4A6FB

Crystal structure of slm1-ph domain in complex with phosphoserine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
110
Chain Sequence
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSTGSDAKFVLHAKQNIIGHNYVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 110
sequence length 116
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6fB00
1GG3A 1U27A 2YS1A 3PZDA 5D3YA 2ELAA 3ULBA 3M1IB 4HDOA 2CRFA 2NMBA 2LULA 4MY6A 4F7HA 4DBBA 2K2UA 3MPXA 3HW2B 2D9YA 5DIFB 1K5GB 2Z0PA 1U5DA 2UZRA 5JLJB 3GYPA 1OMWA 4NY0A 4GXBA 4A5KA 5HE2A 2LG1A 2E2XA 2H7DA 1WVHA 2KGXB 3F5RA 2IFSA 3PVLA 1KZGA 1ZC3B 2D9ZA 4HB0B 5C6RA 1DDMA 3PG7A 3HQCA 1UEFA 3PVWA 1FGYA 2HTHB 1FOEA 1WJ1A 1X86A 3NSUA 4HAUB 4K17A 3MDBC 2D9WA 2P0FA 4XWXA 3TFMA 1ZSQA 1FB8A 1NU2A 4K81A 4WSFA 2N23A 1I7AA 1UNRA 2UVMA 4HHVA 1M7RA 1V89A 3TCAA 4EJNA 4MK0A 2DKQA 4Z2NA 1TJ6A 1BTNA 1TXDA 2HE7A 2Z0OA 1WGQA 4MT7A 1EGXA 1P3RA 3KZ1A 3VOQA 3G9WA 5KQ1A 3F0WA 2KCJA 2LKOA 4YL8A 4KAXB 3AJ4A 4WJ7A 4A6HA 2L2IA 1B55A 5KCVA 2YS5A 4H8SA 2COAA 3QWMA 2DFKA 3ODWA 4PQ0A 1MK7B 1V5UA 5L81A 1J0WA 1K5DB 1PMSA 5HE1A 2CY4A 2ELBA 5DHAB 4L6EA 2FJLA 4KHOA 1TQZA 1V5PA 4Y94A 5D3WA 5D3XA 2I1JA 2L1CA 1U5EA 5D3VA 5D27A 1J19A 2DYQA 2DTCA 1RJ2A 1UNPA 3RCPA 5J3QA 1U5GA 2R0DA 4IAPA 2IYBA 1W1HA 1WI1A 4HB4B 2K00A 1BWNA 5C79A 3WA0A 2LYDA 5J3TA 2EMSA 2QKLA 2MKRA 4TKNA 2R09A 2CAYA 3DXEA 2GJYA 4CYEA 2D4QA 5GOWB 1H10A 1X11A 1DDWA 1ZM0A 4YONA 2Y7BA 2D2QA 3WYFB 1X1FA 2DHJA 3BINA 5JHHA 5DI9B 5DHFB 2X18A 2DA0A 1V61A 1XODA 4ZRJA 4ZRIA 2RGNB 1W1DA 1KZ7A 1XD4A 3KRXA 1U2BA 2ZPYA 3AU5A 4KHAA 4A6FB 2DLWA 1AWEA 4F7UP 3PEGA 2OTXA 3KSYA 1UPQA 2D11A 1ZC4B 1FHXA 2AEHA 1GC6A 3T06A 4DX90 4HATB 3PP2A 1LB1A 5LOPB 4EKUA 1QC6A 2DKPA 3A8PA 2VRWB 3ODOA 1PFJA 1DYNA 2CODA 1OY2A 1MAIA 3O96A 3AU4A 3U7DA 4IFSA 3VIAA 1AQCA 1GC7A 3V5WA 4BBKA 2LOXA 2QKMA 4EMOA 1MK9B 1SGHA 2K2JA 1W1GA 5JP4A 2JP2A 2RLOA 3ULCA 4HAZB 2UZSA 3TVVA 4K2PA 2OQBA 1WG7A 5C5BB 3PVUA 2GCJA 3N7CA 2V76A 2W2XD 3TW1A 3IVFA 2J0MA 2Z0QA 2N0YA 2D10A 3SNHA 3KY9A 1SHCA 1Y5OA 2COFA 4F7GA 1P6SA 1FHOA 4KVGB 2G35A 3DXCA 2I5CA 4HB2B 2D9XA 1V88A 5CLLB 2MDXA 3P6AA 3D8FA 1WJMA 2EMTA 1Z87A 3GYOA 2Y8FA 1UNQA 1NI2A 4PNKA 2DN6A 1NTYA 1EF1A 1FHWA 3SYXA 3SV1A 4B6HA 4D0NB 5FI1A 3PSCA 1XCGA 1DDVA 3FM8C 1EAZA 5J3YA 2MWNB 2GS0A 1KI1B 2ADZA 1FGZA 2VSZA 1I2HA 5JHGA 2MFQA 1E5WA 2CY5A 2M14A 4GPTB 1OQNA 5HE0A 1UPRA 4TYZA 3D8EA 1BTKA 3ZDTA 3QBVB 4KHBB 4CHMA 4NSWA 1NTVA 1BAKA 4Z2MB 1P5TA 2AL6A 2PZ1A 3OANA 2LOZA 4A6FA 1LW3A 2I1KA 2DX1A 3ZVRA 3X23A 3KRWA 1X1GA 2M38A 4HDQA 2W2WA 2DHIA 1V5MA 3CIKA 4HAVB 2J59M 3TO1A 2Q13A 3ML4A 3BJIA 4P7IA 3HK0A 3A98B 3P7ZA 3SUZA 2Y8GA 2YS3A 1PLSA 2GCLA 3UZTA 5C16A 1QQGA 1DBHA 1MIXA 2P0DA 3ODXA 1U29A 1Q67A 1N3HA 2RUKB 2DX5A 2H7EA 4HAWB 1H4RA 2ROZB 2NZ8B 2W2XC 1FAOA 2BCJA 5C5BA 2RVBB 3A8QA 2EC1A 3CXBB 3U8ZA 1MPHA 2D9VA 5FI0A 2DHKA 4GMVA 2I5FA 2J0JA 3FSSA 3FEHA 4GZUA 2YT1A 4ZRKA 1IRSA 1MKEA 2J0KA 2YSZA 4WVFB 2P0HA 1M7EA 5DH9B 2RSGA 1RRPB 4C0AA 4CHJA 1XR0B 2EJ8A 1ZVRA 5HE3A 4K2OA 4HB3B 4HAYB 4GN1A 5EFXA 4DX8A 2P8VA 1MIZB 4DXAB 2YT0A 2VKIA 1U5FA 1EVHA 3D8DA 4A6KA 2KUPA 2RNRB 1Y19B 2YRYA 4GMXB 5LONB 1DROA 1XKEA 1ISNA 2COCA 1XX0A 1WGUA 4HAXB 3DXDA 1X05A 4IOYX 3QIJA 3SO6A 2YF0A 2DYNA 2YVCA 2XQNM 2ROVA 5KQ4A 3LJUX 5CLQB
chains in the Genus database with same CATH superfamily
1GG3A 1U27A 2YS1A 3PZDA 5D3YA 2ELAA 3ULBA 3M1IB 4HDOA 2CRFA 2NMBA 5LG4B 2LULA 4MY6A 4F7HA 4DBBA 2K2UA 3MPXA 3HW2B 2D9YA 5DIFB 1K5GB 2Z0PA 1U5DA 2UZRA 5JLJB 3GYPA 1OMWA 4NY0A 4GXBA 4A5KA 5HE2A 2LG1A 2E2XA 2H7DA 1WVHA 2KGXB 3F5RA 2IFSA 3PVLA 1KZGA 1ZC3B 2D9ZA 4HB0B 5C6RA 1DDMA 3PG7A 2KIEA 3HQCA 1UEFA 3PVWA 1FGYA 2HTHB 1FOEA 1WJ1A 1X86A 3NSUA 4HAUB 4K17A 3MDBC 3NW8A 2D9WA 3A58A 2P0FA 4XWXA 3TFMA 1ZSQA 1FB8A 1NU2A 4K81A 4WSFA 2N23A 1I7AA 1UNRA 2UVMA 4HHVA 1M7RA 1V89A 3TCAA 4EJNA 4MK0A 2DKQA 3HSAA 4Z2NA 1TJ6A 1BTNA 1TXDA 2HE7A 2Z0OA 1WGQA 4MT7A 4OT1A 1EGXA 1P3RA 3KZ1A 2K8EA 3VOQA 3G9WA 4GOUA 5KQ1A 3F0WA 2KCJA 4HSIA 2LKOA 4YL8A 4KAXB 3AJ4A 4WJ7A 4A6HA 2L2IA 1B55A 5KCVA 2YS5A 4H8SA 2COAA 3QWMA 2DFKA 3ODWA 4PQ0A 1MK7B 1V5UA 5L81A 1J0WA 1K5DB 1PMSA 2KR0A 3NWFA 5HE1A 2CY4A 2ELBA 5DHAB 4L6EA 2FJLA 4KHOA 1TQZA 1V5PA 4Y94A 5D3WA 5D3XA 2I1JA 1ZYIA 2L1CA 1U5EA 5D3VA 1MI1A 5D27A 1J19A 2DYQA 2DTCA 1RJ2A 1UNPA 3NWDA 3RCPA 5J3QA 1U5GA 2R0DA 4IAPA 2IYBA 1W1HA 1WI1A 4HB4B 2K00A 1BWNA 5C79A 3WA0A 2LYDA 1T77A 5J3TA 2EMSA 2QKLA 2MKRA 4TKNA 2R09A 2CAYA 3DXEA 2GJYA 4CYEA 2D4QA 5GOWB 1H10A 1X11A 1DDWA 1ZM0A 4YONA 2Y7BA 2D2QA 3WYFB 1X1FA 2DHJA 3BINA 5JHHA 5DI9B 5DHFB 3FVCA 2X18A 2DA0A 1V61A 1XODA 4ZRJA 2RRFA 4ZRIA 2RGNB 1W1DA 1KZ7A 1XD4A 3KRXA 1U2BA 2ZPYA 3AU5A 4OSNA 4CSQA 3NWAA 3U12A 4KHAA 4A6FB 2DLWA 1AWEA 4F7UP 3PEGA 2OTXA 3KSYA 2FJUB 1UPQA 2D11A 1ZC4B 2K49A 1FHXA 2AEHA 1GC6A 3T06A 4DX90 4HATB 3PP2A 2GUMA 1LB1A 5LOPB 4EKUA 1QC6A 2R2YA 2DKPA 3A8PA 2VRWB 3ODOA 1PFJA 1DYNA 2CODA 1OY2A 1MAIA 3O96A 3AU4A 3U7DA 4IFSA 5I2SA 3VIAA 1AQCA 1GC7A 3V5WA 4BBKA 2LOXA 2QKMA 4EMOA 1MK9B 1SGHA 2K2JA 1W1GA 5JP4A 2Z4DA 2JP2A 2RLOA 3ULCA 4HAZB 2UZSA 4QJ3B 5I2MA 4GNKB 3TVVA 4K2PA 2OQBA 1WG7A 2Z13A 5C5BB 3PVUA 2GCJA 2Z59A 3N7CA 2V76A 2W2XD 3TW1A 3IVFA 2J0MA 2Z0QA 2N0YA 2D10A 3SNHA 3KY9A 1SHCA 1Y5OA 2COFA 4F7GA 1P6SA 3OHMB 1FHOA 4KVGB 2G35A 3DXCA 2I5CA 4HB2B 2D9XA 1V88A 5CLLB 2MDXA 3P6AA 3D8FA 1WJMA 2EMTA 4DIXA 1Z87A 3GYOA 2Y8FA 1UNQA 1NI2A 4PNKA 2DN6A 1NTYA 1EF1A 1FHWA 3SYXA 3SV1A 4B6HA 4D0NB 5FI1A 3PSCA 1XCGA 1DDVA 3FM8C 1EAZA 5J3YA 2MWNB 2GS0A 1KI1B 2ADZA 1FGZA 2VSZA 1I2HA 5JHGA 3B77A 2MFQA 1E5WA 2CY5A 2M14A 3HIEA 4GPTB 1OQNA 5HE0A 1UPRA 2KUQA 4TYZA 3D8EA 1BTKA 3ZDTA 3QBVB 4KHBB 4CHMA 4NSWA 1NTVA 1BAKA 4Z2MB 1P5TA 2AL6A 2PZ1A 3OANA 2LOZA 4A6FA 1LW3A 2I1KA 2DX1A 3ZVRA 3DCXA 3X23A 3KRWA 1X1GA 2M38A 4HDQA 2W2WA 2DHIA 1V5MA 4D6WA 2YT2A 3CIKA 4HAVB 2NBVA 2J59M 3TO1A 2Q13A 3ML4A 3BJIA 4P7IA 3HK0A 3A98B 3P7ZA 3SUZA 2Z14A 2Y8GA 2YS3A 1PLSA 2ZKMX 2GCLA 3UZTA 5C16A 1QQGA 1DBHA 1MIXA 2P0DA 3ODXA 1U29A 1Q67A 1N3HA 2RUKB 2DX5A 2H7EA 4HAWB 1H4RA 2ROZB 2NZ8B 2W2XC 1FAOA 2BCJA 5C5BA 2RVBB 3A8QA 2EC1A 3CXBB 3U8ZA 1MPHA 2D9VA 5FI0A 2DHKA 4GMVA 2I5FA 2J0JA 3FSSA 3FEHA 4GZUA 2YT1A 4ZRKA 1IRSA 4QJ5B 1MKEA 2J0KA 2YSZA 4WVFB 2P0HA 1M7EA 5DH9B 2RSGA 5M4YB 1RRPB 4C0AA 4CHJA 1XR0B 2EJ8A 2KIGA 1ZVRA 5HE3A 4K2OA 4HB3B 4HAYB 4GN1A 5EFXA 4DX8A 2P8VA 5IRSA 1MIZB 4DXAB 2YT0A 2VKIA 1U5FA 4QJ4B 4L1RA 1EVHA 3D8DA 4A6KA 2KUPA 2RNRB 1Y19B 2YRYA 4GMXB 5LONB 1DROA 1XKEA 1ISNA 2COCA 1XX0A 1WGUA 4HAXB 3DXDA 4QXAB 1X05A 4IOYX 3QIJA 3SO6A 4KHBA 2YF0A 2DYNA 2YVCA 2XQNM 2ROVA 5KQ4A 3LJUX 5CLQB
chains in the Genus database with same CATH topology
1GG3A 1U27A 2YS1A 3PZDA 5D3YA 2ELAA 3ULBA 3M1IB 4HDOA 2CRFA 2NMBA 2LULA 4MY6A 4F7HA 4DBBA 2K2UA 3MPXA 3HW2B 2D9YA 5DIFB 1K5GB 2Z0PA 1U5DA 2UZRA 5JLJB 3GYPA 1OMWA 4NY0A 4GXBA 4A5KA 5HE2A 2LG1A 2E2XA 2H7DA 1WVHA 2KGXB 3F5RA 2IFSA 3PVLA 1KZGA 1ZC3B 2D9ZA 4HB0B 5C6RA 1DDMA 3PG7A 3HQCA 1UEFA 3PVWA 1FGYA 2HTHB 1FOEA 1WJ1A 1X86A 3NSUA 4HAUB 4K17A 3MDBC 2D9WA 2P0FA 4XWXA 3TFMA 1ZSQA 1FB8A 1NU2A 4K81A 4WSFA 2N23A 1I7AA 1UNRA 2UVMA 4HHVA 1M7RA 1V89A 3TCAA 4EJNA 4MK0A 2DKQA 4Z2NA 1TJ6A 1BTNA 1TXDA 2HE7A 2Z0OA 1WGQA 4MT7A 1EGXA 1P3RA 3KZ1A 3VOQA 3G9WA 5KQ1A 3F0WA 2KCJA 2LKOA 4YL8A 4KAXB 3AJ4A 4WJ7A 4A6HA 2L2IA 1B55A 5KCVA 2YS5A 4H8SA 2COAA 3QWMA 2DFKA 3ODWA 4PQ0A 1MK7B 1V5UA 5L81A 1J0WA 1K5DB 1PMSA 5HE1A 2CY4A 2ELBA 5DHAB 4L6EA 2FJLA 4KHOA 1TQZA 1V5PA 4Y94A 5D3WA 5D3XA 2I1JA 2L1CA 1U5EA 5D3VA 5D27A 1J19A 2DYQA 2DTCA 1RJ2A 1UNPA 3RCPA 5J3QA 1U5GA 2R0DA 4IAPA 2IYBA 1W1HA 1WI1A 4HB4B 2K00A 1BWNA 5C79A 3WA0A 2LYDA 5J3TA 2EMSA 2QKLA 2MKRA 4TKNA 2R09A 2CAYA 3DXEA 2GJYA 4CYEA 2D4QA 5GOWB 1H10A 1X11A 1DDWA 1ZM0A 4YONA 2Y7BA 2D2QA 3WYFB 1X1FA 2DHJA 3BINA 5JHHA 5DI9B 5DHFB 2X18A 2DA0A 1V61A 1XODA 4ZRJA 4ZRIA 2RGNB 1W1DA 1KZ7A 1XD4A 3KRXA 1U2BA 2ZPYA 3AU5A 4KHAA 4A6FB 2DLWA 1AWEA 4F7UP 3PEGA 2OTXA 3KSYA 1UPQA 2D11A 1ZC4B 1FHXA 2AEHA 1GC6A 3T06A 4DX90 4HATB 3PP2A 1LB1A 5LOPB 4EKUA 1QC6A 2DKPA 3A8PA 2VRWB 3ODOA 1PFJA 1DYNA 2CODA 1OY2A 1MAIA 3O96A 3AU4A 3U7DA 4IFSA 3VIAA 1AQCA 1GC7A 3V5WA 4BBKA 2LOXA 2QKMA 4EMOA 1MK9B 1SGHA 2K2JA 1W1GA 5JP4A 2JP2A 2RLOA 3ULCA 4HAZB 2UZSA 3TVVA 4K2PA 2OQBA 1WG7A 5C5BB 3PVUA 2GCJA 3N7CA 2V76A 2W2XD 3TW1A 3IVFA 2J0MA 2Z0QA 2N0YA 2D10A 3SNHA 3KY9A 1SHCA 1Y5OA 2COFA 4F7GA 1P6SA 1FHOA 4KVGB 2G35A 3DXCA 2I5CA 4HB2B 2D9XA 1V88A 5CLLB 2MDXA 3P6AA 3D8FA 1WJMA 2EMTA 1Z87A 3GYOA 2Y8FA 1UNQA 1NI2A 4PNKA 2DN6A 1NTYA 1EF1A 1FHWA 3SYXA 3SV1A 4B6HA 4D0NB 5FI1A 3PSCA 1XCGA 1DDVA 3FM8C 1EAZA 5J3YA 2MWNB 2GS0A 1KI1B 2ADZA 1FGZA 2VSZA 1I2HA 5JHGA 2MFQA 1E5WA 2CY5A 2M14A 4GPTB 1OQNA 5HE0A 1UPRA 4TYZA 3D8EA 1BTKA 3ZDTA 3QBVB 4KHBB 4CHMA 4NSWA 1NTVA 1BAKA 4Z2MB 1P5TA 2AL6A 2PZ1A 3OANA 2LOZA 4A6FA 1LW3A 2I1KA 2DX1A 3ZVRA 3X23A 3KRWA 1X1GA 2M38A 4HDQA 2W2WA 2DHIA 1V5MA 3CIKA 4HAVB 2J59M 3TO1A 2Q13A 3ML4A 3BJIA 4P7IA 3HK0A 3A98B 3P7ZA 3SUZA 2Y8GA 2YS3A 1PLSA 2GCLA 3UZTA 5C16A 1QQGA 1DBHA 1MIXA 2P0DA 3ODXA 1U29A 1Q67A 1N3HA 2RUKB 2DX5A 2H7EA 4HAWB 1H4RA 2ROZB 2NZ8B 2W2XC 1FAOA 2BCJA 5C5BA 2RVBB 3A8QA 2EC1A 3CXBB 3U8ZA 1MPHA 2D9VA 5FI0A 2DHKA 4GMVA 2I5FA 2J0JA 3FSSA 3FEHA 4GZUA 2YT1A 4ZRKA 1IRSA 1MKEA 2J0KA 2YSZA 4WVFB 2P0HA 1M7EA 5DH9B 2RSGA 1RRPB 4C0AA 4CHJA 1XR0B 2EJ8A 1ZVRA 5HE3A 4K2OA 4HB3B 4HAYB 4GN1A 5EFXA 4DX8A 2P8VA 1MIZB 4DXAB 2YT0A 2VKIA 1U5FA 1EVHA 3D8DA 4A6KA 2KUPA 2RNRB 1Y19B 2YRYA 4GMXB 5LONB 1DROA 1XKEA 1ISNA 2COCA 1XX0A 1WGUA 4HAXB 3DXDA 1X05A 4IOYX 3QIJA 3SO6A 2YF0A 2DYNA 2YVCA 2XQNM 2ROVA 5KQ4A 3LJUX 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GG3 A;  1U27 A;  2YS1 A;  3PZD A;  5D3Y A;  2ELA A;  3ULB A;  3M1I B;  4HDO A;  2CRF A;  2NMB A;  2LUL A;  4MY6 A;  4F7H A;  4DBB A;  2K2U A;  3MPX A;  3HW2 B;  2D9Y A;  5DIF B;  1K5G B;  2Z0P A;  1U5D A;  2UZR A;  5JLJ B;  3GYP A;  1OMW A;  4NY0 A;  4GXB A;  4A5K A;  5HE2 A;  2LG1 A;  2E2X A;  2H7D A;  1WVH A;  2KGX B;  3F5R A;  2IFS A;  3PVL A;  1KZG A;  1ZC3 B;  2D9Z A;  4HB0 B;  5C6R A;  1DDM A;  3PG7 A;  3HQC A;  1UEF A;  3PVW A;  1FGY A;  2HTH B;  1FOE A;  1WJ1 A;  1X86 A;  3NSU A;  4HAU B;  4K17 A;  3MDB C;  2D9W A;  2P0F A;  4XWX A;  3TFM A;  1ZSQ A;  1FB8 A;  1NU2 A;  4K81 A;  4WSF A;  2N23 A;  1I7A A;  1UNR A;  2UVM A;  4HHV A;  1M7R A;  1V89 A;  3TCA A;  4EJN A;  4MK0 A;  2DKQ A;  4Z2N A;  1TJ6 A;  1BTN A;  1TXD A;  2HE7 A;  2Z0O A;  1WGQ A;  4MT7 A;  1EGX A;  1P3R A;  3KZ1 A;  3VOQ A;  3G9W A;  5KQ1 A;  3F0W A;  2KCJ A;  2LKO A;  4YL8 A;  4KAX B;  3AJ4 A;  4WJ7 A;  4A6H A;  2L2I A;  1B55 A;  5KCV A;  2YS5 A;  4H8S A;  2COA A;  3QWM A;  2DFK A;  3ODW A;  4PQ0 A;  1MK7 B;  1V5U A;  5L81 A;  1J0W A;  1K5D B;  1PMS A;  5HE1 A;  2CY4 A;  2ELB A;  5DHA B;  4L6E A;  2FJL A;  4KHO A;  1TQZ A;  1V5P A;  4Y94 A;  5D3W A;  5D3X A;  2I1J A;  2L1C A;  1U5E A;  5D3V A;  5D27 A;  1J19 A;  2DYQ A;  2DTC A;  1RJ2 A;  1UNP A;  3RCP A;  5J3Q A;  1U5G A;  2R0D A;  4IAP A;  2IYB A;  1W1H A;  1WI1 A;  4HB4 B;  2K00 A;  1BWN A;  5C79 A;  3WA0 A;  2LYD A;  5J3T A;  2EMS A;  2QKL A;  2MKR A;  4TKN A;  2R09 A;  2CAY A;  3DXE A;  2GJY A;  4CYE A;  2D4Q A;  5GOW B;  1H10 A;  1X11 A;  1DDW A;  1ZM0 A;  4YON A;  2Y7B A;  2D2Q A;  3WYF B;  1X1F A;  2DHJ A;  3BIN A;  5JHH A;  5DI9 B;  5DHF B;  2X18 A;  2DA0 A;  1V61 A;  1XOD A;  4ZRJ A;  4ZRI A;  2RGN B;  1W1D A;  1KZ7 A;  1XD4 A;  3KRX A;  1U2B A;  2ZPY A;  3AU5 A;  4KHA A;  4A6F B;  2DLW A;  1AWE A;  4F7U P;  3PEG A;  2OTX A;  3KSY A;  1UPQ A;  2D11 A;  1ZC4 B;  1FHX A;  2AEH A;  1GC6 A;  3T06 A;  4DX9 0;  4HAT B;  3PP2 A;  1LB1 A;  5LOP B;  4EKU A;  1QC6 A;  2DKP A;  3A8P A;  2VRW B;  3ODO A;  1PFJ A;  1DYN A;  2COD A;  1OY2 A;  1MAI A;  3O96 A;  3AU4 A;  3U7D A;  4IFS A;  3VIA A;  1AQC A;  1GC7 A;  3V5W A;  4BBK A;  2LOX A;  2QKM A;  4EMO A;  1MK9 B;  1SGH A;  2K2J A;  1W1G A;  5JP4 A;  2JP2 A;  2RLO A;  3ULC A;  4HAZ B;  2UZS A;  3TVV A;  4K2P A;  2OQB A;  1WG7 A;  5C5B B;  3PVU A;  2GCJ A;  3N7C A;  2V76 A;  2W2X D;  3TW1 A;  3IVF A;  2J0M A;  2Z0Q A;  2N0Y A;  2D10 A;  3SNH A;  3KY9 A;  1SHC A;  1Y5O A;  2COF A;  4F7G A;  1P6S A;  1FHO A;  4KVG B;  2G35 A;  3DXC A;  2I5C A;  4HB2 B;  2D9X A;  1V88 A;  5CLL B;  2MDX A;  3P6A A;  3D8F A;  1WJM A;  2EMT A;  1Z87 A;  3GYO A;  2Y8F A;  1UNQ A;  1NI2 A;  4PNK A;  2DN6 A;  1NTY A;  1EF1 A;  1FHW A;  3SYX A;  3SV1 A;  4B6H A;  4D0N B;  5FI1 A;  3PSC A;  1XCG A;  1DDV A;  3FM8 C;  1EAZ A;  5J3Y A;  2MWN B;  2GS0 A;  1KI1 B;  2ADZ A;  1FGZ A;  2VSZ A;  1I2H A;  5JHG A;  2MFQ A;  1E5W A;  2CY5 A;  2M14 A;  4GPT B;  1OQN A;  5HE0 A;  1UPR A;  4TYZ A;  3D8E A;  1BTK A;  3ZDT A;  3QBV B;  4KHB B;  4CHM A;  4NSW A;  1NTV A;  1BAK A;  4Z2M B;  1P5T A;  2AL6 A;  2PZ1 A;  3OAN A;  2LOZ A;  4A6F A;  1LW3 A;  2I1K A;  2DX1 A;  3ZVR A;  3X23 A;  3KRW A;  1X1G A;  2M38 A;  4HDQ A;  2W2W A;  2DHI A;  1V5M A;  3CIK A;  4HAV B;  2J59 M;  3TO1 A;  2Q13 A;  3ML4 A;  3BJI A;  4P7I A;  3HK0 A;  3A98 B;  3P7Z A;  3SUZ A;  2Y8G A;  2YS3 A;  1PLS A;  2GCL A;  3UZT A;  5C16 A;  1QQG A;  1DBH A;  1MIX A;  2P0D A;  3ODX A;  1U29 A;  1Q67 A;  1N3H A;  2RUK B;  2DX5 A;  2H7E A;  4HAW B;  1H4R A;  2ROZ B;  2NZ8 B;  2W2X C;  1FAO A;  2BCJ A;  5C5B A;  2RVB B;  3A8Q A;  2EC1 A;  3CXB B;  3U8Z A;  1MPH A;  2D9V A;  5FI0 A;  2DHK A;  4GMV A;  2I5F A;  2J0J A;  3FSS A;  3FEH A;  4GZU A;  2YT1 A;  4ZRK A;  1IRS A;  1MKE A;  2J0K A;  2YSZ A;  4WVF B;  2P0H A;  1M7E A;  5DH9 B;  2RSG A;  1RRP B;  4C0A A;  4CHJ A;  1XR0 B;  2EJ8 A;  1ZVR A;  5HE3 A;  4K2O A;  4HB3 B;  4HAY B;  4GN1 A;  5EFX A;  4DX8 A;  2P8V A;  1MIZ B;  4DXA B;  2YT0 A;  2VKI A;  1U5F A;  1EVH A;  3D8D A;  4A6K A;  2KUP A;  2RNR B;  1Y19 B;  2YRY A;  4GMX B;  5LON B;  1DRO A;  1XKE A;  1ISN A;  2COC A;  1XX0 A;  1WGU A;  4HAX B;  3DXD A;  1X05 A;  4IOY X;  3QIJ A;  3SO6 A;  2YF0 A;  2DYN A;  2YVC A;  2XQN M;  2ROV A;  5KQ4 A;  3LJU X;  5CLQ B; 
#chains in the Genus database with same CATH topology
 1GG3 A;  1U27 A;  2YS1 A;  3PZD A;  5D3Y A;  2ELA A;  3ULB A;  3M1I B;  4HDO A;  2CRF A;  2NMB A;  5LG4 B;  2LUL A;  4MY6 A;  4F7H A;  4DBB A;  2K2U A;  3MPX A;  3HW2 B;  2D9Y A;  5DIF B;  1K5G B;  2Z0P A;  1U5D A;  2UZR A;  5JLJ B;  3GYP A;  1OMW A;  4NY0 A;  4GXB A;  4A5K A;  5HE2 A;  2LG1 A;  2E2X A;  2H7D A;  1WVH A;  2KGX B;  3F5R A;  2IFS A;  3PVL A;  1KZG A;  1ZC3 B;  2D9Z A;  4HB0 B;  5C6R A;  1DDM A;  3PG7 A;  2KIE A;  3HQC A;  1UEF A;  3PVW A;  1FGY A;  2HTH B;  1FOE A;  1WJ1 A;  1X86 A;  3NSU A;  4HAU B;  4K17 A;  3MDB C;  3NW8 A;  2D9W A;  3A58 A;  2P0F A;  4XWX A;  3TFM A;  1ZSQ A;  1FB8 A;  1NU2 A;  4K81 A;  4WSF A;  2N23 A;  1I7A A;  1UNR A;  2UVM A;  4HHV A;  1M7R A;  1V89 A;  3TCA A;  4EJN A;  4MK0 A;  2DKQ A;  3HSA A;  4Z2N A;  1TJ6 A;  1BTN A;  1TXD A;  2HE7 A;  2Z0O A;  1WGQ A;  4MT7 A;  4OT1 A;  1EGX A;  1P3R A;  3KZ1 A;  2K8E A;  3VOQ A;  3G9W A;  4GOU A;  5KQ1 A;  3F0W A;  2KCJ A;  4HSI A;  2LKO A;  4YL8 A;  4KAX B;  3AJ4 A;  4WJ7 A;  4A6H A;  2L2I A;  1B55 A;  5KCV A;  2YS5 A;  4H8S A;  2COA A;  3QWM A;  2DFK A;  3ODW A;  4PQ0 A;  1MK7 B;  1V5U A;  5L81 A;  1J0W A;  1K5D B;  1PMS A;  2KR0 A;  3NWF A;  5HE1 A;  2CY4 A;  2ELB A;  5DHA B;  4L6E A;  2FJL A;  4KHO A;  1TQZ A;  1V5P A;  4Y94 A;  5D3W A;  5D3X A;  2I1J A;  1ZYI A;  2L1C A;  1U5E A;  5D3V A;  1MI1 A;  5D27 A;  1J19 A;  2DYQ A;  2DTC A;  1RJ2 A;  1UNP A;  3NWD A;  3RCP A;  5J3Q A;  1U5G A;  2R0D A;  4IAP A;  2IYB A;  1W1H A;  1WI1 A;  4HB4 B;  2K00 A;  1BWN A;  5C79 A;  3WA0 A;  2LYD A;  1T77 A;  5J3T A;  2EMS A;  2QKL A;  2MKR A;  4TKN A;  2R09 A;  2CAY A;  3DXE A;  2GJY A;  4CYE A;  2D4Q A;  5GOW B;  1H10 A;  1X11 A;  1DDW A;  1ZM0 A;  4YON A;  2Y7B A;  2D2Q A;  3WYF B;  1X1F A;  2DHJ A;  3BIN A;  5JHH A;  5DI9 B;  5DHF B;  3FVC A;  2X18 A;  2DA0 A;  1V61 A;  1XOD A;  4ZRJ A;  2RRF A;  4ZRI A;  2RGN B;  1W1D A;  1KZ7 A;  1XD4 A;  3KRX A;  1U2B A;  2ZPY A;  3AU5 A;  4OSN A;  4CSQ A;  3NWA A;  3U12 A;  4KHA A;  4A6F B;  2DLW A;  1AWE A;  4F7U P;  3PEG A;  2OTX A;  3KSY A;  2FJU B;  1UPQ A;  2D11 A;  1ZC4 B;  2K49 A;  1FHX A;  2AEH A;  1GC6 A;  3T06 A;  4DX9 0;  4HAT B;  3PP2 A;  2GUM A;  1LB1 A;  5LOP B;  4EKU A;  1QC6 A;  2R2Y A;  2DKP A;  3A8P A;  2VRW B;  3ODO A;  1PFJ A;  1DYN A;  2COD A;  1OY2 A;  1MAI A;  3O96 A;  3AU4 A;  3U7D A;  4IFS A;  5I2S A;  3VIA A;  1AQC A;  1GC7 A;  3V5W A;  4BBK A;  2LOX A;  2QKM A;  4EMO A;  1MK9 B;  1SGH A;  2K2J A;  1W1G A;  5JP4 A;  2Z4D A;  2JP2 A;  2RLO A;  3ULC A;  4HAZ B;  2UZS A;  4QJ3 B;  5I2M A;  4GNK B;  3TVV A;  4K2P A;  2OQB A;  1WG7 A;  2Z13 A;  5C5B B;  3PVU A;  2GCJ A;  2Z59 A;  3N7C A;  2V76 A;  2W2X D;  3TW1 A;  3IVF A;  2J0M A;  2Z0Q A;  2N0Y A;  2D10 A;  3SNH A;  3KY9 A;  1SHC A;  1Y5O A;  2COF A;  4F7G A;  1P6S A;  3OHM B;  1FHO A;  4KVG B;  2G35 A;  3DXC A;  2I5C A;  4HB2 B;  2D9X A;  1V88 A;  5CLL B;  2MDX A;  3P6A A;  3D8F A;  1WJM A;  2EMT A;  4DIX A;  1Z87 A;  3GYO A;  2Y8F A;  1UNQ A;  1NI2 A;  4PNK A;  2DN6 A;  1NTY A;  1EF1 A;  1FHW A;  3SYX A;  3SV1 A;  4B6H A;  4D0N B;  5FI1 A;  3PSC A;  1XCG A;  1DDV A;  3FM8 C;  1EAZ A;  5J3Y A;  2MWN B;  2GS0 A;  1KI1 B;  2ADZ A;  1FGZ A;  2VSZ A;  1I2H A;  5JHG A;  3B77 A;  2MFQ A;  1E5W A;  2CY5 A;  2M14 A;  3HIE A;  4GPT B;  1OQN A;  5HE0 A;  1UPR A;  2KUQ A;  4TYZ A;  3D8E A;  1BTK A;  3ZDT A;  3QBV B;  4KHB B;  4CHM A;  4NSW A;  1NTV A;  1BAK A;  4Z2M B;  1P5T A;  2AL6 A;  2PZ1 A;  3OAN A;  2LOZ A;  4A6F A;  1LW3 A;  2I1K A;  2DX1 A;  3ZVR A;  3DCX A;  3X23 A;  3KRW A;  1X1G A;  2M38 A;  4HDQ A;  2W2W A;  2DHI A;  1V5M A;  4D6W A;  2YT2 A;  3CIK A;  4HAV B;  2NBV A;  2J59 M;  3TO1 A;  2Q13 A;  3ML4 A;  3BJI A;  4P7I A;  3HK0 A;  3A98 B;  3P7Z A;  3SUZ A;  2Z14 A;  2Y8G A;  2YS3 A;  1PLS A;  2ZKM X;  2GCL A;  3UZT A;  5C16 A;  1QQG A;  1DBH A;  1MIX A;  2P0D A;  3ODX A;  1U29 A;  1Q67 A;  1N3H A;  2RUK B;  2DX5 A;  2H7E A;  4HAW B;  1H4R A;  2ROZ B;  2NZ8 B;  2W2X C;  1FAO A;  2BCJ A;  5C5B A;  2RVB B;  3A8Q A;  2EC1 A;  3CXB B;  3U8Z A;  1MPH A;  2D9V A;  5FI0 A;  2DHK A;  4GMV A;  2I5F A;  2J0J A;  3FSS A;  3FEH A;  4GZU A;  2YT1 A;  4ZRK A;  1IRS A;  4QJ5 B;  1MKE A;  2J0K A;  2YSZ A;  4WVF B;  2P0H A;  1M7E A;  5DH9 B;  2RSG A;  5M4Y B;  1RRP B;  4C0A A;  4CHJ A;  1XR0 B;  2EJ8 A;  2KIG A;  1ZVR A;  5HE3 A;  4K2O A;  4HB3 B;  4HAY B;  4GN1 A;  5EFX A;  4DX8 A;  2P8V A;  5IRS A;  1MIZ B;  4DXA B;  2YT0 A;  2VKI A;  1U5F A;  4QJ4 B;  4L1R A;  1EVH A;  3D8D A;  4A6K A;  2KUP A;  2RNR B;  1Y19 B;  2YRY A;  4GMX B;  5LON B;  1DRO A;  1XKE A;  1ISN A;  2COC A;  1XX0 A;  1WGU A;  4HAX B;  3DXD A;  4QXA B;  1X05 A;  4IOY X;  3QIJ A;  3SO6 A;  4KHB A;  2YF0 A;  2DYN A;  2YVC A;  2XQN M;  2ROV A;  5KQ4 A;  3LJU X;  5CLQ B; 
#chains in the Genus database with same CATH homology
 1GG3 A;  1U27 A;  2YS1 A;  3PZD A;  5D3Y A;  2ELA A;  3ULB A;  3M1I B;  4HDO A;  2CRF A;  2NMB A;  2LUL A;  4MY6 A;  4F7H A;  4DBB A;  2K2U A;  3MPX A;  3HW2 B;  2D9Y A;  5DIF B;  1K5G B;  2Z0P A;  1U5D A;  2UZR A;  5JLJ B;  3GYP A;  1OMW A;  4NY0 A;  4GXB A;  4A5K A;  5HE2 A;  2LG1 A;  2E2X A;  2H7D A;  1WVH A;  2KGX B;  3F5R A;  2IFS A;  3PVL A;  1KZG A;  1ZC3 B;  2D9Z A;  4HB0 B;  5C6R A;  1DDM A;  3PG7 A;  3HQC A;  1UEF A;  3PVW A;  1FGY A;  2HTH B;  1FOE A;  1WJ1 A;  1X86 A;  3NSU A;  4HAU B;  4K17 A;  3MDB C;  2D9W A;  2P0F A;  4XWX A;  3TFM A;  1ZSQ A;  1FB8 A;  1NU2 A;  4K81 A;  4WSF A;  2N23 A;  1I7A A;  1UNR A;  2UVM A;  4HHV A;  1M7R A;  1V89 A;  3TCA A;  4EJN A;  4MK0 A;  2DKQ A;  4Z2N A;  1TJ6 A;  1BTN A;  1TXD A;  2HE7 A;  2Z0O A;  1WGQ A;  4MT7 A;  1EGX A;  1P3R A;  3KZ1 A;  3VOQ A;  3G9W A;  5KQ1 A;  3F0W A;  2KCJ A;  2LKO A;  4YL8 A;  4KAX B;  3AJ4 A;  4WJ7 A;  4A6H A;  2L2I A;  1B55 A;  5KCV A;  2YS5 A;  4H8S A;  2COA A;  3QWM A;  2DFK A;  3ODW A;  4PQ0 A;  1MK7 B;  1V5U A;  5L81 A;  1J0W A;  1K5D B;  1PMS A;  5HE1 A;  2CY4 A;  2ELB A;  5DHA B;  4L6E A;  2FJL A;  4KHO A;  1TQZ A;  1V5P A;  4Y94 A;  5D3W A;  5D3X A;  2I1J A;  2L1C A;  1U5E A;  5D3V A;  5D27 A;  1J19 A;  2DYQ A;  2DTC A;  1RJ2 A;  1UNP A;  3RCP A;  5J3Q A;  1U5G A;  2R0D A;  4IAP A;  2IYB A;  1W1H A;  1WI1 A;  4HB4 B;  2K00 A;  1BWN A;  5C79 A;  3WA0 A;  2LYD A;  5J3T A;  2EMS A;  2QKL A;  2MKR A;  4TKN A;  2R09 A;  2CAY A;  3DXE A;  2GJY A;  4CYE A;  2D4Q A;  5GOW B;  1H10 A;  1X11 A;  1DDW A;  1ZM0 A;  4YON A;  2Y7B A;  2D2Q A;  3WYF B;  1X1F A;  2DHJ A;  3BIN A;  5JHH A;  5DI9 B;  5DHF B;  2X18 A;  2DA0 A;  1V61 A;  1XOD A;  4ZRJ A;  4ZRI A;  2RGN B;  1W1D A;  1KZ7 A;  1XD4 A;  3KRX A;  1U2B A;  2ZPY A;  3AU5 A;  4KHA A;  4A6F B;  2DLW A;  1AWE A;  4F7U P;  3PEG A;  2OTX A;  3KSY A;  1UPQ A;  2D11 A;  1ZC4 B;  1FHX A;  2AEH A;  1GC6 A;  3T06 A;  4DX9 0;  4HAT B;  3PP2 A;  1LB1 A;  5LOP B;  4EKU A;  1QC6 A;  2DKP A;  3A8P A;  2VRW B;  3ODO A;  1PFJ A;  1DYN A;  2COD A;  1OY2 A;  1MAI A;  3O96 A;  3AU4 A;  3U7D A;  4IFS A;  3VIA A;  1AQC A;  1GC7 A;  3V5W A;  4BBK A;  2LOX A;  2QKM A;  4EMO A;  1MK9 B;  1SGH A;  2K2J A;  1W1G A;  5JP4 A;  2JP2 A;  2RLO A;  3ULC A;  4HAZ B;  2UZS A;  3TVV A;  4K2P A;  2OQB A;  1WG7 A;  5C5B B;  3PVU A;  2GCJ A;  3N7C A;  2V76 A;  2W2X D;  3TW1 A;  3IVF A;  2J0M A;  2Z0Q A;  2N0Y A;  2D10 A;  3SNH A;  3KY9 A;  1SHC A;  1Y5O A;  2COF A;  4F7G A;  1P6S A;  1FHO A;  4KVG B;  2G35 A;  3DXC A;  2I5C A;  4HB2 B;  2D9X A;  1V88 A;  5CLL B;  2MDX A;  3P6A A;  3D8F A;  1WJM A;  2EMT A;  1Z87 A;  3GYO A;  2Y8F A;  1UNQ A;  1NI2 A;  4PNK A;  2DN6 A;  1NTY A;  1EF1 A;  1FHW A;  3SYX A;  3SV1 A;  4B6H A;  4D0N B;  5FI1 A;  3PSC A;  1XCG A;  1DDV A;  3FM8 C;  1EAZ A;  5J3Y A;  2MWN B;  2GS0 A;  1KI1 B;  2ADZ A;  1FGZ A;  2VSZ A;  1I2H A;  5JHG A;  2MFQ A;  1E5W A;  2CY5 A;  2M14 A;  4GPT B;  1OQN A;  5HE0 A;  1UPR A;  4TYZ A;  3D8E A;  1BTK A;  3ZDT A;  3QBV B;  4KHB B;  4CHM A;  4NSW A;  1NTV A;  1BAK A;  4Z2M B;  1P5T A;  2AL6 A;  2PZ1 A;  3OAN A;  2LOZ A;  4A6F A;  1LW3 A;  2I1K A;  2DX1 A;  3ZVR A;  3X23 A;  3KRW A;  1X1G A;  2M38 A;  4HDQ A;  2W2W A;  2DHI A;  1V5M A;  3CIK A;  4HAV B;  2J59 M;  3TO1 A;  2Q13 A;  3ML4 A;  3BJI A;  4P7I A;  3HK0 A;  3A98 B;  3P7Z A;  3SUZ A;  2Y8G A;  2YS3 A;  1PLS A;  2GCL A;  3UZT A;  5C16 A;  1QQG A;  1DBH A;  1MIX A;  2P0D A;  3ODX A;  1U29 A;  1Q67 A;  1N3H A;  2RUK B;  2DX5 A;  2H7E A;  4HAW B;  1H4R A;  2ROZ B;  2NZ8 B;  2W2X C;  1FAO A;  2BCJ A;  5C5B A;  2RVB B;  3A8Q A;  2EC1 A;  3CXB B;  3U8Z A;  1MPH A;  2D9V A;  5FI0 A;  2DHK A;  4GMV A;  2I5F A;  2J0J A;  3FSS A;  3FEH A;  4GZU A;  2YT1 A;  4ZRK A;  1IRS A;  1MKE A;  2J0K A;  2YSZ A;  4WVF B;  2P0H A;  1M7E A;  5DH9 B;  2RSG A;  1RRP B;  4C0A A;  4CHJ A;  1XR0 B;  2EJ8 A;  1ZVR A;  5HE3 A;  4K2O A;  4HB3 B;  4HAY B;  4GN1 A;  5EFX A;  4DX8 A;  2P8V A;  1MIZ B;  4DXA B;  2YT0 A;  2VKI A;  1U5F A;  1EVH A;  3D8D A;  4A6K A;  2KUP A;  2RNR B;  1Y19 B;  2YRY A;  4GMX B;  5LON B;  1DRO A;  1XKE A;  1ISN A;  2COC A;  1XX0 A;  1WGU A;  4HAX B;  3DXD A;  1X05 A;  4IOY X;  3QIJ A;  3SO6 A;  2YF0 A;  2DYN A;  2YVC A;  2XQN M;  2ROV A;  5KQ4 A;  3LJU X;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...