2CY5A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-2 crystal)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
MADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 29
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy5A00
4HAZB 3GYOA 4P7IA 1OQNA 4L6EA 1P5TA 2ROZB 5DIFB 1DROA 1OY2A 1J0WA 4BBKA 2CY5A 4KVGB 1UNQA 3HW2B 2IFSA 4KHAA 3FSSA 3MDBC 1H4RA 3F5RA 4HB4B 1V5PA 2EC1A 1KZ7A 4HB0B 2I1JA 3TCAA 5LOPB 1PMSA 1V5UA 3DXDA 4F7UP 4ZRKA 4DXAB 3D8DA 2PZ1A 3P7ZA 2NZ8B 1IRSA 1MIZB 4KHOA 4K81A 2Y8GA 2L2IA 4CHMA 2M14A 1XKEA 3OANA 5D3YA 4K17A 1SGHA 4DX90 5CLQB 4C0AA 1AWEA 4K2OA 2VKIA 1Y19B 2YF0A 1W1DA 3CXBB 1XD4A 2W2WA 1U5EA 2XQNM 3QBVB 2D9XA 2DA0A 2D11A 5KQ4A 4EKUA 3KSYA 2VRWB 1EF1A 1NTYA 1DDWA 2DYNA 4XWXA 4ZRJA 2D10A 2QKMA 2N23A 2J0KA 2K00A 2D9YA 4A6KA 5FI1A 3PZDA 1UPQA 1TQZA 1OMWA 1XR0B 2P8VA 5JP4A 1DDMA 2LYDA 1QQGA 2Z0QA 3D8EA 5C16A 2DN6A 2KCJA 2J0MA 2LOZA 4F7HA 4HHVA 3DXCA 2CODA 2MFQA 2Y7BA 3SYXA 3V5WA 1BWNA 3ZDTA 1ZC3B 1U5DA 1U5FA 2KUPA 2UVMA 3M1IB 1M7RA 2N0YA 1NI2A 4TYZA 1MK7B 1FOEA 4KHBB 1X11A 1ISNA 4PQ0A 4HATB 3RCPA 1XCGA 1RRPB 1WG7A 2DKQA 4YONA 3PVLA 1GG3A 5J3YA 2RSGA 2BCJA 4DBBA 3ZVRA 2YS1A 4HAWB 4GPTB 2YT0A 2L1CA 5FI0A 1FGYA 2QKLA 2V76A 2Q13A 1U27A 1FHWA 5DH9B 1ZM0A 1V88A 3SV1A 2RGNB 1MKEA 3PSCA 5JLJB 3VIAA 4D0NB 4B6HA 2R0DA 5HE3A 3DXEA 3D8FA 3PVWA 3VOQA 2RLOA 1EVHA 2CY4A 3AJ4A 3X23A 5C5BB 1MAIA 2DLWA 1MPHA 2RUKB 2UZSA 2RVBB 3WA0A 1UEFA 5J3TA 4K2PA 1U29A 4IFSA 1Q67A 1GC7A 2AL6A 5GOWB 2DHKA 2CAYA 2DYQA 1EAZA 2J59M 4YL8A 2ZPYA 2YS3A 3QIJA 1QC6A 1W1GA 4CHJA 5C6RA 5DHFB 2W2XD 1WJMA 3ODWA 4A6FB 1LB1A 3G9WA 2MWNB 1NU2A 2Y8FA 3A8QA 1FAOA 1K5DB 1P3RA 3SNHA 3UZTA 1UNRA 1KZGA 1FHOA 5D3VA 4IOYX 2K2JA 3SUZA 5DI9B 3A8PA 2I5FA 2E2XA 2HE7A 1SHCA 4MT7A 2COFA 2D9WA 2KGXB 1U2BA 2D2QA 3GYPA 1GC6A 2DX1A 2EJ8A 1FB8A 2LG1A 3KRXA 3FEHA 4NY0A 4Y94A 2D4QA 2COCA 1ZSQA 2GS0A 4GMVA 4HAUB 3SO6A 2G35A 2NMBA 5EFXA 2R09A 1Y5OA 2ELAA 3HK0A 2DHJA 3U8ZA 1UPRA 3ULCA 1MK9B 2GCJA 3ML4A 1WVHA 3CIKA 2LOXA 3PVUA 1U5GA 4A6HA 2Z0PA 2GJYA 2OTXA 5KQ1A 1X1FA 1LW3A 2M38A 4EJNA 3NSUA 2I5CA 3U7DA 3KZ1A 1RJ2A 1TJ6A 3WYFB 2D9VA 5KCVA 5CLLB 2CRFA 2P0HA 2VSZA 2K2UA 2FJLA 1MIXA 1UNPA 3TFMA 5LONB 3BJIA 2YVCA 3AU5A 1WGUA 4WJ7A 1K5GB 3TW1A 1BTKA 3TVVA 5JHHA 4CYEA 2DTCA 1V61A 3PP2A 2D9ZA 2HTHB 5HE2A 1FHXA 2YSZA 2AEHA 1WI1A 1WGQA 4Z2MB 3MPXA 4WSFA 1I2HA 4ZRIA 3TO1A 4PNKA 3FM8C 2P0DA 4KAXB 2IYBA 1P6SA 2YRYA 4GN1A 1M7EA 4H8SA 2I1KA 3T06A 1J19A 1TXDA 2DHIA 5L81A 1XODA 1NTVA 2EMSA 4HAXB 2COAA 2Z0OA 3A98B 2RNRB 1E5WA 2ELBA 5C5BA 2YT1A 5J3QA 1X1GA 1AQCA 4Z2NA 1FGZA 2YS5A 5D27A 2MKRA 5JHGA 1EGXA 1Z87A 3N7CA 3ODOA 3ODXA 1N3HA 2P0FA 3LJUX 1W1HA 4MK0A 1DDVA 2X18A 3AU4A 1WJ1A 1V89A 4HAVB 4NSWA 4IAPA 2JP2A 4HB3B 1V5MA 2ROVA 3KRWA 3HQCA 2UZRA 3PG7A 4GXBA 4HAYB 1X86A 2DKPA 1I7AA 4A6FA 5C79A 1B55A 1ZC4B 4HB2B 1X05A 2ADZA 2OQBA 4HDQA 3F0WA 4WVFB 3ULBA 5HE0A 2EMTA 2LKOA 1XX0A 4TKNA 1PLSA 4A5KA 4F7GA 2J0JA 2H7DA 4EMOA 5HE1A 2DX5A 2LULA 1ZVRA 3O96A 2W2XC 1H10A 4HDOA 2H7EA 5DHAB 3BINA 2MDXA 3IVFA 5D3XA 3PEGA 4MY6A 1BTNA 4GMXB 5D3WA 1DBHA 2DFKA 1PFJA 3KY9A 1BAKA 3P6AA 3QWMA 1KI1B 4GZUA 1DYNA 2GCLA 4DX8A
chains in the Genus database with same CATH superfamily
4HAZB 3GYOA 4P7IA 1OQNA 4L6EA 1P5TA 2ROZB 5DIFB 1DROA 1OY2A 1J0WA 4BBKA 2CY5A 4KVGB 1UNQA 5M4YB 3HW2B 2IFSA 4KHAA 3FSSA 3MDBC 1H4RA 3F5RA 4HB4B 1V5PA 2EC1A 1KZ7A 4HB0B 2I1JA 3TCAA 5LOPB 3NWDA 4GOUA 1PMSA 1V5UA 3DXDA 4F7UP 4ZRKA 2RRFA 4DXAB 3D8DA 4GNKB 2PZ1A 3P7ZA 2NZ8B 1IRSA 1MIZB 4KHOA 4K81A 2Y8GA 2L2IA 4CHMA 2M14A 1XKEA 3OANA 5D3YA 4K17A 1SGHA 4DX90 5CLQB 4C0AA 1AWEA 4K2OA 2VKIA 1Y19B 2YF0A 1W1DA 3CXBB 1XD4A 2W2WA 1U5EA 2XQNM 3QBVB 3A58A 2D9XA 2DA0A 2D11A 5KQ4A 4EKUA 3KSYA 2R2YA 2VRWB 1EF1A 1NTYA 1DDWA 2DYNA 4XWXA 4ZRJA 2D10A 1T77A 2QKMA 2N23A 2YT2A 2J0KA 2K00A 2D9YA 4A6KA 5FI1A 3PZDA 1UPQA 1TQZA 1OMWA 1XR0B 2P8VA 5JP4A 1DDMA 2LYDA 1QQGA 2Z0QA 2Z4DA 3D8EA 5C16A 2DN6A 2KCJA 2J0MA 2LOZA 4F7HA 4HHVA 3DXCA 2CODA 2MFQA 2Y7BA 3SYXA 3V5WA 1BWNA 3ZDTA 1ZC3B 1U5DA 1U5FA 2KUPA 2UVMA 3M1IB 1M7RA 2N0YA 1NI2A 2KIGA 4TYZA 1MK7B 1FOEA 4KHBB 1X11A 1ISNA 4PQ0A 4HATB 3RCPA 1XCGA 1RRPB 3NWAA 1WG7A 2DKQA 4YONA 3PVLA 1GG3A 5J3YA 3HSAA 2RSGA 2FJUB 2BCJA 4DBBA 3ZVRA 2YS1A 4HAWB 4GPTB 4OSNA 2YT0A 2L1CA 5FI0A 1FGYA 2QKLA 2V76A 2Q13A 1U27A 1FHWA 5DH9B 1ZM0A 1V88A 3SV1A 2RGNB 1MKEA 3PSCA 5JLJB 3VIAA 2Z13A 4D0NB 4B6HA 2KUQA 3NWFA 2R0DA 5HE3A 3DXEA 3D8FA 3PVWA 3VOQA 2RLOA 1EVHA 2CY4A 3AJ4A 3X23A 4L1RA 5C5BB 1MAIA 2DLWA 5I2SA 1MPHA 2RUKB 2UZSA 4CSQA 2RVBB 3WA0A 1UEFA 5J3TA 4K2PA 4OT1A 1U29A 4IFSA 4DIXA 2K49A 1Q67A 1GC7A 2AL6A 5GOWB 2DHKA 2CAYA 2DYQA 4QJ3B 1EAZA 2J59M 4YL8A 2ZPYA 2YS3A 3QIJA 1QC6A 1W1GA 4CHJA 5C6RA 5DHFB 2W2XD 1WJMA 3ODWA 4A6FB 1LB1A 3G9WA 2MWNB 1NU2A 2Y8FA 3A8QA 1FAOA 2KIEA 1K5DB 1P3RA 3SNHA 3UZTA 1UNRA 2NBVA 4HSIA 1KZGA 1FHOA 5D3VA 4IOYX 2K2JA 3SUZA 5DI9B 2Z14A 3A8PA 2I5FA 2E2XA 2HE7A 1SHCA 4MT7A 2COFA 2D9WA 3HIEA 2KGXB 1U2BA 2D2QA 3GYPA 1GC6A 2K8EA 2DX1A 2EJ8A 1FB8A 4QXAB 2LG1A 3KRXA 3FEHA 4NY0A 4Y94A 2D4QA 2COCA 1ZSQA 2GS0A 4GMVA 4HAUB 3SO6A 2G35A 2NMBA 5EFXA 2R09A 1Y5OA 2ELAA 3HK0A 2DHJA 3U8ZA 1UPRA 3U12A 3ULCA 1MK9B 2GCJA 3ML4A 1WVHA 3CIKA 2LOXA 3PVUA 1U5GA 4A6HA 2GUMA 2Z0PA 2GJYA 2OTXA 5KQ1A 1X1FA 1LW3A 2M38A 4EJNA 3NSUA 2I5CA 4KHBA 3U7DA 3KZ1A 1RJ2A 1TJ6A 3B77A 3WYFB 2D9VA 5KCVA 5CLLB 2CRFA 2P0HA 2VSZA 2K2UA 2FJLA 1MIXA 2Z59A 1UNPA 3TFMA 5LONB 3BJIA 2YVCA 3AU5A 1WGUA 4QJ4B 5LG4B 4WJ7A 1K5GB 3TW1A 1BTKA 3TVVA 5JHHA 4CYEA 2DTCA 1V61A 1ZYIA 2D9ZA 2HTHB 3PP2A 1FHXA 5HE2A 2YSZA 4D6WA 2AEHA 1WI1A 1WGQA 4Z2MB 3MPXA 4WSFA 1I2HA 4ZRIA 3TO1A 4PNKA 3FM8C 2P0DA 4KAXB 2IYBA 1P6SA 2YRYA 4GN1A 1M7EA 4H8SA 2I1KA 3T06A 1J19A 1TXDA 2DHIA 5L81A 1XODA 1NTVA 2EMSA 4HAXB 2COAA 2Z0OA 3A98B 2RNRB 1E5WA 2ELBA 5C5BA 2YT1A 5J3QA 1X1GA 1AQCA 4Z2NA 1FGZA 2YS5A 5D27A 2MKRA 5JHGA 1EGXA 1Z87A 3N7CA 3ODOA 3ODXA 1N3HA 2P0FA 3LJUX 1W1HA 4MK0A 1DDVA 2X18A 3AU4A 1WJ1A 1V89A 4HAVB 4NSWA 5I2MA 4IAPA 3DCXA 2JP2A 4HB3B 1V5MA 2ROVA 3KRWA 3HQCA 2UZRA 3PG7A 4GXBA 4HAYB 1X86A 2DKPA 1I7AA 4A6FA 5C79A 1B55A 1ZC4B 4HB2B 4QJ5B 1X05A 2ADZA 2OQBA 4HDQA 3F0WA 1MI1A 4WVFB 3ULBA 5HE0A 2EMTA 2LKOA 1XX0A 4TKNA 1PLSA 4A5KA 4F7GA 2J0JA 2H7DA 4EMOA 5HE1A 2DX5A 3FVCA 2LULA 1ZVRA 3O96A 2W2XC 1H10A 4HDOA 2H7EA 5DHAB 3BINA 2MDXA 3IVFA 5IRSA 3OHMB 5D3XA 3PEGA 4MY6A 1BTNA 4GMXB 5D3WA 2ZKMX 1DBHA 2DFKA 1PFJA 3KY9A 1BAKA 3P6AA 3QWMA 1KI1B 4GZUA 1DYNA 2KR0A 3NW8A 2GCLA 4DX8A
chains in the Genus database with same CATH topology
4HAZB 3GYOA 4P7IA 1OQNA 4L6EA 1P5TA 2ROZB 5DIFB 1DROA 1OY2A 1J0WA 4BBKA 2CY5A 4KVGB 1UNQA 3HW2B 2IFSA 4KHAA 3FSSA 3MDBC 1H4RA 3F5RA 4HB4B 1V5PA 2EC1A 1KZ7A 4HB0B 2I1JA 3TCAA 5LOPB 1PMSA 1V5UA 3DXDA 4F7UP 4ZRKA 4DXAB 3D8DA 2PZ1A 3P7ZA 2NZ8B 1IRSA 1MIZB 4KHOA 4K81A 2Y8GA 2L2IA 4CHMA 2M14A 1XKEA 3OANA 5D3YA 4K17A 1SGHA 4DX90 5CLQB 4C0AA 1AWEA 4K2OA 2VKIA 1Y19B 2YF0A 1W1DA 3CXBB 1XD4A 2W2WA 1U5EA 2XQNM 3QBVB 2D9XA 2DA0A 2D11A 5KQ4A 4EKUA 3KSYA 2VRWB 1EF1A 1NTYA 1DDWA 2DYNA 4XWXA 4ZRJA 2D10A 2QKMA 2N23A 2J0KA 2K00A 2D9YA 4A6KA 5FI1A 3PZDA 1UPQA 1TQZA 1OMWA 1XR0B 2P8VA 5JP4A 1DDMA 2LYDA 1QQGA 2Z0QA 3D8EA 5C16A 2DN6A 2KCJA 2J0MA 2LOZA 4F7HA 4HHVA 3DXCA 2CODA 2MFQA 2Y7BA 3SYXA 3V5WA 1BWNA 3ZDTA 1ZC3B 1U5DA 1U5FA 2KUPA 2UVMA 3M1IB 1M7RA 2N0YA 1NI2A 4TYZA 1MK7B 1FOEA 4KHBB 1X11A 1ISNA 4PQ0A 4HATB 3RCPA 1XCGA 1RRPB 1WG7A 2DKQA 4YONA 3PVLA 1GG3A 5J3YA 2RSGA 2BCJA 4DBBA 3ZVRA 2YS1A 4HAWB 4GPTB 2YT0A 2L1CA 5FI0A 1FGYA 2QKLA 2V76A 2Q13A 1U27A 1FHWA 5DH9B 1ZM0A 1V88A 3SV1A 2RGNB 1MKEA 3PSCA 5JLJB 3VIAA 4D0NB 4B6HA 2R0DA 5HE3A 3DXEA 3D8FA 3PVWA 3VOQA 2RLOA 1EVHA 2CY4A 3AJ4A 3X23A 5C5BB 1MAIA 2DLWA 1MPHA 2RUKB 2UZSA 2RVBB 3WA0A 1UEFA 5J3TA 4K2PA 1U29A 4IFSA 1Q67A 1GC7A 2AL6A 5GOWB 2DHKA 2CAYA 2DYQA 1EAZA 2J59M 4YL8A 2ZPYA 2YS3A 3QIJA 1QC6A 1W1GA 4CHJA 5C6RA 5DHFB 2W2XD 1WJMA 3ODWA 4A6FB 1LB1A 3G9WA 2MWNB 1NU2A 2Y8FA 3A8QA 1FAOA 1K5DB 1P3RA 3SNHA 3UZTA 1UNRA 1KZGA 1FHOA 5D3VA 4IOYX 2K2JA 3SUZA 5DI9B 3A8PA 2I5FA 2E2XA 2HE7A 1SHCA 4MT7A 2COFA 2D9WA 2KGXB 1U2BA 2D2QA 3GYPA 1GC6A 2DX1A 2EJ8A 1FB8A 2LG1A 3KRXA 3FEHA 4NY0A 4Y94A 2D4QA 2COCA 1ZSQA 2GS0A 4GMVA 4HAUB 3SO6A 2G35A 2NMBA 5EFXA 2R09A 1Y5OA 2ELAA 3HK0A 2DHJA 3U8ZA 1UPRA 3ULCA 1MK9B 2GCJA 3ML4A 1WVHA 3CIKA 2LOXA 3PVUA 1U5GA 4A6HA 2Z0PA 2GJYA 2OTXA 5KQ1A 1X1FA 1LW3A 2M38A 4EJNA 3NSUA 2I5CA 3U7DA 3KZ1A 1RJ2A 1TJ6A 3WYFB 2D9VA 5KCVA 5CLLB 2CRFA 2P0HA 2VSZA 2K2UA 2FJLA 1MIXA 1UNPA 3TFMA 5LONB 3BJIA 2YVCA 3AU5A 1WGUA 4WJ7A 1K5GB 3TW1A 1BTKA 3TVVA 5JHHA 4CYEA 2DTCA 1V61A 3PP2A 2D9ZA 2HTHB 5HE2A 1FHXA 2YSZA 2AEHA 1WI1A 1WGQA 4Z2MB 3MPXA 4WSFA 1I2HA 4ZRIA 3TO1A 4PNKA 3FM8C 2P0DA 4KAXB 2IYBA 1P6SA 2YRYA 4GN1A 1M7EA 4H8SA 2I1KA 3T06A 1J19A 1TXDA 2DHIA 5L81A 1XODA 1NTVA 2EMSA 4HAXB 2COAA 2Z0OA 3A98B 2RNRB 1E5WA 2ELBA 5C5BA 2YT1A 5J3QA 1X1GA 1AQCA 4Z2NA 1FGZA 2YS5A 5D27A 2MKRA 5JHGA 1EGXA 1Z87A 3N7CA 3ODOA 3ODXA 1N3HA 2P0FA 3LJUX 1W1HA 4MK0A 1DDVA 2X18A 3AU4A 1WJ1A 1V89A 4HAVB 4NSWA 4IAPA 2JP2A 4HB3B 1V5MA 2ROVA 3KRWA 3HQCA 2UZRA 3PG7A 4GXBA 4HAYB 1X86A 2DKPA 1I7AA 4A6FA 5C79A 1B55A 1ZC4B 4HB2B 1X05A 2ADZA 2OQBA 4HDQA 3F0WA 4WVFB 3ULBA 5HE0A 2EMTA 2LKOA 1XX0A 4TKNA 1PLSA 4A5KA 4F7GA 2J0JA 2H7DA 4EMOA 5HE1A 2DX5A 2LULA 1ZVRA 3O96A 2W2XC 1H10A 4HDOA 2H7EA 5DHAB 3BINA 2MDXA 3IVFA 5D3XA 3PEGA 4MY6A 1BTNA 4GMXB 5D3WA 1DBHA 2DFKA 1PFJA 3KY9A 1BAKA 3P6AA 3QWMA 1KI1B 4GZUA 1DYNA 2GCLA 4DX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAZ B;  3GYO A;  4P7I A;  1OQN A;  4L6E A;  1P5T A;  2ROZ B;  5DIF B;  1DRO A;  1OY2 A;  1J0W A;  4BBK A;  2CY5 A;  4KVG B;  1UNQ A;  3HW2 B;  2IFS A;  4KHA A;  3FSS A;  3MDB C;  1H4R A;  3F5R A;  4HB4 B;  1V5P A;  2EC1 A;  1KZ7 A;  4HB0 B;  2I1J A;  3TCA A;  5LOP B;  1PMS A;  1V5U A;  3DXD A;  4F7U P;  4ZRK A;  4DXA B;  3D8D A;  2PZ1 A;  3P7Z A;  2NZ8 B;  1IRS A;  1MIZ B;  4KHO A;  4K81 A;  2Y8G A;  2L2I A;  4CHM A;  2M14 A;  1XKE A;  3OAN A;  5D3Y A;  4K17 A;  1SGH A;  4DX9 0;  5CLQ B;  4C0A A;  1AWE A;  4K2O A;  2VKI A;  1Y19 B;  2YF0 A;  1W1D A;  3CXB B;  1XD4 A;  2W2W A;  1U5E A;  2XQN M;  3QBV B;  2D9X A;  2DA0 A;  2D11 A;  5KQ4 A;  4EKU A;  3KSY A;  2VRW B;  1EF1 A;  1NTY A;  1DDW A;  2DYN A;  4XWX A;  4ZRJ A;  2D10 A;  2QKM A;  2N23 A;  2J0K A;  2K00 A;  2D9Y A;  4A6K A;  5FI1 A;  3PZD A;  1UPQ A;  1TQZ A;  1OMW A;  1XR0 B;  2P8V A;  5JP4 A;  1DDM A;  2LYD A;  1QQG A;  2Z0Q A;  3D8E A;  5C16 A;  2DN6 A;  2KCJ A;  2J0M A;  2LOZ A;  4F7H A;  4HHV A;  3DXC A;  2COD A;  2MFQ A;  2Y7B A;  3SYX A;  3V5W A;  1BWN A;  3ZDT A;  1ZC3 B;  1U5D A;  1U5F A;  2KUP A;  2UVM A;  3M1I B;  1M7R A;  2N0Y A;  1NI2 A;  4TYZ A;  1MK7 B;  1FOE A;  4KHB B;  1X11 A;  1ISN A;  4PQ0 A;  4HAT B;  3RCP A;  1XCG A;  1RRP B;  1WG7 A;  2DKQ A;  4YON A;  3PVL A;  1GG3 A;  5J3Y A;  2RSG A;  2BCJ A;  4DBB A;  3ZVR A;  2YS1 A;  4HAW B;  4GPT B;  2YT0 A;  2L1C A;  5FI0 A;  1FGY A;  2QKL A;  2V76 A;  2Q13 A;  1U27 A;  1FHW A;  5DH9 B;  1ZM0 A;  1V88 A;  3SV1 A;  2RGN B;  1MKE A;  3PSC A;  5JLJ B;  3VIA A;  4D0N B;  4B6H A;  2R0D A;  5HE3 A;  3DXE A;  3D8F A;  3PVW A;  3VOQ A;  2RLO A;  1EVH A;  2CY4 A;  3AJ4 A;  3X23 A;  5C5B B;  1MAI A;  2DLW A;  1MPH A;  2RUK B;  2UZS A;  2RVB B;  3WA0 A;  1UEF A;  5J3T A;  4K2P A;  1U29 A;  4IFS A;  1Q67 A;  1GC7 A;  2AL6 A;  5GOW B;  2DHK A;  2CAY A;  2DYQ A;  1EAZ A;  2J59 M;  4YL8 A;  2ZPY A;  2YS3 A;  3QIJ A;  1QC6 A;  1W1G A;  4CHJ A;  5C6R A;  5DHF B;  2W2X D;  1WJM A;  3ODW A;  4A6F B;  1LB1 A;  3G9W A;  2MWN B;  1NU2 A;  2Y8F A;  3A8Q A;  1FAO A;  1K5D B;  1P3R A;  3SNH A;  3UZT A;  1UNR A;  1KZG A;  1FHO A;  5D3V A;  4IOY X;  2K2J A;  3SUZ A;  5DI9 B;  3A8P A;  2I5F A;  2E2X A;  2HE7 A;  1SHC A;  4MT7 A;  2COF A;  2D9W A;  2KGX B;  1U2B A;  2D2Q A;  3GYP A;  1GC6 A;  2DX1 A;  2EJ8 A;  1FB8 A;  2LG1 A;  3KRX A;  3FEH A;  4NY0 A;  4Y94 A;  2D4Q A;  2COC A;  1ZSQ A;  2GS0 A;  4GMV A;  4HAU B;  3SO6 A;  2G35 A;  2NMB A;  5EFX A;  2R09 A;  1Y5O A;  2ELA A;  3HK0 A;  2DHJ A;  3U8Z A;  1UPR A;  3ULC A;  1MK9 B;  2GCJ A;  3ML4 A;  1WVH A;  3CIK A;  2LOX A;  3PVU A;  1U5G A;  4A6H A;  2Z0P A;  2GJY A;  2OTX A;  5KQ1 A;  1X1F A;  1LW3 A;  2M38 A;  4EJN A;  3NSU A;  2I5C A;  3U7D A;  3KZ1 A;  1RJ2 A;  1TJ6 A;  3WYF B;  2D9V A;  5KCV A;  5CLL B;  2CRF A;  2P0H A;  2VSZ A;  2K2U A;  2FJL A;  1MIX A;  1UNP A;  3TFM A;  5LON B;  3BJI A;  2YVC A;  3AU5 A;  1WGU A;  4WJ7 A;  1K5G B;  3TW1 A;  1BTK A;  3TVV A;  5JHH A;  4CYE A;  2DTC A;  1V61 A;  3PP2 A;  2D9Z A;  2HTH B;  5HE2 A;  1FHX A;  2YSZ A;  2AEH A;  1WI1 A;  1WGQ A;  4Z2M B;  3MPX A;  4WSF A;  1I2H A;  4ZRI A;  3TO1 A;  4PNK A;  3FM8 C;  2P0D A;  4KAX B;  2IYB A;  1P6S A;  2YRY A;  4GN1 A;  1M7E A;  4H8S A;  2I1K A;  3T06 A;  1J19 A;  1TXD A;  2DHI A;  5L81 A;  1XOD A;  1NTV A;  2EMS A;  4HAX B;  2COA A;  2Z0O A;  3A98 B;  2RNR B;  1E5W A;  2ELB A;  5C5B A;  2YT1 A;  5J3Q A;  1X1G A;  1AQC A;  4Z2N A;  1FGZ A;  2YS5 A;  5D27 A;  2MKR A;  5JHG A;  1EGX A;  1Z87 A;  3N7C A;  3ODO A;  3ODX A;  1N3H A;  2P0F A;  3LJU X;  1W1H A;  4MK0 A;  1DDV A;  2X18 A;  3AU4 A;  1WJ1 A;  1V89 A;  4HAV B;  4NSW A;  4IAP A;  2JP2 A;  4HB3 B;  1V5M A;  2ROV A;  3KRW A;  3HQC A;  2UZR A;  3PG7 A;  4GXB A;  4HAY B;  1X86 A;  2DKP A;  1I7A A;  4A6F A;  5C79 A;  1B55 A;  1ZC4 B;  4HB2 B;  1X05 A;  2ADZ A;  2OQB A;  4HDQ A;  3F0W A;  4WVF B;  3ULB A;  5HE0 A;  2EMT A;  2LKO A;  1XX0 A;  4TKN A;  1PLS A;  4A5K A;  4F7G A;  2J0J A;  2H7D A;  4EMO A;  5HE1 A;  2DX5 A;  2LUL A;  1ZVR A;  3O96 A;  2W2X C;  1H10 A;  4HDO A;  2H7E A;  5DHA B;  3BIN A;  2MDX A;  3IVF A;  5D3X A;  3PEG A;  4MY6 A;  1BTN A;  4GMX B;  5D3W A;  1DBH A;  2DFK A;  1PFJ A;  3KY9 A;  1BAK A;  3P6A A;  3QWM A;  1KI1 B;  4GZU A;  1DYN A;  2GCL A;  4DX8 A; 
#chains in the Genus database with same CATH topology
 4HAZ B;  3GYO A;  4P7I A;  1OQN A;  4L6E A;  1P5T A;  2ROZ B;  5DIF B;  1DRO A;  1OY2 A;  1J0W A;  4BBK A;  2CY5 A;  4KVG B;  1UNQ A;  5M4Y B;  3HW2 B;  2IFS A;  4KHA A;  3FSS A;  3MDB C;  1H4R A;  3F5R A;  4HB4 B;  1V5P A;  2EC1 A;  1KZ7 A;  4HB0 B;  2I1J A;  3TCA A;  5LOP B;  3NWD A;  4GOU A;  1PMS A;  1V5U A;  3DXD A;  4F7U P;  4ZRK A;  2RRF A;  4DXA B;  3D8D A;  4GNK B;  2PZ1 A;  3P7Z A;  2NZ8 B;  1IRS A;  1MIZ B;  4KHO A;  4K81 A;  2Y8G A;  2L2I A;  4CHM A;  2M14 A;  1XKE A;  3OAN A;  5D3Y A;  4K17 A;  1SGH A;  4DX9 0;  5CLQ B;  4C0A A;  1AWE A;  4K2O A;  2VKI A;  1Y19 B;  2YF0 A;  1W1D A;  3CXB B;  1XD4 A;  2W2W A;  1U5E A;  2XQN M;  3QBV B;  3A58 A;  2D9X A;  2DA0 A;  2D11 A;  5KQ4 A;  4EKU A;  3KSY A;  2R2Y A;  2VRW B;  1EF1 A;  1NTY A;  1DDW A;  2DYN A;  4XWX A;  4ZRJ A;  2D10 A;  1T77 A;  2QKM A;  2N23 A;  2YT2 A;  2J0K A;  2K00 A;  2D9Y A;  4A6K A;  5FI1 A;  3PZD A;  1UPQ A;  1TQZ A;  1OMW A;  1XR0 B;  2P8V A;  5JP4 A;  1DDM A;  2LYD A;  1QQG A;  2Z0Q A;  2Z4D A;  3D8E A;  5C16 A;  2DN6 A;  2KCJ A;  2J0M A;  2LOZ A;  4F7H A;  4HHV A;  3DXC A;  2COD A;  2MFQ A;  2Y7B A;  3SYX A;  3V5W A;  1BWN A;  3ZDT A;  1ZC3 B;  1U5D A;  1U5F A;  2KUP A;  2UVM A;  3M1I B;  1M7R A;  2N0Y A;  1NI2 A;  2KIG A;  4TYZ A;  1MK7 B;  1FOE A;  4KHB B;  1X11 A;  1ISN A;  4PQ0 A;  4HAT B;  3RCP A;  1XCG A;  1RRP B;  3NWA A;  1WG7 A;  2DKQ A;  4YON A;  3PVL A;  1GG3 A;  5J3Y A;  3HSA A;  2RSG A;  2FJU B;  2BCJ A;  4DBB A;  3ZVR A;  2YS1 A;  4HAW B;  4GPT B;  4OSN A;  2YT0 A;  2L1C A;  5FI0 A;  1FGY A;  2QKL A;  2V76 A;  2Q13 A;  1U27 A;  1FHW A;  5DH9 B;  1ZM0 A;  1V88 A;  3SV1 A;  2RGN B;  1MKE A;  3PSC A;  5JLJ B;  3VIA A;  2Z13 A;  4D0N B;  4B6H A;  2KUQ A;  3NWF A;  2R0D A;  5HE3 A;  3DXE A;  3D8F A;  3PVW A;  3VOQ A;  2RLO A;  1EVH A;  2CY4 A;  3AJ4 A;  3X23 A;  4L1R A;  5C5B B;  1MAI A;  2DLW A;  5I2S A;  1MPH A;  2RUK B;  2UZS A;  4CSQ A;  2RVB B;  3WA0 A;  1UEF A;  5J3T A;  4K2P A;  4OT1 A;  1U29 A;  4IFS A;  4DIX A;  2K49 A;  1Q67 A;  1GC7 A;  2AL6 A;  5GOW B;  2DHK A;  2CAY A;  2DYQ A;  4QJ3 B;  1EAZ A;  2J59 M;  4YL8 A;  2ZPY A;  2YS3 A;  3QIJ A;  1QC6 A;  1W1G A;  4CHJ A;  5C6R A;  5DHF B;  2W2X D;  1WJM A;  3ODW A;  4A6F B;  1LB1 A;  3G9W A;  2MWN B;  1NU2 A;  2Y8F A;  3A8Q A;  1FAO A;  2KIE A;  1K5D B;  1P3R A;  3SNH A;  3UZT A;  1UNR A;  2NBV A;  4HSI A;  1KZG A;  1FHO A;  5D3V A;  4IOY X;  2K2J A;  3SUZ A;  5DI9 B;  2Z14 A;  3A8P A;  2I5F A;  2E2X A;  2HE7 A;  1SHC A;  4MT7 A;  2COF A;  2D9W A;  3HIE A;  2KGX B;  1U2B A;  2D2Q A;  3GYP A;  1GC6 A;  2K8E A;  2DX1 A;  2EJ8 A;  1FB8 A;  4QXA B;  2LG1 A;  3KRX A;  3FEH A;  4NY0 A;  4Y94 A;  2D4Q A;  2COC A;  1ZSQ A;  2GS0 A;  4GMV A;  4HAU B;  3SO6 A;  2G35 A;  2NMB A;  5EFX A;  2R09 A;  1Y5O A;  2ELA A;  3HK0 A;  2DHJ A;  3U8Z A;  1UPR A;  3U12 A;  3ULC A;  1MK9 B;  2GCJ A;  3ML4 A;  1WVH A;  3CIK A;  2LOX A;  3PVU A;  1U5G A;  4A6H A;  2GUM A;  2Z0P A;  2GJY A;  2OTX A;  5KQ1 A;  1X1F A;  1LW3 A;  2M38 A;  4EJN A;  3NSU A;  2I5C A;  4KHB A;  3U7D A;  3KZ1 A;  1RJ2 A;  1TJ6 A;  3B77 A;  3WYF B;  2D9V A;  5KCV A;  5CLL B;  2CRF A;  2P0H A;  2VSZ A;  2K2U A;  2FJL A;  1MIX A;  2Z59 A;  1UNP A;  3TFM A;  5LON B;  3BJI A;  2YVC A;  3AU5 A;  1WGU A;  4QJ4 B;  5LG4 B;  4WJ7 A;  1K5G B;  3TW1 A;  1BTK A;  3TVV A;  5JHH A;  4CYE A;  2DTC A;  1V61 A;  1ZYI A;  2D9Z A;  2HTH B;  3PP2 A;  1FHX A;  5HE2 A;  2YSZ A;  4D6W A;  2AEH A;  1WI1 A;  1WGQ A;  4Z2M B;  3MPX A;  4WSF A;  1I2H A;  4ZRI A;  3TO1 A;  4PNK A;  3FM8 C;  2P0D A;  4KAX B;  2IYB A;  1P6S A;  2YRY A;  4GN1 A;  1M7E A;  4H8S A;  2I1K A;  3T06 A;  1J19 A;  1TXD A;  2DHI A;  5L81 A;  1XOD A;  1NTV A;  2EMS A;  4HAX B;  2COA A;  2Z0O A;  3A98 B;  2RNR B;  1E5W A;  2ELB A;  5C5B A;  2YT1 A;  5J3Q A;  1X1G A;  1AQC A;  4Z2N A;  1FGZ A;  2YS5 A;  5D27 A;  2MKR A;  5JHG A;  1EGX A;  1Z87 A;  3N7C A;  3ODO A;  3ODX A;  1N3H A;  2P0F A;  3LJU X;  1W1H A;  4MK0 A;  1DDV A;  2X18 A;  3AU4 A;  1WJ1 A;  1V89 A;  4HAV B;  4NSW A;  5I2M A;  4IAP A;  3DCX A;  2JP2 A;  4HB3 B;  1V5M A;  2ROV A;  3KRW A;  3HQC A;  2UZR A;  3PG7 A;  4GXB A;  4HAY B;  1X86 A;  2DKP A;  1I7A A;  4A6F A;  5C79 A;  1B55 A;  1ZC4 B;  4HB2 B;  4QJ5 B;  1X05 A;  2ADZ A;  2OQB A;  4HDQ A;  3F0W A;  1MI1 A;  4WVF B;  3ULB A;  5HE0 A;  2EMT A;  2LKO A;  1XX0 A;  4TKN A;  1PLS A;  4A5K A;  4F7G A;  2J0J A;  2H7D A;  4EMO A;  5HE1 A;  2DX5 A;  3FVC A;  2LUL A;  1ZVR A;  3O96 A;  2W2X C;  1H10 A;  4HDO A;  2H7E A;  5DHA B;  3BIN A;  2MDX A;  3IVF A;  5IRS A;  3OHM B;  5D3X A;  3PEG A;  4MY6 A;  1BTN A;  4GMX B;  5D3W A;  2ZKM X;  1DBH A;  2DFK A;  1PFJ A;  3KY9 A;  1BAK A;  3P6A A;  3QWM A;  1KI1 B;  4GZU A;  1DYN A;  2KR0 A;  3NW8 A;  2GCL A;  4DX8 A; 
#chains in the Genus database with same CATH homology
 4HAZ B;  3GYO A;  4P7I A;  1OQN A;  4L6E A;  1P5T A;  2ROZ B;  5DIF B;  1DRO A;  1OY2 A;  1J0W A;  4BBK A;  2CY5 A;  4KVG B;  1UNQ A;  3HW2 B;  2IFS A;  4KHA A;  3FSS A;  3MDB C;  1H4R A;  3F5R A;  4HB4 B;  1V5P A;  2EC1 A;  1KZ7 A;  4HB0 B;  2I1J A;  3TCA A;  5LOP B;  1PMS A;  1V5U A;  3DXD A;  4F7U P;  4ZRK A;  4DXA B;  3D8D A;  2PZ1 A;  3P7Z A;  2NZ8 B;  1IRS A;  1MIZ B;  4KHO A;  4K81 A;  2Y8G A;  2L2I A;  4CHM A;  2M14 A;  1XKE A;  3OAN A;  5D3Y A;  4K17 A;  1SGH A;  4DX9 0;  5CLQ B;  4C0A A;  1AWE A;  4K2O A;  2VKI A;  1Y19 B;  2YF0 A;  1W1D A;  3CXB B;  1XD4 A;  2W2W A;  1U5E A;  2XQN M;  3QBV B;  2D9X A;  2DA0 A;  2D11 A;  5KQ4 A;  4EKU A;  3KSY A;  2VRW B;  1EF1 A;  1NTY A;  1DDW A;  2DYN A;  4XWX A;  4ZRJ A;  2D10 A;  2QKM A;  2N23 A;  2J0K A;  2K00 A;  2D9Y A;  4A6K A;  5FI1 A;  3PZD A;  1UPQ A;  1TQZ A;  1OMW A;  1XR0 B;  2P8V A;  5JP4 A;  1DDM A;  2LYD A;  1QQG A;  2Z0Q A;  3D8E A;  5C16 A;  2DN6 A;  2KCJ A;  2J0M A;  2LOZ A;  4F7H A;  4HHV A;  3DXC A;  2COD A;  2MFQ A;  2Y7B A;  3SYX A;  3V5W A;  1BWN A;  3ZDT A;  1ZC3 B;  1U5D A;  1U5F A;  2KUP A;  2UVM A;  3M1I B;  1M7R A;  2N0Y A;  1NI2 A;  4TYZ A;  1MK7 B;  1FOE A;  4KHB B;  1X11 A;  1ISN A;  4PQ0 A;  4HAT B;  3RCP A;  1XCG A;  1RRP B;  1WG7 A;  2DKQ A;  4YON A;  3PVL A;  1GG3 A;  5J3Y A;  2RSG A;  2BCJ A;  4DBB A;  3ZVR A;  2YS1 A;  4HAW B;  4GPT B;  2YT0 A;  2L1C A;  5FI0 A;  1FGY A;  2QKL A;  2V76 A;  2Q13 A;  1U27 A;  1FHW A;  5DH9 B;  1ZM0 A;  1V88 A;  3SV1 A;  2RGN B;  1MKE A;  3PSC A;  5JLJ B;  3VIA A;  4D0N B;  4B6H A;  2R0D A;  5HE3 A;  3DXE A;  3D8F A;  3PVW A;  3VOQ A;  2RLO A;  1EVH A;  2CY4 A;  3AJ4 A;  3X23 A;  5C5B B;  1MAI A;  2DLW A;  1MPH A;  2RUK B;  2UZS A;  2RVB B;  3WA0 A;  1UEF A;  5J3T A;  4K2P A;  1U29 A;  4IFS A;  1Q67 A;  1GC7 A;  2AL6 A;  5GOW B;  2DHK A;  2CAY A;  2DYQ A;  1EAZ A;  2J59 M;  4YL8 A;  2ZPY A;  2YS3 A;  3QIJ A;  1QC6 A;  1W1G A;  4CHJ A;  5C6R A;  5DHF B;  2W2X D;  1WJM A;  3ODW A;  4A6F B;  1LB1 A;  3G9W A;  2MWN B;  1NU2 A;  2Y8F A;  3A8Q A;  1FAO A;  1K5D B;  1P3R A;  3SNH A;  3UZT A;  1UNR A;  1KZG A;  1FHO A;  5D3V A;  4IOY X;  2K2J A;  3SUZ A;  5DI9 B;  3A8P A;  2I5F A;  2E2X A;  2HE7 A;  1SHC A;  4MT7 A;  2COF A;  2D9W A;  2KGX B;  1U2B A;  2D2Q A;  3GYP A;  1GC6 A;  2DX1 A;  2EJ8 A;  1FB8 A;  2LG1 A;  3KRX A;  3FEH A;  4NY0 A;  4Y94 A;  2D4Q A;  2COC A;  1ZSQ A;  2GS0 A;  4GMV A;  4HAU B;  3SO6 A;  2G35 A;  2NMB A;  5EFX A;  2R09 A;  1Y5O A;  2ELA A;  3HK0 A;  2DHJ A;  3U8Z A;  1UPR A;  3ULC A;  1MK9 B;  2GCJ A;  3ML4 A;  1WVH A;  3CIK A;  2LOX A;  3PVU A;  1U5G A;  4A6H A;  2Z0P A;  2GJY A;  2OTX A;  5KQ1 A;  1X1F A;  1LW3 A;  2M38 A;  4EJN A;  3NSU A;  2I5C A;  3U7D A;  3KZ1 A;  1RJ2 A;  1TJ6 A;  3WYF B;  2D9V A;  5KCV A;  5CLL B;  2CRF A;  2P0H A;  2VSZ A;  2K2U A;  2FJL A;  1MIX A;  1UNP A;  3TFM A;  5LON B;  3BJI A;  2YVC A;  3AU5 A;  1WGU A;  4WJ7 A;  1K5G B;  3TW1 A;  1BTK A;  3TVV A;  5JHH A;  4CYE A;  2DTC A;  1V61 A;  3PP2 A;  2D9Z A;  2HTH B;  5HE2 A;  1FHX A;  2YSZ A;  2AEH A;  1WI1 A;  1WGQ A;  4Z2M B;  3MPX A;  4WSF A;  1I2H A;  4ZRI A;  3TO1 A;  4PNK A;  3FM8 C;  2P0D A;  4KAX B;  2IYB A;  1P6S A;  2YRY A;  4GN1 A;  1M7E A;  4H8S A;  2I1K A;  3T06 A;  1J19 A;  1TXD A;  2DHI A;  5L81 A;  1XOD A;  1NTV A;  2EMS A;  4HAX B;  2COA A;  2Z0O A;  3A98 B;  2RNR B;  1E5W A;  2ELB A;  5C5B A;  2YT1 A;  5J3Q A;  1X1G A;  1AQC A;  4Z2N A;  1FGZ A;  2YS5 A;  5D27 A;  2MKR A;  5JHG A;  1EGX A;  1Z87 A;  3N7C A;  3ODO A;  3ODX A;  1N3H A;  2P0F A;  3LJU X;  1W1H A;  4MK0 A;  1DDV A;  2X18 A;  3AU4 A;  1WJ1 A;  1V89 A;  4HAV B;  4NSW A;  4IAP A;  2JP2 A;  4HB3 B;  1V5M A;  2ROV A;  3KRW A;  3HQC A;  2UZR A;  3PG7 A;  4GXB A;  4HAY B;  1X86 A;  2DKP A;  1I7A A;  4A6F A;  5C79 A;  1B55 A;  1ZC4 B;  4HB2 B;  1X05 A;  2ADZ A;  2OQB A;  4HDQ A;  3F0W A;  4WVF B;  3ULB A;  5HE0 A;  2EMT A;  2LKO A;  1XX0 A;  4TKN A;  1PLS A;  4A5K A;  4F7G A;  2J0J A;  2H7D A;  4EMO A;  5HE1 A;  2DX5 A;  2LUL A;  1ZVR A;  3O96 A;  2W2X C;  1H10 A;  4HDO A;  2H7E A;  5DHA B;  3BIN A;  2MDX A;  3IVF A;  5D3X A;  3PEG A;  4MY6 A;  1BTN A;  4GMX B;  5D3W A;  1DBH A;  2DFK A;  1PFJ A;  3KY9 A;  1BAK A;  3P6A A;  3QWM A;  1KI1 B;  4GZU A;  1DYN A;  2GCL A;  4DX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...