2CY5A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-2 crystal)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
MADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
total genus 29
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy5A00
2PZ1A 4YL8A 1UNRA 2ROVA 2QKMA 3SO6A 2CY4A 3DXEA 4HAVB 2I1JA 2ROZB 1V61A 2MFQA 2Z0PA 4TYZA 3V5WA 5KQ4A 2CAYA 2LKOA 1KZGA 4Z2MB 2BCJA 5EFXA 3GYOA 4GMXB 1Y19B 4HDQA 1PFJA 4A6KA 3BINA 2RUKB 2V76A 2DA0A 4HAYB 1V89A 5KQ1A 2E2XA 4H8SA 1EGXA 5LOPB 5D3YA 2JP2A 4XWXA 4P7IA 2D9VA 1Y5OA 5GOWB 5DHAB 1P5TA 3FEHA 4PQ0A 2OTXA 3D8FA 3A8PA 3WA0A 2W2XC 1ZC3B 4ZRJA 2Z0OA 2EJ8A 2J59M 1WGUA 1UEFA 3RCPA 5HE0A 2D4QA 2ZPYA 4F7HA 4DX8A 2K00A 1ZM0A 2YS5A 5C5BB 2L2IA 2YS1A 3ZDTA 2CODA 3M1IB 2MDXA 4KHBB 1FOEA 1B55A 2J0JA 3ML4A 1UNQA 3UZTA 4PNKA 4A5KA 1XCGA 2KGXB 4DBBA 4A6HA 2OQBA 3VOQA 2GCJA 4C0AA 1BAKA 4BBKA 3O96A 1UPQA 2XQNM 2L1CA 1NTYA 5DHFB 4GXBA 1GG3A 1WVHA 2M38A 2CRFA 3ODOA 3QBVB 1GC7A 2VSZA 3PVUA 2D11A 4CYEA 3FSSA 5D3XA 2R09A 5FI0A 1MIZB 3CIKA 4MY6A 2COAA 1XD4A 4HB3B 1V5UA 3HK0A 4IOYX 2D9YA 4B6HA 1X11A 2UVMA 1X1FA 1J0WA 4Y94A 1V5PA 3KRWA 4EKUA 3QWMA 1FAOA 3PVLA 1FHOA 2RSGA 2G35A 4ZRIA 1IRSA 2GJYA 5L81A 2D10A 3PSCA 2DTCA 1DYNA 2DKPA 3P7ZA 4WSFA 1M7RA 1RRPB 1WG7A 2EMSA 2HTHB 4WJ7A 5JHGA 3F5RA 5D27A 4TKNA 1W1DA 4NY0A 1E5WA 3SUZA 2M14A 3U7DA 1U5FA 1BTKA 5DIFB 1KI1B 4DXAB 3AJ4A 4NSWA 3TFMA 1MK7B 5C16A 1FB8A 2VKIA 3U8ZA 4EJNA 2QKLA 3LJUX 2N0YA 1LB1A 1RJ2A 1ISNA 5FI1A 3KY9A 1V88A 2P0DA 5C79A 1AQCA 1GC6A 1MPHA 2K2JA 3ULCA 2DLWA 2DN6A 2HE7A 1Q67A 2Z0QA 1EAZA 4CHMA 1W1GA 1WJ1A 4HDOA 1FHWA 4K2OA 3TW1A 1MAIA 1NU2A 2D9WA 1V5MA 3DXCA 4WVFB 2Q13A 2GS0A 3PP2A 3PG7A 2COFA 3D8EA 4K2PA 1H4RA 2LOXA 3A8QA 5HE2A 1DDVA 5HE1A 2AEHA 1NTVA 2W2WA 2IYBA 1N3HA 3TO1A 1UPRA 3SNHA 4GN1A 3BJIA 2MWNB 2K2UA 2FJLA 4KAXB 2COCA 5D3WA 1WI1A 3TVVA 3ODXA 1DBHA 4MT7A 4HAUB 3KZ1A 1ZC4B 2W2XD 4EMOA 1MK9B 2YT0A 1U2BA 2YT1A 2MKRA 3ULBA 4F7GA 5CLLB 2DX1A 2ADZA 4YONA 3PEGA 2Y7BA 1AWEA 2ELAA 1XODA 2DYQA 2H7EA 2NMBA 2R0DA 2P0FA 4KHAA 3F0WA 1SGHA 2D9XA 2ELBA 3QIJA 1X05A 1SHCA 4KVGB 3AU5A 1TXDA 1OQNA 3VIAA 2P8VA 3D8DA 3HW2B 1WJMA 2RNRB 2D9ZA 4HAZB 3FM8C 3OANA 1EVHA 1U27A 1XKEA 4IAPA 4A6FB 3PVWA 1TQZA 2EMTA 1X1GA 3PZDA 1TJ6A 1Z87A 2YSZA 1LW3A 1X86A 1BWNA 5D3VA 2YRYA 2RGNB 1XX0A 5LONB 4HATB 5CLQB 1UNPA 1P6SA 3N7CA 4A6FA 1MKEA 4KHOA 3DXDA 2I5FA 1I7AA 5JP4A 2CY5A 3MPXA 5JLJB 3TCAA 1K5DB 2DKQA 3T06A 4HHVA 1J19A 2KCJA 2DHKA 4HB4B 1U5GA 4IFSA 4D0NB 1DDMA 1WGQA 5J3TA 1PLSA 5HE3A 1ZVRA 2DFKA 4L6EA 2LG1A 5C5BA 3A98B 1OY2A 2LOZA 4CHJA 2N23A 4DX90 3NSUA 1FGYA 4HB0B 3X23A 4Z2NA 5DI9B 5JHHA 1XR0B 3HQCA 1FHXA 3KSYA 2I5CA 3MDBC 2LYDA 1FGZA 1BTNA 4HB2B 3KRXA 2KUPA 1DROA 1U5EA 4F7UP 1DDWA 2H7DA 4GZUA 2DYNA 2D2QA 3GYPA 2J0KA 1QQGA 2DHIA 2DHJA 3G9WA 2X18A 2UZSA 1MIXA 1H10A 1PMSA 2YVCA 5J3QA 1W1HA 2Y8GA 4GMVA 2J0MA 2LULA 4MK0A 2I1KA 2RVBB 1EF1A 2IFSA 1KZ7A 5DH9B 4HAWB 1OMWA 1M7EA 4ZRKA 2UZRA 2EC1A 2VRWB 4HAXB 2DX5A 3CXBB 3WYFB 3SYXA 1QC6A 2YS3A 1P3RA 3ODWA 4K81A 2P0HA 5C6RA 2RLOA 2Y8FA 3P6AA 4GPTB 3SV1A 1ZSQA 2GCLA 5J3YA 1I2HA 3ZVRA 1U29A 2YF0A 2AL6A 2NZ8B 1NI2A 1K5GB 4K17A 5KCVA 3IVFA 3AU4A 1U5DA
chains in the Genus database with same CATH superfamily
2PZ1A 2K49A 4YL8A 1UNRA 2ROVA 2QKMA 3SO6A 2CY4A 3DXEA 4HAVB 2I1JA 2ROZB 1V61A 2MFQA 2Z0PA 4TYZA 3V5WA 5KQ4A 2CAYA 2LKOA 1KZGA 4OT1A 4Z2MB 2BCJA 5EFXA 2FJUB 3GYOA 4GMXB 1Y19B 4HDQA 1PFJA 4A6KA 3BINA 2RUKB 2V76A 2DA0A 4HAYB 1V89A 5KQ1A 2E2XA 4H8SA 1EGXA 5LOPB 5D3YA 2JP2A 4XWXA 4P7IA 2D9VA 1Y5OA 2NBVA 5GOWB 5DHAB 1P5TA 3FEHA 4PQ0A 1MI1A 2OTXA 3D8FA 3A8PA 3WA0A 2W2XC 1ZC3B 4ZRJA 2Z0OA 2EJ8A 2J59M 1WGUA 1UEFA 3RCPA 2ZKMX 5HE0A 4CSQA 2D4QA 2ZPYA 4F7HA 4DX8A 2K00A 1ZM0A 2YS5A 5C5BB 2L2IA 2YS1A 3ZDTA 4QJ3B 2CODA 3M1IB 2MDXA 4KHBB 1FOEA 1B55A 2J0JA 3ML4A 1UNQA 3UZTA 4PNKA 4A5KA 1XCGA 2KGXB 4DBBA 4A6HA 2OQBA 3VOQA 2GCJA 4C0AA 1BAKA 4BBKA 3O96A 1UPQA 3FVCA 2XQNM 2L1CA 1NTYA 5DHFB 1GG3A 1WVHA 2M38A 4GXBA 4OSNA 2CRFA 3ODOA 3QBVB 1GC7A 4QJ5B 2VSZA 3PVUA 2D11A 4CYEA 3FSSA 5D3XA 2R09A 5FI0A 1MIZB 3CIKA 4MY6A 2COAA 1XD4A 4HB3B 1V5UA 3HK0A 4IOYX 2D9YA 4B6HA 1X11A 2UVMA 1X1FA 1J0WA 4Y94A 1V5PA 3KRWA 4EKUA 3QWMA 1FAOA 3PVLA 1FHOA 2RSGA 2G35A 4ZRIA 2KIEA 1IRSA 2GJYA 5L81A 2D10A 3PSCA 2DTCA 1DYNA 2DKPA 3P7ZA 4WSFA 1M7RA 1RRPB 1WG7A 2EMSA 2HTHB 3HIEA 4WJ7A 5JHGA 3F5RA 5D27A 4TKNA 1W1DA 4NY0A 1E5WA 3SUZA 2Z4DA 2M14A 3U7DA 1U5FA 1BTKA 5DIFB 1KI1B 4DXAB 3AJ4A 4NSWA 3TFMA 3A58A 1MK7B 5C16A 3OHMB 1FB8A 2YT2A 2VKIA 3U8ZA 4EJNA 2QKLA 3LJUX 2N0YA 1LB1A 1RJ2A 1ISNA 5FI1A 3KY9A 3DCXA 1V88A 2P0DA 5C79A 1AQCA 1GC6A 1MPHA 2K2JA 3NWFA 3ULCA 2DLWA 2DN6A 2HE7A 2KUQA 1Q67A 2Z0QA 2Z59A 1EAZA 4CHMA 1W1GA 1WJ1A 4HDOA 1FHWA 2Z13A 4K2OA 3U12A 3TW1A 2Z14A 1MAIA 1NU2A 2D9WA 1V5MA 3DXCA 4WVFB 2Q13A 3NW8A 2GS0A 3PP2A 3PG7A 2COFA 4GNKB 3D8EA 4K2PA 1H4RA 2LOXA 3A8QA 5HE2A 1DDVA 5HE1A 2AEHA 1NTVA 2W2WA 2IYBA 1N3HA 3TO1A 1UPRA 3SNHA 4GN1A 3BJIA 2MWNB 5LG4B 2K2UA 2FJLA 4KAXB 2COCA 5D3WA 1WI1A 3TVVA 4QXAB 3ODXA 1DBHA 4MT7A 4HAUB 3KZ1A 1ZC4B 2W2XD 4EMOA 2KIGA 1MK9B 2YT0A 1U2BA 2YT1A 2MKRA 3ULBA 4QJ4B 4F7GA 5CLLB 2DX1A 2ADZA 4YONA 3PEGA 2Y7BA 1AWEA 2ELAA 2R2YA 1XODA 2DYQA 2H7EA 2NMBA 2R0DA 2P0FA 4KHAA 3F0WA 1SGHA 2D9XA 2ELBA 3QIJA 1X05A 1SHCA 4KVGB 3AU5A 1TXDA 1OQNA 3VIAA 2GUMA 2P8VA 3D8DA 3HW2B 1WJMA 2RNRB 2D9ZA 4HAZB 3B77A 3FM8C 5IRSA 3OANA 1EVHA 1U27A 1XKEA 4IAPA 4A6FB 3PVWA 1TQZA 2EMTA 1X1GA 2K8EA 3PZDA 1TJ6A 1Z87A 1ZYIA 2YSZA 5I2MA 1LW3A 1X86A 3NWDA 1BWNA 5D3VA 2YRYA 2RGNB 1XX0A 5LONB 4HATB 5CLQB 1UNPA 4L1RA 1P6SA 5I2SA 3N7CA 4A6FA 5M4YB 1MKEA 4KHOA 3DXDA 2I5FA 1I7AA 4GOUA 5JP4A 2CY5A 3MPXA 5JLJB 3TCAA 1K5DB 2DKQA 3T06A 4HHVA 1J19A 2KCJA 2DHKA 4HB4B 1U5GA 4IFSA 4D0NB 1DDMA 1WGQA 4KHBA 5J3TA 1PLSA 5HE3A 1ZVRA 2DFKA 4L6EA 2LG1A 5C5BA 3A98B 1OY2A 2LOZA 4CHJA 2N23A 4DX90 3NSUA 1FGYA 4HB0B 3X23A 4HSIA 4Z2NA 5DI9B 5JHHA 4D6WA 1XR0B 3HQCA 1FHXA 3KSYA 2I5CA 3MDBC 3NWAA 2LYDA 1FGZA 2KR0A 1BTNA 4HB2B 3KRXA 2KUPA 1DROA 1U5EA 4F7UP 1DDWA 2H7DA 4GZUA 2DYNA 2D2QA 2RRFA 3GYPA 2J0KA 1QQGA 2DHIA 2DHJA 3G9WA 2X18A 2UZSA 1MIXA 1H10A 1PMSA 2YVCA 5J3QA 1W1HA 2Y8GA 4GMVA 2J0MA 2LULA 4MK0A 2I1KA 2RVBB 1EF1A 2IFSA 1KZ7A 5DH9B 4HAWB 1OMWA 1M7EA 4ZRKA 2UZRA 2EC1A 2VRWB 4HAXB 2DX5A 3CXBB 3WYFB 3SYXA 1QC6A 2YS3A 1T77A 1P3RA 3ODWA 4K81A 2P0HA 5C6RA 2RLOA 2Y8FA 3P6AA 4GPTB 3SV1A 1ZSQA 2GCLA 5J3YA 1I2HA 3ZVRA 1U29A 2YF0A 2AL6A 2NZ8B 4DIXA 1NI2A 1K5GB 3HSAA 4K17A 5KCVA 3IVFA 3AU4A 1U5DA
chains in the Genus database with same CATH topology
2PZ1A 4YL8A 1UNRA 2ROVA 2QKMA 3SO6A 2CY4A 3DXEA 4HAVB 2I1JA 2ROZB 1V61A 2MFQA 2Z0PA 4TYZA 3V5WA 5KQ4A 2CAYA 2LKOA 1KZGA 4Z2MB 2BCJA 5EFXA 3GYOA 4GMXB 1Y19B 4HDQA 1PFJA 4A6KA 3BINA 2RUKB 2V76A 2DA0A 4HAYB 1V89A 5KQ1A 2E2XA 4H8SA 1EGXA 5LOPB 5D3YA 2JP2A 4XWXA 4P7IA 2D9VA 1Y5OA 5GOWB 5DHAB 1P5TA 3FEHA 4PQ0A 2OTXA 3D8FA 3A8PA 3WA0A 2W2XC 1ZC3B 4ZRJA 2Z0OA 2EJ8A 2J59M 1WGUA 1UEFA 3RCPA 5HE0A 2D4QA 2ZPYA 4F7HA 4DX8A 2K00A 1ZM0A 2YS5A 5C5BB 2L2IA 2YS1A 3ZDTA 2CODA 3M1IB 2MDXA 4KHBB 1FOEA 1B55A 2J0JA 3ML4A 1UNQA 3UZTA 4PNKA 4A5KA 1XCGA 2KGXB 4DBBA 4A6HA 2OQBA 3VOQA 2GCJA 4C0AA 1BAKA 4BBKA 3O96A 1UPQA 2XQNM 2L1CA 1NTYA 5DHFB 4GXBA 1GG3A 1WVHA 2M38A 2CRFA 3ODOA 3QBVB 1GC7A 2VSZA 3PVUA 2D11A 4CYEA 3FSSA 5D3XA 2R09A 5FI0A 1MIZB 3CIKA 4MY6A 2COAA 1XD4A 4HB3B 1V5UA 3HK0A 4IOYX 2D9YA 4B6HA 1X11A 2UVMA 1X1FA 1J0WA 4Y94A 1V5PA 3KRWA 4EKUA 3QWMA 1FAOA 3PVLA 1FHOA 2RSGA 2G35A 4ZRIA 1IRSA 2GJYA 5L81A 2D10A 3PSCA 2DTCA 1DYNA 2DKPA 3P7ZA 4WSFA 1M7RA 1RRPB 1WG7A 2EMSA 2HTHB 4WJ7A 5JHGA 3F5RA 5D27A 4TKNA 1W1DA 4NY0A 1E5WA 3SUZA 2M14A 3U7DA 1U5FA 1BTKA 5DIFB 1KI1B 4DXAB 3AJ4A 4NSWA 3TFMA 1MK7B 5C16A 1FB8A 2VKIA 3U8ZA 4EJNA 2QKLA 3LJUX 2N0YA 1LB1A 1RJ2A 1ISNA 5FI1A 3KY9A 1V88A 2P0DA 5C79A 1AQCA 1GC6A 1MPHA 2K2JA 3ULCA 2DLWA 2DN6A 2HE7A 1Q67A 2Z0QA 1EAZA 4CHMA 1W1GA 1WJ1A 4HDOA 1FHWA 4K2OA 3TW1A 1MAIA 1NU2A 2D9WA 1V5MA 3DXCA 4WVFB 2Q13A 2GS0A 3PP2A 3PG7A 2COFA 3D8EA 4K2PA 1H4RA 2LOXA 3A8QA 5HE2A 1DDVA 5HE1A 2AEHA 1NTVA 2W2WA 2IYBA 1N3HA 3TO1A 1UPRA 3SNHA 4GN1A 3BJIA 2MWNB 2K2UA 2FJLA 4KAXB 2COCA 5D3WA 1WI1A 3TVVA 3ODXA 1DBHA 4MT7A 4HAUB 3KZ1A 1ZC4B 2W2XD 4EMOA 1MK9B 2YT0A 1U2BA 2YT1A 2MKRA 3ULBA 4F7GA 5CLLB 2DX1A 2ADZA 4YONA 3PEGA 2Y7BA 1AWEA 2ELAA 1XODA 2DYQA 2H7EA 2NMBA 2R0DA 2P0FA 4KHAA 3F0WA 1SGHA 2D9XA 2ELBA 3QIJA 1X05A 1SHCA 4KVGB 3AU5A 1TXDA 1OQNA 3VIAA 2P8VA 3D8DA 3HW2B 1WJMA 2RNRB 2D9ZA 4HAZB 3FM8C 3OANA 1EVHA 1U27A 1XKEA 4IAPA 4A6FB 3PVWA 1TQZA 2EMTA 1X1GA 3PZDA 1TJ6A 1Z87A 2YSZA 1LW3A 1X86A 1BWNA 5D3VA 2YRYA 2RGNB 1XX0A 5LONB 4HATB 5CLQB 1UNPA 1P6SA 3N7CA 4A6FA 1MKEA 4KHOA 3DXDA 2I5FA 1I7AA 5JP4A 2CY5A 3MPXA 5JLJB 3TCAA 1K5DB 2DKQA 3T06A 4HHVA 1J19A 2KCJA 2DHKA 4HB4B 1U5GA 4IFSA 4D0NB 1DDMA 1WGQA 5J3TA 1PLSA 5HE3A 1ZVRA 2DFKA 4L6EA 2LG1A 5C5BA 3A98B 1OY2A 2LOZA 4CHJA 2N23A 4DX90 3NSUA 1FGYA 4HB0B 3X23A 4Z2NA 5DI9B 5JHHA 1XR0B 3HQCA 1FHXA 3KSYA 2I5CA 3MDBC 2LYDA 1FGZA 1BTNA 4HB2B 3KRXA 2KUPA 1DROA 1U5EA 4F7UP 1DDWA 2H7DA 4GZUA 2DYNA 2D2QA 3GYPA 2J0KA 1QQGA 2DHIA 2DHJA 3G9WA 2X18A 2UZSA 1MIXA 1H10A 1PMSA 2YVCA 5J3QA 1W1HA 2Y8GA 4GMVA 2J0MA 2LULA 4MK0A 2I1KA 2RVBB 1EF1A 2IFSA 1KZ7A 5DH9B 4HAWB 1OMWA 1M7EA 4ZRKA 2UZRA 2EC1A 2VRWB 4HAXB 2DX5A 3CXBB 3WYFB 3SYXA 1QC6A 2YS3A 1P3RA 3ODWA 4K81A 2P0HA 5C6RA 2RLOA 2Y8FA 3P6AA 4GPTB 3SV1A 1ZSQA 2GCLA 5J3YA 1I2HA 3ZVRA 1U29A 2YF0A 2AL6A 2NZ8B 1NI2A 1K5GB 4K17A 5KCVA 3IVFA 3AU4A 1U5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  4YL8 A;  1UNR A;  2ROV A;  2QKM A;  3SO6 A;  2CY4 A;  3DXE A;  4HAV B;  2I1J A;  2ROZ B;  1V61 A;  2MFQ A;  2Z0P A;  4TYZ A;  3V5W A;  5KQ4 A;  2CAY A;  2LKO A;  1KZG A;  4Z2M B;  2BCJ A;  5EFX A;  3GYO A;  4GMX B;  1Y19 B;  4HDQ A;  1PFJ A;  4A6K A;  3BIN A;  2RUK B;  2V76 A;  2DA0 A;  4HAY B;  1V89 A;  5KQ1 A;  2E2X A;  4H8S A;  1EGX A;  5LOP B;  5D3Y A;  2JP2 A;  4XWX A;  4P7I A;  2D9V A;  1Y5O A;  5GOW B;  5DHA B;  1P5T A;  3FEH A;  4PQ0 A;  2OTX A;  3D8F A;  3A8P A;  3WA0 A;  2W2X C;  1ZC3 B;  4ZRJ A;  2Z0O A;  2EJ8 A;  2J59 M;  1WGU A;  1UEF A;  3RCP A;  5HE0 A;  2D4Q A;  2ZPY A;  4F7H A;  4DX8 A;  2K00 A;  1ZM0 A;  2YS5 A;  5C5B B;  2L2I A;  2YS1 A;  3ZDT A;  2COD A;  3M1I B;  2MDX A;  4KHB B;  1FOE A;  1B55 A;  2J0J A;  3ML4 A;  1UNQ A;  3UZT A;  4PNK A;  4A5K A;  1XCG A;  2KGX B;  4DBB A;  4A6H A;  2OQB A;  3VOQ A;  2GCJ A;  4C0A A;  1BAK A;  4BBK A;  3O96 A;  1UPQ A;  2XQN M;  2L1C A;  1NTY A;  5DHF B;  4GXB A;  1GG3 A;  1WVH A;  2M38 A;  2CRF A;  3ODO A;  3QBV B;  1GC7 A;  2VSZ A;  3PVU A;  2D11 A;  4CYE A;  3FSS A;  5D3X A;  2R09 A;  5FI0 A;  1MIZ B;  3CIK A;  4MY6 A;  2COA A;  1XD4 A;  4HB3 B;  1V5U A;  3HK0 A;  4IOY X;  2D9Y A;  4B6H A;  1X11 A;  2UVM A;  1X1F A;  1J0W A;  4Y94 A;  1V5P A;  3KRW A;  4EKU A;  3QWM A;  1FAO A;  3PVL A;  1FHO A;  2RSG A;  2G35 A;  4ZRI A;  1IRS A;  2GJY A;  5L81 A;  2D10 A;  3PSC A;  2DTC A;  1DYN A;  2DKP A;  3P7Z A;  4WSF A;  1M7R A;  1RRP B;  1WG7 A;  2EMS A;  2HTH B;  4WJ7 A;  5JHG A;  3F5R A;  5D27 A;  4TKN A;  1W1D A;  4NY0 A;  1E5W A;  3SUZ A;  2M14 A;  3U7D A;  1U5F A;  1BTK A;  5DIF B;  1KI1 B;  4DXA B;  3AJ4 A;  4NSW A;  3TFM A;  1MK7 B;  5C16 A;  1FB8 A;  2VKI A;  3U8Z A;  4EJN A;  2QKL A;  3LJU X;  2N0Y A;  1LB1 A;  1RJ2 A;  1ISN A;  5FI1 A;  3KY9 A;  1V88 A;  2P0D A;  5C79 A;  1AQC A;  1GC6 A;  1MPH A;  2K2J A;  3ULC A;  2DLW A;  2DN6 A;  2HE7 A;  1Q67 A;  2Z0Q A;  1EAZ A;  4CHM A;  1W1G A;  1WJ1 A;  4HDO A;  1FHW A;  4K2O A;  3TW1 A;  1MAI A;  1NU2 A;  2D9W A;  1V5M A;  3DXC A;  4WVF B;  2Q13 A;  2GS0 A;  3PP2 A;  3PG7 A;  2COF A;  3D8E A;  4K2P A;  1H4R A;  2LOX A;  3A8Q A;  5HE2 A;  1DDV A;  5HE1 A;  2AEH A;  1NTV A;  2W2W A;  2IYB A;  1N3H A;  3TO1 A;  1UPR A;  3SNH A;  4GN1 A;  3BJI A;  2MWN B;  2K2U A;  2FJL A;  4KAX B;  2COC A;  5D3W A;  1WI1 A;  3TVV A;  3ODX A;  1DBH A;  4MT7 A;  4HAU B;  3KZ1 A;  1ZC4 B;  2W2X D;  4EMO A;  1MK9 B;  2YT0 A;  1U2B A;  2YT1 A;  2MKR A;  3ULB A;  4F7G A;  5CLL B;  2DX1 A;  2ADZ A;  4YON A;  3PEG A;  2Y7B A;  1AWE A;  2ELA A;  1XOD A;  2DYQ A;  2H7E A;  2NMB A;  2R0D A;  2P0F A;  4KHA A;  3F0W A;  1SGH A;  2D9X A;  2ELB A;  3QIJ A;  1X05 A;  1SHC A;  4KVG B;  3AU5 A;  1TXD A;  1OQN A;  3VIA A;  2P8V A;  3D8D A;  3HW2 B;  1WJM A;  2RNR B;  2D9Z A;  4HAZ B;  3FM8 C;  3OAN A;  1EVH A;  1U27 A;  1XKE A;  4IAP A;  4A6F B;  3PVW A;  1TQZ A;  2EMT A;  1X1G A;  3PZD A;  1TJ6 A;  1Z87 A;  2YSZ A;  1LW3 A;  1X86 A;  1BWN A;  5D3V A;  2YRY A;  2RGN B;  1XX0 A;  5LON B;  4HAT B;  5CLQ B;  1UNP A;  1P6S A;  3N7C A;  4A6F A;  1MKE A;  4KHO A;  3DXD A;  2I5F A;  1I7A A;  5JP4 A;  2CY5 A;  3MPX A;  5JLJ B;  3TCA A;  1K5D B;  2DKQ A;  3T06 A;  4HHV A;  1J19 A;  2KCJ A;  2DHK A;  4HB4 B;  1U5G A;  4IFS A;  4D0N B;  1DDM A;  1WGQ A;  5J3T A;  1PLS A;  5HE3 A;  1ZVR A;  2DFK A;  4L6E A;  2LG1 A;  5C5B A;  3A98 B;  1OY2 A;  2LOZ A;  4CHJ A;  2N23 A;  4DX9 0;  3NSU A;  1FGY A;  4HB0 B;  3X23 A;  4Z2N A;  5DI9 B;  5JHH A;  1XR0 B;  3HQC A;  1FHX A;  3KSY A;  2I5C A;  3MDB C;  2LYD A;  1FGZ A;  1BTN A;  4HB2 B;  3KRX A;  2KUP A;  1DRO A;  1U5E A;  4F7U P;  1DDW A;  2H7D A;  4GZU A;  2DYN A;  2D2Q A;  3GYP A;  2J0K A;  1QQG A;  2DHI A;  2DHJ A;  3G9W A;  2X18 A;  2UZS A;  1MIX A;  1H10 A;  1PMS A;  2YVC A;  5J3Q A;  1W1H A;  2Y8G A;  4GMV A;  2J0M A;  2LUL A;  4MK0 A;  2I1K A;  2RVB B;  1EF1 A;  2IFS A;  1KZ7 A;  5DH9 B;  4HAW B;  1OMW A;  1M7E A;  4ZRK A;  2UZR A;  2EC1 A;  2VRW B;  4HAX B;  2DX5 A;  3CXB B;  3WYF B;  3SYX A;  1QC6 A;  2YS3 A;  1P3R A;  3ODW A;  4K81 A;  2P0H A;  5C6R A;  2RLO A;  2Y8F A;  3P6A A;  4GPT B;  3SV1 A;  1ZSQ A;  2GCL A;  5J3Y A;  1I2H A;  3ZVR A;  1U29 A;  2YF0 A;  2AL6 A;  2NZ8 B;  1NI2 A;  1K5G B;  4K17 A;  5KCV A;  3IVF A;  3AU4 A;  1U5D A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  2K49 A;  4YL8 A;  1UNR A;  2ROV A;  2QKM A;  3SO6 A;  2CY4 A;  3DXE A;  4HAV B;  2I1J A;  2ROZ B;  1V61 A;  2MFQ A;  2Z0P A;  4TYZ A;  3V5W A;  5KQ4 A;  2CAY A;  2LKO A;  1KZG A;  4OT1 A;  4Z2M B;  2BCJ A;  5EFX A;  2FJU B;  3GYO A;  4GMX B;  1Y19 B;  4HDQ A;  1PFJ A;  4A6K A;  3BIN A;  2RUK B;  2V76 A;  2DA0 A;  4HAY B;  1V89 A;  5KQ1 A;  2E2X A;  4H8S A;  1EGX A;  5LOP B;  5D3Y A;  2JP2 A;  4XWX A;  4P7I A;  2D9V A;  1Y5O A;  2NBV A;  5GOW B;  5DHA B;  1P5T A;  3FEH A;  4PQ0 A;  1MI1 A;  2OTX A;  3D8F A;  3A8P A;  3WA0 A;  2W2X C;  1ZC3 B;  4ZRJ A;  2Z0O A;  2EJ8 A;  2J59 M;  1WGU A;  1UEF A;  3RCP A;  2ZKM X;  5HE0 A;  4CSQ A;  2D4Q A;  2ZPY A;  4F7H A;  4DX8 A;  2K00 A;  1ZM0 A;  2YS5 A;  5C5B B;  2L2I A;  2YS1 A;  3ZDT A;  4QJ3 B;  2COD A;  3M1I B;  2MDX A;  4KHB B;  1FOE A;  1B55 A;  2J0J A;  3ML4 A;  1UNQ A;  3UZT A;  4PNK A;  4A5K A;  1XCG A;  2KGX B;  4DBB A;  4A6H A;  2OQB A;  3VOQ A;  2GCJ A;  4C0A A;  1BAK A;  4BBK A;  3O96 A;  1UPQ A;  3FVC A;  2XQN M;  2L1C A;  1NTY A;  5DHF B;  1GG3 A;  1WVH A;  2M38 A;  4GXB A;  4OSN A;  2CRF A;  3ODO A;  3QBV B;  1GC7 A;  4QJ5 B;  2VSZ A;  3PVU A;  2D11 A;  4CYE A;  3FSS A;  5D3X A;  2R09 A;  5FI0 A;  1MIZ B;  3CIK A;  4MY6 A;  2COA A;  1XD4 A;  4HB3 B;  1V5U A;  3HK0 A;  4IOY X;  2D9Y A;  4B6H A;  1X11 A;  2UVM A;  1X1F A;  1J0W A;  4Y94 A;  1V5P A;  3KRW A;  4EKU A;  3QWM A;  1FAO A;  3PVL A;  1FHO A;  2RSG A;  2G35 A;  4ZRI A;  2KIE A;  1IRS A;  2GJY A;  5L81 A;  2D10 A;  3PSC A;  2DTC A;  1DYN A;  2DKP A;  3P7Z A;  4WSF A;  1M7R A;  1RRP B;  1WG7 A;  2EMS A;  2HTH B;  3HIE A;  4WJ7 A;  5JHG A;  3F5R A;  5D27 A;  4TKN A;  1W1D A;  4NY0 A;  1E5W A;  3SUZ A;  2Z4D A;  2M14 A;  3U7D A;  1U5F A;  1BTK A;  5DIF B;  1KI1 B;  4DXA B;  3AJ4 A;  4NSW A;  3TFM A;  3A58 A;  1MK7 B;  5C16 A;  3OHM B;  1FB8 A;  2YT2 A;  2VKI A;  3U8Z A;  4EJN A;  2QKL A;  3LJU X;  2N0Y A;  1LB1 A;  1RJ2 A;  1ISN A;  5FI1 A;  3KY9 A;  3DCX A;  1V88 A;  2P0D A;  5C79 A;  1AQC A;  1GC6 A;  1MPH A;  2K2J A;  3NWF A;  3ULC A;  2DLW A;  2DN6 A;  2HE7 A;  2KUQ A;  1Q67 A;  2Z0Q A;  2Z59 A;  1EAZ A;  4CHM A;  1W1G A;  1WJ1 A;  4HDO A;  1FHW A;  2Z13 A;  4K2O A;  3U12 A;  3TW1 A;  2Z14 A;  1MAI A;  1NU2 A;  2D9W A;  1V5M A;  3DXC A;  4WVF B;  2Q13 A;  3NW8 A;  2GS0 A;  3PP2 A;  3PG7 A;  2COF A;  4GNK B;  3D8E A;  4K2P A;  1H4R A;  2LOX A;  3A8Q A;  5HE2 A;  1DDV A;  5HE1 A;  2AEH A;  1NTV A;  2W2W A;  2IYB A;  1N3H A;  3TO1 A;  1UPR A;  3SNH A;  4GN1 A;  3BJI A;  2MWN B;  5LG4 B;  2K2U A;  2FJL A;  4KAX B;  2COC A;  5D3W A;  1WI1 A;  3TVV A;  4QXA B;  3ODX A;  1DBH A;  4MT7 A;  4HAU B;  3KZ1 A;  1ZC4 B;  2W2X D;  4EMO A;  2KIG A;  1MK9 B;  2YT0 A;  1U2B A;  2YT1 A;  2MKR A;  3ULB A;  4QJ4 B;  4F7G A;  5CLL B;  2DX1 A;  2ADZ A;  4YON A;  3PEG A;  2Y7B A;  1AWE A;  2ELA A;  2R2Y A;  1XOD A;  2DYQ A;  2H7E A;  2NMB A;  2R0D A;  2P0F A;  4KHA A;  3F0W A;  1SGH A;  2D9X A;  2ELB A;  3QIJ A;  1X05 A;  1SHC A;  4KVG B;  3AU5 A;  1TXD A;  1OQN A;  3VIA A;  2GUM A;  2P8V A;  3D8D A;  3HW2 B;  1WJM A;  2RNR B;  2D9Z A;  4HAZ B;  3B77 A;  3FM8 C;  5IRS A;  3OAN A;  1EVH A;  1U27 A;  1XKE A;  4IAP A;  4A6F B;  3PVW A;  1TQZ A;  2EMT A;  1X1G A;  2K8E A;  3PZD A;  1TJ6 A;  1Z87 A;  1ZYI A;  2YSZ A;  5I2M A;  1LW3 A;  1X86 A;  3NWD A;  1BWN A;  5D3V A;  2YRY A;  2RGN B;  1XX0 A;  5LON B;  4HAT B;  5CLQ B;  1UNP A;  4L1R A;  1P6S A;  5I2S A;  3N7C A;  4A6F A;  5M4Y B;  1MKE A;  4KHO A;  3DXD A;  2I5F A;  1I7A A;  4GOU A;  5JP4 A;  2CY5 A;  3MPX A;  5JLJ B;  3TCA A;  1K5D B;  2DKQ A;  3T06 A;  4HHV A;  1J19 A;  2KCJ A;  2DHK A;  4HB4 B;  1U5G A;  4IFS A;  4D0N B;  1DDM A;  1WGQ A;  4KHB A;  5J3T A;  1PLS A;  5HE3 A;  1ZVR A;  2DFK A;  4L6E A;  2LG1 A;  5C5B A;  3A98 B;  1OY2 A;  2LOZ A;  4CHJ A;  2N23 A;  4DX9 0;  3NSU A;  1FGY A;  4HB0 B;  3X23 A;  4HSI A;  4Z2N A;  5DI9 B;  5JHH A;  4D6W A;  1XR0 B;  3HQC A;  1FHX A;  3KSY A;  2I5C A;  3MDB C;  3NWA A;  2LYD A;  1FGZ A;  2KR0 A;  1BTN A;  4HB2 B;  3KRX A;  2KUP A;  1DRO A;  1U5E A;  4F7U P;  1DDW A;  2H7D A;  4GZU A;  2DYN A;  2D2Q A;  2RRF A;  3GYP A;  2J0K A;  1QQG A;  2DHI A;  2DHJ A;  3G9W A;  2X18 A;  2UZS A;  1MIX A;  1H10 A;  1PMS A;  2YVC A;  5J3Q A;  1W1H A;  2Y8G A;  4GMV A;  2J0M A;  2LUL A;  4MK0 A;  2I1K A;  2RVB B;  1EF1 A;  2IFS A;  1KZ7 A;  5DH9 B;  4HAW B;  1OMW A;  1M7E A;  4ZRK A;  2UZR A;  2EC1 A;  2VRW B;  4HAX B;  2DX5 A;  3CXB B;  3WYF B;  3SYX A;  1QC6 A;  2YS3 A;  1T77 A;  1P3R A;  3ODW A;  4K81 A;  2P0H A;  5C6R A;  2RLO A;  2Y8F A;  3P6A A;  4GPT B;  3SV1 A;  1ZSQ A;  2GCL A;  5J3Y A;  1I2H A;  3ZVR A;  1U29 A;  2YF0 A;  2AL6 A;  2NZ8 B;  4DIX A;  1NI2 A;  1K5G B;  3HSA A;  4K17 A;  5KCV A;  3IVF A;  3AU4 A;  1U5D A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  4YL8 A;  1UNR A;  2ROV A;  2QKM A;  3SO6 A;  2CY4 A;  3DXE A;  4HAV B;  2I1J A;  2ROZ B;  1V61 A;  2MFQ A;  2Z0P A;  4TYZ A;  3V5W A;  5KQ4 A;  2CAY A;  2LKO A;  1KZG A;  4Z2M B;  2BCJ A;  5EFX A;  3GYO A;  4GMX B;  1Y19 B;  4HDQ A;  1PFJ A;  4A6K A;  3BIN A;  2RUK B;  2V76 A;  2DA0 A;  4HAY B;  1V89 A;  5KQ1 A;  2E2X A;  4H8S A;  1EGX A;  5LOP B;  5D3Y A;  2JP2 A;  4XWX A;  4P7I A;  2D9V A;  1Y5O A;  5GOW B;  5DHA B;  1P5T A;  3FEH A;  4PQ0 A;  2OTX A;  3D8F A;  3A8P A;  3WA0 A;  2W2X C;  1ZC3 B;  4ZRJ A;  2Z0O A;  2EJ8 A;  2J59 M;  1WGU A;  1UEF A;  3RCP A;  5HE0 A;  2D4Q A;  2ZPY A;  4F7H A;  4DX8 A;  2K00 A;  1ZM0 A;  2YS5 A;  5C5B B;  2L2I A;  2YS1 A;  3ZDT A;  2COD A;  3M1I B;  2MDX A;  4KHB B;  1FOE A;  1B55 A;  2J0J A;  3ML4 A;  1UNQ A;  3UZT A;  4PNK A;  4A5K A;  1XCG A;  2KGX B;  4DBB A;  4A6H A;  2OQB A;  3VOQ A;  2GCJ A;  4C0A A;  1BAK A;  4BBK A;  3O96 A;  1UPQ A;  2XQN M;  2L1C A;  1NTY A;  5DHF B;  4GXB A;  1GG3 A;  1WVH A;  2M38 A;  2CRF A;  3ODO A;  3QBV B;  1GC7 A;  2VSZ A;  3PVU A;  2D11 A;  4CYE A;  3FSS A;  5D3X A;  2R09 A;  5FI0 A;  1MIZ B;  3CIK A;  4MY6 A;  2COA A;  1XD4 A;  4HB3 B;  1V5U A;  3HK0 A;  4IOY X;  2D9Y A;  4B6H A;  1X11 A;  2UVM A;  1X1F A;  1J0W A;  4Y94 A;  1V5P A;  3KRW A;  4EKU A;  3QWM A;  1FAO A;  3PVL A;  1FHO A;  2RSG A;  2G35 A;  4ZRI A;  1IRS A;  2GJY A;  5L81 A;  2D10 A;  3PSC A;  2DTC A;  1DYN A;  2DKP A;  3P7Z A;  4WSF A;  1M7R A;  1RRP B;  1WG7 A;  2EMS A;  2HTH B;  4WJ7 A;  5JHG A;  3F5R A;  5D27 A;  4TKN A;  1W1D A;  4NY0 A;  1E5W A;  3SUZ A;  2M14 A;  3U7D A;  1U5F A;  1BTK A;  5DIF B;  1KI1 B;  4DXA B;  3AJ4 A;  4NSW A;  3TFM A;  1MK7 B;  5C16 A;  1FB8 A;  2VKI A;  3U8Z A;  4EJN A;  2QKL A;  3LJU X;  2N0Y A;  1LB1 A;  1RJ2 A;  1ISN A;  5FI1 A;  3KY9 A;  1V88 A;  2P0D A;  5C79 A;  1AQC A;  1GC6 A;  1MPH A;  2K2J A;  3ULC A;  2DLW A;  2DN6 A;  2HE7 A;  1Q67 A;  2Z0Q A;  1EAZ A;  4CHM A;  1W1G A;  1WJ1 A;  4HDO A;  1FHW A;  4K2O A;  3TW1 A;  1MAI A;  1NU2 A;  2D9W A;  1V5M A;  3DXC A;  4WVF B;  2Q13 A;  2GS0 A;  3PP2 A;  3PG7 A;  2COF A;  3D8E A;  4K2P A;  1H4R A;  2LOX A;  3A8Q A;  5HE2 A;  1DDV A;  5HE1 A;  2AEH A;  1NTV A;  2W2W A;  2IYB A;  1N3H A;  3TO1 A;  1UPR A;  3SNH A;  4GN1 A;  3BJI A;  2MWN B;  2K2U A;  2FJL A;  4KAX B;  2COC A;  5D3W A;  1WI1 A;  3TVV A;  3ODX A;  1DBH A;  4MT7 A;  4HAU B;  3KZ1 A;  1ZC4 B;  2W2X D;  4EMO A;  1MK9 B;  2YT0 A;  1U2B A;  2YT1 A;  2MKR A;  3ULB A;  4F7G A;  5CLL B;  2DX1 A;  2ADZ A;  4YON A;  3PEG A;  2Y7B A;  1AWE A;  2ELA A;  1XOD A;  2DYQ A;  2H7E A;  2NMB A;  2R0D A;  2P0F A;  4KHA A;  3F0W A;  1SGH A;  2D9X A;  2ELB A;  3QIJ A;  1X05 A;  1SHC A;  4KVG B;  3AU5 A;  1TXD A;  1OQN A;  3VIA A;  2P8V A;  3D8D A;  3HW2 B;  1WJM A;  2RNR B;  2D9Z A;  4HAZ B;  3FM8 C;  3OAN A;  1EVH A;  1U27 A;  1XKE A;  4IAP A;  4A6F B;  3PVW A;  1TQZ A;  2EMT A;  1X1G A;  3PZD A;  1TJ6 A;  1Z87 A;  2YSZ A;  1LW3 A;  1X86 A;  1BWN A;  5D3V A;  2YRY A;  2RGN B;  1XX0 A;  5LON B;  4HAT B;  5CLQ B;  1UNP A;  1P6S A;  3N7C A;  4A6F A;  1MKE A;  4KHO A;  3DXD A;  2I5F A;  1I7A A;  5JP4 A;  2CY5 A;  3MPX A;  5JLJ B;  3TCA A;  1K5D B;  2DKQ A;  3T06 A;  4HHV A;  1J19 A;  2KCJ A;  2DHK A;  4HB4 B;  1U5G A;  4IFS A;  4D0N B;  1DDM A;  1WGQ A;  5J3T A;  1PLS A;  5HE3 A;  1ZVR A;  2DFK A;  4L6E A;  2LG1 A;  5C5B A;  3A98 B;  1OY2 A;  2LOZ A;  4CHJ A;  2N23 A;  4DX9 0;  3NSU A;  1FGY A;  4HB0 B;  3X23 A;  4Z2N A;  5DI9 B;  5JHH A;  1XR0 B;  3HQC A;  1FHX A;  3KSY A;  2I5C A;  3MDB C;  2LYD A;  1FGZ A;  1BTN A;  4HB2 B;  3KRX A;  2KUP A;  1DRO A;  1U5E A;  4F7U P;  1DDW A;  2H7D A;  4GZU A;  2DYN A;  2D2Q A;  3GYP A;  2J0K A;  1QQG A;  2DHI A;  2DHJ A;  3G9W A;  2X18 A;  2UZS A;  1MIX A;  1H10 A;  1PMS A;  2YVC A;  5J3Q A;  1W1H A;  2Y8G A;  4GMV A;  2J0M A;  2LUL A;  4MK0 A;  2I1K A;  2RVB B;  1EF1 A;  2IFS A;  1KZ7 A;  5DH9 B;  4HAW B;  1OMW A;  1M7E A;  4ZRK A;  2UZR A;  2EC1 A;  2VRW B;  4HAX B;  2DX5 A;  3CXB B;  3WYF B;  3SYX A;  1QC6 A;  2YS3 A;  1P3R A;  3ODW A;  4K81 A;  2P0H A;  5C6R A;  2RLO A;  2Y8F A;  3P6A A;  4GPT B;  3SV1 A;  1ZSQ A;  2GCL A;  5J3Y A;  1I2H A;  3ZVR A;  1U29 A;  2YF0 A;  2AL6 A;  2NZ8 B;  1NI2 A;  1K5G B;  4K17 A;  5KCV A;  3IVF A;  3AU4 A;  1U5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...