4A6FB

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
110
Chain Sequence
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSTGSDAKFVLHAKQNIIGHNYVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 22
structure length 110
sequence length 116
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fB00
4F7HA 4GPTB 3QWMA 2QKLA 1OQNA 2D9WA 3F0WA 3PG7A 1X1GA 3P7ZA 1ZC3B 1P5TA 2I1KA 2J0KA 2COFA 4HAYB 4KAXB 2ELAA 4KHOA 1H4RA 4GZUA 3HQCA 4ZRJA 2ROVA 2H7DA 2NZ8B 1FHOA 3D8EA 1TXDA 2EMTA 2RVBB 5J3QA 1V89A 1V88A 4HB0B 2MKRA 2Z0PA 4WSFA 3TO1A 2DA0A 2DN6A 1X11A 3GYOA 2RSGA 4A6KA 1MK7B 3PP2A 4A5KA 3DXCA 2D9XA 2YS5A 3X23A 4K2OA 3KY9A 1WVHA 3SO6A 1DBHA 1N3HA 3WYFB 1TQZA 3RCPA 1MIXA 4EJNA 4Z2NA 1U5FA 4GMVA 3ULCA 2I5CA 2KGXB 1X1FA 4K81A 2DX5A 2EJ8A 4PNKA 2LULA 2KUPA 4HAZB 4WJ7A 1W1GA 2R0DA 2M38A 3PVWA 4DX8A 2AL6A 1EVHA 2GCJA 4K17A 5C6RA 1W1HA 2YS1A 3PVUA 3V5WA 2HE7A 1FHWA 2LOZA 1UNPA 1UPRA 1QC6A 2D9YA 2RGNB 3F5RA 1XR0B 3UZTA 2COAA 5CLLB 2QKMA 3A8QA 1NTVA 4GMXB 3FSSA 4XWXA 5FI0A 5D27A 3BINA 5D3WA 3AJ4A 1MK9B 3TVVA 1PFJA 1ZC4B 2EC1A 1NU2A 4Y94A 3BJIA 4HHVA 2D9ZA 2P0DA 1P3RA 4IFSA 1FHXA 4GXBA 3PZDA 3OANA 1BAKA 2D11A 3VOQA 3A98B 4HB2B 1U5GA 1UNRA 2V76A 1K5DB 5GOWB 3DXDA 4K2PA 3M1IB 4HB3B 3SV1A 3ODWA 4HB4B 2NMBA 2YRYA 2Y7BA 4D0NB 4HDQA 3GYPA 4A6FA 3TW1A 3HK0A 1M7RA 3KRWA 1ZVRA 2GCLA 2GJYA 5CLQB 2N0YA 3P6AA 4IAPA 5DHFB 2VRWB 1E5WA 1V5PA 3ZDTA 1Q67A 3ODOA 4DXAB 4CHJA 2CODA 2DX1A 2YT0A 2YVCA 1J0WA 1WGUA 1DROA 4H8SA 5JHGA 2DTCA 4KHAA 5JLJB 5HE0A 1Y19B 5LOPB 2ELBA 2J0JA 2RUKB 3MPXA 5JP4A 4EMOA 3FEHA 5HE3A 2DHKA 2Y8GA 2R09A 5KCVA 2N23A 1AWEA 3KSYA 2XQNM 4CHMA 2DYNA 1LW3A 2YF0A 2D10A 5HE2A 1SHCA 3TFMA 2LYDA 4YONA 3CXBB 1OMWA 1XD4A 4A6HA 4ZRIA 5KQ1A 5L81A 1ZM0A 4HAXB 1GG3A 3U7DA 4BBKA 2OQBA 1FGYA 1MPHA 1MAIA 3ML4A 1AQCA 2X18A 2K2UA 3WA0A 1U2BA 5D3YA 1QQGA 4GN1A 2K00A 1U29A 1BTKA 1FAOA 1WJMA 1U5EA 4ZRKA 3FM8C 1W1DA 2EMSA 5C16A 2H7EA 4MT7A 3AU5A 4NY0A 1TJ6A 2L2IA 1DDVA 5C5BA 4HAWB 1DDWA 3SNHA 4HAUB 1ISNA 5J3YA 1PLSA 2HTHB 1WI1A 4MY6A 4PQ0A 4DX90 1GC7A 3D8DA 1X86A 1U27A 4MK0A 2ROZB 1XODA 3KZ1A 3KRXA 2YS3A 4A6FB 2DHJA 1EF1A 3ULBA 2MFQA 3D8FA 2Z0OA 2VSZA 5D3XA 2E2XA 2IYBA 2IFSA 1NI2A 4CYEA 1IRSA 3PSCA 1BTNA 5J3TA 2K2JA 5DHAB 2G35A 2J59M 2Q13A 3AU4A 3HW2B 2Y8FA 1B55A 2ADZA 5HE1A 3MDBC 3U8ZA 2DYQA 3ZVRA 3O96A 3QIJA 2CY4A 2FJLA 1Y5OA 2L1CA 1J19A 2CRFA 2W2WA 1PMSA 3CIKA 2Z0QA 1U5DA 2UZSA 3TCAA 1DYNA 2GS0A 2PZ1A 5D3VA 1H10A 3IVFA 5EFXA 1P6SA 2YT1A 2MDXA 1SGHA 2RNRB 1K5GB 1I2HA 3DXEA 2DKQA 1Z87A 2DHIA 3VIAA 1V61A 5LONB 4KHBB 5JHHA 3A8PA 3PVLA 4Z2MB 2LOXA 2MWNB 2W2XC 5DI9B 2OTXA 4NSWA 4F7GA 1FGZA 2BCJA 1MKEA 2DKPA 4F7UP 4DBBA 1BWNA 1X05A 1UEFA 4KVGB 2UVMA 2JP2A 2ZPYA 5KQ4A 2DFKA 1XCGA 4P7IA 2COCA 4EKUA 5C5BB 1V5MA 1LB1A 2UZRA 2RLOA 3ODXA 2DLWA 1NTYA 3PEGA 3SYXA 2CY5A 1XKEA 3QBVB 4WVFB 2KCJA 1WJ1A 2W2XD 4C0AA 4YL8A 2AEHA 1KZ7A 2M14A 1I7AA 1GC6A 1EGXA 5FI1A 3N7CA 1UNQA 2LG1A 2D2QA 4HAVB 3SUZA 1ZSQA 3G9WA 1MIZB 4L6EA 1KI1B 1FOEA 1KZGA 2VKIA 2P0HA 3T06A 1RJ2A 2P0FA 4TKNA 4TYZA 1M7EA 2D9VA 2P8VA 1OY2A 1DDMA 2J0MA 4HDOA 5DIFB 5DH9B 2CAYA 3NSUA 1WG7A 1FB8A 4B6HA 1V5UA 1RRPB 1EAZA 2D4QA 4HATB 2YSZA 3LJUX 2I1JA 1WGQA 4IOYX 5C79A 2LKOA 2I5FA 1XX0A 1UPQA
chains in the Genus database with same CATH superfamily
4F7HA 4GPTB 3NW8A 3QWMA 2QKLA 1OQNA 2D9WA 3F0WA 3NWFA 3PG7A 1X1GA 3P7ZA 1ZC3B 1P5TA 2I1KA 2J0KA 2COFA 4HAYB 4KAXB 2ELAA 4KHOA 1H4RA 4GZUA 3HQCA 4ZRJA 2ROVA 2H7DA 2NZ8B 1FHOA 3D8EA 1TXDA 5IRSA 2EMTA 2RVBB 5J3QA 1V89A 1V88A 4HB0B 2MKRA 2Z0PA 4WSFA 3TO1A 2DA0A 2DN6A 1X11A 3GYOA 2RSGA 4A6KA 1MK7B 3PP2A 4A5KA 3DXCA 2D9XA 2YS5A 2K8EA 3X23A 4K2OA 3KY9A 1WVHA 3SO6A 1DBHA 1N3HA 3WYFB 1TQZA 3RCPA 1MIXA 4EJNA 4Z2NA 1U5FA 4GMVA 3ULCA 2I5CA 2KGXB 1X1FA 4K81A 2DX5A 2EJ8A 4PNKA 2LULA 2KUPA 4HAZB 4WJ7A 1W1GA 2R0DA 2M38A 3PVWA 4DX8A 2AL6A 1EVHA 2GCJA 4K17A 5C6RA 1W1HA 2YS1A 3PVUA 3V5WA 2HE7A 1FHWA 2LOZA 1UNPA 1UPRA 1QC6A 2D9YA 2RGNB 3F5RA 1XR0B 3UZTA 2COAA 5CLLB 5I2SA 2QKMA 3A8QA 1NTVA 4GMXB 3FSSA 4XWXA 5FI0A 5D27A 4CSQA 3BINA 5D3WA 3AJ4A 1MK9B 4DIXA 3TVVA 1PFJA 1ZC4B 2EC1A 1NU2A 4GOUA 4QJ3B 4Y94A 3BJIA 4HHVA 2D9ZA 2P0DA 1P3RA 4IFSA 1FHXA 4GXBA 3PZDA 3OANA 1BAKA 2KUQA 2D11A 3VOQA 3A98B 4HB2B 1U5GA 1UNRA 2V76A 1K5DB 5GOWB 3DXDA 3HSAA 4K2PA 2R2YA 3M1IB 4HB3B 3U12A 3SV1A 3ODWA 4HB4B 2NMBA 2YRYA 2Y7BA 4D0NB 4HDQA 3GYPA 3HIEA 4A6FA 3TW1A 3HK0A 1M7RA 3KRWA 1ZVRA 2GCLA 2GJYA 5CLQB 2N0YA 3P6AA 2FJUB 4IAPA 5DHFB 2VRWB 1E5WA 1V5PA 3ZDTA 1Q67A 3ODOA 4DXAB 4CHJA 2CODA 2DX1A 2YT0A 2YVCA 1J0WA 1WGUA 5M4YB 1DROA 4GNKB 4H8SA 5JHGA 2DTCA 4KHAA 5JLJB 5HE0A 1Y19B 2Z4DA 5LOPB 2ELBA 2J0JA 2RUKB 3MPXA 5JP4A 4EMOA 3FEHA 5HE3A 2DHKA 2Y8GA 2K49A 2R09A 5KCVA 2N23A 1AWEA 2XQNM 3KSYA 4CHMA 2DYNA 1LW3A 2YF0A 2D10A 5HE2A 1SHCA 3TFMA 2LYDA 4YONA 3CXBB 1OMWA 1XD4A 4A6HA 4ZRIA 5KQ1A 5L81A 1ZM0A 2KR0A 4HAXB 4KHBA 1GG3A 3U7DA 4BBKA 2OQBA 1FGYA 1MPHA 1MAIA 4D6WA 3ML4A 1AQCA 2X18A 2K2UA 3DCXA 3WA0A 4QJ4B 2KIEA 1U2BA 5D3YA 1QQGA 4GN1A 2K00A 1U29A 2Z59A 1BTKA 1FAOA 4QXAB 1WJMA 1U5EA 4ZRKA 3FM8C 1W1DA 2EMSA 5C16A 2H7EA 4MT7A 3AU5A 4NY0A 1TJ6A 2L2IA 1DDVA 5C5BA 4HAWB 1DDWA 2Z13A 3SNHA 4HAUB 1ISNA 5J3YA 1PLSA 2HTHB 1WI1A 4MY6A 4PQ0A 4DX90 1GC7A 3D8DA 1X86A 2KIGA 1U27A 4MK0A 2ROZB 1XODA 3KZ1A 3KRXA 2YS3A 4A6FB 2DHJA 1EF1A 3ULBA 2MFQA 3D8FA 2Z0OA 2VSZA 5D3XA 2E2XA 2IYBA 2IFSA 1NI2A 4CYEA 1IRSA 3PSCA 1BTNA 2Z14A 5J3TA 3FVCA 2K2JA 5DHAB 2G35A 2J59M 2Q13A 3AU4A 3HW2B 2Y8FA 1B55A 2ADZA 5HE1A 3MDBC 3U8ZA 2DYQA 3ZVRA 3O96A 3QIJA 2CY4A 2FJLA 1Y5OA 2L1CA 1J19A 2CRFA 2W2WA 1PMSA 3CIKA 2ZKMX 2Z0QA 1U5DA 2UZSA 3TCAA 3B77A 1DYNA 4OT1A 2GS0A 2PZ1A 5D3VA 1H10A 3IVFA 5EFXA 1P6SA 2YT1A 2MDXA 1SGHA 2RNRB 1K5GB 1I2HA 3DXEA 3NWDA 2DKQA 2YT2A 1Z87A 2DHIA 3VIAA 1V61A 5LONB 4KHBB 5JHHA 3A8PA 3PVLA 4Z2MB 2LOXA 2MWNB 2W2XC 5DI9B 2OTXA 4NSWA 4F7GA 1FGZA 2BCJA 1MKEA 2DKPA 4F7UP 4DBBA 1BWNA 1X05A 1UEFA 4KVGB 2UVMA 5LG4B 1ZYIA 2JP2A 2ZPYA 5KQ4A 2DFKA 3A58A 1XCGA 2GUMA 4P7IA 2COCA 4EKUA 5C5BB 1V5MA 1LB1A 2UZRA 2RLOA 3ODXA 2DLWA 4QJ5B 1NTYA 3PEGA 3SYXA 2CY5A 1XKEA 3QBVB 4WVFB 2KCJA 1WJ1A 4OSNA 2W2XD 4C0AA 4YL8A 2AEHA 1KZ7A 2M14A 2NBVA 1I7AA 2RRFA 1GC6A 1EGXA 5FI1A 3N7CA 1UNQA 2LG1A 2D2QA 4HAVB 3SUZA 1ZSQA 3G9WA 1MIZB 4HSIA 4L6EA 1KI1B 1FOEA 1KZGA 2VKIA 3NWAA 2P0HA 1MI1A 3OHMB 3T06A 1RJ2A 2P0FA 4TKNA 4TYZA 1M7EA 2D9VA 2P8VA 1OY2A 1DDMA 2J0MA 4L1RA 4HDOA 5DIFB 5DH9B 2CAYA 3NSUA 1WG7A 1FB8A 4B6HA 5I2MA 1V5UA 1RRPB 1EAZA 2D4QA 4HATB 2YSZA 3LJUX 2I1JA 1WGQA 1T77A 4IOYX 5C79A 2LKOA 2I5FA 1XX0A 1UPQA
chains in the Genus database with same CATH topology
4F7HA 4GPTB 3QWMA 2QKLA 1OQNA 2D9WA 3F0WA 3PG7A 1X1GA 3P7ZA 1ZC3B 1P5TA 2I1KA 2J0KA 2COFA 4HAYB 4KAXB 2ELAA 4KHOA 1H4RA 4GZUA 3HQCA 4ZRJA 2ROVA 2H7DA 2NZ8B 1FHOA 3D8EA 1TXDA 2EMTA 2RVBB 5J3QA 1V89A 1V88A 4HB0B 2MKRA 2Z0PA 4WSFA 3TO1A 2DA0A 2DN6A 1X11A 3GYOA 2RSGA 4A6KA 1MK7B 3PP2A 4A5KA 3DXCA 2D9XA 2YS5A 3X23A 4K2OA 3KY9A 1WVHA 3SO6A 1DBHA 1N3HA 3WYFB 1TQZA 3RCPA 1MIXA 4EJNA 4Z2NA 1U5FA 4GMVA 3ULCA 2I5CA 2KGXB 1X1FA 4K81A 2DX5A 2EJ8A 4PNKA 2LULA 2KUPA 4HAZB 4WJ7A 1W1GA 2R0DA 2M38A 3PVWA 4DX8A 2AL6A 1EVHA 2GCJA 4K17A 5C6RA 1W1HA 2YS1A 3PVUA 3V5WA 2HE7A 1FHWA 2LOZA 1UNPA 1UPRA 1QC6A 2D9YA 2RGNB 3F5RA 1XR0B 3UZTA 2COAA 5CLLB 2QKMA 3A8QA 1NTVA 4GMXB 3FSSA 4XWXA 5FI0A 5D27A 3BINA 5D3WA 3AJ4A 1MK9B 3TVVA 1PFJA 1ZC4B 2EC1A 1NU2A 4Y94A 3BJIA 4HHVA 2D9ZA 2P0DA 1P3RA 4IFSA 1FHXA 4GXBA 3PZDA 3OANA 1BAKA 2D11A 3VOQA 3A98B 4HB2B 1U5GA 1UNRA 2V76A 1K5DB 5GOWB 3DXDA 4K2PA 3M1IB 4HB3B 3SV1A 3ODWA 4HB4B 2NMBA 2YRYA 2Y7BA 4D0NB 4HDQA 3GYPA 4A6FA 3TW1A 3HK0A 1M7RA 3KRWA 1ZVRA 2GCLA 2GJYA 5CLQB 2N0YA 3P6AA 4IAPA 5DHFB 2VRWB 1E5WA 1V5PA 3ZDTA 1Q67A 3ODOA 4DXAB 4CHJA 2CODA 2DX1A 2YT0A 2YVCA 1J0WA 1WGUA 1DROA 4H8SA 5JHGA 2DTCA 4KHAA 5JLJB 5HE0A 1Y19B 5LOPB 2ELBA 2J0JA 2RUKB 3MPXA 5JP4A 4EMOA 3FEHA 5HE3A 2DHKA 2Y8GA 2R09A 5KCVA 2N23A 1AWEA 3KSYA 2XQNM 4CHMA 2DYNA 1LW3A 2YF0A 2D10A 5HE2A 1SHCA 3TFMA 2LYDA 4YONA 3CXBB 1OMWA 1XD4A 4A6HA 4ZRIA 5KQ1A 5L81A 1ZM0A 4HAXB 1GG3A 3U7DA 4BBKA 2OQBA 1FGYA 1MPHA 1MAIA 3ML4A 1AQCA 2X18A 2K2UA 3WA0A 1U2BA 5D3YA 1QQGA 4GN1A 2K00A 1U29A 1BTKA 1FAOA 1WJMA 1U5EA 4ZRKA 3FM8C 1W1DA 2EMSA 5C16A 2H7EA 4MT7A 3AU5A 4NY0A 1TJ6A 2L2IA 1DDVA 5C5BA 4HAWB 1DDWA 3SNHA 4HAUB 1ISNA 5J3YA 1PLSA 2HTHB 1WI1A 4MY6A 4PQ0A 4DX90 1GC7A 3D8DA 1X86A 1U27A 4MK0A 2ROZB 1XODA 3KZ1A 3KRXA 2YS3A 4A6FB 2DHJA 1EF1A 3ULBA 2MFQA 3D8FA 2Z0OA 2VSZA 5D3XA 2E2XA 2IYBA 2IFSA 1NI2A 4CYEA 1IRSA 3PSCA 1BTNA 5J3TA 2K2JA 5DHAB 2G35A 2J59M 2Q13A 3AU4A 3HW2B 2Y8FA 1B55A 2ADZA 5HE1A 3MDBC 3U8ZA 2DYQA 3ZVRA 3O96A 3QIJA 2CY4A 2FJLA 1Y5OA 2L1CA 1J19A 2CRFA 2W2WA 1PMSA 3CIKA 2Z0QA 1U5DA 2UZSA 3TCAA 1DYNA 2GS0A 2PZ1A 5D3VA 1H10A 3IVFA 5EFXA 1P6SA 2YT1A 2MDXA 1SGHA 2RNRB 1K5GB 1I2HA 3DXEA 2DKQA 1Z87A 2DHIA 3VIAA 1V61A 5LONB 4KHBB 5JHHA 3A8PA 3PVLA 4Z2MB 2LOXA 2MWNB 2W2XC 5DI9B 2OTXA 4NSWA 4F7GA 1FGZA 2BCJA 1MKEA 2DKPA 4F7UP 4DBBA 1BWNA 1X05A 1UEFA 4KVGB 2UVMA 2JP2A 2ZPYA 5KQ4A 2DFKA 1XCGA 4P7IA 2COCA 4EKUA 5C5BB 1V5MA 1LB1A 2UZRA 2RLOA 3ODXA 2DLWA 1NTYA 3PEGA 3SYXA 2CY5A 1XKEA 3QBVB 4WVFB 2KCJA 1WJ1A 2W2XD 4C0AA 4YL8A 2AEHA 1KZ7A 2M14A 1I7AA 1GC6A 1EGXA 5FI1A 3N7CA 1UNQA 2LG1A 2D2QA 4HAVB 3SUZA 1ZSQA 3G9WA 1MIZB 4L6EA 1KI1B 1FOEA 1KZGA 2VKIA 2P0HA 3T06A 1RJ2A 2P0FA 4TKNA 4TYZA 1M7EA 2D9VA 2P8VA 1OY2A 1DDMA 2J0MA 4HDOA 5DIFB 5DH9B 2CAYA 3NSUA 1WG7A 1FB8A 4B6HA 1V5UA 1RRPB 1EAZA 2D4QA 4HATB 2YSZA 3LJUX 2I1JA 1WGQA 4IOYX 5C79A 2LKOA 2I5FA 1XX0A 1UPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7H A;  4GPT B;  3QWM A;  2QKL A;  1OQN A;  2D9W A;  3F0W A;  3PG7 A;  1X1G A;  3P7Z A;  1ZC3 B;  1P5T A;  2I1K A;  2J0K A;  2COF A;  4HAY B;  4KAX B;  2ELA A;  4KHO A;  1H4R A;  4GZU A;  3HQC A;  4ZRJ A;  2ROV A;  2H7D A;  2NZ8 B;  1FHO A;  3D8E A;  1TXD A;  2EMT A;  2RVB B;  5J3Q A;  1V89 A;  1V88 A;  4HB0 B;  2MKR A;  2Z0P A;  4WSF A;  3TO1 A;  2DA0 A;  2DN6 A;  1X11 A;  3GYO A;  2RSG A;  4A6K A;  1MK7 B;  3PP2 A;  4A5K A;  3DXC A;  2D9X A;  2YS5 A;  3X23 A;  4K2O A;  3KY9 A;  1WVH A;  3SO6 A;  1DBH A;  1N3H A;  3WYF B;  1TQZ A;  3RCP A;  1MIX A;  4EJN A;  4Z2N A;  1U5F A;  4GMV A;  3ULC A;  2I5C A;  2KGX B;  1X1F A;  4K81 A;  2DX5 A;  2EJ8 A;  4PNK A;  2LUL A;  2KUP A;  4HAZ B;  4WJ7 A;  1W1G A;  2R0D A;  2M38 A;  3PVW A;  4DX8 A;  2AL6 A;  1EVH A;  2GCJ A;  4K17 A;  5C6R A;  1W1H A;  2YS1 A;  3PVU A;  3V5W A;  2HE7 A;  1FHW A;  2LOZ A;  1UNP A;  1UPR A;  1QC6 A;  2D9Y A;  2RGN B;  3F5R A;  1XR0 B;  3UZT A;  2COA A;  5CLL B;  2QKM A;  3A8Q A;  1NTV A;  4GMX B;  3FSS A;  4XWX A;  5FI0 A;  5D27 A;  3BIN A;  5D3W A;  3AJ4 A;  1MK9 B;  3TVV A;  1PFJ A;  1ZC4 B;  2EC1 A;  1NU2 A;  4Y94 A;  3BJI A;  4HHV A;  2D9Z A;  2P0D A;  1P3R A;  4IFS A;  1FHX A;  4GXB A;  3PZD A;  3OAN A;  1BAK A;  2D11 A;  3VOQ A;  3A98 B;  4HB2 B;  1U5G A;  1UNR A;  2V76 A;  1K5D B;  5GOW B;  3DXD A;  4K2P A;  3M1I B;  4HB3 B;  3SV1 A;  3ODW A;  4HB4 B;  2NMB A;  2YRY A;  2Y7B A;  4D0N B;  4HDQ A;  3GYP A;  4A6F A;  3TW1 A;  3HK0 A;  1M7R A;  3KRW A;  1ZVR A;  2GCL A;  2GJY A;  5CLQ B;  2N0Y A;  3P6A A;  4IAP A;  5DHF B;  2VRW B;  1E5W A;  1V5P A;  3ZDT A;  1Q67 A;  3ODO A;  4DXA B;  4CHJ A;  2COD A;  2DX1 A;  2YT0 A;  2YVC A;  1J0W A;  1WGU A;  1DRO A;  4H8S A;  5JHG A;  2DTC A;  4KHA A;  5JLJ B;  5HE0 A;  1Y19 B;  5LOP B;  2ELB A;  2J0J A;  2RUK B;  3MPX A;  5JP4 A;  4EMO A;  3FEH A;  5HE3 A;  2DHK A;  2Y8G A;  2R09 A;  5KCV A;  2N23 A;  1AWE A;  3KSY A;  2XQN M;  4CHM A;  2DYN A;  1LW3 A;  2YF0 A;  2D10 A;  5HE2 A;  1SHC A;  3TFM A;  2LYD A;  4YON A;  3CXB B;  1OMW A;  1XD4 A;  4A6H A;  4ZRI A;  5KQ1 A;  5L81 A;  1ZM0 A;  4HAX B;  1GG3 A;  3U7D A;  4BBK A;  2OQB A;  1FGY A;  1MPH A;  1MAI A;  3ML4 A;  1AQC A;  2X18 A;  2K2U A;  3WA0 A;  1U2B A;  5D3Y A;  1QQG A;  4GN1 A;  2K00 A;  1U29 A;  1BTK A;  1FAO A;  1WJM A;  1U5E A;  4ZRK A;  3FM8 C;  1W1D A;  2EMS A;  5C16 A;  2H7E A;  4MT7 A;  3AU5 A;  4NY0 A;  1TJ6 A;  2L2I A;  1DDV A;  5C5B A;  4HAW B;  1DDW A;  3SNH A;  4HAU B;  1ISN A;  5J3Y A;  1PLS A;  2HTH B;  1WI1 A;  4MY6 A;  4PQ0 A;  4DX9 0;  1GC7 A;  3D8D A;  1X86 A;  1U27 A;  4MK0 A;  2ROZ B;  1XOD A;  3KZ1 A;  3KRX A;  2YS3 A;  4A6F B;  2DHJ A;  1EF1 A;  3ULB A;  2MFQ A;  3D8F A;  2Z0O A;  2VSZ A;  5D3X A;  2E2X A;  2IYB A;  2IFS A;  1NI2 A;  4CYE A;  1IRS A;  3PSC A;  1BTN A;  5J3T A;  2K2J A;  5DHA B;  2G35 A;  2J59 M;  2Q13 A;  3AU4 A;  3HW2 B;  2Y8F A;  1B55 A;  2ADZ A;  5HE1 A;  3MDB C;  3U8Z A;  2DYQ A;  3ZVR A;  3O96 A;  3QIJ A;  2CY4 A;  2FJL A;  1Y5O A;  2L1C A;  1J19 A;  2CRF A;  2W2W A;  1PMS A;  3CIK A;  2Z0Q A;  1U5D A;  2UZS A;  3TCA A;  1DYN A;  2GS0 A;  2PZ1 A;  5D3V A;  1H10 A;  3IVF A;  5EFX A;  1P6S A;  2YT1 A;  2MDX A;  1SGH A;  2RNR B;  1K5G B;  1I2H A;  3DXE A;  2DKQ A;  1Z87 A;  2DHI A;  3VIA A;  1V61 A;  5LON B;  4KHB B;  5JHH A;  3A8P A;  3PVL A;  4Z2M B;  2LOX A;  2MWN B;  2W2X C;  5DI9 B;  2OTX A;  4NSW A;  4F7G A;  1FGZ A;  2BCJ A;  1MKE A;  2DKP A;  4F7U P;  4DBB A;  1BWN A;  1X05 A;  1UEF A;  4KVG B;  2UVM A;  2JP2 A;  2ZPY A;  5KQ4 A;  2DFK A;  1XCG A;  4P7I A;  2COC A;  4EKU A;  5C5B B;  1V5M A;  1LB1 A;  2UZR A;  2RLO A;  3ODX A;  2DLW A;  1NTY A;  3PEG A;  3SYX A;  2CY5 A;  1XKE A;  3QBV B;  4WVF B;  2KCJ A;  1WJ1 A;  2W2X D;  4C0A A;  4YL8 A;  2AEH A;  1KZ7 A;  2M14 A;  1I7A A;  1GC6 A;  1EGX A;  5FI1 A;  3N7C A;  1UNQ A;  2LG1 A;  2D2Q A;  4HAV B;  3SUZ A;  1ZSQ A;  3G9W A;  1MIZ B;  4L6E A;  1KI1 B;  1FOE A;  1KZG A;  2VKI A;  2P0H A;  3T06 A;  1RJ2 A;  2P0F A;  4TKN A;  4TYZ A;  1M7E A;  2D9V A;  2P8V A;  1OY2 A;  1DDM A;  2J0M A;  4HDO A;  5DIF B;  5DH9 B;  2CAY A;  3NSU A;  1WG7 A;  1FB8 A;  4B6H A;  1V5U A;  1RRP B;  1EAZ A;  2D4Q A;  4HAT B;  2YSZ A;  3LJU X;  2I1J A;  1WGQ A;  4IOY X;  5C79 A;  2LKO A;  2I5F A;  1XX0 A;  1UPQ A; 
#chains in the Genus database with same CATH topology
 4F7H A;  4GPT B;  3NW8 A;  3QWM A;  2QKL A;  1OQN A;  2D9W A;  3F0W A;  3NWF A;  3PG7 A;  1X1G A;  3P7Z A;  1ZC3 B;  1P5T A;  2I1K A;  2J0K A;  2COF A;  4HAY B;  4KAX B;  2ELA A;  4KHO A;  1H4R A;  4GZU A;  3HQC A;  4ZRJ A;  2ROV A;  2H7D A;  2NZ8 B;  1FHO A;  3D8E A;  1TXD A;  5IRS A;  2EMT A;  2RVB B;  5J3Q A;  1V89 A;  1V88 A;  4HB0 B;  2MKR A;  2Z0P A;  4WSF A;  3TO1 A;  2DA0 A;  2DN6 A;  1X11 A;  3GYO A;  2RSG A;  4A6K A;  1MK7 B;  3PP2 A;  4A5K A;  3DXC A;  2D9X A;  2YS5 A;  2K8E A;  3X23 A;  4K2O A;  3KY9 A;  1WVH A;  3SO6 A;  1DBH A;  1N3H A;  3WYF B;  1TQZ A;  3RCP A;  1MIX A;  4EJN A;  4Z2N A;  1U5F A;  4GMV A;  3ULC A;  2I5C A;  2KGX B;  1X1F A;  4K81 A;  2DX5 A;  2EJ8 A;  4PNK A;  2LUL A;  2KUP A;  4HAZ B;  4WJ7 A;  1W1G A;  2R0D A;  2M38 A;  3PVW A;  4DX8 A;  2AL6 A;  1EVH A;  2GCJ A;  4K17 A;  5C6R A;  1W1H A;  2YS1 A;  3PVU A;  3V5W A;  2HE7 A;  1FHW A;  2LOZ A;  1UNP A;  1UPR A;  1QC6 A;  2D9Y A;  2RGN B;  3F5R A;  1XR0 B;  3UZT A;  2COA A;  5CLL B;  5I2S A;  2QKM A;  3A8Q A;  1NTV A;  4GMX B;  3FSS A;  4XWX A;  5FI0 A;  5D27 A;  4CSQ A;  3BIN A;  5D3W A;  3AJ4 A;  1MK9 B;  4DIX A;  3TVV A;  1PFJ A;  1ZC4 B;  2EC1 A;  1NU2 A;  4GOU A;  4QJ3 B;  4Y94 A;  3BJI A;  4HHV A;  2D9Z A;  2P0D A;  1P3R A;  4IFS A;  1FHX A;  4GXB A;  3PZD A;  3OAN A;  1BAK A;  2KUQ A;  2D11 A;  3VOQ A;  3A98 B;  4HB2 B;  1U5G A;  1UNR A;  2V76 A;  1K5D B;  5GOW B;  3DXD A;  3HSA A;  4K2P A;  2R2Y A;  3M1I B;  4HB3 B;  3U12 A;  3SV1 A;  3ODW A;  4HB4 B;  2NMB A;  2YRY A;  2Y7B A;  4D0N B;  4HDQ A;  3GYP A;  3HIE A;  4A6F A;  3TW1 A;  3HK0 A;  1M7R A;  3KRW A;  1ZVR A;  2GCL A;  2GJY A;  5CLQ B;  2N0Y A;  3P6A A;  2FJU B;  4IAP A;  5DHF B;  2VRW B;  1E5W A;  1V5P A;  3ZDT A;  1Q67 A;  3ODO A;  4DXA B;  4CHJ A;  2COD A;  2DX1 A;  2YT0 A;  2YVC A;  1J0W A;  1WGU A;  5M4Y B;  1DRO A;  4GNK B;  4H8S A;  5JHG A;  2DTC A;  4KHA A;  5JLJ B;  5HE0 A;  1Y19 B;  2Z4D A;  5LOP B;  2ELB A;  2J0J A;  2RUK B;  3MPX A;  5JP4 A;  4EMO A;  3FEH A;  5HE3 A;  2DHK A;  2Y8G A;  2K49 A;  2R09 A;  5KCV A;  2N23 A;  1AWE A;  2XQN M;  3KSY A;  4CHM A;  2DYN A;  1LW3 A;  2YF0 A;  2D10 A;  5HE2 A;  1SHC A;  3TFM A;  2LYD A;  4YON A;  3CXB B;  1OMW A;  1XD4 A;  4A6H A;  4ZRI A;  5KQ1 A;  5L81 A;  1ZM0 A;  2KR0 A;  4HAX B;  4KHB A;  1GG3 A;  3U7D A;  4BBK A;  2OQB A;  1FGY A;  1MPH A;  1MAI A;  4D6W A;  3ML4 A;  1AQC A;  2X18 A;  2K2U A;  3DCX A;  3WA0 A;  4QJ4 B;  2KIE A;  1U2B A;  5D3Y A;  1QQG A;  4GN1 A;  2K00 A;  1U29 A;  2Z59 A;  1BTK A;  1FAO A;  4QXA B;  1WJM A;  1U5E A;  4ZRK A;  3FM8 C;  1W1D A;  2EMS A;  5C16 A;  2H7E A;  4MT7 A;  3AU5 A;  4NY0 A;  1TJ6 A;  2L2I A;  1DDV A;  5C5B A;  4HAW B;  1DDW A;  2Z13 A;  3SNH A;  4HAU B;  1ISN A;  5J3Y A;  1PLS A;  2HTH B;  1WI1 A;  4MY6 A;  4PQ0 A;  4DX9 0;  1GC7 A;  3D8D A;  1X86 A;  2KIG A;  1U27 A;  4MK0 A;  2ROZ B;  1XOD A;  3KZ1 A;  3KRX A;  2YS3 A;  4A6F B;  2DHJ A;  1EF1 A;  3ULB A;  2MFQ A;  3D8F A;  2Z0O A;  2VSZ A;  5D3X A;  2E2X A;  2IYB A;  2IFS A;  1NI2 A;  4CYE A;  1IRS A;  3PSC A;  1BTN A;  2Z14 A;  5J3T A;  3FVC A;  2K2J A;  5DHA B;  2G35 A;  2J59 M;  2Q13 A;  3AU4 A;  3HW2 B;  2Y8F A;  1B55 A;  2ADZ A;  5HE1 A;  3MDB C;  3U8Z A;  2DYQ A;  3ZVR A;  3O96 A;  3QIJ A;  2CY4 A;  2FJL A;  1Y5O A;  2L1C A;  1J19 A;  2CRF A;  2W2W A;  1PMS A;  3CIK A;  2ZKM X;  2Z0Q A;  1U5D A;  2UZS A;  3TCA A;  3B77 A;  1DYN A;  4OT1 A;  2GS0 A;  2PZ1 A;  5D3V A;  1H10 A;  3IVF A;  5EFX A;  1P6S A;  2YT1 A;  2MDX A;  1SGH A;  2RNR B;  1K5G B;  1I2H A;  3DXE A;  3NWD A;  2DKQ A;  2YT2 A;  1Z87 A;  2DHI A;  3VIA A;  1V61 A;  5LON B;  4KHB B;  5JHH A;  3A8P A;  3PVL A;  4Z2M B;  2LOX A;  2MWN B;  2W2X C;  5DI9 B;  2OTX A;  4NSW A;  4F7G A;  1FGZ A;  2BCJ A;  1MKE A;  2DKP A;  4F7U P;  4DBB A;  1BWN A;  1X05 A;  1UEF A;  4KVG B;  2UVM A;  5LG4 B;  1ZYI A;  2JP2 A;  2ZPY A;  5KQ4 A;  2DFK A;  3A58 A;  1XCG A;  2GUM A;  4P7I A;  2COC A;  4EKU A;  5C5B B;  1V5M A;  1LB1 A;  2UZR A;  2RLO A;  3ODX A;  2DLW A;  4QJ5 B;  1NTY A;  3PEG A;  3SYX A;  2CY5 A;  1XKE A;  3QBV B;  4WVF B;  2KCJ A;  1WJ1 A;  4OSN A;  2W2X D;  4C0A A;  4YL8 A;  2AEH A;  1KZ7 A;  2M14 A;  2NBV A;  1I7A A;  2RRF A;  1GC6 A;  1EGX A;  5FI1 A;  3N7C A;  1UNQ A;  2LG1 A;  2D2Q A;  4HAV B;  3SUZ A;  1ZSQ A;  3G9W A;  1MIZ B;  4HSI A;  4L6E A;  1KI1 B;  1FOE A;  1KZG A;  2VKI A;  3NWA A;  2P0H A;  1MI1 A;  3OHM B;  3T06 A;  1RJ2 A;  2P0F A;  4TKN A;  4TYZ A;  1M7E A;  2D9V A;  2P8V A;  1OY2 A;  1DDM A;  2J0M A;  4L1R A;  4HDO A;  5DIF B;  5DH9 B;  2CAY A;  3NSU A;  1WG7 A;  1FB8 A;  4B6H A;  5I2M A;  1V5U A;  1RRP B;  1EAZ A;  2D4Q A;  4HAT B;  2YSZ A;  3LJU X;  2I1J A;  1WGQ A;  1T77 A;  4IOY X;  5C79 A;  2LKO A;  2I5F A;  1XX0 A;  1UPQ A; 
#chains in the Genus database with same CATH homology
 4F7H A;  4GPT B;  3QWM A;  2QKL A;  1OQN A;  2D9W A;  3F0W A;  3PG7 A;  1X1G A;  3P7Z A;  1ZC3 B;  1P5T A;  2I1K A;  2J0K A;  2COF A;  4HAY B;  4KAX B;  2ELA A;  4KHO A;  1H4R A;  4GZU A;  3HQC A;  4ZRJ A;  2ROV A;  2H7D A;  2NZ8 B;  1FHO A;  3D8E A;  1TXD A;  2EMT A;  2RVB B;  5J3Q A;  1V89 A;  1V88 A;  4HB0 B;  2MKR A;  2Z0P A;  4WSF A;  3TO1 A;  2DA0 A;  2DN6 A;  1X11 A;  3GYO A;  2RSG A;  4A6K A;  1MK7 B;  3PP2 A;  4A5K A;  3DXC A;  2D9X A;  2YS5 A;  3X23 A;  4K2O A;  3KY9 A;  1WVH A;  3SO6 A;  1DBH A;  1N3H A;  3WYF B;  1TQZ A;  3RCP A;  1MIX A;  4EJN A;  4Z2N A;  1U5F A;  4GMV A;  3ULC A;  2I5C A;  2KGX B;  1X1F A;  4K81 A;  2DX5 A;  2EJ8 A;  4PNK A;  2LUL A;  2KUP A;  4HAZ B;  4WJ7 A;  1W1G A;  2R0D A;  2M38 A;  3PVW A;  4DX8 A;  2AL6 A;  1EVH A;  2GCJ A;  4K17 A;  5C6R A;  1W1H A;  2YS1 A;  3PVU A;  3V5W A;  2HE7 A;  1FHW A;  2LOZ A;  1UNP A;  1UPR A;  1QC6 A;  2D9Y A;  2RGN B;  3F5R A;  1XR0 B;  3UZT A;  2COA A;  5CLL B;  2QKM A;  3A8Q A;  1NTV A;  4GMX B;  3FSS A;  4XWX A;  5FI0 A;  5D27 A;  3BIN A;  5D3W A;  3AJ4 A;  1MK9 B;  3TVV A;  1PFJ A;  1ZC4 B;  2EC1 A;  1NU2 A;  4Y94 A;  3BJI A;  4HHV A;  2D9Z A;  2P0D A;  1P3R A;  4IFS A;  1FHX A;  4GXB A;  3PZD A;  3OAN A;  1BAK A;  2D11 A;  3VOQ A;  3A98 B;  4HB2 B;  1U5G A;  1UNR A;  2V76 A;  1K5D B;  5GOW B;  3DXD A;  4K2P A;  3M1I B;  4HB3 B;  3SV1 A;  3ODW A;  4HB4 B;  2NMB A;  2YRY A;  2Y7B A;  4D0N B;  4HDQ A;  3GYP A;  4A6F A;  3TW1 A;  3HK0 A;  1M7R A;  3KRW A;  1ZVR A;  2GCL A;  2GJY A;  5CLQ B;  2N0Y A;  3P6A A;  4IAP A;  5DHF B;  2VRW B;  1E5W A;  1V5P A;  3ZDT A;  1Q67 A;  3ODO A;  4DXA B;  4CHJ A;  2COD A;  2DX1 A;  2YT0 A;  2YVC A;  1J0W A;  1WGU A;  1DRO A;  4H8S A;  5JHG A;  2DTC A;  4KHA A;  5JLJ B;  5HE0 A;  1Y19 B;  5LOP B;  2ELB A;  2J0J A;  2RUK B;  3MPX A;  5JP4 A;  4EMO A;  3FEH A;  5HE3 A;  2DHK A;  2Y8G A;  2R09 A;  5KCV A;  2N23 A;  1AWE A;  3KSY A;  2XQN M;  4CHM A;  2DYN A;  1LW3 A;  2YF0 A;  2D10 A;  5HE2 A;  1SHC A;  3TFM A;  2LYD A;  4YON A;  3CXB B;  1OMW A;  1XD4 A;  4A6H A;  4ZRI A;  5KQ1 A;  5L81 A;  1ZM0 A;  4HAX B;  1GG3 A;  3U7D A;  4BBK A;  2OQB A;  1FGY A;  1MPH A;  1MAI A;  3ML4 A;  1AQC A;  2X18 A;  2K2U A;  3WA0 A;  1U2B A;  5D3Y A;  1QQG A;  4GN1 A;  2K00 A;  1U29 A;  1BTK A;  1FAO A;  1WJM A;  1U5E A;  4ZRK A;  3FM8 C;  1W1D A;  2EMS A;  5C16 A;  2H7E A;  4MT7 A;  3AU5 A;  4NY0 A;  1TJ6 A;  2L2I A;  1DDV A;  5C5B A;  4HAW B;  1DDW A;  3SNH A;  4HAU B;  1ISN A;  5J3Y A;  1PLS A;  2HTH B;  1WI1 A;  4MY6 A;  4PQ0 A;  4DX9 0;  1GC7 A;  3D8D A;  1X86 A;  1U27 A;  4MK0 A;  2ROZ B;  1XOD A;  3KZ1 A;  3KRX A;  2YS3 A;  4A6F B;  2DHJ A;  1EF1 A;  3ULB A;  2MFQ A;  3D8F A;  2Z0O A;  2VSZ A;  5D3X A;  2E2X A;  2IYB A;  2IFS A;  1NI2 A;  4CYE A;  1IRS A;  3PSC A;  1BTN A;  5J3T A;  2K2J A;  5DHA B;  2G35 A;  2J59 M;  2Q13 A;  3AU4 A;  3HW2 B;  2Y8F A;  1B55 A;  2ADZ A;  5HE1 A;  3MDB C;  3U8Z A;  2DYQ A;  3ZVR A;  3O96 A;  3QIJ A;  2CY4 A;  2FJL A;  1Y5O A;  2L1C A;  1J19 A;  2CRF A;  2W2W A;  1PMS A;  3CIK A;  2Z0Q A;  1U5D A;  2UZS A;  3TCA A;  1DYN A;  2GS0 A;  2PZ1 A;  5D3V A;  1H10 A;  3IVF A;  5EFX A;  1P6S A;  2YT1 A;  2MDX A;  1SGH A;  2RNR B;  1K5G B;  1I2H A;  3DXE A;  2DKQ A;  1Z87 A;  2DHI A;  3VIA A;  1V61 A;  5LON B;  4KHB B;  5JHH A;  3A8P A;  3PVL A;  4Z2M B;  2LOX A;  2MWN B;  2W2X C;  5DI9 B;  2OTX A;  4NSW A;  4F7G A;  1FGZ A;  2BCJ A;  1MKE A;  2DKP A;  4F7U P;  4DBB A;  1BWN A;  1X05 A;  1UEF A;  4KVG B;  2UVM A;  2JP2 A;  2ZPY A;  5KQ4 A;  2DFK A;  1XCG A;  4P7I A;  2COC A;  4EKU A;  5C5B B;  1V5M A;  1LB1 A;  2UZR A;  2RLO A;  3ODX A;  2DLW A;  1NTY A;  3PEG A;  3SYX A;  2CY5 A;  1XKE A;  3QBV B;  4WVF B;  2KCJ A;  1WJ1 A;  2W2X D;  4C0A A;  4YL8 A;  2AEH A;  1KZ7 A;  2M14 A;  1I7A A;  1GC6 A;  1EGX A;  5FI1 A;  3N7C A;  1UNQ A;  2LG1 A;  2D2Q A;  4HAV B;  3SUZ A;  1ZSQ A;  3G9W A;  1MIZ B;  4L6E A;  1KI1 B;  1FOE A;  1KZG A;  2VKI A;  2P0H A;  3T06 A;  1RJ2 A;  2P0F A;  4TKN A;  4TYZ A;  1M7E A;  2D9V A;  2P8V A;  1OY2 A;  1DDM A;  2J0M A;  4HDO A;  5DIF B;  5DH9 B;  2CAY A;  3NSU A;  1WG7 A;  1FB8 A;  4B6H A;  1V5U A;  1RRP B;  1EAZ A;  2D4Q A;  4HAT B;  2YSZ A;  3LJU X;  2I1J A;  1WGQ A;  4IOY X;  5C79 A;  2LKO A;  2I5F A;  1XX0 A;  1UPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...