4A6FB

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
110
Chain Sequence
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSTGSDAKFVLHAKQNIIGHNYVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 22
structure length 110
sequence length 116
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fB00
3CIKA 3ZDTA 2UVMA 1XKEA 2DTCA 2DX5A 1X11A 2DX1A 2VRWB 4NY0A 4GN1A 1DBHA 2Q13A 3QWMA 1GG3A 4GMXB 2H7EA 3KRWA 1QQGA 4GPTB 4HHVA 1BAKA 3F5RA 3VIAA 3BJIA 1U5FA 1X86A 1Y19B 3ODWA 4HAUB 1PMSA 4HDQA 4A6FB 3PP2A 4YL8A 1FGZA 4GZUA 3CXBB 2YS5A 4HB2B 5CLQB 4A5KA 2L1CA 3BINA 2CODA 3D8DA 4CHMA 2MWNB 1U27A 4KHOA 1UPRA 2GCLA 1X1GA 2ELBA 3VOQA 3MDBC 3T06A 1V5PA 5D27A 4HAVB 5C5BA 3GYPA 2W2XC 2NZ8B 2BCJA 2XQNM 4KVGB 2OTXA 5KCVA 4KHBB 1UNQA 3TCAA 2Z0PA 4TKNA 4K2PA 3FM8C 2HTHB 2P0DA 2IFSA 4ZRKA 4L6EA 2RGNB 3O96A 1P6SA 2DFKA 2LOZA 5J3YA 2D9VA 2FJLA 2DKQA 4HAWB 2K2UA 3PG7A 4HAZB 1WI1A 5HE1A 5EFXA 2D9YA 3RCPA 3TFMA 3U8ZA 4MT7A 1MIZB 1DDMA 4HATB 1KZGA 5KQ1A 4B6HA 4K81A 4NSWA 5C5BB 2E2XA 4PNKA 3PEGA 2DA0A 2CY5A 4KAXB 2D9XA 1FB8A 3D8FA 2VKIA 1LB1A 2LYDA 2D10A 2PZ1A 3V5WA 2COCA 2Y8GA 2NMBA 3DXCA 4TYZA 4EJNA 3OANA 2RLOA 4A6HA 2QKMA 1M7EA 2KGXB 3KRXA 4DX8A 1I2HA 2DHJA 1FHOA 2DYQA 5HE3A 3ODXA 2DN6A 2DLWA 4Z2NA 1X1FA 2OQBA 4P7IA 1V89A 2D9ZA 2MKRA 3TW1A 1K5GB 4H8SA 3ML4A 5D3VA 3TO1A 3PVLA 4CHJA 1U5GA 2LULA 3HQCA 1WJMA 1ZSQA 1DDVA 1ZVRA 2GS0A 2I5CA 3KSYA 4HAXB 5C79A 1BTKA 3SUZA 2YVCA 2YSZA 2J0KA 2YT1A 1K5DB 1QC6A 4HB3B 2CAYA 4F7HA 3KY9A 1MPHA 1Q67A 2G35A 2I5FA 1E5WA 2Z0OA 5DH9B 3SV1A 4D0NB 5GOWB 1UEFA 2GJYA 1WJ1A 3LJUX 1TJ6A 2EC1A 2AL6A 2D2QA 1U2BA 2J0MA 2V76A 2W2WA 1EGXA 3GYOA 1W1DA 1U29A 1UPQA 1H10A 2DKPA 2LG1A 2UZRA 2N23A 3ULCA 2YT0A 1NTVA 1SGHA 2UZSA 1MAIA 1XD4A 2EJ8A 5D3YA 3ULBA 3AU4A 1DROA 3SO6A 1XX0A 4KHAA 3NSUA 2W2XD 3AU5A 5KQ4A 4DXAB 4GMVA 2JP2A 1MK9B 2DHIA 1TXDA 4ZRJA 2LKOA 4YONA 2CY4A 4GXBA 3QBVB 1EVHA 4WJ7A 2J59M 2RUKB 2J0JA 1V5UA 5DIFB 4HB0B 1V61A 5JP4A 3WYFB 1B55A 1Y5OA 2CRFA 1WGQA 2D11A 5JLJB 2R09A 3HK0A 1FGYA 1PFJA 5JHGA 3PSCA 2GCJA 4ZRIA 1EF1A 1XR0B 4EMOA 4MY6A 1ZM0A 4DX90 3D8EA 4F7UP 1AQCA 1RJ2A 4IAPA 3X23A 3M1IB 2X18A 5D3WA 3A8PA 4K2OA 2COFA 5DHFB 2N0YA 4XWXA 5L81A 1GC7A 2Y7BA 4HB4B 2H7DA 2RSGA 2DYNA 1FHWA 1J0WA 2M38A 1RRPB 2IYBA 3N7CA 1U5EA 4WVFB 1XODA 1H4RA 1SHCA 3ZVRA 2YF0A 2ADZA 5DHAB 2D4QA 3A8QA 2P0FA 3G9WA 3P7ZA 1OQNA 1W1HA 3MPXA 2VSZA 3P6AA 5FI0A 1ZC4B 4K17A 5CLLB 5C16A 1M7RA 2Z0QA 2ELAA 2R0DA 2RVBB 5LONB 5FI1A 3FEHA 1TQZA 1J19A 1UNRA 1I7AA 3DXEA 2AEHA 3A98B 3IVFA 1LW3A 4C0AA 2L2IA 3U7DA 1BWNA 4HAYB 5HE2A 1P3RA 3UZTA 4EKUA 4IFSA 5DI9B 2YS3A 4IOYX 2P8VA 2ROVA 5J3QA 2LOXA 1U5DA 1EAZA 2YRYA 5LOPB 2ZPYA 1N3HA 5C6RA 4BBKA 3KZ1A 3F0WA 1P5TA 1IRSA 2HE7A 3WA0A 2I1JA 3SNHA 4A6KA 4Y94A 1MK7B 4F7GA 4WSFA 4Z2MB 2YS1A 1FAOA 3AJ4A 4DBBA 2K2JA 2Y8FA 1DDWA 2D9WA 5D3XA 4CYEA 3FSSA 2QKLA 1BTNA 2KCJA 2COAA 1FOEA 1GC6A 2RNRB 2EMSA 5JHHA 2DHKA 3TVVA 1AWEA 1KZ7A 3DXDA 2ROZB 1PLSA 1ISNA 1ZC3B 4A6FA 4MK0A 1DYNA 1V5MA 1NU2A 2MDXA 5HE0A 2M14A 1WGUA 1OY2A 1MKEA 1W1GA 3PZDA 1XCGA 1NTYA 5J3TA 2P0HA 2EMTA 1Z87A 1KI1B 2K00A 3SYXA 3QIJA 1X05A 3HW2B 1WG7A 1OMWA 3PVWA 4HDOA 2I1KA 3PVUA 1V88A 1WVHA 1MIXA 3ODOA 2KUPA 2MFQA 1UNPA 4PQ0A 1FHXA 1NI2A
chains in the Genus database with same CATH superfamily
3CIKA 3ZDTA 2UVMA 1XKEA 2DTCA 2DX5A 1X11A 2DX1A 2VRWB 4NY0A 4GN1A 3DCXA 4KHBA 1DBHA 2Q13A 3QWMA 1GG3A 4GMXB 2H7EA 3KRWA 1QQGA 4GPTB 4HHVA 1BAKA 3F5RA 3VIAA 3BJIA 1U5FA 1X86A 1Y19B 3ODWA 4HAUB 1PMSA 2Z4DA 4HDQA 4A6FB 3PP2A 4YL8A 1FGZA 3NWAA 4GZUA 3CXBB 2YS5A 4HB2B 5CLQB 4A5KA 2L1CA 3BINA 2CODA 3D8DA 4CHMA 2MWNB 1U27A 4KHOA 1UPRA 2GCLA 1X1GA 2ELBA 3VOQA 3MDBC 3T06A 1V5PA 5D27A 4HAVB 5C5BA 3GYPA 2W2XC 3B77A 2NZ8B 2BCJA 2XQNM 4KVGB 2OTXA 5KCVA 4KHBB 1UNQA 3TCAA 2Z0PA 4TKNA 4K2PA 3FM8C 2HTHB 2P0DA 2IFSA 4ZRKA 4L6EA 2RGNB 3O96A 1P6SA 2DFKA 2LOZA 5J3YA 2D9VA 2FJLA 2DKQA 4HAWB 2K2UA 3PG7A 4HAZB 2R2YA 1WI1A 5HE1A 5EFXA 2D9YA 3RCPA 3TFMA 3U8ZA 4MT7A 1MIZB 1DDMA 2GUMA 2KIGA 4HATB 1KZGA 5KQ1A 4B6HA 4K81A 4NSWA 5C5BB 2E2XA 4PNKA 3PEGA 4DIXA 2DA0A 2CY5A 4KAXB 2D9XA 1FB8A 3D8FA 2VKIA 1LB1A 2LYDA 2D10A 2PZ1A 3V5WA 3FVCA 2COCA 5M4YB 2Y8GA 2NMBA 3DXCA 4TYZA 4EJNA 3OANA 2RLOA 4QXAB 4A6HA 2QKMA 4GNKB 1M7EA 2KGXB 3KRXA 4DX8A 1I2HA 2KUQA 2DHJA 1FHOA 2DYQA 5HE3A 2Z59A 3ODXA 2DN6A 2DLWA 4Z2NA 1X1FA 2OQBA 4P7IA 1V89A 2D9ZA 2MKRA 3TW1A 1K5GB 3HSAA 4H8SA 3ML4A 5D3VA 3NW8A 3TO1A 2Z13A 4HSIA 3PVLA 2Z14A 4CHJA 2ZKMX 4OT1A 1U5GA 2LULA 3HQCA 1WJMA 1ZSQA 1DDVA 1ZVRA 2GS0A 2I5CA 3KSYA 4QJ3B 4HAXB 5C79A 1BTKA 3SUZA 2YVCA 2YSZA 2J0KA 2YT1A 1K5DB 1QC6A 4HB3B 2CAYA 4F7HA 3KY9A 1MPHA 1Q67A 2G35A 2I5FA 1E5WA 2Z0OA 5DH9B 3SV1A 4D0NB 5GOWB 1UEFA 2GJYA 1WJ1A 2KIEA 3LJUX 1TJ6A 2EC1A 2AL6A 2D2QA 1U2BA 2J0MA 2V76A 2W2WA 1EGXA 3GYOA 1W1DA 1U29A 1UPQA 1H10A 2DKPA 2LG1A 2UZRA 2N23A 3ULCA 2YT0A 1NTVA 1SGHA 3A58A 2UZSA 1MAIA 1XD4A 2EJ8A 5D3YA 3ULBA 3AU4A 1DROA 3SO6A 1ZYIA 1XX0A 4KHAA 3NSUA 2W2XD 3AU5A 5KQ4A 4DXAB 4GMVA 2JP2A 1MK9B 2DHIA 1TXDA 4ZRJA 2LKOA 4YONA 2CY4A 4GXBA 3QBVB 1EVHA 4WJ7A 5I2MA 2J59M 2RUKB 2J0JA 1V5UA 5DIFB 4HB0B 1V61A 5JP4A 3WYFB 3U12A 1B55A 1Y5OA 2CRFA 1WGQA 2D11A 4D6WA 5JLJB 2R09A 3HK0A 1FGYA 1PFJA 3NWDA 5JHGA 3PSCA 2GCJA 4ZRIA 1EF1A 1XR0B 4EMOA 4MY6A 1ZM0A 4DX90 3D8EA 4F7UP 1AQCA 1RJ2A 4IAPA 3HIEA 3X23A 3M1IB 2X18A 5D3WA 4CSQA 3A8PA 4K2OA 2COFA 5DHFB 2N0YA 4XWXA 5L81A 1GC7A 2Y7BA 4HB4B 2H7DA 4OSNA 2RSGA 2DYNA 1FHWA 1J0WA 2M38A 1RRPB 2IYBA 3N7CA 1U5EA 4WVFB 1XODA 1H4RA 1SHCA 3ZVRA 2YF0A 2ADZA 5DHAB 2D4QA 3A8QA 2P0FA 3G9WA 3P7ZA 1OQNA 1W1HA 3MPXA 2VSZA 3P6AA 4L1RA 5FI0A 1ZC4B 4K17A 5CLLB 5C16A 1M7RA 2Z0QA 2ELAA 2R0DA 2RVBB 5LONB 2RRFA 5FI1A 3FEHA 1TQZA 1J19A 1UNRA 1I7AA 3DXEA 2AEHA 3A98B 3IVFA 1LW3A 1T77A 4C0AA 2L2IA 3OHMB 3U7DA 1BWNA 4HAYB 5HE2A 1P3RA 3UZTA 4EKUA 4IFSA 5DI9B 2YS3A 4IOYX 2P8VA 2ROVA 5J3QA 2LOXA 1U5DA 4QJ5B 2K49A 1EAZA 2YRYA 3NWFA 5LOPB 2ZPYA 1N3HA 5C6RA 4BBKA 3KZ1A 3F0WA 1P5TA 1IRSA 2HE7A 3WA0A 2I1JA 5LG4B 3SNHA 4A6KA 4Y94A 1MK7B 4F7GA 4WSFA 4Z2MB 2YS1A 1FAOA 3AJ4A 4DBBA 5IRSA 2K2JA 2Y8FA 1DDWA 2D9WA 5D3XA 4CYEA 3FSSA 2QKLA 4GOUA 1BTNA 2KCJA 2YT2A 2COAA 1FOEA 1GC6A 2RNRB 2EMSA 5JHHA 2DHKA 2K8EA 3TVVA 1AWEA 1KZ7A 5I2SA 3DXDA 2NBVA 2ROZB 1PLSA 2FJUB 1MI1A 1ISNA 1ZC3B 4A6FA 4MK0A 1DYNA 1V5MA 1NU2A 2MDXA 5HE0A 2M14A 1WGUA 1OY2A 1MKEA 1W1GA 3PZDA 1XCGA 1NTYA 5J3TA 2P0HA 2EMTA 1Z87A 1KI1B 2K00A 3SYXA 3QIJA 1X05A 3HW2B 2KR0A 1WG7A 1OMWA 3PVWA 4HDOA 2I1KA 4QJ4B 3PVUA 1V88A 1WVHA 1MIXA 3ODOA 2KUPA 2MFQA 1UNPA 4PQ0A 1FHXA 1NI2A
chains in the Genus database with same CATH topology
3CIKA 3ZDTA 2UVMA 1XKEA 2DTCA 2DX5A 1X11A 2DX1A 2VRWB 4NY0A 4GN1A 1DBHA 2Q13A 3QWMA 1GG3A 4GMXB 2H7EA 3KRWA 1QQGA 4GPTB 4HHVA 1BAKA 3F5RA 3VIAA 3BJIA 1U5FA 1X86A 1Y19B 3ODWA 4HAUB 1PMSA 4HDQA 4A6FB 3PP2A 4YL8A 1FGZA 4GZUA 3CXBB 2YS5A 4HB2B 5CLQB 4A5KA 2L1CA 3BINA 2CODA 3D8DA 4CHMA 2MWNB 1U27A 4KHOA 1UPRA 2GCLA 1X1GA 2ELBA 3VOQA 3MDBC 3T06A 1V5PA 5D27A 4HAVB 5C5BA 3GYPA 2W2XC 2NZ8B 2BCJA 2XQNM 4KVGB 2OTXA 5KCVA 4KHBB 1UNQA 3TCAA 2Z0PA 4TKNA 4K2PA 3FM8C 2HTHB 2P0DA 2IFSA 4ZRKA 4L6EA 2RGNB 3O96A 1P6SA 2DFKA 2LOZA 5J3YA 2D9VA 2FJLA 2DKQA 4HAWB 2K2UA 3PG7A 4HAZB 1WI1A 5HE1A 5EFXA 2D9YA 3RCPA 3TFMA 3U8ZA 4MT7A 1MIZB 1DDMA 4HATB 1KZGA 5KQ1A 4B6HA 4K81A 4NSWA 5C5BB 2E2XA 4PNKA 3PEGA 2DA0A 2CY5A 4KAXB 2D9XA 1FB8A 3D8FA 2VKIA 1LB1A 2LYDA 2D10A 2PZ1A 3V5WA 2COCA 2Y8GA 2NMBA 3DXCA 4TYZA 4EJNA 3OANA 2RLOA 4A6HA 2QKMA 1M7EA 2KGXB 3KRXA 4DX8A 1I2HA 2DHJA 1FHOA 2DYQA 5HE3A 3ODXA 2DN6A 2DLWA 4Z2NA 1X1FA 2OQBA 4P7IA 1V89A 2D9ZA 2MKRA 3TW1A 1K5GB 4H8SA 3ML4A 5D3VA 3TO1A 3PVLA 4CHJA 1U5GA 2LULA 3HQCA 1WJMA 1ZSQA 1DDVA 1ZVRA 2GS0A 2I5CA 3KSYA 4HAXB 5C79A 1BTKA 3SUZA 2YVCA 2YSZA 2J0KA 2YT1A 1K5DB 1QC6A 4HB3B 2CAYA 4F7HA 3KY9A 1MPHA 1Q67A 2G35A 2I5FA 1E5WA 2Z0OA 5DH9B 3SV1A 4D0NB 5GOWB 1UEFA 2GJYA 1WJ1A 3LJUX 1TJ6A 2EC1A 2AL6A 2D2QA 1U2BA 2J0MA 2V76A 2W2WA 1EGXA 3GYOA 1W1DA 1U29A 1UPQA 1H10A 2DKPA 2LG1A 2UZRA 2N23A 3ULCA 2YT0A 1NTVA 1SGHA 2UZSA 1MAIA 1XD4A 2EJ8A 5D3YA 3ULBA 3AU4A 1DROA 3SO6A 1XX0A 4KHAA 3NSUA 2W2XD 3AU5A 5KQ4A 4DXAB 4GMVA 2JP2A 1MK9B 2DHIA 1TXDA 4ZRJA 2LKOA 4YONA 2CY4A 4GXBA 3QBVB 1EVHA 4WJ7A 2J59M 2RUKB 2J0JA 1V5UA 5DIFB 4HB0B 1V61A 5JP4A 3WYFB 1B55A 1Y5OA 2CRFA 1WGQA 2D11A 5JLJB 2R09A 3HK0A 1FGYA 1PFJA 5JHGA 3PSCA 2GCJA 4ZRIA 1EF1A 1XR0B 4EMOA 4MY6A 1ZM0A 4DX90 3D8EA 4F7UP 1AQCA 1RJ2A 4IAPA 3X23A 3M1IB 2X18A 5D3WA 3A8PA 4K2OA 2COFA 5DHFB 2N0YA 4XWXA 5L81A 1GC7A 2Y7BA 4HB4B 2H7DA 2RSGA 2DYNA 1FHWA 1J0WA 2M38A 1RRPB 2IYBA 3N7CA 1U5EA 4WVFB 1XODA 1H4RA 1SHCA 3ZVRA 2YF0A 2ADZA 5DHAB 2D4QA 3A8QA 2P0FA 3G9WA 3P7ZA 1OQNA 1W1HA 3MPXA 2VSZA 3P6AA 5FI0A 1ZC4B 4K17A 5CLLB 5C16A 1M7RA 2Z0QA 2ELAA 2R0DA 2RVBB 5LONB 5FI1A 3FEHA 1TQZA 1J19A 1UNRA 1I7AA 3DXEA 2AEHA 3A98B 3IVFA 1LW3A 4C0AA 2L2IA 3U7DA 1BWNA 4HAYB 5HE2A 1P3RA 3UZTA 4EKUA 4IFSA 5DI9B 2YS3A 4IOYX 2P8VA 2ROVA 5J3QA 2LOXA 1U5DA 1EAZA 2YRYA 5LOPB 2ZPYA 1N3HA 5C6RA 4BBKA 3KZ1A 3F0WA 1P5TA 1IRSA 2HE7A 3WA0A 2I1JA 3SNHA 4A6KA 4Y94A 1MK7B 4F7GA 4WSFA 4Z2MB 2YS1A 1FAOA 3AJ4A 4DBBA 2K2JA 2Y8FA 1DDWA 2D9WA 5D3XA 4CYEA 3FSSA 2QKLA 1BTNA 2KCJA 2COAA 1FOEA 1GC6A 2RNRB 2EMSA 5JHHA 2DHKA 3TVVA 1AWEA 1KZ7A 3DXDA 2ROZB 1PLSA 1ISNA 1ZC3B 4A6FA 4MK0A 1DYNA 1V5MA 1NU2A 2MDXA 5HE0A 2M14A 1WGUA 1OY2A 1MKEA 1W1GA 3PZDA 1XCGA 1NTYA 5J3TA 2P0HA 2EMTA 1Z87A 1KI1B 2K00A 3SYXA 3QIJA 1X05A 3HW2B 1WG7A 1OMWA 3PVWA 4HDOA 2I1KA 3PVUA 1V88A 1WVHA 1MIXA 3ODOA 2KUPA 2MFQA 1UNPA 4PQ0A 1FHXA 1NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK A;  3ZDT A;  2UVM A;  1XKE A;  2DTC A;  2DX5 A;  1X11 A;  2DX1 A;  2VRW B;  4NY0 A;  4GN1 A;  1DBH A;  2Q13 A;  3QWM A;  1GG3 A;  4GMX B;  2H7E A;  3KRW A;  1QQG A;  4GPT B;  4HHV A;  1BAK A;  3F5R A;  3VIA A;  3BJI A;  1U5F A;  1X86 A;  1Y19 B;  3ODW A;  4HAU B;  1PMS A;  4HDQ A;  4A6F B;  3PP2 A;  4YL8 A;  1FGZ A;  4GZU A;  3CXB B;  2YS5 A;  4HB2 B;  5CLQ B;  4A5K A;  2L1C A;  3BIN A;  2COD A;  3D8D A;  4CHM A;  2MWN B;  1U27 A;  4KHO A;  1UPR A;  2GCL A;  1X1G A;  2ELB A;  3VOQ A;  3MDB C;  3T06 A;  1V5P A;  5D27 A;  4HAV B;  5C5B A;  3GYP A;  2W2X C;  2NZ8 B;  2BCJ A;  2XQN M;  4KVG B;  2OTX A;  5KCV A;  4KHB B;  1UNQ A;  3TCA A;  2Z0P A;  4TKN A;  4K2P A;  3FM8 C;  2HTH B;  2P0D A;  2IFS A;  4ZRK A;  4L6E A;  2RGN B;  3O96 A;  1P6S A;  2DFK A;  2LOZ A;  5J3Y A;  2D9V A;  2FJL A;  2DKQ A;  4HAW B;  2K2U A;  3PG7 A;  4HAZ B;  1WI1 A;  5HE1 A;  5EFX A;  2D9Y A;  3RCP A;  3TFM A;  3U8Z A;  4MT7 A;  1MIZ B;  1DDM A;  4HAT B;  1KZG A;  5KQ1 A;  4B6H A;  4K81 A;  4NSW A;  5C5B B;  2E2X A;  4PNK A;  3PEG A;  2DA0 A;  2CY5 A;  4KAX B;  2D9X A;  1FB8 A;  3D8F A;  2VKI A;  1LB1 A;  2LYD A;  2D10 A;  2PZ1 A;  3V5W A;  2COC A;  2Y8G A;  2NMB A;  3DXC A;  4TYZ A;  4EJN A;  3OAN A;  2RLO A;  4A6H A;  2QKM A;  1M7E A;  2KGX B;  3KRX A;  4DX8 A;  1I2H A;  2DHJ A;  1FHO A;  2DYQ A;  5HE3 A;  3ODX A;  2DN6 A;  2DLW A;  4Z2N A;  1X1F A;  2OQB A;  4P7I A;  1V89 A;  2D9Z A;  2MKR A;  3TW1 A;  1K5G B;  4H8S A;  3ML4 A;  5D3V A;  3TO1 A;  3PVL A;  4CHJ A;  1U5G A;  2LUL A;  3HQC A;  1WJM A;  1ZSQ A;  1DDV A;  1ZVR A;  2GS0 A;  2I5C A;  3KSY A;  4HAX B;  5C79 A;  1BTK A;  3SUZ A;  2YVC A;  2YSZ A;  2J0K A;  2YT1 A;  1K5D B;  1QC6 A;  4HB3 B;  2CAY A;  4F7H A;  3KY9 A;  1MPH A;  1Q67 A;  2G35 A;  2I5F A;  1E5W A;  2Z0O A;  5DH9 B;  3SV1 A;  4D0N B;  5GOW B;  1UEF A;  2GJY A;  1WJ1 A;  3LJU X;  1TJ6 A;  2EC1 A;  2AL6 A;  2D2Q A;  1U2B A;  2J0M A;  2V76 A;  2W2W A;  1EGX A;  3GYO A;  1W1D A;  1U29 A;  1UPQ A;  1H10 A;  2DKP A;  2LG1 A;  2UZR A;  2N23 A;  3ULC A;  2YT0 A;  1NTV A;  1SGH A;  2UZS A;  1MAI A;  1XD4 A;  2EJ8 A;  5D3Y A;  3ULB A;  3AU4 A;  1DRO A;  3SO6 A;  1XX0 A;  4KHA A;  3NSU A;  2W2X D;  3AU5 A;  5KQ4 A;  4DXA B;  4GMV A;  2JP2 A;  1MK9 B;  2DHI A;  1TXD A;  4ZRJ A;  2LKO A;  4YON A;  2CY4 A;  4GXB A;  3QBV B;  1EVH A;  4WJ7 A;  2J59 M;  2RUK B;  2J0J A;  1V5U A;  5DIF B;  4HB0 B;  1V61 A;  5JP4 A;  3WYF B;  1B55 A;  1Y5O A;  2CRF A;  1WGQ A;  2D11 A;  5JLJ B;  2R09 A;  3HK0 A;  1FGY A;  1PFJ A;  5JHG A;  3PSC A;  2GCJ A;  4ZRI A;  1EF1 A;  1XR0 B;  4EMO A;  4MY6 A;  1ZM0 A;  4DX9 0;  3D8E A;  4F7U P;  1AQC A;  1RJ2 A;  4IAP A;  3X23 A;  3M1I B;  2X18 A;  5D3W A;  3A8P A;  4K2O A;  2COF A;  5DHF B;  2N0Y A;  4XWX A;  5L81 A;  1GC7 A;  2Y7B A;  4HB4 B;  2H7D A;  2RSG A;  2DYN A;  1FHW A;  1J0W A;  2M38 A;  1RRP B;  2IYB A;  3N7C A;  1U5E A;  4WVF B;  1XOD A;  1H4R A;  1SHC A;  3ZVR A;  2YF0 A;  2ADZ A;  5DHA B;  2D4Q A;  3A8Q A;  2P0F A;  3G9W A;  3P7Z A;  1OQN A;  1W1H A;  3MPX A;  2VSZ A;  3P6A A;  5FI0 A;  1ZC4 B;  4K17 A;  5CLL B;  5C16 A;  1M7R A;  2Z0Q A;  2ELA A;  2R0D A;  2RVB B;  5LON B;  5FI1 A;  3FEH A;  1TQZ A;  1J19 A;  1UNR A;  1I7A A;  3DXE A;  2AEH A;  3A98 B;  3IVF A;  1LW3 A;  4C0A A;  2L2I A;  3U7D A;  1BWN A;  4HAY B;  5HE2 A;  1P3R A;  3UZT A;  4EKU A;  4IFS A;  5DI9 B;  2YS3 A;  4IOY X;  2P8V A;  2ROV A;  5J3Q A;  2LOX A;  1U5D A;  1EAZ A;  2YRY A;  5LOP B;  2ZPY A;  1N3H A;  5C6R A;  4BBK A;  3KZ1 A;  3F0W A;  1P5T A;  1IRS A;  2HE7 A;  3WA0 A;  2I1J A;  3SNH A;  4A6K A;  4Y94 A;  1MK7 B;  4F7G A;  4WSF A;  4Z2M B;  2YS1 A;  1FAO A;  3AJ4 A;  4DBB A;  2K2J A;  2Y8F A;  1DDW A;  2D9W A;  5D3X A;  4CYE A;  3FSS A;  2QKL A;  1BTN A;  2KCJ A;  2COA A;  1FOE A;  1GC6 A;  2RNR B;  2EMS A;  5JHH A;  2DHK A;  3TVV A;  1AWE A;  1KZ7 A;  3DXD A;  2ROZ B;  1PLS A;  1ISN A;  1ZC3 B;  4A6F A;  4MK0 A;  1DYN A;  1V5M A;  1NU2 A;  2MDX A;  5HE0 A;  2M14 A;  1WGU A;  1OY2 A;  1MKE A;  1W1G A;  3PZD A;  1XCG A;  1NTY A;  5J3T A;  2P0H A;  2EMT A;  1Z87 A;  1KI1 B;  2K00 A;  3SYX A;  3QIJ A;  1X05 A;  3HW2 B;  1WG7 A;  1OMW A;  3PVW A;  4HDO A;  2I1K A;  3PVU A;  1V88 A;  1WVH A;  1MIX A;  3ODO A;  2KUP A;  2MFQ A;  1UNP A;  4PQ0 A;  1FHX A;  1NI2 A; 
#chains in the Genus database with same CATH topology
 3CIK A;  3ZDT A;  2UVM A;  1XKE A;  2DTC A;  2DX5 A;  1X11 A;  2DX1 A;  2VRW B;  4NY0 A;  4GN1 A;  3DCX A;  4KHB A;  1DBH A;  2Q13 A;  3QWM A;  1GG3 A;  4GMX B;  2H7E A;  3KRW A;  1QQG A;  4GPT B;  4HHV A;  1BAK A;  3F5R A;  3VIA A;  3BJI A;  1U5F A;  1X86 A;  1Y19 B;  3ODW A;  4HAU B;  1PMS A;  2Z4D A;  4HDQ A;  4A6F B;  3PP2 A;  4YL8 A;  1FGZ A;  3NWA A;  4GZU A;  3CXB B;  2YS5 A;  4HB2 B;  5CLQ B;  4A5K A;  2L1C A;  3BIN A;  2COD A;  3D8D A;  4CHM A;  2MWN B;  1U27 A;  4KHO A;  1UPR A;  2GCL A;  1X1G A;  2ELB A;  3VOQ A;  3MDB C;  3T06 A;  1V5P A;  5D27 A;  4HAV B;  5C5B A;  3GYP A;  2W2X C;  3B77 A;  2NZ8 B;  2BCJ A;  2XQN M;  4KVG B;  2OTX A;  5KCV A;  4KHB B;  1UNQ A;  3TCA A;  2Z0P A;  4TKN A;  4K2P A;  3FM8 C;  2HTH B;  2P0D A;  2IFS A;  4ZRK A;  4L6E A;  2RGN B;  3O96 A;  1P6S A;  2DFK A;  2LOZ A;  5J3Y A;  2D9V A;  2FJL A;  2DKQ A;  4HAW B;  2K2U A;  3PG7 A;  4HAZ B;  2R2Y A;  1WI1 A;  5HE1 A;  5EFX A;  2D9Y A;  3RCP A;  3TFM A;  3U8Z A;  4MT7 A;  1MIZ B;  1DDM A;  2GUM A;  2KIG A;  4HAT B;  1KZG A;  5KQ1 A;  4B6H A;  4K81 A;  4NSW A;  5C5B B;  2E2X A;  4PNK A;  3PEG A;  4DIX A;  2DA0 A;  2CY5 A;  4KAX B;  2D9X A;  1FB8 A;  3D8F A;  2VKI A;  1LB1 A;  2LYD A;  2D10 A;  2PZ1 A;  3V5W A;  3FVC A;  2COC A;  5M4Y B;  2Y8G A;  2NMB A;  3DXC A;  4TYZ A;  4EJN A;  3OAN A;  2RLO A;  4QXA B;  4A6H A;  2QKM A;  4GNK B;  1M7E A;  2KGX B;  3KRX A;  4DX8 A;  1I2H A;  2KUQ A;  2DHJ A;  1FHO A;  2DYQ A;  5HE3 A;  2Z59 A;  3ODX A;  2DN6 A;  2DLW A;  4Z2N A;  1X1F A;  2OQB A;  4P7I A;  1V89 A;  2D9Z A;  2MKR A;  3TW1 A;  1K5G B;  3HSA A;  4H8S A;  3ML4 A;  5D3V A;  3NW8 A;  3TO1 A;  2Z13 A;  4HSI A;  3PVL A;  2Z14 A;  4CHJ A;  2ZKM X;  4OT1 A;  1U5G A;  2LUL A;  3HQC A;  1WJM A;  1ZSQ A;  1DDV A;  1ZVR A;  2GS0 A;  2I5C A;  3KSY A;  4QJ3 B;  4HAX B;  5C79 A;  1BTK A;  3SUZ A;  2YVC A;  2YSZ A;  2J0K A;  2YT1 A;  1K5D B;  1QC6 A;  4HB3 B;  2CAY A;  4F7H A;  3KY9 A;  1MPH A;  1Q67 A;  2G35 A;  2I5F A;  1E5W A;  2Z0O A;  5DH9 B;  3SV1 A;  4D0N B;  5GOW B;  1UEF A;  2GJY A;  1WJ1 A;  2KIE A;  3LJU X;  1TJ6 A;  2EC1 A;  2AL6 A;  2D2Q A;  1U2B A;  2J0M A;  2V76 A;  2W2W A;  1EGX A;  3GYO A;  1W1D A;  1U29 A;  1UPQ A;  1H10 A;  2DKP A;  2LG1 A;  2UZR A;  2N23 A;  3ULC A;  2YT0 A;  1NTV A;  1SGH A;  3A58 A;  2UZS A;  1MAI A;  1XD4 A;  2EJ8 A;  5D3Y A;  3ULB A;  3AU4 A;  1DRO A;  3SO6 A;  1ZYI A;  1XX0 A;  4KHA A;  3NSU A;  2W2X D;  3AU5 A;  5KQ4 A;  4DXA B;  4GMV A;  2JP2 A;  1MK9 B;  2DHI A;  1TXD A;  4ZRJ A;  2LKO A;  4YON A;  2CY4 A;  4GXB A;  3QBV B;  1EVH A;  4WJ7 A;  5I2M A;  2J59 M;  2RUK B;  2J0J A;  1V5U A;  5DIF B;  4HB0 B;  1V61 A;  5JP4 A;  3WYF B;  3U12 A;  1B55 A;  1Y5O A;  2CRF A;  1WGQ A;  2D11 A;  4D6W A;  5JLJ B;  2R09 A;  3HK0 A;  1FGY A;  1PFJ A;  3NWD A;  5JHG A;  3PSC A;  2GCJ A;  4ZRI A;  1EF1 A;  1XR0 B;  4EMO A;  4MY6 A;  1ZM0 A;  4DX9 0;  3D8E A;  4F7U P;  1AQC A;  1RJ2 A;  4IAP A;  3HIE A;  3X23 A;  3M1I B;  2X18 A;  5D3W A;  4CSQ A;  3A8P A;  4K2O A;  2COF A;  5DHF B;  2N0Y A;  4XWX A;  5L81 A;  1GC7 A;  2Y7B A;  4HB4 B;  2H7D A;  4OSN A;  2RSG A;  2DYN A;  1FHW A;  1J0W A;  2M38 A;  1RRP B;  2IYB A;  3N7C A;  1U5E A;  4WVF B;  1XOD A;  1H4R A;  1SHC A;  3ZVR A;  2YF0 A;  2ADZ A;  5DHA B;  2D4Q A;  3A8Q A;  2P0F A;  3G9W A;  3P7Z A;  1OQN A;  1W1H A;  3MPX A;  2VSZ A;  3P6A A;  4L1R A;  5FI0 A;  1ZC4 B;  4K17 A;  5CLL B;  5C16 A;  1M7R A;  2Z0Q A;  2ELA A;  2R0D A;  2RVB B;  5LON B;  2RRF A;  5FI1 A;  3FEH A;  1TQZ A;  1J19 A;  1UNR A;  1I7A A;  3DXE A;  2AEH A;  3A98 B;  3IVF A;  1LW3 A;  1T77 A;  4C0A A;  2L2I A;  3OHM B;  3U7D A;  1BWN A;  4HAY B;  5HE2 A;  1P3R A;  3UZT A;  4EKU A;  4IFS A;  5DI9 B;  2YS3 A;  4IOY X;  2P8V A;  2ROV A;  5J3Q A;  2LOX A;  1U5D A;  4QJ5 B;  2K49 A;  1EAZ A;  2YRY A;  3NWF A;  5LOP B;  2ZPY A;  1N3H A;  5C6R A;  4BBK A;  3KZ1 A;  3F0W A;  1P5T A;  1IRS A;  2HE7 A;  3WA0 A;  2I1J A;  5LG4 B;  3SNH A;  4A6K A;  4Y94 A;  1MK7 B;  4F7G A;  4WSF A;  4Z2M B;  2YS1 A;  1FAO A;  3AJ4 A;  4DBB A;  5IRS A;  2K2J A;  2Y8F A;  1DDW A;  2D9W A;  5D3X A;  4CYE A;  3FSS A;  2QKL A;  4GOU A;  1BTN A;  2KCJ A;  2YT2 A;  2COA A;  1FOE A;  1GC6 A;  2RNR B;  2EMS A;  5JHH A;  2DHK A;  2K8E A;  3TVV A;  1AWE A;  1KZ7 A;  5I2S A;  3DXD A;  2NBV A;  2ROZ B;  1PLS A;  2FJU B;  1MI1 A;  1ISN A;  1ZC3 B;  4A6F A;  4MK0 A;  1DYN A;  1V5M A;  1NU2 A;  2MDX A;  5HE0 A;  2M14 A;  1WGU A;  1OY2 A;  1MKE A;  1W1G A;  3PZD A;  1XCG A;  1NTY A;  5J3T A;  2P0H A;  2EMT A;  1Z87 A;  1KI1 B;  2K00 A;  3SYX A;  3QIJ A;  1X05 A;  3HW2 B;  2KR0 A;  1WG7 A;  1OMW A;  3PVW A;  4HDO A;  2I1K A;  4QJ4 B;  3PVU A;  1V88 A;  1WVH A;  1MIX A;  3ODO A;  2KUP A;  2MFQ A;  1UNP A;  4PQ0 A;  1FHX A;  1NI2 A; 
#chains in the Genus database with same CATH homology
 3CIK A;  3ZDT A;  2UVM A;  1XKE A;  2DTC A;  2DX5 A;  1X11 A;  2DX1 A;  2VRW B;  4NY0 A;  4GN1 A;  1DBH A;  2Q13 A;  3QWM A;  1GG3 A;  4GMX B;  2H7E A;  3KRW A;  1QQG A;  4GPT B;  4HHV A;  1BAK A;  3F5R A;  3VIA A;  3BJI A;  1U5F A;  1X86 A;  1Y19 B;  3ODW A;  4HAU B;  1PMS A;  4HDQ A;  4A6F B;  3PP2 A;  4YL8 A;  1FGZ A;  4GZU A;  3CXB B;  2YS5 A;  4HB2 B;  5CLQ B;  4A5K A;  2L1C A;  3BIN A;  2COD A;  3D8D A;  4CHM A;  2MWN B;  1U27 A;  4KHO A;  1UPR A;  2GCL A;  1X1G A;  2ELB A;  3VOQ A;  3MDB C;  3T06 A;  1V5P A;  5D27 A;  4HAV B;  5C5B A;  3GYP A;  2W2X C;  2NZ8 B;  2BCJ A;  2XQN M;  4KVG B;  2OTX A;  5KCV A;  4KHB B;  1UNQ A;  3TCA A;  2Z0P A;  4TKN A;  4K2P A;  3FM8 C;  2HTH B;  2P0D A;  2IFS A;  4ZRK A;  4L6E A;  2RGN B;  3O96 A;  1P6S A;  2DFK A;  2LOZ A;  5J3Y A;  2D9V A;  2FJL A;  2DKQ A;  4HAW B;  2K2U A;  3PG7 A;  4HAZ B;  1WI1 A;  5HE1 A;  5EFX A;  2D9Y A;  3RCP A;  3TFM A;  3U8Z A;  4MT7 A;  1MIZ B;  1DDM A;  4HAT B;  1KZG A;  5KQ1 A;  4B6H A;  4K81 A;  4NSW A;  5C5B B;  2E2X A;  4PNK A;  3PEG A;  2DA0 A;  2CY5 A;  4KAX B;  2D9X A;  1FB8 A;  3D8F A;  2VKI A;  1LB1 A;  2LYD A;  2D10 A;  2PZ1 A;  3V5W A;  2COC A;  2Y8G A;  2NMB A;  3DXC A;  4TYZ A;  4EJN A;  3OAN A;  2RLO A;  4A6H A;  2QKM A;  1M7E A;  2KGX B;  3KRX A;  4DX8 A;  1I2H A;  2DHJ A;  1FHO A;  2DYQ A;  5HE3 A;  3ODX A;  2DN6 A;  2DLW A;  4Z2N A;  1X1F A;  2OQB A;  4P7I A;  1V89 A;  2D9Z A;  2MKR A;  3TW1 A;  1K5G B;  4H8S A;  3ML4 A;  5D3V A;  3TO1 A;  3PVL A;  4CHJ A;  1U5G A;  2LUL A;  3HQC A;  1WJM A;  1ZSQ A;  1DDV A;  1ZVR A;  2GS0 A;  2I5C A;  3KSY A;  4HAX B;  5C79 A;  1BTK A;  3SUZ A;  2YVC A;  2YSZ A;  2J0K A;  2YT1 A;  1K5D B;  1QC6 A;  4HB3 B;  2CAY A;  4F7H A;  3KY9 A;  1MPH A;  1Q67 A;  2G35 A;  2I5F A;  1E5W A;  2Z0O A;  5DH9 B;  3SV1 A;  4D0N B;  5GOW B;  1UEF A;  2GJY A;  1WJ1 A;  3LJU X;  1TJ6 A;  2EC1 A;  2AL6 A;  2D2Q A;  1U2B A;  2J0M A;  2V76 A;  2W2W A;  1EGX A;  3GYO A;  1W1D A;  1U29 A;  1UPQ A;  1H10 A;  2DKP A;  2LG1 A;  2UZR A;  2N23 A;  3ULC A;  2YT0 A;  1NTV A;  1SGH A;  2UZS A;  1MAI A;  1XD4 A;  2EJ8 A;  5D3Y A;  3ULB A;  3AU4 A;  1DRO A;  3SO6 A;  1XX0 A;  4KHA A;  3NSU A;  2W2X D;  3AU5 A;  5KQ4 A;  4DXA B;  4GMV A;  2JP2 A;  1MK9 B;  2DHI A;  1TXD A;  4ZRJ A;  2LKO A;  4YON A;  2CY4 A;  4GXB A;  3QBV B;  1EVH A;  4WJ7 A;  2J59 M;  2RUK B;  2J0J A;  1V5U A;  5DIF B;  4HB0 B;  1V61 A;  5JP4 A;  3WYF B;  1B55 A;  1Y5O A;  2CRF A;  1WGQ A;  2D11 A;  5JLJ B;  2R09 A;  3HK0 A;  1FGY A;  1PFJ A;  5JHG A;  3PSC A;  2GCJ A;  4ZRI A;  1EF1 A;  1XR0 B;  4EMO A;  4MY6 A;  1ZM0 A;  4DX9 0;  3D8E A;  4F7U P;  1AQC A;  1RJ2 A;  4IAP A;  3X23 A;  3M1I B;  2X18 A;  5D3W A;  3A8P A;  4K2O A;  2COF A;  5DHF B;  2N0Y A;  4XWX A;  5L81 A;  1GC7 A;  2Y7B A;  4HB4 B;  2H7D A;  2RSG A;  2DYN A;  1FHW A;  1J0W A;  2M38 A;  1RRP B;  2IYB A;  3N7C A;  1U5E A;  4WVF B;  1XOD A;  1H4R A;  1SHC A;  3ZVR A;  2YF0 A;  2ADZ A;  5DHA B;  2D4Q A;  3A8Q A;  2P0F A;  3G9W A;  3P7Z A;  1OQN A;  1W1H A;  3MPX A;  2VSZ A;  3P6A A;  5FI0 A;  1ZC4 B;  4K17 A;  5CLL B;  5C16 A;  1M7R A;  2Z0Q A;  2ELA A;  2R0D A;  2RVB B;  5LON B;  5FI1 A;  3FEH A;  1TQZ A;  1J19 A;  1UNR A;  1I7A A;  3DXE A;  2AEH A;  3A98 B;  3IVF A;  1LW3 A;  4C0A A;  2L2I A;  3U7D A;  1BWN A;  4HAY B;  5HE2 A;  1P3R A;  3UZT A;  4EKU A;  4IFS A;  5DI9 B;  2YS3 A;  4IOY X;  2P8V A;  2ROV A;  5J3Q A;  2LOX A;  1U5D A;  1EAZ A;  2YRY A;  5LOP B;  2ZPY A;  1N3H A;  5C6R A;  4BBK A;  3KZ1 A;  3F0W A;  1P5T A;  1IRS A;  2HE7 A;  3WA0 A;  2I1J A;  3SNH A;  4A6K A;  4Y94 A;  1MK7 B;  4F7G A;  4WSF A;  4Z2M B;  2YS1 A;  1FAO A;  3AJ4 A;  4DBB A;  2K2J A;  2Y8F A;  1DDW A;  2D9W A;  5D3X A;  4CYE A;  3FSS A;  2QKL A;  1BTN A;  2KCJ A;  2COA A;  1FOE A;  1GC6 A;  2RNR B;  2EMS A;  5JHH A;  2DHK A;  3TVV A;  1AWE A;  1KZ7 A;  3DXD A;  2ROZ B;  1PLS A;  1ISN A;  1ZC3 B;  4A6F A;  4MK0 A;  1DYN A;  1V5M A;  1NU2 A;  2MDX A;  5HE0 A;  2M14 A;  1WGU A;  1OY2 A;  1MKE A;  1W1G A;  3PZD A;  1XCG A;  1NTY A;  5J3T A;  2P0H A;  2EMT A;  1Z87 A;  1KI1 B;  2K00 A;  3SYX A;  3QIJ A;  1X05 A;  3HW2 B;  1WG7 A;  1OMW A;  3PVW A;  4HDO A;  2I1K A;  3PVU A;  1V88 A;  1WVH A;  1MIX A;  3ODO A;  2KUP A;  2MFQ A;  1UNP A;  4PQ0 A;  1FHX A;  1NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...