4HAVB

Crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 32
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4havB00
2I1KA 3KRWA 1X05A 2YT0A 2DYNA 3D8DA 1U5EA 3KZ1A 1DDMA 2DKQA 3SO6A 4HDQA 5KQ1A 1ISNA 2K00A 1U5GA 2YS1A 2N23A 2HTHB 1NTVA 3HK0A 5C6RA 2NZ8B 1XCGA 1BTKA 2P0FA 2NMBA 1W1DA 2OQBA 1OY2A 2LG1A 3HW2B 5D3VA 2E2XA 2GCLA 4L6EA 4MY6A 1DBHA 5C5BB 1KZGA 4F7HA 4MT7A 3RCPA 1I7AA 2DX5A 3PP2A 4WJ7A 1ZC4B 1SHCA 1WGUA 1P6SA 3ZDTA 3UZTA 4P7IA 2GS0A 2BCJA 2G35A 3ULCA 1NI2A 2JP2A 2W2XD 4Z2MB 4F7GA 2COFA 3ODOA 2J0JA 4HAUB 2CODA 4A6FB 4K17A 4A6KA 4EJNA 2D9ZA 2X18A 1QC6A 2OTXA 3OANA 4Y94A 1V89A 3ODWA 3VIAA 1EVHA 2Z0PA 1P5TA 2ROVA 2RNRB 1FHOA 4GN1A 2J0MA 1FHWA 2L2IA 3QWMA 3QIJA 1MK9B 5JHHA 1DDVA 2P0DA 2DTCA 3GYOA 2DA0A 2YS5A 3CXBB 4CHJA 1MPHA 4HHVA 2V76A 3G9WA 1TXDA 3DXDA 1ZC3B 4HAXB 4HAWB 2RGNB 2L1CA 1M7RA 4HDOA 1GG3A 2I5CA 2K2JA 3D8EA 2UZSA 3MPXA 2ELAA 3T06A 1MK7B 4DX8A 4PNKA 2YS3A 5HE2A 1H4RA 2XQNM 1AWEA 4GZUA 1XR0B 3V5WA 4K2OA 2R0DA 2M38A 1Z87A 4EKUA 1UNPA 1U5FA 3WYFB 2D9XA 2D4QA 2D11A 5KCVA 3FSSA 2LOZA 1NTYA 5L81A 5GOWB 1J0WA 4CHMA 4BBKA 2GJYA 2RUKB 2DX1A 3ZVRA 1DDWA 2EMSA 3DXEA 3ML4A 1X1FA 2KGXB 1W1GA 5HE0A 1LB1A 1UNRA 3PVLA 2VKIA 4IFSA 5JHGA 2CRFA 3QBVB 5JLJB 1KI1B 1WVHA 1PLSA 3PEGA 1EGXA 2D9VA 5C5BA 4DX90 4HAVB 2Z0OA 2LYDA 3X23A 1WG7A 5DHAB 3TCAA 1ZM0A 3PVUA 5FI0A 1Q67A 1I2HA 3PZDA 2DN6A 3O96A 2HE7A 5LONB 3SYXA 5J3TA 1GC7A 4D0NB 2DHIA 4HB3B 3F0WA 3N7CA 4YL8A 3SNHA 2M14A 2P8VA 2UZRA 2DHJA 2J0KA 5HE1A 3CIKA 1MIXA 3D8FA 1V88A 1J19A 1ZSQA 1FHXA 1N3HA 1DROA 1OQNA 5HE3A 1NU2A 1V61A 1V5UA 3GYPA 4B6HA 1U29A 3DXCA 4HB0B 2D10A 5DH9B 1XODA 2RLOA 1Y19B 4KHBB 5DIFB 1SGHA 1QQGA 2EMTA 1H10A 4TKNA 1GC6A 3U8ZA 1RRPB 2DHKA 2ELBA 1MKEA 1WJ1A 1BAKA 1K5GB 4KHOA 5DHFB 1W1HA 5JP4A 3M1IB 2R09A 4HAZB 4HATB 5J3YA 1B55A 1TQZA 1X86A 3P6AA 1P3RA 2K2UA 1KZ7A 3F5RA 1Y5OA 4HB4B 2ADZA 2J59M 3IVFA 4KAXB 5J3QA 2DKPA 2DYQA 1XKEA 3TFMA 2CY4A 1FOEA 4WVFB 4A6FA 3NSUA 1FAOA 3SUZA 2EC1A 2QKLA 1EF1A 2IYBA 2KUPA 4GPTB 3TVVA 3TO1A 2RVBB 2Y8GA 2GCJA 3KY9A 2LOXA 2D2QA 1E5WA 1M7EA 4CYEA 4YONA 2MDXA 2MWNB 3SV1A 5KQ4A 5LOPB 3KRXA 2D9WA 4HB2B 4WSFA 3BINA 1UPRA 4DXAB 2KCJA 3TW1A 3ULBA 4TYZA 2AEHA 5DI9B 1BWNA 2W2WA 4EMOA 2YT1A 1V5MA 2DFKA 4KVGB 1XD4A 4PQ0A 4ZRJA 4F7UP 3A98B 4NSWA 3AU4A 5D3WA 1LW3A 1WGQA 4C0AA 1TJ6A 3A8QA 2CAYA 4ZRKA 1ZVRA 1XX0A 4MK0A 4Z2NA 2Z0QA 5D3XA 1IRSA 4GXBA 1U27A 5C79A 4GMXB 3HQCA 2Q13A 5D27A 5C16A 5CLQB 4K81A 1FGZA 1X11A 2ZPYA 1EAZA 2VSZA 5EFXA 4H8SA 1V5PA 1UPQA 2COCA 2YVCA 2MKRA 4IOYX 3MDBC 2I1JA 2IFSA 1PFJA 3PG7A 4A5KA 2Y8FA 1K5DB 1U5DA 4HAYB 2I5FA 3ODXA 2EJ8A 4IAPA 4NY0A 3BJIA 1RJ2A 2CY5A 4ZRIA 2COAA 2AL6A 4XWXA 1OMWA 1MIZB 3WA0A 1UNQA 3FEHA 4A6HA 1DYNA 3VOQA 3A8PA 2P0HA 1X1GA 2YSZA 4GMVA 2W2XC 2ROZB 2D9YA 2RSGA 5D3YA 2UVMA 2VRWB 4KHAA 2Y7BA 3PSCA 3AU5A 2H7DA 2YF0A 3KSYA 1WJMA 3FM8C 4DBBA 2FJLA 5CLLB 2DLWA 1MAIA 3P7ZA 2LKOA 1BTNA 1FB8A 2QKMA 3AJ4A 2YRYA 2MFQA 2PZ1A 3PVWA 3U7DA 1U2BA 1WI1A 2H7EA 1FGYA 2LULA 2N0YA 4K2PA 1PMSA 1AQCA 5FI1A 3LJUX 1UEFA
chains in the Genus database with same CATH superfamily
2I1KA 3KRWA 1X05A 2YT0A 2DYNA 3D8DA 1U5EA 3KZ1A 1DDMA 2DKQA 3SO6A 4HDQA 5KQ1A 1ISNA 2K00A 1U5GA 2YS1A 1MI1A 2N23A 2HTHB 1NTVA 3HK0A 4CSQA 5C6RA 2NZ8B 1XCGA 1BTKA 2P0FA 2NMBA 1W1DA 2OQBA 5I2MA 1OY2A 2LG1A 4OT1A 4QXAB 3HW2B 5D3VA 2E2XA 2GCLA 4L6EA 4MY6A 1DBHA 5C5BB 1KZGA 4F7HA 2FJUB 4MT7A 3RCPA 1I7AA 2DX5A 3PP2A 4WJ7A 1ZC4B 1SHCA 1WGUA 1P6SA 3ZDTA 3UZTA 4P7IA 2GS0A 2BCJA 2G35A 3ULCA 1NI2A 2JP2A 2W2XD 4Z2MB 4F7GA 2COFA 3ODOA 2J0JA 4HAUB 2CODA 4A6FB 4K17A 4A6KA 4EJNA 2D9ZA 2X18A 1QC6A 2OTXA 3OANA 4Y94A 1V89A 4HSIA 3ODWA 3VIAA 1EVHA 2Z0PA 1P5TA 1ZYIA 3A58A 2ROVA 2RNRB 1FHOA 4GN1A 2J0MA 1FHWA 2L2IA 3QWMA 3QIJA 1MK9B 2KUQA 5JHHA 1DDVA 2P0DA 2DTCA 5LG4B 3GYOA 2DA0A 2YS5A 3CXBB 4CHJA 1MPHA 4HHVA 2V76A 3G9WA 1TXDA 3DXDA 1ZC3B 4HAXB 4HAWB 2RGNB 2RRFA 2L1CA 1M7RA 4HDOA 4L1RA 1GG3A 2I5CA 2K2JA 3D8EA 2UZSA 3MPXA 2ELAA 3T06A 1MK7B 4OSNA 1T77A 4DX8A 4PNKA 2YS3A 5HE2A 2GUMA 1H4RA 2XQNM 1AWEA 4GZUA 2R2YA 3NWFA 2K8EA 1XR0B 3V5WA 4K2OA 2R0DA 2M38A 4D6WA 1Z87A 4EKUA 1UNPA 2KR0A 1U5FA 3WYFB 2D9XA 2D4QA 2D11A 5M4YB 5KCVA 3FSSA 2LOZA 1NTYA 5L81A 5GOWB 1J0WA 4CHMA 4BBKA 2GJYA 2RUKB 2DX1A 3ZVRA 1DDWA 2EMSA 3DXEA 3ML4A 1X1FA 2KGXB 1W1GA 5HE0A 1LB1A 1UNRA 3PVLA 3NW8A 2VKIA 4IFSA 5JHGA 3NWAA 2CRFA 3QBVB 5JLJB 1KI1B 1WVHA 1PLSA 3PEGA 1EGXA 2D9VA 4GNKB 5C5BA 4DX90 4HAVB 2Z0OA 2LYDA 3X23A 1WG7A 2YT2A 5DHAB 3TCAA 1ZM0A 3PVUA 5FI0A 1Q67A 1I2HA 3PZDA 2DN6A 3O96A 2HE7A 5LONB 3SYXA 3HSAA 5J3TA 1GC7A 4D0NB 2DHIA 4HB3B 3F0WA 3N7CA 4YL8A 3SNHA 2M14A 4KHBA 2P8VA 2UZRA 2DHJA 2J0KA 5HE1A 3CIKA 1MIXA 3D8FA 4QJ3B 1V88A 1J19A 1ZSQA 1FHXA 1N3HA 1DROA 1OQNA 5HE3A 1NU2A 1V61A 1V5UA 3GYPA 4B6HA 1U29A 3DXCA 4HB0B 2D10A 5DH9B 1XODA 2RLOA 1Y19B 4KHBB 5DIFB 4DIXA 1SGHA 1QQGA 2EMTA 1H10A 4TKNA 1GC6A 3U8ZA 1RRPB 2DHKA 2ELBA 1MKEA 1WJ1A 1BAKA 1K5GB 4KHOA 5DHFB 1W1HA 5JP4A 3M1IB 2R09A 4HAZB 4HATB 5J3YA 1B55A 1TQZA 1X86A 3P6AA 1P3RA 2K2UA 1KZ7A 3F5RA 1Y5OA 2KIEA 4HB4B 2ADZA 2J59M 3IVFA 4KAXB 2Z14A 5J3QA 2DKPA 2DYQA 1XKEA 3TFMA 2CY4A 1FOEA 4WVFB 4A6FA 3NSUA 1FAOA 3SUZA 2EC1A 2QKLA 1EF1A 2IYBA 2KUPA 4GPTB 3TVVA 3TO1A 2RVBB 2Y8GA 2GCJA 3KY9A 2LOXA 2D2QA 1E5WA 1M7EA 4CYEA 4YONA 4GOUA 2MDXA 2MWNB 3SV1A 5KQ4A 5LOPB 3KRXA 2D9WA 4HB2B 4WSFA 3BINA 1UPRA 4DXAB 2KCJA 3TW1A 3ULBA 2NBVA 4TYZA 2AEHA 5DI9B 1BWNA 2W2WA 4EMOA 3DCXA 2YT1A 1V5MA 2DFKA 4KVGB 1XD4A 4PQ0A 4ZRJA 4F7UP 3A98B 2K49A 4NSWA 5I2SA 3AU4A 5D3WA 1LW3A 1WGQA 4C0AA 1TJ6A 3A8QA 2CAYA 4ZRKA 2Z4DA 1ZVRA 1XX0A 4MK0A 4Z2NA 2Z0QA 5D3XA 1IRSA 2Z13A 4GXBA 3B77A 1U27A 5C79A 4GMXB 3HQCA 2Q13A 5D27A 5C16A 5CLQB 4K81A 1FGZA 1X11A 3OHMB 5IRSA 2ZPYA 1EAZA 2VSZA 5EFXA 4H8SA 1V5PA 1UPQA 2COCA 2YVCA 2MKRA 4IOYX 3MDBC 2I1JA 2Z59A 2IFSA 1PFJA 3PG7A 4A5KA 2Y8FA 1K5DB 1U5DA 3NWDA 4HAYB 2I5FA 3ODXA 2EJ8A 4IAPA 4NY0A 3BJIA 1RJ2A 2CY5A 4ZRIA 2COAA 2AL6A 4XWXA 1OMWA 1MIZB 3WA0A 1UNQA 3FEHA 4A6HA 1DYNA 3HIEA 3VOQA 3A8PA 2P0HA 1X1GA 2YSZA 4GMVA 2W2XC 2ROZB 2D9YA 2RSGA 5D3YA 2UVMA 2VRWB 4KHAA 2Y7BA 3PSCA 2KIGA 3AU5A 2H7DA 2YF0A 3KSYA 1WJMA 3FM8C 3FVCA 4DBBA 2FJLA 5CLLB 2DLWA 1MAIA 3P7ZA 2LKOA 3U12A 1BTNA 1FB8A 2QKMA 3AJ4A 2YRYA 2MFQA 2PZ1A 4QJ5B 3PVWA 3U7DA 1U2BA 1WI1A 2H7EA 1FGYA 2LULA 2N0YA 4K2PA 1PMSA 1AQCA 2ZKMX 5FI1A 3LJUX 1UEFA 4QJ4B
chains in the Genus database with same CATH topology
2I1KA 3KRWA 1X05A 2YT0A 2DYNA 3D8DA 1U5EA 3KZ1A 1DDMA 2DKQA 3SO6A 4HDQA 5KQ1A 1ISNA 2K00A 1U5GA 2YS1A 2N23A 2HTHB 1NTVA 3HK0A 5C6RA 2NZ8B 1XCGA 1BTKA 2P0FA 2NMBA 1W1DA 2OQBA 1OY2A 2LG1A 3HW2B 5D3VA 2E2XA 2GCLA 4L6EA 4MY6A 1DBHA 5C5BB 1KZGA 4F7HA 4MT7A 3RCPA 1I7AA 2DX5A 3PP2A 4WJ7A 1ZC4B 1SHCA 1WGUA 1P6SA 3ZDTA 3UZTA 4P7IA 2GS0A 2BCJA 2G35A 3ULCA 1NI2A 2JP2A 2W2XD 4Z2MB 4F7GA 2COFA 3ODOA 2J0JA 4HAUB 2CODA 4A6FB 4K17A 4A6KA 4EJNA 2D9ZA 2X18A 1QC6A 2OTXA 3OANA 4Y94A 1V89A 3ODWA 3VIAA 1EVHA 2Z0PA 1P5TA 2ROVA 2RNRB 1FHOA 4GN1A 2J0MA 1FHWA 2L2IA 3QWMA 3QIJA 1MK9B 5JHHA 1DDVA 2P0DA 2DTCA 3GYOA 2DA0A 2YS5A 3CXBB 4CHJA 1MPHA 4HHVA 2V76A 3G9WA 1TXDA 3DXDA 1ZC3B 4HAXB 4HAWB 2RGNB 2L1CA 1M7RA 4HDOA 1GG3A 2I5CA 2K2JA 3D8EA 2UZSA 3MPXA 2ELAA 3T06A 1MK7B 4DX8A 4PNKA 2YS3A 5HE2A 1H4RA 2XQNM 1AWEA 4GZUA 1XR0B 3V5WA 4K2OA 2R0DA 2M38A 1Z87A 4EKUA 1UNPA 1U5FA 3WYFB 2D9XA 2D4QA 2D11A 5KCVA 3FSSA 2LOZA 1NTYA 5L81A 5GOWB 1J0WA 4CHMA 4BBKA 2GJYA 2RUKB 2DX1A 3ZVRA 1DDWA 2EMSA 3DXEA 3ML4A 1X1FA 2KGXB 1W1GA 5HE0A 1LB1A 1UNRA 3PVLA 2VKIA 4IFSA 5JHGA 2CRFA 3QBVB 5JLJB 1KI1B 1WVHA 1PLSA 3PEGA 1EGXA 2D9VA 5C5BA 4DX90 4HAVB 2Z0OA 2LYDA 3X23A 1WG7A 5DHAB 3TCAA 1ZM0A 3PVUA 5FI0A 1Q67A 1I2HA 3PZDA 2DN6A 3O96A 2HE7A 5LONB 3SYXA 5J3TA 1GC7A 4D0NB 2DHIA 4HB3B 3F0WA 3N7CA 4YL8A 3SNHA 2M14A 2P8VA 2UZRA 2DHJA 2J0KA 5HE1A 3CIKA 1MIXA 3D8FA 1V88A 1J19A 1ZSQA 1FHXA 1N3HA 1DROA 1OQNA 5HE3A 1NU2A 1V61A 1V5UA 3GYPA 4B6HA 1U29A 3DXCA 4HB0B 2D10A 5DH9B 1XODA 2RLOA 1Y19B 4KHBB 5DIFB 1SGHA 1QQGA 2EMTA 1H10A 4TKNA 1GC6A 3U8ZA 1RRPB 2DHKA 2ELBA 1MKEA 1WJ1A 1BAKA 1K5GB 4KHOA 5DHFB 1W1HA 5JP4A 3M1IB 2R09A 4HAZB 4HATB 5J3YA 1B55A 1TQZA 1X86A 3P6AA 1P3RA 2K2UA 1KZ7A 3F5RA 1Y5OA 4HB4B 2ADZA 2J59M 3IVFA 4KAXB 5J3QA 2DKPA 2DYQA 1XKEA 3TFMA 2CY4A 1FOEA 4WVFB 4A6FA 3NSUA 1FAOA 3SUZA 2EC1A 2QKLA 1EF1A 2IYBA 2KUPA 4GPTB 3TVVA 3TO1A 2RVBB 2Y8GA 2GCJA 3KY9A 2LOXA 2D2QA 1E5WA 1M7EA 4CYEA 4YONA 2MDXA 2MWNB 3SV1A 5KQ4A 5LOPB 3KRXA 2D9WA 4HB2B 4WSFA 3BINA 1UPRA 4DXAB 2KCJA 3TW1A 3ULBA 4TYZA 2AEHA 5DI9B 1BWNA 2W2WA 4EMOA 2YT1A 1V5MA 2DFKA 4KVGB 1XD4A 4PQ0A 4ZRJA 4F7UP 3A98B 4NSWA 3AU4A 5D3WA 1LW3A 1WGQA 4C0AA 1TJ6A 3A8QA 2CAYA 4ZRKA 1ZVRA 1XX0A 4MK0A 4Z2NA 2Z0QA 5D3XA 1IRSA 4GXBA 1U27A 5C79A 4GMXB 3HQCA 2Q13A 5D27A 5C16A 5CLQB 4K81A 1FGZA 1X11A 2ZPYA 1EAZA 2VSZA 5EFXA 4H8SA 1V5PA 1UPQA 2COCA 2YVCA 2MKRA 4IOYX 3MDBC 2I1JA 2IFSA 1PFJA 3PG7A 4A5KA 2Y8FA 1K5DB 1U5DA 4HAYB 2I5FA 3ODXA 2EJ8A 4IAPA 4NY0A 3BJIA 1RJ2A 2CY5A 4ZRIA 2COAA 2AL6A 4XWXA 1OMWA 1MIZB 3WA0A 1UNQA 3FEHA 4A6HA 1DYNA 3VOQA 3A8PA 2P0HA 1X1GA 2YSZA 4GMVA 2W2XC 2ROZB 2D9YA 2RSGA 5D3YA 2UVMA 2VRWB 4KHAA 2Y7BA 3PSCA 3AU5A 2H7DA 2YF0A 3KSYA 1WJMA 3FM8C 4DBBA 2FJLA 5CLLB 2DLWA 1MAIA 3P7ZA 2LKOA 1BTNA 1FB8A 2QKMA 3AJ4A 2YRYA 2MFQA 2PZ1A 3PVWA 3U7DA 1U2BA 1WI1A 2H7EA 1FGYA 2LULA 2N0YA 4K2PA 1PMSA 1AQCA 5FI1A 3LJUX 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1K A;  3KRW A;  1X05 A;  2YT0 A;  2DYN A;  3D8D A;  1U5E A;  3KZ1 A;  1DDM A;  2DKQ A;  3SO6 A;  4HDQ A;  5KQ1 A;  1ISN A;  2K00 A;  1U5G A;  2YS1 A;  2N23 A;  2HTH B;  1NTV A;  3HK0 A;  5C6R A;  2NZ8 B;  1XCG A;  1BTK A;  2P0F A;  2NMB A;  1W1D A;  2OQB A;  1OY2 A;  2LG1 A;  3HW2 B;  5D3V A;  2E2X A;  2GCL A;  4L6E A;  4MY6 A;  1DBH A;  5C5B B;  1KZG A;  4F7H A;  4MT7 A;  3RCP A;  1I7A A;  2DX5 A;  3PP2 A;  4WJ7 A;  1ZC4 B;  1SHC A;  1WGU A;  1P6S A;  3ZDT A;  3UZT A;  4P7I A;  2GS0 A;  2BCJ A;  2G35 A;  3ULC A;  1NI2 A;  2JP2 A;  2W2X D;  4Z2M B;  4F7G A;  2COF A;  3ODO A;  2J0J A;  4HAU B;  2COD A;  4A6F B;  4K17 A;  4A6K A;  4EJN A;  2D9Z A;  2X18 A;  1QC6 A;  2OTX A;  3OAN A;  4Y94 A;  1V89 A;  3ODW A;  3VIA A;  1EVH A;  2Z0P A;  1P5T A;  2ROV A;  2RNR B;  1FHO A;  4GN1 A;  2J0M A;  1FHW A;  2L2I A;  3QWM A;  3QIJ A;  1MK9 B;  5JHH A;  1DDV A;  2P0D A;  2DTC A;  3GYO A;  2DA0 A;  2YS5 A;  3CXB B;  4CHJ A;  1MPH A;  4HHV A;  2V76 A;  3G9W A;  1TXD A;  3DXD A;  1ZC3 B;  4HAX B;  4HAW B;  2RGN B;  2L1C A;  1M7R A;  4HDO A;  1GG3 A;  2I5C A;  2K2J A;  3D8E A;  2UZS A;  3MPX A;  2ELA A;  3T06 A;  1MK7 B;  4DX8 A;  4PNK A;  2YS3 A;  5HE2 A;  1H4R A;  2XQN M;  1AWE A;  4GZU A;  1XR0 B;  3V5W A;  4K2O A;  2R0D A;  2M38 A;  1Z87 A;  4EKU A;  1UNP A;  1U5F A;  3WYF B;  2D9X A;  2D4Q A;  2D11 A;  5KCV A;  3FSS A;  2LOZ A;  1NTY A;  5L81 A;  5GOW B;  1J0W A;  4CHM A;  4BBK A;  2GJY A;  2RUK B;  2DX1 A;  3ZVR A;  1DDW A;  2EMS A;  3DXE A;  3ML4 A;  1X1F A;  2KGX B;  1W1G A;  5HE0 A;  1LB1 A;  1UNR A;  3PVL A;  2VKI A;  4IFS A;  5JHG A;  2CRF A;  3QBV B;  5JLJ B;  1KI1 B;  1WVH A;  1PLS A;  3PEG A;  1EGX A;  2D9V A;  5C5B A;  4DX9 0;  4HAV B;  2Z0O A;  2LYD A;  3X23 A;  1WG7 A;  5DHA B;  3TCA A;  1ZM0 A;  3PVU A;  5FI0 A;  1Q67 A;  1I2H A;  3PZD A;  2DN6 A;  3O96 A;  2HE7 A;  5LON B;  3SYX A;  5J3T A;  1GC7 A;  4D0N B;  2DHI A;  4HB3 B;  3F0W A;  3N7C A;  4YL8 A;  3SNH A;  2M14 A;  2P8V A;  2UZR A;  2DHJ A;  2J0K A;  5HE1 A;  3CIK A;  1MIX A;  3D8F A;  1V88 A;  1J19 A;  1ZSQ A;  1FHX A;  1N3H A;  1DRO A;  1OQN A;  5HE3 A;  1NU2 A;  1V61 A;  1V5U A;  3GYP A;  4B6H A;  1U29 A;  3DXC A;  4HB0 B;  2D10 A;  5DH9 B;  1XOD A;  2RLO A;  1Y19 B;  4KHB B;  5DIF B;  1SGH A;  1QQG A;  2EMT A;  1H10 A;  4TKN A;  1GC6 A;  3U8Z A;  1RRP B;  2DHK A;  2ELB A;  1MKE A;  1WJ1 A;  1BAK A;  1K5G B;  4KHO A;  5DHF B;  1W1H A;  5JP4 A;  3M1I B;  2R09 A;  4HAZ B;  4HAT B;  5J3Y A;  1B55 A;  1TQZ A;  1X86 A;  3P6A A;  1P3R A;  2K2U A;  1KZ7 A;  3F5R A;  1Y5O A;  4HB4 B;  2ADZ A;  2J59 M;  3IVF A;  4KAX B;  5J3Q A;  2DKP A;  2DYQ A;  1XKE A;  3TFM A;  2CY4 A;  1FOE A;  4WVF B;  4A6F A;  3NSU A;  1FAO A;  3SUZ A;  2EC1 A;  2QKL A;  1EF1 A;  2IYB A;  2KUP A;  4GPT B;  3TVV A;  3TO1 A;  2RVB B;  2Y8G A;  2GCJ A;  3KY9 A;  2LOX A;  2D2Q A;  1E5W A;  1M7E A;  4CYE A;  4YON A;  2MDX A;  2MWN B;  3SV1 A;  5KQ4 A;  5LOP B;  3KRX A;  2D9W A;  4HB2 B;  4WSF A;  3BIN A;  1UPR A;  4DXA B;  2KCJ A;  3TW1 A;  3ULB A;  4TYZ A;  2AEH A;  5DI9 B;  1BWN A;  2W2W A;  4EMO A;  2YT1 A;  1V5M A;  2DFK A;  4KVG B;  1XD4 A;  4PQ0 A;  4ZRJ A;  4F7U P;  3A98 B;  4NSW A;  3AU4 A;  5D3W A;  1LW3 A;  1WGQ A;  4C0A A;  1TJ6 A;  3A8Q A;  2CAY A;  4ZRK A;  1ZVR A;  1XX0 A;  4MK0 A;  4Z2N A;  2Z0Q A;  5D3X A;  1IRS A;  4GXB A;  1U27 A;  5C79 A;  4GMX B;  3HQC A;  2Q13 A;  5D27 A;  5C16 A;  5CLQ B;  4K81 A;  1FGZ A;  1X11 A;  2ZPY A;  1EAZ A;  2VSZ A;  5EFX A;  4H8S A;  1V5P A;  1UPQ A;  2COC A;  2YVC A;  2MKR A;  4IOY X;  3MDB C;  2I1J A;  2IFS A;  1PFJ A;  3PG7 A;  4A5K A;  2Y8F A;  1K5D B;  1U5D A;  4HAY B;  2I5F A;  3ODX A;  2EJ8 A;  4IAP A;  4NY0 A;  3BJI A;  1RJ2 A;  2CY5 A;  4ZRI A;  2COA A;  2AL6 A;  4XWX A;  1OMW A;  1MIZ B;  3WA0 A;  1UNQ A;  3FEH A;  4A6H A;  1DYN A;  3VOQ A;  3A8P A;  2P0H A;  1X1G A;  2YSZ A;  4GMV A;  2W2X C;  2ROZ B;  2D9Y A;  2RSG A;  5D3Y A;  2UVM A;  2VRW B;  4KHA A;  2Y7B A;  3PSC A;  3AU5 A;  2H7D A;  2YF0 A;  3KSY A;  1WJM A;  3FM8 C;  4DBB A;  2FJL A;  5CLL B;  2DLW A;  1MAI A;  3P7Z A;  2LKO A;  1BTN A;  1FB8 A;  2QKM A;  3AJ4 A;  2YRY A;  2MFQ A;  2PZ1 A;  3PVW A;  3U7D A;  1U2B A;  1WI1 A;  2H7E A;  1FGY A;  2LUL A;  2N0Y A;  4K2P A;  1PMS A;  1AQC A;  5FI1 A;  3LJU X;  1UEF A; 
#chains in the Genus database with same CATH topology
 2I1K A;  3KRW A;  1X05 A;  2YT0 A;  2DYN A;  3D8D A;  1U5E A;  3KZ1 A;  1DDM A;  2DKQ A;  3SO6 A;  4HDQ A;  5KQ1 A;  1ISN A;  2K00 A;  1U5G A;  2YS1 A;  1MI1 A;  2N23 A;  2HTH B;  1NTV A;  3HK0 A;  4CSQ A;  5C6R A;  2NZ8 B;  1XCG A;  1BTK A;  2P0F A;  2NMB A;  1W1D A;  2OQB A;  5I2M A;  1OY2 A;  2LG1 A;  4OT1 A;  4QXA B;  3HW2 B;  5D3V A;  2E2X A;  2GCL A;  4L6E A;  4MY6 A;  1DBH A;  5C5B B;  1KZG A;  4F7H A;  2FJU B;  4MT7 A;  3RCP A;  1I7A A;  2DX5 A;  3PP2 A;  4WJ7 A;  1ZC4 B;  1SHC A;  1WGU A;  1P6S A;  3ZDT A;  3UZT A;  4P7I A;  2GS0 A;  2BCJ A;  2G35 A;  3ULC A;  1NI2 A;  2JP2 A;  2W2X D;  4Z2M B;  4F7G A;  2COF A;  3ODO A;  2J0J A;  4HAU B;  2COD A;  4A6F B;  4K17 A;  4A6K A;  4EJN A;  2D9Z A;  2X18 A;  1QC6 A;  2OTX A;  3OAN A;  4Y94 A;  1V89 A;  4HSI A;  3ODW A;  3VIA A;  1EVH A;  2Z0P A;  1P5T A;  1ZYI A;  3A58 A;  2ROV A;  2RNR B;  1FHO A;  4GN1 A;  2J0M A;  1FHW A;  2L2I A;  3QWM A;  3QIJ A;  1MK9 B;  2KUQ A;  5JHH A;  1DDV A;  2P0D A;  2DTC A;  5LG4 B;  3GYO A;  2DA0 A;  2YS5 A;  3CXB B;  4CHJ A;  1MPH A;  4HHV A;  2V76 A;  3G9W A;  1TXD A;  3DXD A;  1ZC3 B;  4HAX B;  4HAW B;  2RGN B;  2RRF A;  2L1C A;  1M7R A;  4HDO A;  4L1R A;  1GG3 A;  2I5C A;  2K2J A;  3D8E A;  2UZS A;  3MPX A;  2ELA A;  3T06 A;  1MK7 B;  4OSN A;  1T77 A;  4DX8 A;  4PNK A;  2YS3 A;  5HE2 A;  2GUM A;  1H4R A;  2XQN M;  1AWE A;  4GZU A;  2R2Y A;  3NWF A;  2K8E A;  1XR0 B;  3V5W A;  4K2O A;  2R0D A;  2M38 A;  4D6W A;  1Z87 A;  4EKU A;  1UNP A;  2KR0 A;  1U5F A;  3WYF B;  2D9X A;  2D4Q A;  2D11 A;  5M4Y B;  5KCV A;  3FSS A;  2LOZ A;  1NTY A;  5L81 A;  5GOW B;  1J0W A;  4CHM A;  4BBK A;  2GJY A;  2RUK B;  2DX1 A;  3ZVR A;  1DDW A;  2EMS A;  3DXE A;  3ML4 A;  1X1F A;  2KGX B;  1W1G A;  5HE0 A;  1LB1 A;  1UNR A;  3PVL A;  3NW8 A;  2VKI A;  4IFS A;  5JHG A;  3NWA A;  2CRF A;  3QBV B;  5JLJ B;  1KI1 B;  1WVH A;  1PLS A;  3PEG A;  1EGX A;  2D9V A;  4GNK B;  5C5B A;  4DX9 0;  4HAV B;  2Z0O A;  2LYD A;  3X23 A;  1WG7 A;  2YT2 A;  5DHA B;  3TCA A;  1ZM0 A;  3PVU A;  5FI0 A;  1Q67 A;  1I2H A;  3PZD A;  2DN6 A;  3O96 A;  2HE7 A;  5LON B;  3SYX A;  3HSA A;  5J3T A;  1GC7 A;  4D0N B;  2DHI A;  4HB3 B;  3F0W A;  3N7C A;  4YL8 A;  3SNH A;  2M14 A;  4KHB A;  2P8V A;  2UZR A;  2DHJ A;  2J0K A;  5HE1 A;  3CIK A;  1MIX A;  3D8F A;  4QJ3 B;  1V88 A;  1J19 A;  1ZSQ A;  1FHX A;  1N3H A;  1DRO A;  1OQN A;  5HE3 A;  1NU2 A;  1V61 A;  1V5U A;  3GYP A;  4B6H A;  1U29 A;  3DXC A;  4HB0 B;  2D10 A;  5DH9 B;  1XOD A;  2RLO A;  1Y19 B;  4KHB B;  5DIF B;  4DIX A;  1SGH A;  1QQG A;  2EMT A;  1H10 A;  4TKN A;  1GC6 A;  3U8Z A;  1RRP B;  2DHK A;  2ELB A;  1MKE A;  1WJ1 A;  1BAK A;  1K5G B;  4KHO A;  5DHF B;  1W1H A;  5JP4 A;  3M1I B;  2R09 A;  4HAZ B;  4HAT B;  5J3Y A;  1B55 A;  1TQZ A;  1X86 A;  3P6A A;  1P3R A;  2K2U A;  1KZ7 A;  3F5R A;  1Y5O A;  2KIE A;  4HB4 B;  2ADZ A;  2J59 M;  3IVF A;  4KAX B;  2Z14 A;  5J3Q A;  2DKP A;  2DYQ A;  1XKE A;  3TFM A;  2CY4 A;  1FOE A;  4WVF B;  4A6F A;  3NSU A;  1FAO A;  3SUZ A;  2EC1 A;  2QKL A;  1EF1 A;  2IYB A;  2KUP A;  4GPT B;  3TVV A;  3TO1 A;  2RVB B;  2Y8G A;  2GCJ A;  3KY9 A;  2LOX A;  2D2Q A;  1E5W A;  1M7E A;  4CYE A;  4YON A;  4GOU A;  2MDX A;  2MWN B;  3SV1 A;  5KQ4 A;  5LOP B;  3KRX A;  2D9W A;  4HB2 B;  4WSF A;  3BIN A;  1UPR A;  4DXA B;  2KCJ A;  3TW1 A;  3ULB A;  2NBV A;  4TYZ A;  2AEH A;  5DI9 B;  1BWN A;  2W2W A;  4EMO A;  3DCX A;  2YT1 A;  1V5M A;  2DFK A;  4KVG B;  1XD4 A;  4PQ0 A;  4ZRJ A;  4F7U P;  3A98 B;  2K49 A;  4NSW A;  5I2S A;  3AU4 A;  5D3W A;  1LW3 A;  1WGQ A;  4C0A A;  1TJ6 A;  3A8Q A;  2CAY A;  4ZRK A;  2Z4D A;  1ZVR A;  1XX0 A;  4MK0 A;  4Z2N A;  2Z0Q A;  5D3X A;  1IRS A;  2Z13 A;  4GXB A;  3B77 A;  1U27 A;  5C79 A;  4GMX B;  3HQC A;  2Q13 A;  5D27 A;  5C16 A;  5CLQ B;  4K81 A;  1FGZ A;  1X11 A;  3OHM B;  5IRS A;  2ZPY A;  1EAZ A;  2VSZ A;  5EFX A;  4H8S A;  1V5P A;  1UPQ A;  2COC A;  2YVC A;  2MKR A;  4IOY X;  3MDB C;  2I1J A;  2Z59 A;  2IFS A;  1PFJ A;  3PG7 A;  4A5K A;  2Y8F A;  1K5D B;  1U5D A;  3NWD A;  4HAY B;  2I5F A;  3ODX A;  2EJ8 A;  4IAP A;  4NY0 A;  3BJI A;  1RJ2 A;  2CY5 A;  4ZRI A;  2COA A;  2AL6 A;  4XWX A;  1OMW A;  1MIZ B;  3WA0 A;  1UNQ A;  3FEH A;  4A6H A;  1DYN A;  3HIE A;  3VOQ A;  3A8P A;  2P0H A;  1X1G A;  2YSZ A;  4GMV A;  2W2X C;  2ROZ B;  2D9Y A;  2RSG A;  5D3Y A;  2UVM A;  2VRW B;  4KHA A;  2Y7B A;  3PSC A;  2KIG A;  3AU5 A;  2H7D A;  2YF0 A;  3KSY A;  1WJM A;  3FM8 C;  3FVC A;  4DBB A;  2FJL A;  5CLL B;  2DLW A;  1MAI A;  3P7Z A;  2LKO A;  3U12 A;  1BTN A;  1FB8 A;  2QKM A;  3AJ4 A;  2YRY A;  2MFQ A;  2PZ1 A;  4QJ5 B;  3PVW A;  3U7D A;  1U2B A;  1WI1 A;  2H7E A;  1FGY A;  2LUL A;  2N0Y A;  4K2P A;  1PMS A;  1AQC A;  2ZKM X;  5FI1 A;  3LJU X;  1UEF A;  4QJ4 B; 
#chains in the Genus database with same CATH homology
 2I1K A;  3KRW A;  1X05 A;  2YT0 A;  2DYN A;  3D8D A;  1U5E A;  3KZ1 A;  1DDM A;  2DKQ A;  3SO6 A;  4HDQ A;  5KQ1 A;  1ISN A;  2K00 A;  1U5G A;  2YS1 A;  2N23 A;  2HTH B;  1NTV A;  3HK0 A;  5C6R A;  2NZ8 B;  1XCG A;  1BTK A;  2P0F A;  2NMB A;  1W1D A;  2OQB A;  1OY2 A;  2LG1 A;  3HW2 B;  5D3V A;  2E2X A;  2GCL A;  4L6E A;  4MY6 A;  1DBH A;  5C5B B;  1KZG A;  4F7H A;  4MT7 A;  3RCP A;  1I7A A;  2DX5 A;  3PP2 A;  4WJ7 A;  1ZC4 B;  1SHC A;  1WGU A;  1P6S A;  3ZDT A;  3UZT A;  4P7I A;  2GS0 A;  2BCJ A;  2G35 A;  3ULC A;  1NI2 A;  2JP2 A;  2W2X D;  4Z2M B;  4F7G A;  2COF A;  3ODO A;  2J0J A;  4HAU B;  2COD A;  4A6F B;  4K17 A;  4A6K A;  4EJN A;  2D9Z A;  2X18 A;  1QC6 A;  2OTX A;  3OAN A;  4Y94 A;  1V89 A;  3ODW A;  3VIA A;  1EVH A;  2Z0P A;  1P5T A;  2ROV A;  2RNR B;  1FHO A;  4GN1 A;  2J0M A;  1FHW A;  2L2I A;  3QWM A;  3QIJ A;  1MK9 B;  5JHH A;  1DDV A;  2P0D A;  2DTC A;  3GYO A;  2DA0 A;  2YS5 A;  3CXB B;  4CHJ A;  1MPH A;  4HHV A;  2V76 A;  3G9W A;  1TXD A;  3DXD A;  1ZC3 B;  4HAX B;  4HAW B;  2RGN B;  2L1C A;  1M7R A;  4HDO A;  1GG3 A;  2I5C A;  2K2J A;  3D8E A;  2UZS A;  3MPX A;  2ELA A;  3T06 A;  1MK7 B;  4DX8 A;  4PNK A;  2YS3 A;  5HE2 A;  1H4R A;  2XQN M;  1AWE A;  4GZU A;  1XR0 B;  3V5W A;  4K2O A;  2R0D A;  2M38 A;  1Z87 A;  4EKU A;  1UNP A;  1U5F A;  3WYF B;  2D9X A;  2D4Q A;  2D11 A;  5KCV A;  3FSS A;  2LOZ A;  1NTY A;  5L81 A;  5GOW B;  1J0W A;  4CHM A;  4BBK A;  2GJY A;  2RUK B;  2DX1 A;  3ZVR A;  1DDW A;  2EMS A;  3DXE A;  3ML4 A;  1X1F A;  2KGX B;  1W1G A;  5HE0 A;  1LB1 A;  1UNR A;  3PVL A;  2VKI A;  4IFS A;  5JHG A;  2CRF A;  3QBV B;  5JLJ B;  1KI1 B;  1WVH A;  1PLS A;  3PEG A;  1EGX A;  2D9V A;  5C5B A;  4DX9 0;  4HAV B;  2Z0O A;  2LYD A;  3X23 A;  1WG7 A;  5DHA B;  3TCA A;  1ZM0 A;  3PVU A;  5FI0 A;  1Q67 A;  1I2H A;  3PZD A;  2DN6 A;  3O96 A;  2HE7 A;  5LON B;  3SYX A;  5J3T A;  1GC7 A;  4D0N B;  2DHI A;  4HB3 B;  3F0W A;  3N7C A;  4YL8 A;  3SNH A;  2M14 A;  2P8V A;  2UZR A;  2DHJ A;  2J0K A;  5HE1 A;  3CIK A;  1MIX A;  3D8F A;  1V88 A;  1J19 A;  1ZSQ A;  1FHX A;  1N3H A;  1DRO A;  1OQN A;  5HE3 A;  1NU2 A;  1V61 A;  1V5U A;  3GYP A;  4B6H A;  1U29 A;  3DXC A;  4HB0 B;  2D10 A;  5DH9 B;  1XOD A;  2RLO A;  1Y19 B;  4KHB B;  5DIF B;  1SGH A;  1QQG A;  2EMT A;  1H10 A;  4TKN A;  1GC6 A;  3U8Z A;  1RRP B;  2DHK A;  2ELB A;  1MKE A;  1WJ1 A;  1BAK A;  1K5G B;  4KHO A;  5DHF B;  1W1H A;  5JP4 A;  3M1I B;  2R09 A;  4HAZ B;  4HAT B;  5J3Y A;  1B55 A;  1TQZ A;  1X86 A;  3P6A A;  1P3R A;  2K2U A;  1KZ7 A;  3F5R A;  1Y5O A;  4HB4 B;  2ADZ A;  2J59 M;  3IVF A;  4KAX B;  5J3Q A;  2DKP A;  2DYQ A;  1XKE A;  3TFM A;  2CY4 A;  1FOE A;  4WVF B;  4A6F A;  3NSU A;  1FAO A;  3SUZ A;  2EC1 A;  2QKL A;  1EF1 A;  2IYB A;  2KUP A;  4GPT B;  3TVV A;  3TO1 A;  2RVB B;  2Y8G A;  2GCJ A;  3KY9 A;  2LOX A;  2D2Q A;  1E5W A;  1M7E A;  4CYE A;  4YON A;  2MDX A;  2MWN B;  3SV1 A;  5KQ4 A;  5LOP B;  3KRX A;  2D9W A;  4HB2 B;  4WSF A;  3BIN A;  1UPR A;  4DXA B;  2KCJ A;  3TW1 A;  3ULB A;  4TYZ A;  2AEH A;  5DI9 B;  1BWN A;  2W2W A;  4EMO A;  2YT1 A;  1V5M A;  2DFK A;  4KVG B;  1XD4 A;  4PQ0 A;  4ZRJ A;  4F7U P;  3A98 B;  4NSW A;  3AU4 A;  5D3W A;  1LW3 A;  1WGQ A;  4C0A A;  1TJ6 A;  3A8Q A;  2CAY A;  4ZRK A;  1ZVR A;  1XX0 A;  4MK0 A;  4Z2N A;  2Z0Q A;  5D3X A;  1IRS A;  4GXB A;  1U27 A;  5C79 A;  4GMX B;  3HQC A;  2Q13 A;  5D27 A;  5C16 A;  5CLQ B;  4K81 A;  1FGZ A;  1X11 A;  2ZPY A;  1EAZ A;  2VSZ A;  5EFX A;  4H8S A;  1V5P A;  1UPQ A;  2COC A;  2YVC A;  2MKR A;  4IOY X;  3MDB C;  2I1J A;  2IFS A;  1PFJ A;  3PG7 A;  4A5K A;  2Y8F A;  1K5D B;  1U5D A;  4HAY B;  2I5F A;  3ODX A;  2EJ8 A;  4IAP A;  4NY0 A;  3BJI A;  1RJ2 A;  2CY5 A;  4ZRI A;  2COA A;  2AL6 A;  4XWX A;  1OMW A;  1MIZ B;  3WA0 A;  1UNQ A;  3FEH A;  4A6H A;  1DYN A;  3VOQ A;  3A8P A;  2P0H A;  1X1G A;  2YSZ A;  4GMV A;  2W2X C;  2ROZ B;  2D9Y A;  2RSG A;  5D3Y A;  2UVM A;  2VRW B;  4KHA A;  2Y7B A;  3PSC A;  3AU5 A;  2H7D A;  2YF0 A;  3KSY A;  1WJM A;  3FM8 C;  4DBB A;  2FJL A;  5CLL B;  2DLW A;  1MAI A;  3P7Z A;  2LKO A;  1BTN A;  1FB8 A;  2QKM A;  3AJ4 A;  2YRY A;  2MFQ A;  2PZ1 A;  3PVW A;  3U7D A;  1U2B A;  1WI1 A;  2H7E A;  1FGY A;  2LUL A;  2N0Y A;  4K2P A;  1PMS A;  1AQC A;  5FI1 A;  3LJU X;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...