2CY5A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-2 crystal)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
MADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)
rcsb
source organism Mus musculus
total genus 29
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy5A00
2COCA 2HE7A 3KRWA 3ML4A 2UZSA 1GC6A 1UNPA 2D9XA 4Z2NA 4TKNA 2DYQA 4A6HA 1WVHA 2Q13A 4PNKA 1BWNA 4TYZA 5J3TA 4A6FA 3TCAA 1OY2A 1TJ6A 4K2PA 2L1CA 1MK9B 1XR0B 2K2JA 2KUPA 4HHVA 2ELAA 2Y8FA 2GS0A 2LOZA 2DTCA 4NSWA 2D9WA 4C0AA 3CIKA 1V5MA 5J3YA 2E2XA 2HTHB 2YS1A 3PVUA 1UPQA 4B6HA 5HE0A 3V5WA 2H7EA 4EJNA 1OMWA 2GJYA 4H8SA 4D0NB 3CXBB 2RUKB 1MIXA 1XKEA 1WJMA 1W1HA 3A8PA 3MPXA 2YT1A 4A5KA 2MDXA 3PVLA 5D3XA 2Z0PA 1ZM0A 1UPRA 1X1GA 2VSZA 1BTNA 2R0DA 4A6FB 4CYEA 1BTKA 4F7HA 4F7GA 1X05A 2BCJA 5HE3A 5HE2A 1W1DA 1DYNA 5D3YA 1MK7B 2D9ZA 4KHBB 3ULCA 3GYPA 2QKMA 3ULBA 2P0FA 2ZPYA 3NSUA 3WA0A 5D27A 1NU2A 4GXBA 2W2XC 2I5CA 1ZSQA 2UZRA 2DHKA 4DBBA 1V61A 4ZRIA 3OANA 2CY4A 2AL6A 1WG7A 1PFJA 1EGXA 4HDQA 1IRSA 5LONB 2DKQA 4WVFB 1J0WA 4GMXB 2YS5A 2IFSA 1RJ2A 4HAXB 1MKEA 4DX8A 2RSGA 2DX1A 2DLWA 5DIFB 3FEHA 2P0HA 3F0WA 2NMBA 5D3VA 3SO6A 1TXDA 2Y7BA 3LJUX 4EMOA 1UEFA 1J19A 4YONA 1WI1A 1U5FA 4HAWB 1I7AA 2DKPA 2DFKA 2VKIA 2M38A 5C79A 1KZ7A 2FJLA 5JHHA 2KGXB 1KZGA 2K2UA 1PLSA 3RCPA 2ROVA 4WSFA 4KAXB 1Y19B 1H4RA 2IYBA 2D9VA 2YF0A 2PZ1A 3D8FA 2RVBB 3HQCA 4HB0B 3DXDA 3T06A 1FHOA 1MPHA 2MFQA 5J3QA 2RNRB 2DX5A 2L2IA 5L81A 1QC6A 2YT0A 1XODA 4K81A 5DH9B 5DI9B 1DBHA 1SGHA 4ZRKA 1U29A 1FGZA 1U5EA 1U2BA 2N0YA 3VIAA 5C6RA 1DDWA 1UNRA 2GCLA 2D2QA 4CHMA 3SUZA 2COAA 2LYDA 2P0DA 1FAOA 1E5WA 3U8ZA 1EF1A 3HK0A 3N7CA 1OQNA 1DDVA 4BBKA 2I1JA 3O96A 2G35A 2MWNB 1FB8A 4HAVB 1X1FA 1Q67A 2D9YA 4IFSA 1I2HA 2W2XD 3DXCA 3PZDA 2W2WA 4K17A 2LKOA 1DDMA 4GPTB 3SYXA 2Z0QA 5DHFB 5FI0A 3KSYA 1Z87A 4KVGB 3A8QA 3TO1A 4Z2MB 1XCGA 1P5TA 3PEGA 5GOWB 3VOQA 2JP2A 4IOYX 3QBVB 1FHXA 2DHJA 4YL8A 3FSSA 5CLQB 4HB3B 4HAZB 3X23A 3A98B 2Y8GA 1DROA 1H10A 2ADZA 2CY5A 3ODOA 4MK0A 4CHJA 2QKLA 2J59M 1P3RA 5LOPB 1BAKA 3PP2A 1Y5OA 1FOEA 4WJ7A 1U27A 2XQNM 3AU4A 4KHOA 3TVVA 2GCJA 2R09A 1K5GB 5JLJB 3G9WA 1P6SA 2DYNA 1GC7A 4L6EA 1X11A 2CODA 3AJ4A 2H7DA 5C16A 3FM8C 2EMTA 3TFMA 2V76A 5JP4A 3KZ1A 4HDOA 4ZRJA 2DN6A 2LULA 1M7RA 1FHWA 4MT7A 5JHGA 2J0KA 1EAZA 3AU5A 1NI2A 1X86A 4K2OA 2J0MA 2OQBA 1U5GA 2AEHA 2UVMA 5EFXA 2VRWB 3BINA 4P7IA 4GN1A 2DA0A 3PVWA 1ZC3B 1KI1B 4IAPA 2COFA 2D11A 3SV1A 3GYOA 2D10A 4DX90 1SHCA 2CAYA 3PSCA 4HB2B 2J0JA 3HW2B 1V5PA 5DHAB 2CRFA 3UZTA 2DHIA 2ROZB 2YSZA 1N3HA 4HAUB 4HB4B 2P8VA 3QIJA 4HAYB 2X18A 2RLOA 4MY6A 1AQCA 1GG3A 5KQ1A 1WGUA 3ZDTA 3M1IB 3ODXA 1WJ1A 2Z0OA 1ZC4B 1B55A 1EVHA 5FI1A 3BJIA 1M7EA 3D8DA 2YS3A 2N23A 4GZUA 4A6KA 4GMVA 1QQGA 3MDBC 3WYFB 3KRXA 2MKRA 3PG7A 3SNHA 4NY0A 2NZ8B 5CLLB 1TQZA 4F7UP 1V89A 2LOXA 1XX0A 4Y94A 5C5BA 3P7ZA 3U7DA 2EJ8A 1K5DB 1AWEA 2K00A 3P6AA 2KCJA 1V88A 1NTYA 1W1GA 2EMSA 2D4QA 4HATB 3KY9A 1ZVRA 1WGQA 2ELBA 3ODWA 1FGYA 1PMSA 5HE1A 5D3WA 2M14A 4PQ0A 2I1KA 1MIZB 2YVCA 1UNQA 5KQ4A 2I5FA 1U5DA 3ZVRA 2RGNB 4EKUA 1LW3A 2YRYA 5KCVA 2LG1A 3D8EA 1ISNA 3TW1A 3DXEA 1LB1A 3QWMA 1NTVA 4KHAA 4XWXA 1V5UA 2OTXA 3IVFA 4DXAB 1RRPB 5C5BB 1XD4A 1MAIA 2EC1A 3F5RA
chains in the Genus database with same CATH superfamily
2COCA 2HE7A 3KRWA 3ML4A 2UZSA 1GC6A 3DCXA 1UNPA 2K8EA 2D9XA 4Z2NA 4TKNA 2DYQA 4GOUA 3NWDA 4A6HA 4DIXA 1WVHA 3NWFA 2Q13A 4PNKA 1BWNA 1ZYIA 4TYZA 5J3TA 4A6FA 3TCAA 1OY2A 1TJ6A 4K2PA 2L1CA 1MK9B 1XR0B 2K2JA 2KUPA 4HHVA 2ELAA 2Y8FA 2GS0A 2LOZA 2DTCA 4NSWA 2D9WA 4C0AA 3CIKA 1V5MA 5J3YA 4KHBA 2E2XA 2HTHB 2YS1A 3PVUA 1UPQA 4B6HA 5HE0A 3V5WA 2H7EA 4EJNA 1OMWA 2GJYA 4H8SA 4D0NB 3CXBB 2RUKB 1MIXA 1XKEA 1WJMA 1W1HA 3A8PA 3MPXA 2YT1A 4A5KA 2MDXA 3PVLA 5D3XA 2Z0PA 1ZM0A 1UPRA 1X1GA 2KUQA 2VSZA 1BTNA 2R0DA 4A6FB 4CYEA 1BTKA 4F7HA 4F7GA 1X05A 2BCJA 5HE3A 2NBVA 5HE2A 1W1DA 1DYNA 5D3YA 1MK7B 2RRFA 2D9ZA 4KHBB 3ULCA 3GYPA 2QKMA 3ULBA 2P0FA 2ZPYA 3NSUA 3WA0A 5D27A 1NU2A 4QJ3B 4GXBA 2W2XC 2I5CA 1ZSQA 2UZRA 2DHKA 4DBBA 1V61A 3A58A 3OANA 4ZRIA 2CY4A 2AL6A 4GNKB 1WG7A 1PFJA 4CSQA 4HDQA 1IRSA 1EGXA 5LONB 2DKQA 4QXAB 4WVFB 1J0WA 4GMXB 2YS5A 2IFSA 1RJ2A 4HAXB 1MKEA 4DX8A 2RSGA 2DX1A 2DLWA 5DIFB 3FEHA 2P0HA 3F0WA 2NMBA 5D3VA 3SO6A 1TXDA 2Y7BA 3LJUX 4EMOA 1UEFA 1J19A 4YONA 1WI1A 1U5FA 4HAWB 1I7AA 4HSIA 2DKPA 2DFKA 2VKIA 2M38A 5C79A 1KZ7A 2FJLA 5JHHA 2KGXB 1KZGA 2K2UA 1PLSA 3RCPA 2ROVA 4WSFA 4KAXB 1Y19B 1H4RA 2IYBA 2D9VA 2YF0A 2KIGA 2PZ1A 3D8FA 2RVBB 3HQCA 4HB0B 3DXDA 3T06A 1FHOA 1MPHA 2MFQA 5J3QA 2RNRB 2DX5A 2L2IA 5L81A 1QC6A 2YT0A 1XODA 4K81A 2YT2A 5DH9B 5DI9B 1DBHA 1SGHA 4ZRKA 2Z59A 1U29A 1FGZA 1U5EA 4QJ4B 1U2BA 2N0YA 3VIAA 5C6RA 1DDWA 1UNRA 2GCLA 2D2QA 4CHMA 3SUZA 2COAA 2LYDA 2P0DA 1FAOA 1E5WA 3U8ZA 1EF1A 3HK0A 3N7CA 1OQNA 1DDVA 4BBKA 2I1JA 3O96A 2G35A 2MWNB 1FB8A 4HAVB 1X1FA 1Q67A 2D9YA 4IFSA 1I2HA 2W2XD 3DXCA 3PZDA 2W2WA 3HIEA 4K17A 2Z13A 2LKOA 1DDMA 4GPTB 3FVCA 3SYXA 2Z0QA 5DHFB 5FI0A 3KSYA 1Z87A 4KVGB 3A8QA 3TO1A 4Z2MB 1XCGA 5I2MA 1P5TA 3PEGA 5GOWB 3VOQA 2JP2A 4IOYX 2Z4DA 3QBVB 1FHXA 2DHJA 4YL8A 3FSSA 5CLQB 4HB3B 1T77A 4HAZB 3X23A 3A98B 2KR0A 2Y8GA 1DROA 3OHMB 1H10A 2ADZA 2CY5A 3ODOA 4MK0A 4CHJA 2QKLA 2J59M 1P3RA 5LOPB 1BAKA 3PP2A 1Y5OA 1FOEA 2GUMA 4WJ7A 1U27A 2XQNM 3AU4A 4KHOA 3TVVA 5LG4B 2GCJA 4OT1A 2R09A 4D6WA 1K5GB 5JLJB 3G9WA 1P6SA 2DYNA 1GC7A 4L6EA 1X11A 2CODA 3AJ4A 2H7DA 5C16A 3FM8C 2EMTA 3TFMA 2V76A 5JP4A 3KZ1A 4HDOA 4ZRJA 2DN6A 2R2YA 2LULA 1M7RA 1FHWA 4MT7A 5JHGA 2J0KA 5IRSA 1EAZA 3AU5A 2K49A 1NI2A 1X86A 4K2OA 2J0MA 2OQBA 1U5GA 2AEHA 2UVMA 5EFXA 2VRWB 3BINA 4P7IA 4GN1A 4OSNA 2DA0A 3PVWA 1ZC3B 1KI1B 4IAPA 2COFA 2D11A 3SV1A 3GYOA 2D10A 1MI1A 4DX90 1SHCA 2CAYA 3PSCA 4HB2B 2J0JA 3HW2B 1V5PA 5DHAB 2CRFA 3UZTA 2DHIA 2ROZB 2YSZA 1N3HA 4HAUB 4HB4B 2P8VA 3QIJA 4HAYB 2X18A 2RLOA 4MY6A 1AQCA 1GG3A 4QJ5B 5KQ1A 1WGUA 3ZDTA 2KIEA 3M1IB 3ODXA 1WJ1A 2Z0OA 1ZC4B 2Z14A 5I2SA 1B55A 1EVHA 5FI1A 3BJIA 4L1RA 1M7EA 3D8DA 2YS3A 2N23A 4GZUA 4A6KA 4GMVA 1QQGA 3MDBC 3WYFB 3NW8A 3KRXA 2MKRA 3PG7A 3SNHA 3HSAA 4NY0A 2NZ8B 2FJUB 5M4YB 5CLLB 1TQZA 4F7UP 1V89A 2LOXA 1XX0A 4Y94A 5C5BA 3P7ZA 3U7DA 2EJ8A 1K5DB 1AWEA 2K00A 2KCJA 3P6AA 1V88A 1NTYA 3U12A 1W1GA 2EMSA 2D4QA 3NWAA 4HATB 3KY9A 1ZVRA 1WGQA 2ELBA 3ODWA 1FGYA 1PMSA 5HE1A 5D3WA 2M14A 4PQ0A 2I1KA 1MIZB 2YVCA 1UNQA 5KQ4A 2I5FA 1U5DA 3ZVRA 2RGNB 3B77A 4EKUA 1LW3A 2YRYA 5KCVA 2LG1A 3D8EA 1ISNA 3TW1A 3DXEA 1LB1A 3QWMA 1NTVA 4KHAA 4XWXA 1V5UA 2OTXA 3IVFA 4DXAB 1RRPB 2ZKMX 5C5BB 1XD4A 1MAIA 2EC1A 3F5RA
chains in the Genus database with same CATH topology
2COCA 2HE7A 3KRWA 3ML4A 2UZSA 1GC6A 1UNPA 2D9XA 4Z2NA 4TKNA 2DYQA 4A6HA 1WVHA 2Q13A 4PNKA 1BWNA 4TYZA 5J3TA 4A6FA 3TCAA 1OY2A 1TJ6A 4K2PA 2L1CA 1MK9B 1XR0B 2K2JA 2KUPA 4HHVA 2ELAA 2Y8FA 2GS0A 2LOZA 2DTCA 4NSWA 2D9WA 4C0AA 3CIKA 1V5MA 5J3YA 2E2XA 2HTHB 2YS1A 3PVUA 1UPQA 4B6HA 5HE0A 3V5WA 2H7EA 4EJNA 1OMWA 2GJYA 4H8SA 4D0NB 3CXBB 2RUKB 1MIXA 1XKEA 1WJMA 1W1HA 3A8PA 3MPXA 2YT1A 4A5KA 2MDXA 3PVLA 5D3XA 2Z0PA 1ZM0A 1UPRA 1X1GA 2VSZA 1BTNA 2R0DA 4A6FB 4CYEA 1BTKA 4F7HA 4F7GA 1X05A 2BCJA 5HE3A 5HE2A 1W1DA 1DYNA 5D3YA 1MK7B 2D9ZA 4KHBB 3ULCA 3GYPA 2QKMA 3ULBA 2P0FA 2ZPYA 3NSUA 3WA0A 5D27A 1NU2A 4GXBA 2W2XC 2I5CA 1ZSQA 2UZRA 2DHKA 4DBBA 1V61A 4ZRIA 3OANA 2CY4A 2AL6A 1WG7A 1PFJA 1EGXA 4HDQA 1IRSA 5LONB 2DKQA 4WVFB 1J0WA 4GMXB 2YS5A 2IFSA 1RJ2A 4HAXB 1MKEA 4DX8A 2RSGA 2DX1A 2DLWA 5DIFB 3FEHA 2P0HA 3F0WA 2NMBA 5D3VA 3SO6A 1TXDA 2Y7BA 3LJUX 4EMOA 1UEFA 1J19A 4YONA 1WI1A 1U5FA 4HAWB 1I7AA 2DKPA 2DFKA 2VKIA 2M38A 5C79A 1KZ7A 2FJLA 5JHHA 2KGXB 1KZGA 2K2UA 1PLSA 3RCPA 2ROVA 4WSFA 4KAXB 1Y19B 1H4RA 2IYBA 2D9VA 2YF0A 2PZ1A 3D8FA 2RVBB 3HQCA 4HB0B 3DXDA 3T06A 1FHOA 1MPHA 2MFQA 5J3QA 2RNRB 2DX5A 2L2IA 5L81A 1QC6A 2YT0A 1XODA 4K81A 5DH9B 5DI9B 1DBHA 1SGHA 4ZRKA 1U29A 1FGZA 1U5EA 1U2BA 2N0YA 3VIAA 5C6RA 1DDWA 1UNRA 2GCLA 2D2QA 4CHMA 3SUZA 2COAA 2LYDA 2P0DA 1FAOA 1E5WA 3U8ZA 1EF1A 3HK0A 3N7CA 1OQNA 1DDVA 4BBKA 2I1JA 3O96A 2G35A 2MWNB 1FB8A 4HAVB 1X1FA 1Q67A 2D9YA 4IFSA 1I2HA 2W2XD 3DXCA 3PZDA 2W2WA 4K17A 2LKOA 1DDMA 4GPTB 3SYXA 2Z0QA 5DHFB 5FI0A 3KSYA 1Z87A 4KVGB 3A8QA 3TO1A 4Z2MB 1XCGA 1P5TA 3PEGA 5GOWB 3VOQA 2JP2A 4IOYX 3QBVB 1FHXA 2DHJA 4YL8A 3FSSA 5CLQB 4HB3B 4HAZB 3X23A 3A98B 2Y8GA 1DROA 1H10A 2ADZA 2CY5A 3ODOA 4MK0A 4CHJA 2QKLA 2J59M 1P3RA 5LOPB 1BAKA 3PP2A 1Y5OA 1FOEA 4WJ7A 1U27A 2XQNM 3AU4A 4KHOA 3TVVA 2GCJA 2R09A 1K5GB 5JLJB 3G9WA 1P6SA 2DYNA 1GC7A 4L6EA 1X11A 2CODA 3AJ4A 2H7DA 5C16A 3FM8C 2EMTA 3TFMA 2V76A 5JP4A 3KZ1A 4HDOA 4ZRJA 2DN6A 2LULA 1M7RA 1FHWA 4MT7A 5JHGA 2J0KA 1EAZA 3AU5A 1NI2A 1X86A 4K2OA 2J0MA 2OQBA 1U5GA 2AEHA 2UVMA 5EFXA 2VRWB 3BINA 4P7IA 4GN1A 2DA0A 3PVWA 1ZC3B 1KI1B 4IAPA 2COFA 2D11A 3SV1A 3GYOA 2D10A 4DX90 1SHCA 2CAYA 3PSCA 4HB2B 2J0JA 3HW2B 1V5PA 5DHAB 2CRFA 3UZTA 2DHIA 2ROZB 2YSZA 1N3HA 4HAUB 4HB4B 2P8VA 3QIJA 4HAYB 2X18A 2RLOA 4MY6A 1AQCA 1GG3A 5KQ1A 1WGUA 3ZDTA 3M1IB 3ODXA 1WJ1A 2Z0OA 1ZC4B 1B55A 1EVHA 5FI1A 3BJIA 1M7EA 3D8DA 2YS3A 2N23A 4GZUA 4A6KA 4GMVA 1QQGA 3MDBC 3WYFB 3KRXA 2MKRA 3PG7A 3SNHA 4NY0A 2NZ8B 5CLLB 1TQZA 4F7UP 1V89A 2LOXA 1XX0A 4Y94A 5C5BA 3P7ZA 3U7DA 2EJ8A 1K5DB 1AWEA 2K00A 3P6AA 2KCJA 1V88A 1NTYA 1W1GA 2EMSA 2D4QA 4HATB 3KY9A 1ZVRA 1WGQA 2ELBA 3ODWA 1FGYA 1PMSA 5HE1A 5D3WA 2M14A 4PQ0A 2I1KA 1MIZB 2YVCA 1UNQA 5KQ4A 2I5FA 1U5DA 3ZVRA 2RGNB 4EKUA 1LW3A 2YRYA 5KCVA 2LG1A 3D8EA 1ISNA 3TW1A 3DXEA 1LB1A 3QWMA 1NTVA 4KHAA 4XWXA 1V5UA 2OTXA 3IVFA 4DXAB 1RRPB 5C5BB 1XD4A 1MAIA 2EC1A 3F5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  2HE7 A;  3KRW A;  3ML4 A;  2UZS A;  1GC6 A;  1UNP A;  2D9X A;  4Z2N A;  4TKN A;  2DYQ A;  4A6H A;  1WVH A;  2Q13 A;  4PNK A;  1BWN A;  4TYZ A;  5J3T A;  4A6F A;  3TCA A;  1OY2 A;  1TJ6 A;  4K2P A;  2L1C A;  1MK9 B;  1XR0 B;  2K2J A;  2KUP A;  4HHV A;  2ELA A;  2Y8F A;  2GS0 A;  2LOZ A;  2DTC A;  4NSW A;  2D9W A;  4C0A A;  3CIK A;  1V5M A;  5J3Y A;  2E2X A;  2HTH B;  2YS1 A;  3PVU A;  1UPQ A;  4B6H A;  5HE0 A;  3V5W A;  2H7E A;  4EJN A;  1OMW A;  2GJY A;  4H8S A;  4D0N B;  3CXB B;  2RUK B;  1MIX A;  1XKE A;  1WJM A;  1W1H A;  3A8P A;  3MPX A;  2YT1 A;  4A5K A;  2MDX A;  3PVL A;  5D3X A;  2Z0P A;  1ZM0 A;  1UPR A;  1X1G A;  2VSZ A;  1BTN A;  2R0D A;  4A6F B;  4CYE A;  1BTK A;  4F7H A;  4F7G A;  1X05 A;  2BCJ A;  5HE3 A;  5HE2 A;  1W1D A;  1DYN A;  5D3Y A;  1MK7 B;  2D9Z A;  4KHB B;  3ULC A;  3GYP A;  2QKM A;  3ULB A;  2P0F A;  2ZPY A;  3NSU A;  3WA0 A;  5D27 A;  1NU2 A;  4GXB A;  2W2X C;  2I5C A;  1ZSQ A;  2UZR A;  2DHK A;  4DBB A;  1V61 A;  4ZRI A;  3OAN A;  2CY4 A;  2AL6 A;  1WG7 A;  1PFJ A;  1EGX A;  4HDQ A;  1IRS A;  5LON B;  2DKQ A;  4WVF B;  1J0W A;  4GMX B;  2YS5 A;  2IFS A;  1RJ2 A;  4HAX B;  1MKE A;  4DX8 A;  2RSG A;  2DX1 A;  2DLW A;  5DIF B;  3FEH A;  2P0H A;  3F0W A;  2NMB A;  5D3V A;  3SO6 A;  1TXD A;  2Y7B A;  3LJU X;  4EMO A;  1UEF A;  1J19 A;  4YON A;  1WI1 A;  1U5F A;  4HAW B;  1I7A A;  2DKP A;  2DFK A;  2VKI A;  2M38 A;  5C79 A;  1KZ7 A;  2FJL A;  5JHH A;  2KGX B;  1KZG A;  2K2U A;  1PLS A;  3RCP A;  2ROV A;  4WSF A;  4KAX B;  1Y19 B;  1H4R A;  2IYB A;  2D9V A;  2YF0 A;  2PZ1 A;  3D8F A;  2RVB B;  3HQC A;  4HB0 B;  3DXD A;  3T06 A;  1FHO A;  1MPH A;  2MFQ A;  5J3Q A;  2RNR B;  2DX5 A;  2L2I A;  5L81 A;  1QC6 A;  2YT0 A;  1XOD A;  4K81 A;  5DH9 B;  5DI9 B;  1DBH A;  1SGH A;  4ZRK A;  1U29 A;  1FGZ A;  1U5E A;  1U2B A;  2N0Y A;  3VIA A;  5C6R A;  1DDW A;  1UNR A;  2GCL A;  2D2Q A;  4CHM A;  3SUZ A;  2COA A;  2LYD A;  2P0D A;  1FAO A;  1E5W A;  3U8Z A;  1EF1 A;  3HK0 A;  3N7C A;  1OQN A;  1DDV A;  4BBK A;  2I1J A;  3O96 A;  2G35 A;  2MWN B;  1FB8 A;  4HAV B;  1X1F A;  1Q67 A;  2D9Y A;  4IFS A;  1I2H A;  2W2X D;  3DXC A;  3PZD A;  2W2W A;  4K17 A;  2LKO A;  1DDM A;  4GPT B;  3SYX A;  2Z0Q A;  5DHF B;  5FI0 A;  3KSY A;  1Z87 A;  4KVG B;  3A8Q A;  3TO1 A;  4Z2M B;  1XCG A;  1P5T A;  3PEG A;  5GOW B;  3VOQ A;  2JP2 A;  4IOY X;  3QBV B;  1FHX A;  2DHJ A;  4YL8 A;  3FSS A;  5CLQ B;  4HB3 B;  4HAZ B;  3X23 A;  3A98 B;  2Y8G A;  1DRO A;  1H10 A;  2ADZ A;  2CY5 A;  3ODO A;  4MK0 A;  4CHJ A;  2QKL A;  2J59 M;  1P3R A;  5LOP B;  1BAK A;  3PP2 A;  1Y5O A;  1FOE A;  4WJ7 A;  1U27 A;  2XQN M;  3AU4 A;  4KHO A;  3TVV A;  2GCJ A;  2R09 A;  1K5G B;  5JLJ B;  3G9W A;  1P6S A;  2DYN A;  1GC7 A;  4L6E A;  1X11 A;  2COD A;  3AJ4 A;  2H7D A;  5C16 A;  3FM8 C;  2EMT A;  3TFM A;  2V76 A;  5JP4 A;  3KZ1 A;  4HDO A;  4ZRJ A;  2DN6 A;  2LUL A;  1M7R A;  1FHW A;  4MT7 A;  5JHG A;  2J0K A;  1EAZ A;  3AU5 A;  1NI2 A;  1X86 A;  4K2O A;  2J0M A;  2OQB A;  1U5G A;  2AEH A;  2UVM A;  5EFX A;  2VRW B;  3BIN A;  4P7I A;  4GN1 A;  2DA0 A;  3PVW A;  1ZC3 B;  1KI1 B;  4IAP A;  2COF A;  2D11 A;  3SV1 A;  3GYO A;  2D10 A;  4DX9 0;  1SHC A;  2CAY A;  3PSC A;  4HB2 B;  2J0J A;  3HW2 B;  1V5P A;  5DHA B;  2CRF A;  3UZT A;  2DHI A;  2ROZ B;  2YSZ A;  1N3H A;  4HAU B;  4HB4 B;  2P8V A;  3QIJ A;  4HAY B;  2X18 A;  2RLO A;  4MY6 A;  1AQC A;  1GG3 A;  5KQ1 A;  1WGU A;  3ZDT A;  3M1I B;  3ODX A;  1WJ1 A;  2Z0O A;  1ZC4 B;  1B55 A;  1EVH A;  5FI1 A;  3BJI A;  1M7E A;  3D8D A;  2YS3 A;  2N23 A;  4GZU A;  4A6K A;  4GMV A;  1QQG A;  3MDB C;  3WYF B;  3KRX A;  2MKR A;  3PG7 A;  3SNH A;  4NY0 A;  2NZ8 B;  5CLL B;  1TQZ A;  4F7U P;  1V89 A;  2LOX A;  1XX0 A;  4Y94 A;  5C5B A;  3P7Z A;  3U7D A;  2EJ8 A;  1K5D B;  1AWE A;  2K00 A;  3P6A A;  2KCJ A;  1V88 A;  1NTY A;  1W1G A;  2EMS A;  2D4Q A;  4HAT B;  3KY9 A;  1ZVR A;  1WGQ A;  2ELB A;  3ODW A;  1FGY A;  1PMS A;  5HE1 A;  5D3W A;  2M14 A;  4PQ0 A;  2I1K A;  1MIZ B;  2YVC A;  1UNQ A;  5KQ4 A;  2I5F A;  1U5D A;  3ZVR A;  2RGN B;  4EKU A;  1LW3 A;  2YRY A;  5KCV A;  2LG1 A;  3D8E A;  1ISN A;  3TW1 A;  3DXE A;  1LB1 A;  3QWM A;  1NTV A;  4KHA A;  4XWX A;  1V5U A;  2OTX A;  3IVF A;  4DXA B;  1RRP B;  5C5B B;  1XD4 A;  1MAI A;  2EC1 A;  3F5R A; 
#chains in the Genus database with same CATH topology
 2COC A;  2HE7 A;  3KRW A;  3ML4 A;  2UZS A;  1GC6 A;  3DCX A;  1UNP A;  2K8E A;  2D9X A;  4Z2N A;  4TKN A;  2DYQ A;  4GOU A;  3NWD A;  4A6H A;  4DIX A;  1WVH A;  3NWF A;  2Q13 A;  4PNK A;  1BWN A;  1ZYI A;  4TYZ A;  5J3T A;  4A6F A;  3TCA A;  1OY2 A;  1TJ6 A;  4K2P A;  2L1C A;  1MK9 B;  1XR0 B;  2K2J A;  2KUP A;  4HHV A;  2ELA A;  2Y8F A;  2GS0 A;  2LOZ A;  2DTC A;  4NSW A;  2D9W A;  4C0A A;  3CIK A;  1V5M A;  5J3Y A;  4KHB A;  2E2X A;  2HTH B;  2YS1 A;  3PVU A;  1UPQ A;  4B6H A;  5HE0 A;  3V5W A;  2H7E A;  4EJN A;  1OMW A;  2GJY A;  4H8S A;  4D0N B;  3CXB B;  2RUK B;  1MIX A;  1XKE A;  1WJM A;  1W1H A;  3A8P A;  3MPX A;  2YT1 A;  4A5K A;  2MDX A;  3PVL A;  5D3X A;  2Z0P A;  1ZM0 A;  1UPR A;  1X1G A;  2KUQ A;  2VSZ A;  1BTN A;  2R0D A;  4A6F B;  4CYE A;  1BTK A;  4F7H A;  4F7G A;  1X05 A;  2BCJ A;  5HE3 A;  2NBV A;  5HE2 A;  1W1D A;  1DYN A;  5D3Y A;  1MK7 B;  2RRF A;  2D9Z A;  4KHB B;  3ULC A;  3GYP A;  2QKM A;  3ULB A;  2P0F A;  2ZPY A;  3NSU A;  3WA0 A;  5D27 A;  1NU2 A;  4QJ3 B;  4GXB A;  2W2X C;  2I5C A;  1ZSQ A;  2UZR A;  2DHK A;  4DBB A;  1V61 A;  3A58 A;  3OAN A;  4ZRI A;  2CY4 A;  2AL6 A;  4GNK B;  1WG7 A;  1PFJ A;  4CSQ A;  4HDQ A;  1IRS A;  1EGX A;  5LON B;  2DKQ A;  4QXA B;  4WVF B;  1J0W A;  4GMX B;  2YS5 A;  2IFS A;  1RJ2 A;  4HAX B;  1MKE A;  4DX8 A;  2RSG A;  2DX1 A;  2DLW A;  5DIF B;  3FEH A;  2P0H A;  3F0W A;  2NMB A;  5D3V A;  3SO6 A;  1TXD A;  2Y7B A;  3LJU X;  4EMO A;  1UEF A;  1J19 A;  4YON A;  1WI1 A;  1U5F A;  4HAW B;  1I7A A;  4HSI A;  2DKP A;  2DFK A;  2VKI A;  2M38 A;  5C79 A;  1KZ7 A;  2FJL A;  5JHH A;  2KGX B;  1KZG A;  2K2U A;  1PLS A;  3RCP A;  2ROV A;  4WSF A;  4KAX B;  1Y19 B;  1H4R A;  2IYB A;  2D9V A;  2YF0 A;  2KIG A;  2PZ1 A;  3D8F A;  2RVB B;  3HQC A;  4HB0 B;  3DXD A;  3T06 A;  1FHO A;  1MPH A;  2MFQ A;  5J3Q A;  2RNR B;  2DX5 A;  2L2I A;  5L81 A;  1QC6 A;  2YT0 A;  1XOD A;  4K81 A;  2YT2 A;  5DH9 B;  5DI9 B;  1DBH A;  1SGH A;  4ZRK A;  2Z59 A;  1U29 A;  1FGZ A;  1U5E A;  4QJ4 B;  1U2B A;  2N0Y A;  3VIA A;  5C6R A;  1DDW A;  1UNR A;  2GCL A;  2D2Q A;  4CHM A;  3SUZ A;  2COA A;  2LYD A;  2P0D A;  1FAO A;  1E5W A;  3U8Z A;  1EF1 A;  3HK0 A;  3N7C A;  1OQN A;  1DDV A;  4BBK A;  2I1J A;  3O96 A;  2G35 A;  2MWN B;  1FB8 A;  4HAV B;  1X1F A;  1Q67 A;  2D9Y A;  4IFS A;  1I2H A;  2W2X D;  3DXC A;  3PZD A;  2W2W A;  3HIE A;  4K17 A;  2Z13 A;  2LKO A;  1DDM A;  4GPT B;  3FVC A;  3SYX A;  2Z0Q A;  5DHF B;  5FI0 A;  3KSY A;  1Z87 A;  4KVG B;  3A8Q A;  3TO1 A;  4Z2M B;  1XCG A;  5I2M A;  1P5T A;  3PEG A;  5GOW B;  3VOQ A;  2JP2 A;  4IOY X;  2Z4D A;  3QBV B;  1FHX A;  2DHJ A;  4YL8 A;  3FSS A;  5CLQ B;  4HB3 B;  1T77 A;  4HAZ B;  3X23 A;  3A98 B;  2KR0 A;  2Y8G A;  1DRO A;  3OHM B;  1H10 A;  2ADZ A;  2CY5 A;  3ODO A;  4MK0 A;  4CHJ A;  2QKL A;  2J59 M;  1P3R A;  5LOP B;  1BAK A;  3PP2 A;  1Y5O A;  1FOE A;  2GUM A;  4WJ7 A;  1U27 A;  2XQN M;  3AU4 A;  4KHO A;  3TVV A;  5LG4 B;  2GCJ A;  4OT1 A;  2R09 A;  4D6W A;  1K5G B;  5JLJ B;  3G9W A;  1P6S A;  2DYN A;  1GC7 A;  4L6E A;  1X11 A;  2COD A;  3AJ4 A;  2H7D A;  5C16 A;  3FM8 C;  2EMT A;  3TFM A;  2V76 A;  5JP4 A;  3KZ1 A;  4HDO A;  4ZRJ A;  2DN6 A;  2R2Y A;  2LUL A;  1M7R A;  1FHW A;  4MT7 A;  5JHG A;  2J0K A;  5IRS A;  1EAZ A;  3AU5 A;  2K49 A;  1NI2 A;  1X86 A;  4K2O A;  2J0M A;  2OQB A;  1U5G A;  2AEH A;  2UVM A;  5EFX A;  2VRW B;  3BIN A;  4P7I A;  4GN1 A;  4OSN A;  2DA0 A;  3PVW A;  1ZC3 B;  1KI1 B;  4IAP A;  2COF A;  2D11 A;  3SV1 A;  3GYO A;  2D10 A;  1MI1 A;  4DX9 0;  1SHC A;  2CAY A;  3PSC A;  4HB2 B;  2J0J A;  3HW2 B;  1V5P A;  5DHA B;  2CRF A;  3UZT A;  2DHI A;  2ROZ B;  2YSZ A;  1N3H A;  4HAU B;  4HB4 B;  2P8V A;  3QIJ A;  4HAY B;  2X18 A;  2RLO A;  4MY6 A;  1AQC A;  1GG3 A;  4QJ5 B;  5KQ1 A;  1WGU A;  3ZDT A;  2KIE A;  3M1I B;  3ODX A;  1WJ1 A;  2Z0O A;  1ZC4 B;  2Z14 A;  5I2S A;  1B55 A;  1EVH A;  5FI1 A;  3BJI A;  4L1R A;  1M7E A;  3D8D A;  2YS3 A;  2N23 A;  4GZU A;  4A6K A;  4GMV A;  1QQG A;  3MDB C;  3WYF B;  3NW8 A;  3KRX A;  2MKR A;  3PG7 A;  3SNH A;  3HSA A;  4NY0 A;  2NZ8 B;  2FJU B;  5M4Y B;  5CLL B;  1TQZ A;  4F7U P;  1V89 A;  2LOX A;  1XX0 A;  4Y94 A;  5C5B A;  3P7Z A;  3U7D A;  2EJ8 A;  1K5D B;  1AWE A;  2K00 A;  2KCJ A;  3P6A A;  1V88 A;  1NTY A;  3U12 A;  1W1G A;  2EMS A;  2D4Q A;  3NWA A;  4HAT B;  3KY9 A;  1ZVR A;  1WGQ A;  2ELB A;  3ODW A;  1FGY A;  1PMS A;  5HE1 A;  5D3W A;  2M14 A;  4PQ0 A;  2I1K A;  1MIZ B;  2YVC A;  1UNQ A;  5KQ4 A;  2I5F A;  1U5D A;  3ZVR A;  2RGN B;  3B77 A;  4EKU A;  1LW3 A;  2YRY A;  5KCV A;  2LG1 A;  3D8E A;  1ISN A;  3TW1 A;  3DXE A;  1LB1 A;  3QWM A;  1NTV A;  4KHA A;  4XWX A;  1V5U A;  2OTX A;  3IVF A;  4DXA B;  1RRP B;  2ZKM X;  5C5B B;  1XD4 A;  1MAI A;  2EC1 A;  3F5R A; 
#chains in the Genus database with same CATH homology
 2COC A;  2HE7 A;  3KRW A;  3ML4 A;  2UZS A;  1GC6 A;  1UNP A;  2D9X A;  4Z2N A;  4TKN A;  2DYQ A;  4A6H A;  1WVH A;  2Q13 A;  4PNK A;  1BWN A;  4TYZ A;  5J3T A;  4A6F A;  3TCA A;  1OY2 A;  1TJ6 A;  4K2P A;  2L1C A;  1MK9 B;  1XR0 B;  2K2J A;  2KUP A;  4HHV A;  2ELA A;  2Y8F A;  2GS0 A;  2LOZ A;  2DTC A;  4NSW A;  2D9W A;  4C0A A;  3CIK A;  1V5M A;  5J3Y A;  2E2X A;  2HTH B;  2YS1 A;  3PVU A;  1UPQ A;  4B6H A;  5HE0 A;  3V5W A;  2H7E A;  4EJN A;  1OMW A;  2GJY A;  4H8S A;  4D0N B;  3CXB B;  2RUK B;  1MIX A;  1XKE A;  1WJM A;  1W1H A;  3A8P A;  3MPX A;  2YT1 A;  4A5K A;  2MDX A;  3PVL A;  5D3X A;  2Z0P A;  1ZM0 A;  1UPR A;  1X1G A;  2VSZ A;  1BTN A;  2R0D A;  4A6F B;  4CYE A;  1BTK A;  4F7H A;  4F7G A;  1X05 A;  2BCJ A;  5HE3 A;  5HE2 A;  1W1D A;  1DYN A;  5D3Y A;  1MK7 B;  2D9Z A;  4KHB B;  3ULC A;  3GYP A;  2QKM A;  3ULB A;  2P0F A;  2ZPY A;  3NSU A;  3WA0 A;  5D27 A;  1NU2 A;  4GXB A;  2W2X C;  2I5C A;  1ZSQ A;  2UZR A;  2DHK A;  4DBB A;  1V61 A;  4ZRI A;  3OAN A;  2CY4 A;  2AL6 A;  1WG7 A;  1PFJ A;  1EGX A;  4HDQ A;  1IRS A;  5LON B;  2DKQ A;  4WVF B;  1J0W A;  4GMX B;  2YS5 A;  2IFS A;  1RJ2 A;  4HAX B;  1MKE A;  4DX8 A;  2RSG A;  2DX1 A;  2DLW A;  5DIF B;  3FEH A;  2P0H A;  3F0W A;  2NMB A;  5D3V A;  3SO6 A;  1TXD A;  2Y7B A;  3LJU X;  4EMO A;  1UEF A;  1J19 A;  4YON A;  1WI1 A;  1U5F A;  4HAW B;  1I7A A;  2DKP A;  2DFK A;  2VKI A;  2M38 A;  5C79 A;  1KZ7 A;  2FJL A;  5JHH A;  2KGX B;  1KZG A;  2K2U A;  1PLS A;  3RCP A;  2ROV A;  4WSF A;  4KAX B;  1Y19 B;  1H4R A;  2IYB A;  2D9V A;  2YF0 A;  2PZ1 A;  3D8F A;  2RVB B;  3HQC A;  4HB0 B;  3DXD A;  3T06 A;  1FHO A;  1MPH A;  2MFQ A;  5J3Q A;  2RNR B;  2DX5 A;  2L2I A;  5L81 A;  1QC6 A;  2YT0 A;  1XOD A;  4K81 A;  5DH9 B;  5DI9 B;  1DBH A;  1SGH A;  4ZRK A;  1U29 A;  1FGZ A;  1U5E A;  1U2B A;  2N0Y A;  3VIA A;  5C6R A;  1DDW A;  1UNR A;  2GCL A;  2D2Q A;  4CHM A;  3SUZ A;  2COA A;  2LYD A;  2P0D A;  1FAO A;  1E5W A;  3U8Z A;  1EF1 A;  3HK0 A;  3N7C A;  1OQN A;  1DDV A;  4BBK A;  2I1J A;  3O96 A;  2G35 A;  2MWN B;  1FB8 A;  4HAV B;  1X1F A;  1Q67 A;  2D9Y A;  4IFS A;  1I2H A;  2W2X D;  3DXC A;  3PZD A;  2W2W A;  4K17 A;  2LKO A;  1DDM A;  4GPT B;  3SYX A;  2Z0Q A;  5DHF B;  5FI0 A;  3KSY A;  1Z87 A;  4KVG B;  3A8Q A;  3TO1 A;  4Z2M B;  1XCG A;  1P5T A;  3PEG A;  5GOW B;  3VOQ A;  2JP2 A;  4IOY X;  3QBV B;  1FHX A;  2DHJ A;  4YL8 A;  3FSS A;  5CLQ B;  4HB3 B;  4HAZ B;  3X23 A;  3A98 B;  2Y8G A;  1DRO A;  1H10 A;  2ADZ A;  2CY5 A;  3ODO A;  4MK0 A;  4CHJ A;  2QKL A;  2J59 M;  1P3R A;  5LOP B;  1BAK A;  3PP2 A;  1Y5O A;  1FOE A;  4WJ7 A;  1U27 A;  2XQN M;  3AU4 A;  4KHO A;  3TVV A;  2GCJ A;  2R09 A;  1K5G B;  5JLJ B;  3G9W A;  1P6S A;  2DYN A;  1GC7 A;  4L6E A;  1X11 A;  2COD A;  3AJ4 A;  2H7D A;  5C16 A;  3FM8 C;  2EMT A;  3TFM A;  2V76 A;  5JP4 A;  3KZ1 A;  4HDO A;  4ZRJ A;  2DN6 A;  2LUL A;  1M7R A;  1FHW A;  4MT7 A;  5JHG A;  2J0K A;  1EAZ A;  3AU5 A;  1NI2 A;  1X86 A;  4K2O A;  2J0M A;  2OQB A;  1U5G A;  2AEH A;  2UVM A;  5EFX A;  2VRW B;  3BIN A;  4P7I A;  4GN1 A;  2DA0 A;  3PVW A;  1ZC3 B;  1KI1 B;  4IAP A;  2COF A;  2D11 A;  3SV1 A;  3GYO A;  2D10 A;  4DX9 0;  1SHC A;  2CAY A;  3PSC A;  4HB2 B;  2J0J A;  3HW2 B;  1V5P A;  5DHA B;  2CRF A;  3UZT A;  2DHI A;  2ROZ B;  2YSZ A;  1N3H A;  4HAU B;  4HB4 B;  2P8V A;  3QIJ A;  4HAY B;  2X18 A;  2RLO A;  4MY6 A;  1AQC A;  1GG3 A;  5KQ1 A;  1WGU A;  3ZDT A;  3M1I B;  3ODX A;  1WJ1 A;  2Z0O A;  1ZC4 B;  1B55 A;  1EVH A;  5FI1 A;  3BJI A;  1M7E A;  3D8D A;  2YS3 A;  2N23 A;  4GZU A;  4A6K A;  4GMV A;  1QQG A;  3MDB C;  3WYF B;  3KRX A;  2MKR A;  3PG7 A;  3SNH A;  4NY0 A;  2NZ8 B;  5CLL B;  1TQZ A;  4F7U P;  1V89 A;  2LOX A;  1XX0 A;  4Y94 A;  5C5B A;  3P7Z A;  3U7D A;  2EJ8 A;  1K5D B;  1AWE A;  2K00 A;  3P6A A;  2KCJ A;  1V88 A;  1NTY A;  1W1G A;  2EMS A;  2D4Q A;  4HAT B;  3KY9 A;  1ZVR A;  1WGQ A;  2ELB A;  3ODW A;  1FGY A;  1PMS A;  5HE1 A;  5D3W A;  2M14 A;  4PQ0 A;  2I1K A;  1MIZ B;  2YVC A;  1UNQ A;  5KQ4 A;  2I5F A;  1U5D A;  3ZVR A;  2RGN B;  4EKU A;  1LW3 A;  2YRY A;  5KCV A;  2LG1 A;  3D8E A;  1ISN A;  3TW1 A;  3DXE A;  1LB1 A;  3QWM A;  1NTV A;  4KHA A;  4XWX A;  1V5U A;  2OTX A;  3IVF A;  4DXA B;  1RRP B;  5C5B B;  1XD4 A;  1MAI A;  2EC1 A;  3F5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...