3HIEA

Structure of the membrane-binding domain of the sec3 subunit of the exocyst complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
165
structure length
161
Chain Sequence
b'SNFLAEQYERDRKAIINCCFSRPGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKPNNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTMSKKYYWETNSAKERTVFIKSLITLYIQTFEGHVPELVNWDLSLFYLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component SEC3
publication title Structure-function study of the N-terminal domain of exocyst subunit Sec3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Exocytosis
total genus 42
structure length 161
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15277 Sec3-PIP2_bind Exocyst complex component SEC3 N-terminal PIP2 binding PH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.90 Mainly Beta Roll PH-domain like PH-domain like 3hieA01
3A58A 5M4YB 3HIEA 5LG4B
chains in the Genus database with same CATH superfamily
1RJ2A 4YL8A 1DBHA 4F7GA 3TCAA 2KIGA 2RUKB 4Y94A 2YVCA 4HAYB 2MWNB 3BJIA 4GMXB 4YONA 5JHGA 2UZRA 1MIXA 2D10A 5LONB 1FHWA 2VSZA 3D8DA 3M1IB 1PLSA 1KZ7A 2CY5A 1T77A 1AWEA 3A8QA 1LB1A 4EJNA 3AU4A 4DBBA 4HAWB 2Q13A 4H8SA 1OQNA 1BAKA 3F0WA 5CLLB 3VIAA 2P0HA 3ODWA 4XWXA 1U2BA 3SO6A 2ROZB 5HE1A 1V61A 1Z87A 2LOXA 2RGNB 3KSYA 2CRFA 4EMOA 1J0WA 3CXBB 1P5TA 4MY6A 2FJUB 2KCJA 4BBKA 3PP2A 5L81A 4B6HA 3MDBC 2EMTA 1U5DA 4TYZA 2W2XD 2X18A 1I7AA 1ZC3B 1K5DB 2H7DA 4K2PA 1FAOA 2Z59A 2IFSA 2P0DA 1MPHA 1BWNA 4GXBA 1MK9B 2N0YA 4OSNA 2LOZA 4DX90 1B55A 3A98B 1W1DA 2ZKMX 4KAXB 1PMSA 1Q67A 2LKOA 2RSGA 2W2WA 2AL6A 2I1JA 4HB4B 1EF1A 1SGHA 2BCJA 3NSUA 3NW8A 2RNRB 4WJ7A 1MIZB 2HE7A 2DTCA 1OY2A 1H10A 2XQNM 3KRXA 3ULCA 4K81A 3KZ1A 5C5BB 2DFKA 4GOUA 4OT1A 5D3XA 1EGXA 2YT0A 1DYNA 1FB8A 2COFA 3FVCA 3G9WA 5C79A 5JLJB 2YT1A 5IRSA 4IOYX 2K2UA 2Y7BA 3PVWA 2DX1A 2GUMA 1DDMA 5KQ1A 4F7HA 4WVFB 5HE3A 1MI1A 5FI1A 3TVVA 1IRSA 1XODA 4C0AA 3U7DA 2P0FA 2J0MA 1U27A 1Y5OA 4HDQA 1NTVA 5LOPB 2DHKA 2D4QA 3V5WA 3PZDA 1KI1B 2YRYA 2J0KA 5D3WA 4A6KA 2IYBA 5DHAB 1MKEA 2L1CA 1V5UA 2PZ1A 3PVUA 4CSQA 1U29A 4KVGB 1X1FA 2YT2A 4QXAB 2D9ZA 2EC1A 4GN1A 2K8EA 3U12A 1DDVA 3LJUX 2I1KA 1WVHA 5C5BA 2VKIA 2EJ8A 2ZPYA 2R09A 5KQ4A 4GZUA 1SHCA 2DKPA 4A6HA 3BINA 4HAVB 1DDWA 2DYNA 2DLWA 1BTNA 2D9XA 1WGQA 2COCA 2CODA 1FGYA 1XKEA 1ZSQA 1N3HA 4NY0A 1UPQA 2G35A 4HSIA 4F7UP 1P6SA 1V5PA 2MDXA 1KZGA 3ODXA 1UEFA 1AQCA 3RCPA 5HE0A 3N7CA 3UZTA 1V5MA 5D3YA 2MKRA 4KHOA 5HE2A 2UVMA 2NZ8B 1ZM0A 1FHXA 4KHBB 1BTKA 2YF0A 4HHVA 2DKQA 2I5CA 3PG7A 1X86A 3HW2B 2LG1A 4IAPA 3FM8C 2Z14A 2NMBA 3U8ZA 2DX5A 2W2XC 1MK7B 1LW3A 4L1RA 1U5EA 1U5FA 2GCLA 3OHMB 4WSFA 4DX8A 4IFSA 2ELBA 2MFQA 4ZRJA 1FGZA 4A5KA 5DIFB 2E2XA 4HAUB 5DI9B 4QJ5B 4HDOA 1E5WA 2Z13A 1TQZA 4A6FB 1M7RA 2YSZA 2D2QA 1NI2A 1QC6A 2M14A 4L6EA 2RVBB 1WGUA 1XD4A 3HK0A 1FHOA 4HAXB 5EFXA 3HSAA 4D0NB 4MK0A 4KHBA 3GYOA 2K49A 3NWDA 3CIKA 3FEHA 1ISNA 1J19A 1M7EA 4K2OA 1X11A 1UNPA 2K2JA 4KHAA 2KUQA 3HIEA 2CAYA 3D8FA 2DHJA 5J3YA 3D8EA 4MT7A 3SNHA 2Z4DA 5I2SA 3P6AA 2N23A 4P7IA 5I2MA 2V76A 1WI1A 1W1HA 2DYQA 3A8PA 1RRPB 3DCXA 3WYFB 4HATB 1V89A 2COAA 2DA0A 3QIJA 1ZC4B 5C6RA 1EAZA 3SV1A 3ODOA 3TFMA 3VOQA 5GOWB 4HB3B 2GCJA 4TKNA 1UPRA 2LULA 4QJ4B 5LG4B 3MPXA 2KR0A 4GNKB 2D11A 4A6FA 2R0DA 5J3QA 1PFJA 1X05A 1DROA 3NWFA 4Z2NA 1XR0B 1OMWA 4HB2B 3SYXA 2QKLA 2Z0OA 1I2HA 4D6WA 3HQCA 4CHJA 2RLOA 3A58A 2AEHA 3O96A 1UNRA 3ZVRA 4CHMA 2LYDA 1Y19B 3T06A 2ELAA 3KY9A 4HAZB 4ZRKA 2OTXA 4DXAB 4EKUA 2YS5A 1U5GA 5CLQB 2J59M 2KGXB 5JP4A 1W1GA 2H7EA 3NWAA 1WG7A 1X1GA 2JP2A 3ULBA 1EVHA 1WJMA 4ZRIA 3TO1A 2DHIA 3SUZA 2D9WA 2Z0PA 2L2IA 4DIXA 3PEGA 4GMVA 2OQBA 2QKMA 4GPTB 3FSSA 4NSWA 3X23A 4PNKA 1FOEA 2FJLA 2Y8GA 1H4RA 2YS3A 2M38A 3P7ZA 1UNQA 2VRWB 3OANA 3WA0A 5KCVA 3ML4A 2D9VA 2J0JA 2KUPA 3AJ4A 2YS1A 3PSCA 1GG3A 5DHFB 3DXDA 1TXDA 1ZYIA 1P3RA 5D3VA 1XCGA 1V88A 2RRFA 4K17A 2KIEA 1GC7A 2CY4A 2Z0QA 3DXEA 5M4YB 2P8VA 4QJ3B 2GS0A 1TJ6A 1MAIA 1QQGA 3TW1A 5J3TA 2HTHB 4CYEA 2UZSA 2R2YA 3KRWA 1NTYA 1NU2A 3AU5A 3DXCA 3QBVB 5JHHA 4HB0B 2D9YA 3QWMA 2Y8FA 3PVLA 3B77A 1GC6A 3F5RA 2K00A 2EMSA 3IVFA 3ZDTA 1ZVRA 2ROVA 5C16A 4PQ0A 5D27A 2ADZA 2NBVA 1WJ1A 1XX0A 5DH9B 5FI0A 2GJYA 2I5FA 4Z2MB 3GYPA 2DN6A 1K5GB
chains in the Genus database with same CATH topology
3GYOA 2K49A 3NWDA 4D6WA 4QJ5B 3TO1A 2GUMA 4DIXA 3NW8A 2Z14A 2KIGA 3A58A 2Z13A 1ZYIA 4KHAA 2KUQA 2Z59A 3HIEA 4KHOA 2RRFA 4CSQA 2KIEA 2GCJA 5LG4B 3FSSA 4GOUA 4L1RA 4QJ4B 2YT2A 4QXAB 2KR0A 2GCLA 3TVVA 2K8EA 3OHMB 3U12A 4OT1A 4KHBB 4GNKB 5M4YB 4IFSA 2Z4DA 4OSNA 4QJ3B 5I2SA 3FVCA 4PQ0A 3NWFA 3TW1A 4Z2NA 2FJUB 5I2MA 3NWAA 2NBVA 2ZKMX 2R2YA 4HSIA 5IRSA 4IOYX 4Z2MB 4KHBA 3GYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A58 A;  5M4Y B;  3HIE A;  5LG4 B; 
#chains in the Genus database with same CATH topology
 1RJ2 A;  4YL8 A;  1DBH A;  4F7G A;  3TCA A;  2KIG A;  2RUK B;  4Y94 A;  2YVC A;  4HAY B;  2MWN B;  3BJI A;  4GMX B;  4YON A;  5JHG A;  2UZR A;  1MIX A;  2D10 A;  5LON B;  1FHW A;  2VSZ A;  3D8D A;  3M1I B;  1PLS A;  1KZ7 A;  2CY5 A;  1T77 A;  1AWE A;  3A8Q A;  1LB1 A;  4EJN A;  3AU4 A;  4DBB A;  4HAW B;  2Q13 A;  4H8S A;  1OQN A;  1BAK A;  3F0W A;  5CLL B;  3VIA A;  2P0H A;  3ODW A;  4XWX A;  1U2B A;  3SO6 A;  2ROZ B;  5HE1 A;  1V61 A;  1Z87 A;  2LOX A;  2RGN B;  3KSY A;  2CRF A;  4EMO A;  1J0W A;  3CXB B;  1P5T A;  4MY6 A;  2FJU B;  2KCJ A;  4BBK A;  3PP2 A;  5L81 A;  4B6H A;  3MDB C;  2EMT A;  1U5D A;  4TYZ A;  2W2X D;  2X18 A;  1I7A A;  1ZC3 B;  1K5D B;  2H7D A;  4K2P A;  1FAO A;  2Z59 A;  2IFS A;  2P0D A;  1MPH A;  1BWN A;  4GXB A;  1MK9 B;  2N0Y A;  4OSN A;  2LOZ A;  4DX9 0;  1B55 A;  3A98 B;  1W1D A;  2ZKM X;  4KAX B;  1PMS A;  1Q67 A;  2LKO A;  2RSG A;  2W2W A;  2AL6 A;  2I1J A;  4HB4 B;  1EF1 A;  1SGH A;  2BCJ A;  3NSU A;  3NW8 A;  2RNR B;  4WJ7 A;  1MIZ B;  2HE7 A;  2DTC A;  1OY2 A;  1H10 A;  2XQN M;  3KRX A;  3ULC A;  4K81 A;  3KZ1 A;  5C5B B;  2DFK A;  4GOU A;  4OT1 A;  5D3X A;  1EGX A;  2YT0 A;  1DYN A;  1FB8 A;  2COF A;  3FVC A;  3G9W A;  5C79 A;  5JLJ B;  2YT1 A;  5IRS A;  4IOY X;  2K2U A;  2Y7B A;  3PVW A;  2DX1 A;  2GUM A;  1DDM A;  5KQ1 A;  4F7H A;  4WVF B;  5HE3 A;  1MI1 A;  5FI1 A;  3TVV A;  1IRS A;  1XOD A;  4C0A A;  3U7D A;  2P0F A;  2J0M A;  1U27 A;  1Y5O A;  4HDQ A;  1NTV A;  5LOP B;  2DHK A;  2D4Q A;  3V5W A;  3PZD A;  1KI1 B;  2YRY A;  2J0K A;  5D3W A;  4A6K A;  2IYB A;  5DHA B;  1MKE A;  2L1C A;  1V5U A;  2PZ1 A;  3PVU A;  4CSQ A;  1U29 A;  4KVG B;  1X1F A;  2YT2 A;  4QXA B;  2D9Z A;  2EC1 A;  4GN1 A;  2K8E A;  3U12 A;  1DDV A;  3LJU X;  2I1K A;  1WVH A;  5C5B A;  2VKI A;  2EJ8 A;  2ZPY A;  2R09 A;  5KQ4 A;  4GZU A;  1SHC A;  2DKP A;  4A6H A;  3BIN A;  4HAV B;  1DDW A;  2DYN A;  2DLW A;  1BTN A;  2D9X A;  1WGQ A;  2COC A;  2COD A;  1FGY A;  1XKE A;  1ZSQ A;  1N3H A;  4NY0 A;  1UPQ A;  2G35 A;  4HSI A;  4F7U P;  1P6S A;  1V5P A;  2MDX A;  1KZG A;  3ODX A;  1UEF A;  1AQC A;  3RCP A;  5HE0 A;  3N7C A;  3UZT A;  1V5M A;  5D3Y A;  2MKR A;  4KHO A;  5HE2 A;  2UVM A;  2NZ8 B;  1ZM0 A;  1FHX A;  4KHB B;  1BTK A;  2YF0 A;  4HHV A;  2DKQ A;  2I5C A;  3PG7 A;  1X86 A;  3HW2 B;  2LG1 A;  4IAP A;  3FM8 C;  2Z14 A;  2NMB A;  3U8Z A;  2DX5 A;  2W2X C;  1MK7 B;  1LW3 A;  4L1R A;  1U5E A;  1U5F A;  2GCL A;  3OHM B;  4WSF A;  4DX8 A;  4IFS A;  2ELB A;  2MFQ A;  4ZRJ A;  1FGZ A;  4A5K A;  5DIF B;  2E2X A;  4HAU B;  5DI9 B;  4QJ5 B;  4HDO A;  1E5W A;  2Z13 A;  1TQZ A;  4A6F B;  1M7R A;  2YSZ A;  2D2Q A;  1NI2 A;  1QC6 A;  2M14 A;  4L6E A;  2RVB B;  1WGU A;  1XD4 A;  3HK0 A;  1FHO A;  4HAX B;  5EFX A;  3HSA A;  4D0N B;  4MK0 A;  4KHB A;  3GYO A;  2K49 A;  3NWD A;  3CIK A;  3FEH A;  1ISN A;  1J19 A;  1M7E A;  4K2O A;  1X11 A;  1UNP A;  2K2J A;  4KHA A;  2KUQ A;  3HIE A;  2CAY A;  3D8F A;  2DHJ A;  5J3Y A;  3D8E A;  4MT7 A;  3SNH A;  2Z4D A;  5I2S A;  3P6A A;  2N23 A;  4P7I A;  5I2M A;  2V76 A;  1WI1 A;  1W1H A;  2DYQ A;  3A8P A;  1RRP B;  3DCX A;  3WYF B;  4HAT B;  1V89 A;  2COA A;  2DA0 A;  3QIJ A;  1ZC4 B;  5C6R A;  1EAZ A;  3SV1 A;  3ODO A;  3TFM A;  3VOQ A;  5GOW B;  4HB3 B;  2GCJ A;  4TKN A;  1UPR A;  2LUL A;  4QJ4 B;  5LG4 B;  3MPX A;  2KR0 A;  4GNK B;  2D11 A;  4A6F A;  2R0D A;  5J3Q A;  1PFJ A;  1X05 A;  1DRO A;  3NWF A;  4Z2N A;  1XR0 B;  1OMW A;  4HB2 B;  3SYX A;  2QKL A;  2Z0O A;  1I2H A;  4D6W A;  3HQC A;  4CHJ A;  2RLO A;  3A58 A;  2AEH A;  3O96 A;  1UNR A;  3ZVR A;  4CHM A;  2LYD A;  1Y19 B;  3T06 A;  2ELA A;  3KY9 A;  4HAZ B;  4ZRK A;  2OTX A;  4DXA B;  4EKU A;  2YS5 A;  1U5G A;  5CLQ B;  2J59 M;  2KGX B;  5JP4 A;  1W1G A;  2H7E A;  3NWA A;  1WG7 A;  1X1G A;  2JP2 A;  3ULB A;  1EVH A;  1WJM A;  4ZRI A;  3TO1 A;  2DHI A;  3SUZ A;  2D9W A;  2Z0P A;  2L2I A;  4DIX A;  3PEG A;  4GMV A;  2OQB A;  2QKM A;  4GPT B;  3FSS A;  4NSW A;  3X23 A;  4PNK A;  1FOE A;  2FJL A;  2Y8G A;  1H4R A;  2YS3 A;  2M38 A;  3P7Z A;  1UNQ A;  2VRW B;  3OAN A;  3WA0 A;  5KCV A;  3ML4 A;  2D9V A;  2J0J A;  2KUP A;  3AJ4 A;  2YS1 A;  3PSC A;  1GG3 A;  5DHF B;  3DXD A;  1TXD A;  1ZYI A;  1P3R A;  5D3V A;  1XCG A;  1V88 A;  2RRF A;  4K17 A;  2KIE A;  1GC7 A;  2CY4 A;  2Z0Q A;  3DXE A;  5M4Y B;  2P8V A;  4QJ3 B;  2GS0 A;  1TJ6 A;  1MAI A;  1QQG A;  3TW1 A;  5J3T A;  2HTH B;  4CYE A;  2UZS A;  2R2Y A;  3KRW A;  1NTY A;  1NU2 A;  3AU5 A;  3DXC A;  3QBV B;  5JHH A;  4HB0 B;  2D9Y A;  3QWM A;  2Y8F A;  3PVL A;  3B77 A;  1GC6 A;  3F5R A;  2K00 A;  2EMS A;  3IVF A;  3ZDT A;  1ZVR A;  2ROV A;  5C16 A;  4PQ0 A;  5D27 A;  2ADZ A;  2NBV A;  1WJ1 A;  1XX0 A;  5DH9 B;  5FI0 A;  2GJY A;  2I5F A;  4Z2M B;  3GYP A;  2DN6 A;  1K5G B; 
#chains in the Genus database with same CATH homology
 3GYO A;  2K49 A;  3NWD A;  4D6W A;  4QJ5 B;  3TO1 A;  2GUM A;  4DIX A;  3NW8 A;  2Z14 A;  2KIG A;  3A58 A;  2Z13 A;  1ZYI A;  4KHA A;  2KUQ A;  2Z59 A;  3HIE A;  4KHO A;  2RRF A;  4CSQ A;  2KIE A;  2GCJ A;  5LG4 B;  3FSS A;  4GOU A;  4L1R A;  4QJ4 B;  2YT2 A;  4QXA B;  2KR0 A;  2GCL A;  3TVV A;  2K8E A;  3OHM B;  3U12 A;  4OT1 A;  4KHB B;  4GNK B;  5M4Y B;  4IFS A;  2Z4D A;  4OSN A;  4QJ3 B;  5I2S A;  3FVC A;  4PQ0 A;  3NWF A;  3TW1 A;  4Z2N A;  2FJU B;  5I2M A;  3NWA A;  2NBV A;  2ZKM X;  2R2Y A;  4HSI A;  5IRS A;  4IOY X;  4Z2M B;  4KHB A;  3GYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...