3HIEA

Structure of the membrane-binding domain of the sec3 subunit of the exocyst complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
165
structure length
161
Chain Sequence
SNFLAEQYERDRKAIINCCFSRPGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKPNNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTMSKKYYWETNSAKERTVFIKSLITLYIQTFEGHVPELVNWDLSLFYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component SEC3
publication title Structure-function study of the N-terminal domain of exocyst subunit Sec3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Exocytosis
total genus 42
structure length 161
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15277 Sec3-PIP2_bind Exocyst complex component SEC3 N-terminal PIP2 binding PH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.90 Mainly Beta Roll PH-domain like PH-domain like 3hieA01
5LG4B 3HIEA 3A58A 5M4YB
chains in the Genus database with same CATH superfamily
2RUKB 1FHXA 3AU5A 2P0FA 2D4QA 3SO6A 3OANA 4GMVA 2RRFA 5D3VA 2R2YA 4CHJA 1V88A 4P7IA 2V76A 5D27A 4D0NB 1P5TA 3X23A 2D10A 4Z2NA 1FHWA 1ZYIA 1FOEA 2PZ1A 5JLJB 1Y5OA 2KGXB 2NZ8B 4DX8A 3OHMB 4EKUA 3P6AA 2Z0OA 3D8DA 2Z0PA 2Z14A 1P3RA 4B6HA 2K2JA 1B55A 1KZGA 4Y94A 3ZDTA 1WVHA 4CSQA 1MAIA 2D9XA 1FGZA 1XCGA 2L1CA 4HAUB 4HB4B 1W1HA 2YRYA 1U5EA 1DYNA 1PLSA 2Z0QA 3HSAA 3ZVRA 4F7HA 3UZTA 5DHFB 1TQZA 4F7GA 2LULA 1W1GA 4TKNA 3FSSA 1FB8A 1LB1A 1QQGA 1U29A 3TVVA 2ROZB 3M1IB 3CXBB 2CRFA 1NU2A 1V5PA 1Y19B 2L2IA 4GOUA 3DXEA 4QJ4B 4ZRKA 1E5WA 2DN6A 1LW3A 3GYOA 2Z59A 3CIKA 2KIEA 5HE2A 4L6EA 1MK7B 1EF1A 3KSYA 2NBVA 2VSZA 2COAA 2COCA 2D11A 4HDOA 2MWNB 4OT1A 5I2MA 2I5FA 2ADZA 5J3YA 4D6WA 2I1KA 4YL8A 5IRSA 2KCJA 2N0YA 2J59M 2GS0A 3ODXA 1DROA 2K49A 2LKOA 3NWAA 1UPQA 3MDBC 5J3TA 4WSFA 3MPXA 5DIFB 2DYNA 2LYDA 3NW8A 5C5BB 3N7CA 5KCVA 4A6KA 4QJ3B 2VRWB 5M4YB 1WJMA 2RNRB 3NWDA 2D2QA 3PZDA 4KAXB 2R09A 4MY6A 3RCPA 2BCJA 4DXAB 1TXDA 3HIEA 4K17A 3F0WA 5DH9B 3SUZA 4IAPA 3A8QA 3PVUA 2OQBA 4KVGB 5HE3A 2MFQA 2YS1A 2J0MA 1N3HA 5LOPB 4QJ5B 2KUQA 4KHBA 2DKQA 1UNRA 2YT2A 1T77A 2LOZA 1MI1A 3SNHA 1WGQA 2UZRA 1ZSQA 3TO1A 3QWMA 3AJ4A 4DX90 4NSWA 4TYZA 2MDXA 4MT7A 2FJUB 3DXDA 1NTYA 5LONB 2JP2A 3PP2A 2X18A 3G9WA 1ZVRA 1PMSA 2DHJA 3AU4A 4ZRJA 4HB0B 4K81A 2UVMA 4F7UP 1K5GB 3P7ZA 4CHMA 2EMSA 5C16A 1X1GA 4DIXA 1GC7A 1Q67A 4CYEA 4NY0A 5J3QA 1OQNA 2DHKA 2DKPA 3WA0A 4GNKB 1WJ1A 3DCXA 2ROVA 2KIGA 5FI1A 2J0JA 1DDWA 3F5RA 4H8SA 1M7EA 5C6RA 3KY9A 4A6HA 1OY2A 4IOYX 3PSCA 2ZKMX 4EJNA 4HAZB 1X05A 5FI0A 3HQCA 1EVHA 5JHHA 2HE7A 4GMXB 2D9ZA 3U7DA 1IRSA 2DHIA 2IYBA 1RRPB 1NI2A 2YS3A 1GG3A 1SHCA 1X86A 1OMWA 2DA0A 1BTNA 5L81A 1GC6A 4PNKA 2R0DA 3PVLA 3HW2B 2GUMA 4BBKA 2K8EA 4HHVA 2LG1A 4HATB 1FGYA 4HAYB 1U5DA 1U5GA 2ZPYA 2GJYA 3V5WA 4HAWB 1XX0A 1I7AA 3B77A 1BAKA 3U8ZA 2AEHA 1X1FA 4XWXA 1DBHA 1Z87A 4GPTB 4OSNA 1WG7A 2CAYA 3U12A 4K2OA 3IVFA 3D8EA 1P6SA 2Z13A 2YSZA 3ODOA 1XD4A 1I2HA 2HTHB 2G35A 2GCJA 2DLWA 3QBVB 4QXAB 1FAOA 5HE1A 2YT0A 1M7RA 1EGXA 2YS5A 5I2SA 2Y8GA 3LJUX 3NWFA 2NMBA 3KZ1A 2UZSA 2YT1A 4A5KA 1MK9B 1XR0B 1RJ2A 3KRWA 3PVWA 1PFJA 1V5UA 3GYPA 4A6FB 3NSUA 1EAZA 5KQ1A 2W2XD 2H7DA 2LOXA 1V61A 1X11A 3FEHA 2GCLA 1WI1A 5KQ4A 3TFMA 2XQNM 4HB3B 2ELAA 2OTXA 3ML4A 2E2XA 5DHAB 2D9WA 2DX1A 1DDVA 2MKRA 1NTVA 1V89A 5D3XA 1MKEA 4GXBA 2D9VA 3BINA 1SGHA 2COFA 5D3YA 2Y7BA 3SYXA 2CY5A 2P0DA 2RSGA 3QIJA 5CLQB 3VIAA 4HB2B 5GOWB 1U27A 1UNPA 1WGUA 2KUPA 2VKIA 5EFXA 2DTCA 2Q13A 5JP4A 4KHBB 3A8PA 1MIZB 2K00A 2N23A 2P8VA 4K2PA 2IFSA 4PQ0A 3ODWA 1U2BA 4GN1A 2CODA 4HDQA 2EMTA 1ISNA 2J0KA 1AQCA 2I5CA 3PEGA 2RLOA 4MK0A 3FM8C 5C79A 1XODA 1QC6A 2AL6A 3A98B 5JHGA 4L1RA 2YF0A 1ZC3B 4KHOA 2H7EA 3D8FA 2QKLA 4KHAA 2EC1A 3TCAA 1H4RA 4YONA 3TW1A 1UEFA 1TJ6A 1J19A 4WVFB 5HE0A 2D9YA 4IFSA 2ELBA 2FJLA 1AWEA 3VOQA 2CY4A 4GZUA 5C5BA 3T06A 4ZRIA 1ZC4B 1MPHA 2DX5A 1BTKA 2QKMA 1MIXA 2YVCA 3A58A 5D3WA 5CLLB 1V5MA 1UPRA 3PG7A 3O96A 2DFKA 2KR0A 3KRXA 4HSIA 3FVCA 2EJ8A 1KZ7A 2M38A 2W2XC 5LG4B 2I1JA 4Z2MB 1KI1B 2Y8FA 4A6FA 1DDMA 2W2WA 5DI9B 3WYFB 1H10A 2K2UA 3HK0A 2RGNB 3BJIA 3ULCA 3DXCA 1W1DA 1FHOA 4C0AA 1BWNA 2DYQA 2Z4DA 3ULBA 2P0HA 4HAVB 3SV1A 2RVBB 4WJ7A 1U5FA 1UNQA 1K5DB 4DBBA 1J0WA 4HAXB 1ZM0A 2M14A 4EMOA 1XKEA
chains in the Genus database with same CATH topology
2FJUB 2K8EA 2GCJA 3HIEA 4KHOA 2Z14A 4QXAB 2NBVA 2K49A 3FSSA 3A58A 4KHAA 4KHBB 2RRFA 2R2YA 4GNKB 3TVVA 3NWFA 5I2SA 3TW1A 4PQ0A 3NWAA 2KIGA 4QJ5B 4OT1A 2KUQA 4KHBA 5I2MA 2KR0A 4GOUA 2Z4DA 2GUMA 4CSQA 3FVCA 4IFSA 4HSIA 2YT2A 4QJ4B 3NW8A 3GYPA 3GYOA 4OSNA 4D6WA 4Z2NA 4QJ3B 1ZYIA 5LG4B 5M4YB 5IRSA 2Z59A 3U12A 3NWDA 4Z2MB 2KIEA 2Z13A 4IOYX 3OHMB 3TO1A 4DIXA 2GCLA 4L1RA 2ZKMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 B;  3HIE A;  3A58 A;  5M4Y B; 
#chains in the Genus database with same CATH topology
 2RUK B;  1FHX A;  3AU5 A;  2P0F A;  2D4Q A;  3SO6 A;  3OAN A;  4GMV A;  2RRF A;  5D3V A;  2R2Y A;  4CHJ A;  1V88 A;  4P7I A;  2V76 A;  5D27 A;  4D0N B;  1P5T A;  3X23 A;  2D10 A;  4Z2N A;  1FHW A;  1ZYI A;  1FOE A;  2PZ1 A;  5JLJ B;  1Y5O A;  2KGX B;  2NZ8 B;  4DX8 A;  3OHM B;  4EKU A;  3P6A A;  2Z0O A;  3D8D A;  2Z0P A;  2Z14 A;  1P3R A;  4B6H A;  2K2J A;  1B55 A;  1KZG A;  4Y94 A;  3ZDT A;  1WVH A;  4CSQ A;  1MAI A;  2D9X A;  1FGZ A;  1XCG A;  2L1C A;  4HAU B;  4HB4 B;  1W1H A;  2YRY A;  1U5E A;  1DYN A;  1PLS A;  2Z0Q A;  3HSA A;  3ZVR A;  4F7H A;  3UZT A;  5DHF B;  1TQZ A;  4F7G A;  2LUL A;  1W1G A;  4TKN A;  3FSS A;  1FB8 A;  1LB1 A;  1QQG A;  1U29 A;  3TVV A;  2ROZ B;  3M1I B;  3CXB B;  2CRF A;  1NU2 A;  1V5P A;  1Y19 B;  2L2I A;  4GOU A;  3DXE A;  4QJ4 B;  4ZRK A;  1E5W A;  2DN6 A;  1LW3 A;  3GYO A;  2Z59 A;  3CIK A;  2KIE A;  5HE2 A;  4L6E A;  1MK7 B;  1EF1 A;  3KSY A;  2NBV A;  2VSZ A;  2COA A;  2COC A;  2D11 A;  4HDO A;  2MWN B;  4OT1 A;  5I2M A;  2I5F A;  2ADZ A;  5J3Y A;  4D6W A;  2I1K A;  4YL8 A;  5IRS A;  2KCJ A;  2N0Y A;  2J59 M;  2GS0 A;  3ODX A;  1DRO A;  2K49 A;  2LKO A;  3NWA A;  1UPQ A;  3MDB C;  5J3T A;  4WSF A;  3MPX A;  5DIF B;  2DYN A;  2LYD A;  3NW8 A;  5C5B B;  3N7C A;  5KCV A;  4A6K A;  4QJ3 B;  2VRW B;  5M4Y B;  1WJM A;  2RNR B;  3NWD A;  2D2Q A;  3PZD A;  4KAX B;  2R09 A;  4MY6 A;  3RCP A;  2BCJ A;  4DXA B;  1TXD A;  3HIE A;  4K17 A;  3F0W A;  5DH9 B;  3SUZ A;  4IAP A;  3A8Q A;  3PVU A;  2OQB A;  4KVG B;  5HE3 A;  2MFQ A;  2YS1 A;  2J0M A;  1N3H A;  5LOP B;  4QJ5 B;  2KUQ A;  4KHB A;  2DKQ A;  1UNR A;  2YT2 A;  1T77 A;  2LOZ A;  1MI1 A;  3SNH A;  1WGQ A;  2UZR A;  1ZSQ A;  3TO1 A;  3QWM A;  3AJ4 A;  4DX9 0;  4NSW A;  4TYZ A;  2MDX A;  4MT7 A;  2FJU B;  3DXD A;  1NTY A;  5LON B;  2JP2 A;  3PP2 A;  2X18 A;  3G9W A;  1ZVR A;  1PMS A;  2DHJ A;  3AU4 A;  4ZRJ A;  4HB0 B;  4K81 A;  2UVM A;  4F7U P;  1K5G B;  3P7Z A;  4CHM A;  2EMS A;  5C16 A;  1X1G A;  4DIX A;  1GC7 A;  1Q67 A;  4CYE A;  4NY0 A;  5J3Q A;  1OQN A;  2DHK A;  2DKP A;  3WA0 A;  4GNK B;  1WJ1 A;  3DCX A;  2ROV A;  2KIG A;  5FI1 A;  2J0J A;  1DDW A;  3F5R A;  4H8S A;  1M7E A;  5C6R A;  3KY9 A;  4A6H A;  1OY2 A;  4IOY X;  3PSC A;  2ZKM X;  4EJN A;  4HAZ B;  1X05 A;  5FI0 A;  3HQC A;  1EVH A;  5JHH A;  2HE7 A;  4GMX B;  2D9Z A;  3U7D A;  1IRS A;  2DHI A;  2IYB A;  1RRP B;  1NI2 A;  2YS3 A;  1GG3 A;  1SHC A;  1X86 A;  1OMW A;  2DA0 A;  1BTN A;  5L81 A;  1GC6 A;  4PNK A;  2R0D A;  3PVL A;  3HW2 B;  2GUM A;  4BBK A;  2K8E A;  4HHV A;  2LG1 A;  4HAT B;  1FGY A;  4HAY B;  1U5D A;  1U5G A;  2ZPY A;  2GJY A;  3V5W A;  4HAW B;  1XX0 A;  1I7A A;  3B77 A;  1BAK A;  3U8Z A;  2AEH A;  1X1F A;  4XWX A;  1DBH A;  1Z87 A;  4GPT B;  4OSN A;  1WG7 A;  2CAY A;  3U12 A;  4K2O A;  3IVF A;  3D8E A;  1P6S A;  2Z13 A;  2YSZ A;  3ODO A;  1XD4 A;  1I2H A;  2HTH B;  2G35 A;  2GCJ A;  2DLW A;  3QBV B;  4QXA B;  1FAO A;  5HE1 A;  2YT0 A;  1M7R A;  1EGX A;  2YS5 A;  5I2S A;  2Y8G A;  3LJU X;  3NWF A;  2NMB A;  3KZ1 A;  2UZS A;  2YT1 A;  4A5K A;  1MK9 B;  1XR0 B;  1RJ2 A;  3KRW A;  3PVW A;  1PFJ A;  1V5U A;  3GYP A;  4A6F B;  3NSU A;  1EAZ A;  5KQ1 A;  2W2X D;  2H7D A;  2LOX A;  1V61 A;  1X11 A;  3FEH A;  2GCL A;  1WI1 A;  5KQ4 A;  3TFM A;  2XQN M;  4HB3 B;  2ELA A;  2OTX A;  3ML4 A;  2E2X A;  5DHA B;  2D9W A;  2DX1 A;  1DDV A;  2MKR A;  1NTV A;  1V89 A;  5D3X A;  1MKE A;  4GXB A;  2D9V A;  3BIN A;  1SGH A;  2COF A;  5D3Y A;  2Y7B A;  3SYX A;  2CY5 A;  2P0D A;  2RSG A;  3QIJ A;  5CLQ B;  3VIA A;  4HB2 B;  5GOW B;  1U27 A;  1UNP A;  1WGU A;  2KUP A;  2VKI A;  5EFX A;  2DTC A;  2Q13 A;  5JP4 A;  4KHB B;  3A8P A;  1MIZ B;  2K00 A;  2N23 A;  2P8V A;  4K2P A;  2IFS A;  4PQ0 A;  3ODW A;  1U2B A;  4GN1 A;  2COD A;  4HDQ A;  2EMT A;  1ISN A;  2J0K A;  1AQC A;  2I5C A;  3PEG A;  2RLO A;  4MK0 A;  3FM8 C;  5C79 A;  1XOD A;  1QC6 A;  2AL6 A;  3A98 B;  5JHG A;  4L1R A;  2YF0 A;  1ZC3 B;  4KHO A;  2H7E A;  3D8F A;  2QKL A;  4KHA A;  2EC1 A;  3TCA A;  1H4R A;  4YON A;  3TW1 A;  1UEF A;  1TJ6 A;  1J19 A;  4WVF B;  5HE0 A;  2D9Y A;  4IFS A;  2ELB A;  2FJL A;  1AWE A;  3VOQ A;  2CY4 A;  4GZU A;  5C5B A;  3T06 A;  4ZRI A;  1ZC4 B;  1MPH A;  2DX5 A;  1BTK A;  2QKM A;  1MIX A;  2YVC A;  3A58 A;  5D3W A;  5CLL B;  1V5M A;  1UPR A;  3PG7 A;  3O96 A;  2DFK A;  2KR0 A;  3KRX A;  4HSI A;  3FVC A;  2EJ8 A;  1KZ7 A;  2M38 A;  2W2X C;  5LG4 B;  2I1J A;  4Z2M B;  1KI1 B;  2Y8F A;  4A6F A;  1DDM A;  2W2W A;  5DI9 B;  3WYF B;  1H10 A;  2K2U A;  3HK0 A;  2RGN B;  3BJI A;  3ULC A;  3DXC A;  1W1D A;  1FHO A;  4C0A A;  1BWN A;  2DYQ A;  2Z4D A;  3ULB A;  2P0H A;  4HAV B;  3SV1 A;  2RVB B;  4WJ7 A;  1U5F A;  1UNQ A;  1K5D B;  4DBB A;  1J0W A;  4HAX B;  1ZM0 A;  2M14 A;  4EMO A;  1XKE A; 
#chains in the Genus database with same CATH homology
 2FJU B;  2K8E A;  2GCJ A;  3HIE A;  4KHO A;  2Z14 A;  4QXA B;  2NBV A;  2K49 A;  3FSS A;  3A58 A;  4KHA A;  4KHB B;  2RRF A;  2R2Y A;  4GNK B;  3TVV A;  3NWF A;  5I2S A;  3TW1 A;  4PQ0 A;  3NWA A;  2KIG A;  4QJ5 B;  4OT1 A;  2KUQ A;  4KHB A;  5I2M A;  2KR0 A;  4GOU A;  2Z4D A;  2GUM A;  4CSQ A;  3FVC A;  4IFS A;  4HSI A;  2YT2 A;  4QJ4 B;  3NW8 A;  3GYP A;  3GYO A;  4OSN A;  4D6W A;  4Z2N A;  4QJ3 B;  1ZYI A;  5LG4 B;  5M4Y B;  5IRS A;  2Z59 A;  3U12 A;  3NWD A;  4Z2M B;  2KIE A;  2Z13 A;  4IOY X;  3OHM B;  3TO1 A;  4DIX A;  2GCL A;  4L1R A;  2ZKM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...