3HIEA

Structure of the membrane-binding domain of the sec3 subunit of the exocyst complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
165
structure length
161
Chain Sequence
SNFLAEQYERDRKAIINCCFSRPGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKPNNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTMSKKYYWETNSAKERTVFIKSLITLYIQTFEGHVPELVNWDLSLFYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Exocytosis
molecule keywords Exocyst complex component SEC3
publication title Structure-function study of the N-terminal domain of exocyst subunit Sec3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 161
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15277 Sec3-PIP2_bind Exocyst complex component SEC3 N-terminal PIP2 binding PH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.90 Mainly Beta Roll PH-domain like PH-domain like 3hieA01
3A58A 5LG4B 3HIEA 5M4YB
chains in the Genus database with same CATH superfamily
4IAPA 2FJUB 5D3VA 4L6EA 2CY5A 3P6AA 1P6SA 3V5WA 3MDBC 2X18A 1DYNA 1UPRA 1MAIA 2N23A 1Q67A 1V89A 2EC1A 2LKOA 2YS3A 2ZPYA 4P7IA 5D3XA 2GUMA 4H8SA 3U12A 5D3WA 5JHHA 1WVHA 3ULBA 4HAXB 3CXBB 3O96A 4Z2MB 5FI1A 4F7HA 1WG7A 3HW2B 5LG4B 4OSNA 3NWFA 3F5RA 5C5BA 5C79A 3AU4A 2IFSA 1M7EA 4D0NB 3A98B 4DX90 1H4RA 2MKRA 2ELAA 4KHOA 1V88A 3SV1A 4TKNA 1UNQA 1WGQA 1DDWA 3PEGA 5I2SA 2CRFA 3PZDA 4GPTB 5J3QA 4ZRJA 2YSZA 1WGUA 3PSCA 3TFMA 1BTNA 3N7CA 3DCXA 2OTXA 3TVVA 2G35A 3FEHA 1NI2A 1I2HA 3QBVB 4HB3B 1V61A 5HE2A 4GNKB 1MIXA 3P7ZA 2KUPA 2H7DA 2LG1A 2YT0A 1U29A 2FJLA 5I2MA 3DXEA 1X11A 2COFA 1OMWA 2DLWA 2EJ8A 2Z13A 4A6KA 1NTVA 2KUQA 3T06A 1ZVRA 2RGNB 1K5GB 5L81A 1GC7A 1OQNA 2KGXB 2YT2A 1ZC4B 2AL6A 2K8EA 1MI1A 3MPXA 1XKEA 2DTCA 4DX8A 3SYXA 4NSWA 1KZGA 3A8QA 2MDXA 2YF0A 5HE3A 1XCGA 2UZRA 2D11A 1PLSA 1GC6A 2DHIA 2M38A 2J0MA 1LW3A 1QQGA 4K17A 1WJMA 4HDOA 4HDQA 1X1FA 3SNHA 2D10A 2I5FA 3FM8C 4QJ3B 4CSQA 1SHCA 1EGXA 2V76A 1EVHA 1PMSA 3UZTA 1U2BA 1WJ1A 2L2IA 3BJIA 1V5PA 3B77A 3VIAA 4YL8A 1AWEA 4KVGB 4QJ4B 1P5TA 5DH9B 2N0YA 5KQ1A 1MK7B 1N3HA 4CHMA 4NY0A 4MY6A 2J0KA 5C16A 1FHXA 3U7DA 4HAWB 2DX1A 1UPQA 4MT7A 1E5WA 2DKPA 3KSYA 1XODA 4HATB 5KCVA 2HTHB 2XQNM 3IVFA 4GZUA 5J3TA 4KHBA 2M14A 3HQCA 2RLOA 2D9YA 3SUZA 3KY9A 2Z0OA 2UVMA 2NBVA 4D6WA 3ODWA 1W1HA 2Z14A 2AEHA 1IRSA 2ROVA 2J0JA 2UZSA 2KCJA 2J59M 4DBBA 2COCA 4HB2B 4A6FA 2DA0A 3LJUX 2LULA 2P8VA 1U27A 2H7EA 4F7UP 1ZC3B 3HIEA 1NTYA 2Z0QA 2Y8GA 1BTKA 2YVCA 1UNPA 1W1GA 1ZSQA 2RRFA 4QJ5B 2MFQA 1UEFA 2YT1A 1V5UA 1X86A 4C0AA 2DN6A 1P3RA 2GCLA 2Z4DA 2KIGA 2ADZA 2P0HA 3A58A 1ISNA 4GOUA 4EMOA 4ZRKA 4HAVB 1MPHA 2W2WA 1PFJA 4WVFB 4YONA 2DHJA 1V5MA 5FI0A 2VKIA 3KRWA 1J0WA 2Y7BA 2VRWB 2D4QA 2QKLA 5DIFB 4GXBA 5CLQB 2RVBB 3D8EA 1U5GA 4K81A 1TJ6A 1U5EA 3NSUA 3WA0A 2YS5A 4GMXB 4CHJA 3CIKA 4GN1A 1ZM0A 4EKUA 1BAKA 1RRPB 3PP2A 4BBKA 2EMSA 3OANA 2Y8FA 1MK9B 3ODXA 2D2QA 5C5BB 2E2XA 5DHFB 4CYEA 1BWNA 1H10A 3NWDA 4IOYX 1K5DB 1FHOA 1AQCA 1WI1A 1FOEA 4HHVA 2RUKB 2L1CA 4A6FB 4WSFA 4Y94A 2W2XD 1UNRA 5IRSA 3ZDTA 5J3YA 4QXAB 2DYQA 2K49A 2I1JA 4IFSA 2DFKA 4HAYB 2OQBA 4DIXA 1Y5OA 3SO6A 3TO1A 4PNKA 5D3YA 2P0FA 1B55A 1NU2A 1FGZA 4KAXB 2R09A 4MK0A 1DDVA 2DX5A 4Z2NA 1X1GA 5CLLB 3FVCA 4HAUB 5C6RA 2ROZB 1FGYA 4OT1A 1Y19B 3AU5A 3ZVRA 2K00A 1U5FA 1J19A 3X23A 4GMVA 1T77A 2DYNA 3QIJA 2HE7A 4WJ7A 2PZ1A 1W1DA 2D9ZA 1LB1A 3DXDA 2D9XA 2EMTA 5GOWB 5DHAB 3TW1A 1FAOA 5HE0A 2KR0A 4TYZA 5DI9B 3FSSA 2D9WA 4A6HA 1MKEA 3AJ4A 2DHKA 3A8PA 5D27A 1TQZA 5JLJB 4B6HA 1TXDA 1ZYIA 4HB0B 2GCJA 2RNRB 4KHAA 3VOQA 2Z0PA 2R0DA 2YRYA 3ODOA 3PVWA 3RCPA 4EJNA 1I7AA 4K2PA 3BINA 1XD4A 3F0WA 1FHWA 3HK0A 2LYDA 1EAZA 1EF1A 3G9WA 2BCJA 2JP2A 4HB4B 2LOZA 3DXCA 2CY4A 5M4YB 1RJ2A 1U5DA 2CODA 4DXAB 1OY2A 2RSGA 2MWNB 2NZ8B 3GYOA 2CAYA 3GYPA 3ML4A 3KZ1A 2COAA 4KHBB 3U8ZA 5LOPB 1XX0A 1FB8A 2VSZA 3KRXA 2I1KA 2Z59A 4F7GA 2NMBA 5JP4A 3M1IB 3PVUA 2I5CA 4HAZB 4L1RA 2K2UA 2IYBA 1MIZB 3D8DA 3QWMA 4A5KA 3PG7A 2P0DA 4K2OA 4XWXA 2YS1A 2ZKMX 1DROA 4PQ0A 2KIEA 5LONB 1DBHA 5KQ4A 1X05A 1Z87A 1GG3A 5HE1A 3NW8A 3D8FA 1KZ7A 4ZRIA 1SGHA 2QKMA 1XR0B 2ELBA 2W2XC 3NWAA 4HSIA 2GS0A 2D9VA 3HSAA 1QC6A 3PVLA 5JHGA 3ULCA 3TCAA 1DDMA 3WYFB 3OHMB 1KI1B 5EFXA 1M7RA 2R2YA 2Q13A 2DKQA 2K2JA 2LOXA 2GJYA
chains in the Genus database with same CATH topology
2RRFA 2FJUB 3NWAA 3NWDA 4IOYX 4HSIA 2Z59A 4DIXA 4KHBA 3TO1A 4QJ5B 4L1RA 3TVVA 2NBVA 4D6WA 2YT2A 1ZYIA 2Z14A 2GCLA 2K8EA 2Z4DA 2GCJA 2ZKMX 5M4YB 3TW1A 2KIGA 4QJ4B 4GNKB 4KHAA 3OHMB 3A58A 2KIEA 4PQ0A 4GOUA 4QJ3B 4CSQA 5IRSA 4Z2NA 4KHOA 3FVCA 2GUMA 3U12A 2KR0A 2R2YA 5I2MA 3FSSA 4OT1A 4QXAB 3GYOA 3NW8A 4OSNA 3GYPA 5I2SA 4Z2MB 2K49A 2Z13A 3HIEA 4KHBB 4IFSA 5LG4B 2KUQA 3NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A58 A;  5LG4 B;  3HIE A;  5M4Y B; 
#chains in the Genus database with same CATH topology
 4IAP A;  2FJU B;  5D3V A;  4L6E A;  2CY5 A;  3P6A A;  1P6S A;  3V5W A;  3MDB C;  2X18 A;  1DYN A;  1UPR A;  1MAI A;  2N23 A;  1Q67 A;  1V89 A;  2EC1 A;  2LKO A;  2YS3 A;  2ZPY A;  4P7I A;  5D3X A;  2GUM A;  4H8S A;  3U12 A;  5D3W A;  5JHH A;  1WVH A;  3ULB A;  4HAX B;  3CXB B;  3O96 A;  4Z2M B;  5FI1 A;  4F7H A;  1WG7 A;  3HW2 B;  5LG4 B;  4OSN A;  3NWF A;  3F5R A;  5C5B A;  5C79 A;  3AU4 A;  2IFS A;  1M7E A;  4D0N B;  3A98 B;  4DX9 0;  1H4R A;  2MKR A;  2ELA A;  4KHO A;  1V88 A;  3SV1 A;  4TKN A;  1UNQ A;  1WGQ A;  1DDW A;  3PEG A;  5I2S A;  2CRF A;  3PZD A;  4GPT B;  5J3Q A;  4ZRJ A;  2YSZ A;  1WGU A;  3PSC A;  3TFM A;  1BTN A;  3N7C A;  3DCX A;  2OTX A;  3TVV A;  2G35 A;  3FEH A;  1NI2 A;  1I2H A;  3QBV B;  4HB3 B;  1V61 A;  5HE2 A;  4GNK B;  1MIX A;  3P7Z A;  2KUP A;  2H7D A;  2LG1 A;  2YT0 A;  1U29 A;  2FJL A;  5I2M A;  3DXE A;  1X11 A;  2COF A;  1OMW A;  2DLW A;  2EJ8 A;  2Z13 A;  4A6K A;  1NTV A;  2KUQ A;  3T06 A;  1ZVR A;  2RGN B;  1K5G B;  5L81 A;  1GC7 A;  1OQN A;  2KGX B;  2YT2 A;  1ZC4 B;  2AL6 A;  2K8E A;  1MI1 A;  3MPX A;  1XKE A;  2DTC A;  4DX8 A;  3SYX A;  4NSW A;  1KZG A;  3A8Q A;  2MDX A;  2YF0 A;  5HE3 A;  1XCG A;  2UZR A;  2D11 A;  1PLS A;  1GC6 A;  2DHI A;  2M38 A;  2J0M A;  1LW3 A;  1QQG A;  4K17 A;  1WJM A;  4HDO A;  4HDQ A;  1X1F A;  3SNH A;  2D10 A;  2I5F A;  3FM8 C;  4QJ3 B;  4CSQ A;  1SHC A;  1EGX A;  2V76 A;  1EVH A;  1PMS A;  3UZT A;  1U2B A;  1WJ1 A;  2L2I A;  3BJI A;  1V5P A;  3B77 A;  3VIA A;  4YL8 A;  1AWE A;  4KVG B;  4QJ4 B;  1P5T A;  5DH9 B;  2N0Y A;  5KQ1 A;  1MK7 B;  1N3H A;  4CHM A;  4NY0 A;  4MY6 A;  2J0K A;  5C16 A;  1FHX A;  3U7D A;  4HAW B;  2DX1 A;  1UPQ A;  4MT7 A;  1E5W A;  2DKP A;  3KSY A;  1XOD A;  4HAT B;  5KCV A;  2HTH B;  2XQN M;  3IVF A;  4GZU A;  5J3T A;  4KHB A;  2M14 A;  3HQC A;  2RLO A;  2D9Y A;  3SUZ A;  3KY9 A;  2Z0O A;  2UVM A;  2NBV A;  4D6W A;  3ODW A;  1W1H A;  2Z14 A;  2AEH A;  1IRS A;  2ROV A;  2J0J A;  2UZS A;  2KCJ A;  2J59 M;  4DBB A;  2COC A;  4HB2 B;  4A6F A;  2DA0 A;  3LJU X;  2LUL A;  2P8V A;  1U27 A;  2H7E A;  4F7U P;  1ZC3 B;  3HIE A;  1NTY A;  2Z0Q A;  2Y8G A;  1BTK A;  2YVC A;  1UNP A;  1W1G A;  1ZSQ A;  2RRF A;  4QJ5 B;  2MFQ A;  1UEF A;  2YT1 A;  1V5U A;  1X86 A;  4C0A A;  2DN6 A;  1P3R A;  2GCL A;  2Z4D A;  2KIG A;  2ADZ A;  2P0H A;  3A58 A;  1ISN A;  4GOU A;  4EMO A;  4ZRK A;  4HAV B;  1MPH A;  2W2W A;  1PFJ A;  4WVF B;  4YON A;  2DHJ A;  1V5M A;  5FI0 A;  2VKI A;  3KRW A;  1J0W A;  2Y7B A;  2VRW B;  2D4Q A;  2QKL A;  5DIF B;  4GXB A;  5CLQ B;  2RVB B;  3D8E A;  1U5G A;  4K81 A;  1TJ6 A;  1U5E A;  3NSU A;  3WA0 A;  2YS5 A;  4GMX B;  4CHJ A;  3CIK A;  4GN1 A;  1ZM0 A;  4EKU A;  1BAK A;  1RRP B;  3PP2 A;  4BBK A;  2EMS A;  3OAN A;  2Y8F A;  1MK9 B;  3ODX A;  2D2Q A;  5C5B B;  2E2X A;  5DHF B;  4CYE A;  1BWN A;  1H10 A;  3NWD A;  4IOY X;  1K5D B;  1FHO A;  1AQC A;  1WI1 A;  1FOE A;  4HHV A;  2RUK B;  2L1C A;  4A6F B;  4WSF A;  4Y94 A;  2W2X D;  1UNR A;  5IRS A;  3ZDT A;  5J3Y A;  4QXA B;  2DYQ A;  2K49 A;  2I1J A;  4IFS A;  2DFK A;  4HAY B;  2OQB A;  4DIX A;  1Y5O A;  3SO6 A;  3TO1 A;  4PNK A;  5D3Y A;  2P0F A;  1B55 A;  1NU2 A;  1FGZ A;  4KAX B;  2R09 A;  4MK0 A;  1DDV A;  2DX5 A;  4Z2N A;  1X1G A;  5CLL B;  3FVC A;  4HAU B;  5C6R A;  2ROZ B;  1FGY A;  4OT1 A;  1Y19 B;  3AU5 A;  3ZVR A;  2K00 A;  1U5F A;  1J19 A;  3X23 A;  4GMV A;  1T77 A;  2DYN A;  3QIJ A;  2HE7 A;  4WJ7 A;  2PZ1 A;  1W1D A;  2D9Z A;  1LB1 A;  3DXD A;  2D9X A;  2EMT A;  5GOW B;  5DHA B;  3TW1 A;  1FAO A;  5HE0 A;  2KR0 A;  4TYZ A;  5DI9 B;  3FSS A;  2D9W A;  4A6H A;  1MKE A;  3AJ4 A;  2DHK A;  3A8P A;  5D27 A;  1TQZ A;  5JLJ B;  4B6H A;  1TXD A;  1ZYI A;  4HB0 B;  2GCJ A;  2RNR B;  4KHA A;  3VOQ A;  2Z0P A;  2R0D A;  2YRY A;  3ODO A;  3PVW A;  3RCP A;  4EJN A;  1I7A A;  4K2P A;  3BIN A;  1XD4 A;  3F0W A;  1FHW A;  3HK0 A;  2LYD A;  1EAZ A;  1EF1 A;  3G9W A;  2BCJ A;  2JP2 A;  4HB4 B;  2LOZ A;  3DXC A;  2CY4 A;  5M4Y B;  1RJ2 A;  1U5D A;  2COD A;  4DXA B;  1OY2 A;  2RSG A;  2MWN B;  2NZ8 B;  3GYO A;  2CAY A;  3GYP A;  3ML4 A;  3KZ1 A;  2COA A;  4KHB B;  3U8Z A;  5LOP B;  1XX0 A;  1FB8 A;  2VSZ A;  3KRX A;  2I1K A;  2Z59 A;  4F7G A;  2NMB A;  5JP4 A;  3M1I B;  3PVU A;  2I5C A;  4HAZ B;  4L1R A;  2K2U A;  2IYB A;  1MIZ B;  3D8D A;  3QWM A;  4A5K A;  3PG7 A;  2P0D A;  4K2O A;  4XWX A;  2YS1 A;  2ZKM X;  1DRO A;  4PQ0 A;  2KIE A;  5LON B;  1DBH A;  5KQ4 A;  1X05 A;  1Z87 A;  1GG3 A;  5HE1 A;  3NW8 A;  3D8F A;  1KZ7 A;  4ZRI A;  1SGH A;  2QKM A;  1XR0 B;  2ELB A;  2W2X C;  3NWA A;  4HSI A;  2GS0 A;  2D9V A;  3HSA A;  1QC6 A;  3PVL A;  5JHG A;  3ULC A;  3TCA A;  1DDM A;  3WYF B;  3OHM B;  1KI1 B;  5EFX A;  1M7R A;  2R2Y A;  2Q13 A;  2DKQ A;  2K2J A;  2LOX A;  2GJY A; 
#chains in the Genus database with same CATH homology
 2RRF A;  2FJU B;  3NWA A;  3NWD A;  4IOY X;  4HSI A;  2Z59 A;  4DIX A;  4KHB A;  3TO1 A;  4QJ5 B;  4L1R A;  3TVV A;  2NBV A;  4D6W A;  2YT2 A;  1ZYI A;  2Z14 A;  2GCL A;  2K8E A;  2Z4D A;  2GCJ A;  2ZKM X;  5M4Y B;  3TW1 A;  2KIG A;  4QJ4 B;  4GNK B;  4KHA A;  3OHM B;  3A58 A;  2KIE A;  4PQ0 A;  4GOU A;  4QJ3 B;  4CSQ A;  5IRS A;  4Z2N A;  4KHO A;  3FVC A;  2GUM A;  3U12 A;  2KR0 A;  2R2Y A;  5I2M A;  3FSS A;  4OT1 A;  4QXA B;  3GYO A;  3NW8 A;  4OSN A;  3GYP A;  5I2S A;  4Z2M B;  2K49 A;  2Z13 A;  3HIE A;  4KHB B;  4IFS A;  5LG4 B;  2KUQ A;  3NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...