MA 5DHFB 5JHHA 1EVHA 4GXBA 4L6EA 4EJNA 3AU5A 4YL8A 5HE3A 3QBVB 1P6SA 4GNKB 3RCPA 2KR0A 5J3QA 4EMOA 4KAXB 2DN6A 2I1KA 2NZ8B 4HAZB 3MDBC 2LYDA 2ADZA 1WI1A 3F5RA 2R09A 1UNPA 4WJ7A 1TQZA 3P7ZA 1X05A 2FJLA 5J3TA 1FGYA 1EAZA 1BTNA 4HDQA 3HK0A 4K81A 4BBKA 2KUQA 3O96A 1AQCA 3ODOA 2GJYA 4HSIA 1M7RA 3CIKA 3FM8C 2QKLA 4KHOA 1NTYA 4IFSA 1W1HA 1LW3A 4NSWA 1V5PA 2DHJA 1WVHA 1P3RA 1WJ1A 5DH9B 1MIXA 2YS5A 3SO6A 1X11A 4CYEA 2HE7A 1ZSQA 3PEGA 5DIFB 1XKEA 2P0HA 2AEHA 4KHBB 3X23A 3ML4A 5HE0A 1WGQA 2DKQA 2DX1A 3A98B 1MAIA 3QIJA 5I2MA 1KI1B 1H4RA 2YF0A 3WYFB 2M38A 1V61A 3F0WA 1PFJA 4A5KA 3DXCA 2DKPA 3TW1A 3PG7A 4KHBA 5JLJB 2YT2A 2JP2A 2YRYA 4PNKA 5KQ1A 2YSZA 3AJ4A 2R2YA 1MPHA 1Q67A 4A6HA 3TVVA 2CRFA 2VSZA 3SV1A 4GPTB 2Z14A 4Y94A 1DYNA 3KY9A 4GMVA 3ULCA 3MPXA 2DFKA 2OTXA 5DHAB 3DCXA 4GMXB 1M7EA 3SYXA 4DX90 4D0NB 4CHJA 5FI0A 1RJ2A 5DI9B 2LG1A 2Y8FA 2NMBA 3HSAA 3TCAA 5D3YA 2D4QA 4MK0A 3M1IB 2P8VA 4Z2MB 5C79A 2K2JA 2EMTA 1KZ7A 5LG4B 1V89A 5M4YB 2K8EA 2H7DA 1IRSA 4TKNA 2ELAA 3AU4A 3B77A 4HB4B 2EJ8A 1FAOA 2IFSA 3A8QA 1AWEA 2UVMA 1QC6A 1UPQA 2MDXA 4HAXB 1FHWA 1SGHA 1U5DA 2EMSA 1MK9B 5CLLB 1ZC4B 2J0JA 5CLQB 4HB3B 2EC1A 2D9XA 2MKRA 5IRSA 2KIEA 3UZTA 3GYPA 1RRPB 2GS0A 2Z4DA 4HAUB 3NWFA 4HATB 2AL6A 3ULBA 3D8FA 2DYNA 4K2PA 1Z87A 4PQ0A 1FGZA 5I2SA 2XQNM 5FI1A 4P7IA 3BINA
chains in the Genus database with same CATH topology
4B6HA 4ZRKA 2LULA 5J3YA 2CODA 3HW2B 4TYZA 1NTVA 4HAYB 2DYQA 3CXBB 2X18A 5JHGA 4F7UP 2D10A 5LOPB 3U8ZA 1J19A 1XCGA 2J59M 5L81A 2DA0A 3KRXA 2ROVA 1DDWA 2MWNB 4MY6A 4DBBA 1NI2A 3HQCA 4DXAB 1QQGA 1DDMA 2P0FA 4A6FB 1W1DA 2UZSA 2R0DA 1N3HA 1GG3A 3N7CA 1WGUA 1XD4A 3D8EA 5KCVA 2CAYA 4A6FA 2YT1A 4K2OA 2CY4A 4MT7A 1H10A 1FB8A 2Z0OA 3DXDA 3WA0A 2MFQA 1U29A 2OQBA 5EFXA 5D3WA 1X1GA 1FHOA 2KCJA 4K17A 1MIZB 5C5BA 3PP2A 2I5FA 3P6AA 2RNRB 4WVFB 1U5FA 1I2HA 2COAA 2YVCA 2RVBB 2D2QA 1DDVA 2Z0QA 3BJIA 1SHCA 3T06A 4IAPA 2L2IA 2I1JA 1OY2A 1NU2A 1XX0A 3TO1A 5LONB 1TJ6A 2QKMA 3FSSA 1EGXA 2D9WA 1GC7A 2W2WA 2COCA 4HB0B 2ROZB 1KZGA 2HTHB 1E5WA 1ZC3B 1BWNA 1UPRA 3ODWA 5GOWB 1K5DB 3LJUX 2G35A 3PVLA 4F7GA 3DXEA 2L1CA 3V5WA 3FEHA 4KVGB 2N23A 4GZUA 3PSCA 3KZ1A 4GN1A 2LOZA 2DLWA 4DX8A 5JP4A 3G9WA 4HAVB 2RLOA 4CHMA 4HHVA 2ZPYA 2D9YA 3SNHA 2D9VA 1ZVRA 2D11A 2VKIA 3ODXA 2ELBA 3OANA 2GCLA 2Y8GA 2YT0A 1PLSA 2Y7BA 1FHXA 2KGXB 4Z2NA 1V5UA 1XR0B 2YS3A 2V76A 3VIAA 1WG7A 5D27A 1U5GA 1BAKA 1W1GA 2DHKA 4F7HA 1V88A 3A8PA 1WJMA 2CY5A 4NY0A 1GC6A 1FOEA 1K5GB 3KRWA 1P5TA 4C0AA 2J0KA 1J0WA 4H8SA 2K2UA 5KQ4A 2Z0PA 1ISNA 2GCJA 2RSGA 1OMWA 2VRWB 1OQNA 1DROA 2DHIA 1DBHA 1UEFA 3PVUA 1U5EA 1LB1A 2M14A 3PZDA 5C5BB 2E2XA 1X1FA 3U7DA 2W2XC 1TXDA 2K00A 2UZRA 1MK7B 4HAWB 1B55A 1Y5OA 5D3VA 5C16A 1MKEA 4HB2B 2COFA 1V5MA 2LKOA 3GYOA 3VOQA 5HE1A 2N0YA 4HDOA 4A6KA 2YS1A 4ZRIA 4EKUA 2D9ZA 3PVWA 1XODA 3ZDTA 3SUZA 3TFMA 2H7EA 5HE2A 1PMSA 4WSFA 1U27A 1UNRA 2RGNB 2IYBA 3IVFA 4ZRJA 4YONA 1UNQA 3ZVRA 2RUKB 1Y19B 2DX5A 3NSUA 1EF1A 2Q13A 2LOXA 4XWXA 3D8DA 2P0DA 2KUPA 5C6RA 2DTCA 4IOYX 2I5CA 1ZM0A 1I7AA 2PZ1A 2BCJA 3QWMA 1X86A 4KHAA 3KSYA 1U2BA 1BTKA 5D3XA 2W2XD 2J0MA 5DHFB 5JHHA 1EVHA 4GXBA 4L6EA 4EJNA 3AU5A 4YL8A 5HE3A 3QBVB 1P6SA 3RCPA 5J3QA 4EMOA 4KAXB 2DN6A 2I1KA 2NZ8B 4HAZB 3MDBC 2LYDA 2ADZA 1WI1A 3F5RA 2R09A 1UNPA 4WJ7A 1TQZA 3P7ZA 1X05A 2FJLA 5J3TA 1FGYA 1EAZA 1BTNA 4HDQA 3HK0A 4K81A 4BBKA 3O96A 1AQCA 3ODOA 2GJYA 1M7RA 3CIKA 3FM8C 2QKLA 4KHOA 1NTYA 4IFSA 1W1HA 1LW3A 4NSWA 1V5PA 2DHJA 1WVHA 1P3RA 1WJ1A 5DH9B 1MIXA 2YS5A 3SO6A 1X11A 4CYEA 2HE7A 1ZSQA 3PEGA 5DIFB 1XKEA 2P0HA 2AEHA 4KHBB 3X23A 3ML4A 5HE0A 1WGQA 2DKQA 2DX1A 3A98B 1MAIA 3QIJA 1KI1B 1H4RA 2YF0A 3WYFB 2M38A 1V61A 3F0WA 1PFJA 4A5KA 3DXCA 2DKPA 3TW1A 3PG7A 5JLJB 2JP2A 2YRYA 4PNKA 5KQ1A 2YSZA 3AJ4A 1MPHA 1Q67A 4A6HA 3TVVA 2CRFA 2VSZA 3SV1A 4GPTB 4Y94A 1DYNA 3KY9A 4GMVA 3ULCA 3MPXA 2DFKA 2OTXA 5DHAB 4GMXB 1M7EA 3SYXA 4DX90 4D0NB 4CHJA 5FI0A 1RJ2A 5DI9B 2LG1A 2Y8FA 2NMBA 3TCAA 5D3YA 2D4QA 4MK0A 3M1IB 2P8VA 4Z2MB 5C79A 2K2JA 2EMTA 1KZ7A 1V89A 2H7DA 1IRSA 4TKNA 2ELAA 3AU4A 4HB4B 2EJ8A 1FAOA 2IFSA 3A8QA 1AWEA 2UVMA 1QC6A 1UPQA 2MDXA 4HAXB 1FHWA 1SGHA 1U5DA 2EMSA 1MK9B 5CLLB 1ZC4B 2J0JA 5CLQB 4HB3B 2EC1A 2D9XA 2MKRA 3UZTA 3GYPA 1RRPB 2GS0A 4HAUB 4HATB 2AL6A 3ULBA 3D8FA 2DYNA 4K2PA 1Z87A 4PQ0A 1FGZA 2XQNM 5FI1A 4P7IA 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6H A;  4ZRK A;  2LUL A;  5J3Y A;  2COD A;  3HW2 B;  4TYZ A;  1NTV A;  4HAY B;  2DYQ A;  3CXB B;  2X18 A;  5JHG A;  4F7U P;  2D10 A;  5LOP B;  3U8Z A;  1J19 A;  1XCG A;  2J59 M;  5L81 A;  2DA0 A;  3KRX A;  2ROV A;  1DDW A;  2MWN B;  4MY6 A;  4DBB A;  1NI2 A;  3HQC A;  4DXA B;  1QQG A;  1DDM A;  2P0F A;  4A6F B;  1W1D A;  2UZS A;  2R0D A;  1N3H A;  1GG3 A;  3N7C A;  1WGU A;  1XD4 A;  3D8E A;  5KCV A;  2CAY A;  4A6F A;  2YT1 A;  4K2O A;  2CY4 A;  4MT7 A;  1H10 A;  1FB8 A;  2Z0O A;  3DXD A;  3WA0 A;  2MFQ A;  1U29 A;  2OQB A;  5EFX A;  5D3W A;  1X1G A;  1FHO A;  2KCJ A;  4K17 A;  1MIZ B;  5C5B A;  3PP2 A;  2I5F A;  3P6A A;  2RNR B;  4WVF B;  1U5F A;  1I2H A;  2COA A;  2YVC A;  2RVB B;  2D2Q A;  1DDV A;  2Z0Q A;  3BJI A;  1SHC A;  3T06 A;  4IAP A;  2L2I A;  2I1J A;  1OY2 A;  1NU2 A;  1XX0 A;  3TO1 A;  5LON B;  1TJ6 A;  2QKM A;  3FSS A;  1EGX A;  2D9W A;  1GC7 A;  2W2W A;  2COC A;  4HB0 B;  2ROZ B;  1KZG A;  2HTH B;  1E5W A;  1ZC3 B;  1BWN A;  1UPR A;  3ODW A;  5GOW B;  1K5D B;  3LJU X;  2G35 A;  3PVL A;  4F7G A;  3DXE A;  2L1C A;  3V5W A;  3FEH A;  4KVG B;  2N23 A;  4GZU A;  3PSC A;  3KZ1 A;  4GN1 A;  2LOZ A;  2DLW A;  4DX8 A;  5JP4 A;  3G9W A;  4HAV B;  2RLO A;  4CHM A;  4HHV A;  2ZPY A;  2D9Y A;  3SNH A;  2D9V A;  1ZVR A;  2D11 A;  2VKI A;  3ODX A;  2ELB A;  3OAN A;  2GCL A;  2Y8G A;  2YT0 A;  1PLS A;  2Y7B A;  1FHX A;  2KGX B;  4Z2N A;  1V5U A;  1XR0 B;  2YS3 A;  2V76 A;  3VIA A;  1WG7 A;  5D27 A;  1U5G A;  1BAK A;  1W1G A;  2DHK A;  4F7H A;  1V88 A;  3A8P A;  1WJM A;  2CY5 A;  4NY0 A;  1GC6 A;  1FOE A;  1K5G B;  3KRW A;  1P5T A;  4C0A A;  2J0K A;  1J0W A;  4H8S A;  2K2U A;  5KQ4 A;  2Z0P A;  1ISN A;  2GCJ A;  2RSG A;  1OMW A;  2VRW B;  1OQN A;  1DRO A;  2DHI A;  1DBH A;  1UEF A;  3PVU A;  1U5E A;  1LB1 A;  2M14 A;  3PZD A;  5C5B B;  2E2X A;  1X1F A;  3U7D A;  2W2X C;  1TXD A;  2K00 A;  2UZR A;  1MK7 B;  4HAW B;  1B55 A;  1Y5O A;  5D3V A;  5C16 A;  1MKE A;  4HB2 B;  2COF A;  1V5M A;  2LKO A;  3GYO A;  3VOQ A;  5HE1 A;  2N0Y A;  4HDO A;  4A6K A;  2YS1 A;  4ZRI A;  4EKU A;  2D9Z A;  3PVW A;  1XOD A;  3ZDT A;  3SUZ A;  3TFM A;  2H7E A;  5HE2 A;  1PMS A;  4WSF A;  1U27 A;  1UNR A;  2RGN B;  2IYB A;  3IVF A;  4ZRJ A;  4YON A;  1UNQ A;  3ZVR A;  2RUK B;  1Y19 B;  2DX5 A;  3NSU A;  1EF1 A;  2Q13 A;  2LOX A;  4XWX A;  3D8D A;  2P0D A;  2KUP A;  5C6R A;  2DTC A;  4IOY X;  2I5C A;  1ZM0 A;  1I7A A;  2PZ1 A;  2BCJ A;  3QWM A;  1X86 A;  4KHA A;  3KSY A;  1U2B A;  1BTK A;  5D3X A;  2W2X D;  2J0M A;  5DHF B;  5JHH A;  1EVH A;  4GXB A;  4L6E A;  4EJN A;  3AU5 A;  4YL8 A;  5HE3 A;  3QBV B;  1P6S A;  3RCP A;  5J3Q A;  4EMO A;  4KAX B;  2DN6 A;  2I1K A;  2NZ8 B;  4HAZ B;  3MDB C;  2LYD A;  2ADZ A;  1WI1 A;  3F5R A;  2R09 A;  1UNP A;  4WJ7 A;  1TQZ A;  3P7Z A;  1X05 A;  2FJL A;  5J3T A;  1FGY A;  1EAZ A;  1BTN A;  4HDQ A;  3HK0 A;  4K81 A;  4BBK A;  3O96 A;  1AQC A;  3ODO A;  2GJY A;  1M7R A;  3CIK A;  3FM8 C;  2QKL A;  4KHO A;  1NTY A;  4IFS A;  1W1H A;  1LW3 A;  4NSW A;  1V5P A;  2DHJ A;  1WVH A;  1P3R A;  1WJ1 A;  5DH9 B;  1MIX A;  2YS5 A;  3SO6 A;  1X11 A;  4CYE A;  2HE7 A;  1ZSQ A;  3PEG A;  5DIF B;  1XKE A;  2P0H A;  2AEH A;  4KHB B;  3X23 A;  3ML4 A;  5HE0 A;  1WGQ A;  2DKQ A;  2DX1 A;  3A98 B;  1MAI A;  3QIJ A;  1KI1 B;  1H4R A;  2YF0 A;  3WYF B;  2M38 A;  1V61 A;  3F0W A;  1PFJ A;  4A5K A;  3DXC A;  2DKP A;  3TW1 A;  3PG7 A;  5JLJ B;  2JP2 A;  2YRY A;  4PNK A;  5KQ1 A;  2YSZ A;  3AJ4 A;  1MPH A;  1Q67 A;  4A6H A;  3TVV A;  2CRF A;  2VSZ A;  3SV1 A;  4GPT B;  4Y94 A;  1DYN A;  3KY9 A;  4GMV A;  3ULC A;  3MPX A;  2DFK A;  2OTX A;  5DHA B;  4GMX B;  1M7E A;  3SYX A;  4DX9 0;  4D0N B;  4CHJ A;  5FI0 A;  1RJ2 A;  5DI9 B;  2LG1 A;  2Y8F A;  2NMB A;  3TCA A;  5D3Y A;  2D4Q A;  4MK0 A;  3M1I B;  2P8V A;  4Z2M B;  5C79 A;  2K2J A;  2EMT A;  1KZ7 A;  1V89 A;  2H7D A;  1IRS A;  4TKN A;  2ELA A;  3AU4 A;  4HB4 B;  2EJ8 A;  1FAO A;  2IFS A;  3A8Q A;  1AWE A;  2UVM A;  1QC6 A;  1UPQ A;  2MDX A;  4HAX B;  1FHW A;  1SGH A;  1U5D A;  2EMS A;  1MK9 B;  5CLL B;  1ZC4 B;  2J0J A;  5CLQ B;  4HB3 B;  2EC1 A;  2D9X A;  2MKR A;  3UZT A;  3GYP A;  1RRP B;  2GS0 A;  4HAU B;  4HAT B;  2AL6 A;  3ULB A;  3D8F A;  2DYN A;  4K2P A;  1Z87 A;  4PQ0 A;  1FGZ A;  2XQN M;  5FI1 A;  4P7I A;  3BIN A; 
#chains in the Genus database with same CATH topology
 4B6H A;  4ZRK A;  2LUL A;  5J3Y A;  2COD A;  3HW2 B;  1MI1 A;  4TYZ A;  2ZKM X;  1NTV A;  4HAY B;  2DYQ A;  4QJ3 B;  3CXB B;  2X18 A;  5JHG A;  4F7U P;  2D10 A;  5LOP B;  3U8Z A;  1J19 A;  1XCG A;  2J59 M;  5L81 A;  2DA0 A;  3KRX A;  2ROV A;  2FJU B;  1DDW A;  2MWN B;  4MY6 A;  4DBB A;  1NI2 A;  3HQC A;  4DXA B;  1QQG A;  1DDM A;  2P0F A;  4A6F B;  1W1D A;  2UZS A;  2R0D A;  1N3H A;  1GG3 A;  3N7C A;  1WGU A;  1XD4 A;  3HIE A;  3D8E A;  3NWD A;  5KCV A;  2CAY A;  2K49 A;  2YT1 A;  4A6F A;  4K2O A;  2CY4 A;  4MT7 A;  1H10 A;  1FB8 A;  4GOU A;  2Z0O A;  3DXD A;  3WA0 A;  2MFQ A;  1U29 A;  2OQB A;  5EFX A;  5D3W A;  1X1G A;  4DIX A;  1FHO A;  2KCJ A;  4K17 A;  1MIZ B;  5C5B A;  2I5F A;  3P6A A;  3PP2 A;  2RNR B;  4WVF B;  1U5F A;  1I2H A;  2COA A;  2YVC A;  2RVB B;  2D2Q A;  1DDV A;  2Z0Q A;  3BJI A;  1SHC A;  3T06 A;  4IAP A;  2L2I A;  2I1J A;  1OY2 A;  1NU2 A;  1XX0 A;  3TO1 A;  5LON B;  1TJ6 A;  2QKM A;  3FSS A;  1EGX A;  2D9W A;  3OHM B;  1GC7 A;  3U12 A;  2W2W A;  4CSQ A;  2COC A;  4HB0 B;  4QJ5 B;  2GUM A;  1T77 A;  2ROZ B;  1KZG A;  4OSN A;  2HTH B;  1E5W A;  1ZC3 B;  1BWN A;  1UPR A;  3ODW A;  5GOW B;  1K5D B;  3LJU X;  2G35 A;  3PVL A;  4F7G A;  3DXE A;  2L1C A;  3V5W A;  3FEH A;  4KVG B;  2N23 A;  4GZU A;  3PSC A;  3KZ1 A;  4GN1 A;  2LOZ A;  2DLW A;  4DX8 A;  1ZYI A;  5JP4 A;  3G9W A;  4HAV B;  2RLO A;  4CHM A;  4HHV A;  2ZPY A;  2D9Y A;  3SNH A;  2D9V A;  1ZVR A;  2D11 A;  2VKI A;  3ODX A;  2ELB A;  3OAN A;  2GCL A;  2Y8G A;  2YT0 A;  1PLS A;  2Y7B A;  1FHX A;  2KGX B;  4Z2N A;  3FVC A;  1V5U A;  1XR0 B;  2YS3 A;  2V76 A;  3VIA A;  1WG7 A;  5D27 A;  1U5G A;  1BAK A;  2KIG A;  1W1G A;  2DHK A;  4F7H A;  1V88 A;  3A58 A;  3A8P A;  1WJM A;  2CY5 A;  4NY0 A;  1GC6 A;  1FOE A;  1K5G B;  3KRW A;  1P5T A;  4C0A A;  2J0K A;  1J0W A;  4H8S A;  2K2U A;  5KQ4 A;  2Z0P A;  1ISN A;  4OT1 A;  2GCJ A;  3NW8 A;  2RSG A;  1OMW A;  2VRW B;  1OQN A;  1DRO A;  2DHI A;  1DBH A;  1UEF A;  3PVU A;  1U5E A;  1LB1 A;  2M14 A;  3PZD A;  5C5B B;  2E2X A;  1X1F A;  3U7D A;  2W2X C;  1TXD A;  2K00 A;  2UZR A;  1MK7 B;  4HAW B;  1B55 A;  1Y5O A;  5D3V A;  5C16 A;  1MKE A;  4HB2 B;  2COF A;  1V5M A;  2LKO A;  3GYO A;  3VOQ A;  2RRF A;  5HE1 A;  2N0Y A;  4HDO A;  4A6K A;  2YS1 A;  4ZRI A;  4QJ4 B;  4EKU A;  2D9Z A;  3PVW A;  1XOD A;  4L1R A;  3ZDT A;  3SUZ A;  3TFM A;  2H7E A;  5HE2 A;  1PMS A;  4D6W A;  4WSF A;  1U27 A;  1UNR A;  2RGN B;  2IYB A;  3IVF A;  4ZRJ A;  4QXA B;  4YON A;  2Z13 A;  1UNQ A;  3ZVR A;  2RUK B;  1Y19 B;  2DX5 A;  3NSU A;  1EF1 A;  2Q13 A;  2LOX A;  4XWX A;  3D8D A;  2P0D A;  2KUP A;  5C6R A;  2DTC A;  4IOY X;  2NBV A;  2I5C A;  1ZM0 A;  1I7A A;  2PZ1 A;  2Z59 A;  2BCJ A;  3QWM A;  3NWA A;  1X86 A;  4KHA A;  3KSY A;  1U2B A;  1BTK A;  5D3X A;  2W2X D;  2J0M A;  5DHF B;  5JHH A;  1EVH A;  4GXB A;  4L6E A;  4EJN A;  3AU5 A;  4YL8 A;  5HE3 A;  3QBV B;  1P6S A;  4GNK B;  3RCP A;  2KR0 A;  5J3Q A;  4EMO A;  4KAX B;  2DN6 A;  2I1K A;  2NZ8 B;  4HAZ B;  3MDB C;  2LYD A;  2ADZ A;  1WI1 A;  3F5R A;  2R09 A;  1UNP A;  4WJ7 A;  1TQZ A;  3P7Z A;  1X05 A;  2FJL A;  5J3T A;  1FGY A;  1EAZ A;  1BTN A;  4HDQ A;  3HK0 A;  4K81 A;  4BBK A;  2KUQ A;  3O96 A;  1AQC A;  3ODO A;  2GJY A;  4HSI A;  1M7R A;  3CIK A;  3FM8 C;  2QKL A;  4KHO A;  1NTY A;  4IFS A;  1W1H A;  1LW3 A;  4NSW A;  1V5P A;  2DHJ A;  1WVH A;  1P3R A;  1WJ1 A;  5DH9 B;  1MIX A;  2YS5 A;  3SO6 A;  1X11 A;  4CYE A;  2HE7 A;  1ZSQ A;  3PEG A;  5DIF B;  1XKE A;  2P0H A;  2AEH A;  4KHB B;  3X23 A;  3ML4 A;  5HE0 A;  1WGQ A;  2DKQ A;  2DX1 A;  3A98 B;  1MAI A;  3QIJ A;  5I2M A;  1KI1 B;  1H4R A;  2YF0 A;  3WYF B;  2M38 A;  1V61 A;  3F0W A;  1PFJ A;  4A5K A;  3DXC A;  2DKP A;  3TW1 A;  3PG7 A;  4KHB A;  5JLJ B;  2YT2 A;  2JP2 A;  2YRY A;  4PNK A;  5KQ1 A;  2YSZ A;  3AJ4 A;  2R2Y A;  1MPH A;  1Q67 A;  4A6H A;  3TVV A;  2CRF A;  2VSZ A;  3SV1 A;  4GPT B;  2Z14 A;  4Y94 A;  1DYN A;  3KY9 A;  4GMV A;  3ULC A;  3MPX A;  2DFK A;  2OTX A;  5DHA B;  3DCX A;  4GMX B;  1M7E A;  3SYX A;  4DX9 0;  4D0N B;  4CHJ A;  5FI0 A;  1RJ2 A;  5DI9 B;  2LG1 A;  2Y8F A;  2NMB A;  3HSA A;  3TCA A;  5D3Y A;  2D4Q A;  4MK0 A;  3M1I B;  2P8V A;  4Z2M B;  5C79 A;  2K2J A;  2EMT A;  1KZ7 A;  5LG4 B;  1V89 A;  5M4Y B;  2K8E A;  2H7D A;  1IRS A;  4TKN A;  2ELA A;  3AU4 A;  3B77 A;  4HB4 B;  2EJ8 A;  1FAO A;  2IFS A;  3A8Q A;  1AWE A;  2UVM A;  1QC6 A;  1UPQ A;  2MDX A;  4HAX B;  1FHW A;  1SGH A;  1U5D A;  2EMS A;  1MK9 B;  5CLL B;  1ZC4 B;  2J0J A;  5CLQ B;  4HB3 B;  2EC1 A;  2D9X A;  2MKR A;  5IRS A;  2KIE A;  3UZT A;  3GYP A;  1RRP B;  2GS0 A;  2Z4D A;  4HAU B;  3NWF A;  4HAT B;  2AL6 A;  3ULB A;  3D8F A;  2DYN A;  4K2P A;  1Z87 A;  4PQ0 A;  1FGZ A;  5I2S A;  2XQN M;  5FI1 A;  4P7I A;  3BIN A; 
#chains in the Genus database with same CATH homology
 4B6H A;  4ZRK A;  2LUL A;  5J3Y A;  2COD A;  3HW2 B;  4TYZ A;  1NTV A;  4HAY B;  2DYQ A;  3CXB B;  2X18 A;  5JHG A;  4F7U P;  2D10 A;  5LOP B;  3U8Z A;  1J19 A;  1XCG A;  2J59 M;  5L81 A;  2DA0 A;  3KRX A;  2ROV A;  1DDW A;  2MWN B;  4MY6 A;  4DBB A;  1NI2 A;  3HQC A;  4DXA B;  1QQG A;  1DDM A;  2P0F A;  4A6F B;  1W1D A;  2UZS A;  2R0D A;  1N3H A;  1GG3 A;  3N7C A;  1WGU A;  1XD4 A;  3D8E A;  5KCV A;  2CAY A;  4A6F A;  2YT1 A;  4K2O A;  2CY4 A;  4MT7 A;  1H10 A;  1FB8 A;  2Z0O A;  3DXD A;  3WA0 A;  2MFQ A;  1U29 A;  2OQB A;  5EFX A;  5D3W A;  1X1G A;  1FHO A;  2KCJ A;  4K17 A;  1MIZ B;  5C5B A;  3PP2 A;  2I5F A;  3P6A A;  2RNR B;  4WVF B;  1U5F A;  1I2H A;  2COA A;  2YVC A;  2RVB B;  2D2Q A;  1DDV A;  2Z0Q A;  3BJI A;  1SHC A;  3T06 A;  4IAP A;  2L2I A;  2I1J A;  1OY2 A;  1NU2 A;  1XX0 A;  3TO1 A;  5LON B;  1TJ6 A;  2QKM A;  3FSS A;  1EGX A;  2D9W A;  1GC7 A;  2W2W A;  2COC A;  4HB0 B;  2ROZ B;  1KZG A;  2HTH B;  1E5W A;  1ZC3 B;  1BWN A;  1UPR A;  3ODW A;  5GOW B;  1K5D B;  3LJU X;  2G35 A;  3PVL A;  4F7G A;  3DXE A;  2L1C A;  3V5W A;  3FEH A;  4KVG B;  2N23 A;  4GZU A;  3PSC A;  3KZ1 A;  4GN1 A;  2LOZ A;  2DLW A;  4DX8 A;  5JP4 A;  3G9W A;  4HAV B;  2RLO A;  4CHM A;  4HHV A;  2ZPY A;  2D9Y A;  3SNH A;  2D9V A;  1ZVR A;  2D11 A;  2VKI A;  3ODX A;  2ELB A;  3OAN A;  2GCL A;  2Y8G A;  2YT0 A;  1PLS A;  2Y7B A;  1FHX A;  2KGX B;  4Z2N A;  1V5U A;  1XR0 B;  2YS3 A;  2V76 A;  3VIA A;  1WG7 A;  5D27 A;  1U5G A;  1BAK A;  1W1G A;  2DHK A;  4F7H A;  1V88 A;  3A8P A;  1WJM A;  2CY5 A;  4NY0 A;  1GC6 A;  1FOE A;  1K5G B;  3KRW A;  1P5T A;  4C0A A;  2J0K A;  1J0W A;  4H8S A;  2K2U A;  5KQ4 A;  2Z0P A;  1ISN A;  2GCJ A;  2RSG A;  1OMW A;  2VRW B;  1OQN A;  1DRO A;  2DHI A;  1DBH A;  1UEF A;  3PVU A;  1U5E A;  1LB1 A;  2M14 A;  3PZD A;  5C5B B;  2E2X A;  1X1F A;  3U7D A;  2W2X C;  1TXD A;  2K00 A;  2UZR A;  1MK7 B;  4HAW B;  1B55 A;  1Y5O A;  5D3V A;  5C16 A;  1MKE A;  4HB2 B;  2COF A;  1V5M A;  2LKO A;  3GYO A;  3VOQ A;  5HE1 A;  2N0Y A;  4HDO A;  4A6K A;  2YS1 A;  4ZRI A;  4EKU A;  2D9Z A;  3PVW A;  1XOD A;  3ZDT A;  3SUZ A;  3TFM A;  2H7E A;  5HE2 A;  1PMS A;  4WSF A;  1U27 A;  1UNR A;  2RGN B;  2IYB A;  3IVF A;  4ZRJ A;  4YON A;  1UNQ A;  3ZVR A;  2RUK B;  1Y19 B;  2DX5 A;  3NSU A;  1EF1 A;  2Q13 A;  2LOX A;  4XWX A;  3D8D A;  2P0D A;  2KUP A;  5C6R A;  2DTC A;  4IOY X;  2I5C A;  1ZM0 A;  1I7A A;  2PZ1 A;  2BCJ A;  3QWM A;  1X86 A;  4KHA A;  3KSY A;  1U2B A;  1BTK A;  5D3X A;  2W2X D;  2J0M A;  5DHF B;  5JHH A;  1EVH A;  4GXB A;  4L6E A;  4EJN A;  3AU5 A;  4YL8 A;  5HE3 A;  3QBV B;  1P6S A;  3RCP A;  5J3Q A;  4EMO A;  4KAX B;  2DN6 A;  2I1K A;  2NZ8 B;  4HAZ B;  3MDB C;  2LYD A;  2ADZ A;  1WI1 A;  3F5R A;  2R09 A;  1UNP A;  4WJ7 A;  1TQZ A;  3P7Z A;  1X05 A;  2FJL A;  5J3T A;  1FGY A;  1EAZ A;  1BTN A;  4HDQ A;  3HK0 A;  4K81 A;  4BBK A;  3O96 A;  1AQC A;  3ODO A;  2GJY A;  1M7R A;  3CIK A;  3FM8 C;  2QKL A;  4KHO A;  1NTY A;  4IFS A;  1W1H A;  1LW3 A;  4NSW A;  1V5P A;  2DHJ A;  1WVH A;  1P3R A;  1WJ1 A;  5DH9 B;  1MIX A;  2YS5 A;  3SO6 A;  1X11 A;  4CYE A;  2HE7 A;  1ZSQ A;  3PEG A;  5DIF B;  1XKE A;  2P0H A;  2AEH A;  4KHB B;  3X23 A;  3ML4 A;  5HE0 A;  1WGQ A;  2DKQ A;  2DX1 A;  3A98 B;  1MAI A;  3QIJ A;  1KI1 B;  1H4R A;  2YF0 A;  3WYF B;  2M38 A;  1V61 A;  3F0W A;  1PFJ A;  4A5K A;  3DXC A;  2DKP A;  3TW1 A;  3PG7 A;  5JLJ B;  2JP2 A;  2YRY A;  4PNK A;  5KQ1 A;  2YSZ A;  3AJ4 A;  1MPH A;  1Q67 A;  4A6H A;  3TVV A;  2CRF A;  2VSZ A;  3SV1 A;  4GPT B;  4Y94 A;  1DYN A;  3KY9 A;  4GMV A;  3ULC A;  3MPX A;  2DFK A;  2OTX A;  5DHA B;  4GMX B;  1M7E A;  3SYX A;  4DX9 0;  4D0N B;  4CHJ A;  5FI0 A;  1RJ2 A;  5DI9 B;  2LG1 A;  2Y8F A;  2NMB A;  3TCA A;  5D3Y A;  2D4Q A;  4MK0 A;  3M1I B;  2P8V A;  4Z2M B;  5C79 A;  2K2J A;  2EMT A;  1KZ7 A;  1V89 A;  2H7D A;  1IRS A;  4TKN A;  2ELA A;  3AU4 A;  4HB4 B;  2EJ8 A;  1FAO A;  2IFS A;  3A8Q A;  1AWE A;  2UVM A;  1QC6 A;  1UPQ A;  2MDX A;  4HAX B;  1FHW A;  1SGH A;  1U5D A;  2EMS A;  1MK9 B;  5CLL B;  1ZC4 B;  2J0J A;  5CLQ B;  4HB3 B;  2EC1 A;  2D9X A;  2MKR A;  3UZT A;  3GYP A;  1RRP B;  2GS0 A;  4HAU B;  4HAT B;  2AL6 A;  3ULB A;  3D8F A;  2DYN A;  4K2P A;  1Z87 A;  4PQ0 A;  1FGZ A;  2XQN M;  5FI1 A;  4P7I A;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...