3D8DA

Crystal structure of the human fe65-ptb1 domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
139
Chain Sequence
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 139
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8dA00
3M1IB 2DTCA 2DYNA 4HB3B 4TKNA 5C16A 2ZPYA 2YT0A 2Q13A 3ML4A 4K17A 2LOXA 3QBVB 1MKEA 5D27A 3ULCA 3FEHA 2I5CA 1NTYA 2Y7BA 2LULA 3KY9A 2J59M 2QKLA 4D0NB 3DXCA 4GPTB 4GN1A 2P0HA 3HW2B 4GZUA 1I7AA 4IOYX 1GC6A 1U5FA 4HAZB 1DBHA 1M7EA 2GS0A 3U8ZA 1UNPA 2JP2A 3QIJA 4HB2B 5DIFB 5C5BA 4K2OA 4DX8A 2LOZA 1W1GA 3SNHA 3SV1A 2YS1A 3PEGA 1J0WA 2FJLA 1XR0B 4HAVB 3VIAA 2MDXA 4C0AA 1BTNA 5J3QA 1ZM0A 2CY4A 1EVHA 3D8FA 2VKIA 4HAUB 5JHGA 1K5DB 3TO1A 5L81A 2DLWA 3PVWA 2YF0A 4Z2NA 1U27A 2D9VA 3ZDTA 2W2XD 1NU2A 2P8VA 1XCGA 3A98B 5HE1A 3SO6A 2KUPA 4IAPA 2M14A 1MK7B 3BJIA 4ZRJA 3LJUX 1V89A 4K81A 1P3RA 5KCVA 3SUZA 4MT7A 4EJNA 3D8EA 1W1DA 3ODXA 3CIKA 2KGXB 4DBBA 5C6RA 1EF1A 2ELBA 3ULBA 5JLJB 1FGYA 2GJYA 1WJ1A 1U2BA 1V88A 5LOPB 2D9WA 1WVHA 2MFQA 2DX5A 3VOQA 2DHJA 3N7CA 1FB8A 1TXDA 1LB1A 4CHMA 1KZ7A 3X23A 1WGQA 2IFSA 3ODWA 1UEFA 3BINA 1ISNA 3GYPA 4XWXA 2RNRB 5KQ4A 2D2QA 3KRXA 4F7HA 4HB4B 2LG1A 2I1JA 2N23A 1XX0A 5JHHA 2DA0A 2AEHA 1U5DA 1UNRA 2D10A 1MPHA 3TW1A 4EMOA 1OQNA 3TFMA 2YVCA 2D4QA 2HTHB 2H7EA 1PMSA 1QC6A 2OTXA 2R09A 4KHOA 1Q67A 1Z87A 2E2XA 5CLLB 1MK9B 2DX1A 2L1CA 2DHIA 2ROVA 1DYNA 3TCAA 5HE3A 1WG7A 1B55A 3PZDA 3AJ4A 1LW3A 5JP4A 1MIXA 1P5TA 2RLOA 2COFA 3DXEA 1WI1A 3WYFB 1QQGA 5DH9B 5HE0A 1NI2A 2RGNB 4DXAB 2J0KA 1ZVRA 4NSWA 1U5GA 1X11A 1H4RA 4WSFA 2COCA 5EFXA 4HAXB 1FGZA 4KAXB 3A8PA 3OANA 1P6SA 4WVFB 1FOEA 1I2HA 4CYEA 4P7IA 2W2WA 4A6HA 3CXBB 4HB0B 4A6KA 2DKPA 1PFJA 3HK0A 4K2PA 2MWNB 4WJ7A 2QKMA 4GXBA 5DHAB 2I5FA 1W1HA 4YONA 2Y8FA 2J0MA 3MDBC 2YS5A 4KVGB 1V5MA 4GMXB 2KCJA 2PZ1A 4Z2MB 1V5UA 4MK0A 3PP2A 1SGHA 1UNQA 2DKQA 3PVUA 4MY6A 4NY0A 5D3YA 1X1FA 2Z0OA 4BBKA 4GMVA 2DYQA 2BCJA 5C79A 2RUKB 2P0DA 1XKEA 2UZSA 2H7DA 5D3XA 1Y5OA 1FHWA 1KZGA 3KRWA 3O96A 4HDQA 1OY2A 2ELAA 1GG3A 4EKUA 3ODOA 3SYXA 1TJ6A 4HDOA 4YL8A 3PSCA 5J3TA 1RRPB 2GCLA 2R0DA 1UPRA 2J0JA 1Y19B 3HQCA 5DHFB 2CRFA 1SHCA 1IRSA 5GOWB 4A5KA 1KI1B 4B6HA 1J19A 1WGUA 2YSZA 1ZC3B 1TQZA 3ZVRA 2NZ8B 5C5BB 2K2JA 5LONB 2LYDA 3P7ZA 2I1KA 2W2XC 1X86A 2K2UA 4KHBB 1M7RA 2Z0QA 2P0FA 2COAA 3KSYA 4HATB 3IVFA 2VRWB 1X05A 1X1GA 1H10A 3PVLA 3UZTA 2LKOA 3FSSA 2D9ZA 3TVVA 5D3VA 3G9WA 3P6AA 3V5WA 2CODA 2EC1A 1DDMA 4IFSA 5J3YA 1UPQA 1FHOA 5DI9B 2ROZB 3FM8C 3PG7A 2EMTA 4KHAA 1XD4A 3QWMA 2K00A 1GC7A 1MAIA 2XQNM 1AQCA 1FAOA 4H8SA 2NMBA 3MPXA 1AWEA 5CLQB 3RCPA 4PQ0A 2RSGA 2GCJA 2IYBA 1K5GB 2X18A 3DXDA 2VSZA 3WA0A 3AU5A 4A6FB 3F0WA 4ZRIA 1U5EA 2OQBA 1BTKA 2L2IA 1ZC4B 5FI0A 4PNKA 3KZ1A 1V5PA 2D9YA 2EMSA 2YT1A 3T06A 2UVMA 2EJ8A 1ZSQA 4Y94A 2V76A 2MKRA 2DN6A 3U7DA 1NTVA 2UZRA 4F7UP 1WJMA 3AU4A 1DDWA 1EGXA 1OMWA 1FHXA 1E5WA 2Y8GA 4CHJA 1EAZA 4A6FA 2D11A 2YS3A 3NSUA 5FI1A 2DFKA 1XODA 2DHKA 1U29A 4TYZA 1PLSA 5HE2A 2RVBB 1MIZB 4HAWB 1DROA 4DX90 2CY5A 2ADZA 2M38A 1BWNA 1BAKA 5KQ1A 3D8DA 4HHVA 1DDVA 2AL6A 3F5RA 4L6EA 4F7GA 3GYOA 2N0YA 2D9XA 5D3WA 2Z0PA 4ZRKA 2YRYA 2HE7A 3A8QA 2CAYA 1RJ2A 1N3HA 4HAYB 2G35A 1V61A
chains in the Genus database with same CATH superfamily
3M1IB 2DTCA 2DYNA 4HB3B 4TKNA 5C16A 2ZPYA 2YT0A 2Q13A 3ML4A 4K17A 2LOXA 3QBVB 1MKEA 5D27A 3ULCA 3FEHA 2I5CA 1NTYA 2Y7BA 2LULA 3KY9A 2J59M 2QKLA 4D0NB 3DXCA 4GPTB 4GN1A 2K8EA 2P0HA 3HW2B 4GZUA 1I7AA 4IOYX 1GC6A 1U5FA 4HAZB 1DBHA 1M7EA 2GS0A 3U8ZA 1UNPA 2JP2A 3QIJA 4HB2B 5DIFB 5C5BA 4K2OA 3OHMB 2LOZA 4DX8A 1W1GA 3SNHA 3SV1A 2YS1A 3PEGA 1J0WA 2FJLA 3U12A 1XR0B 4HAVB 4QXAB 3VIAA 2MDXA 4C0AA 1BTNA 5J3QA 1ZM0A 2CY4A 4KHBA 1EVHA 3D8FA 2VKIA 4HAUB 5JHGA 1K5DB 3DCXA 3TO1A 5L81A 2DLWA 3PVWA 2YF0A 4Z2NA 1U27A 2KUQA 2D9VA 3ZDTA 3HSAA 2W2XD 1NU2A 2P8VA 1XCGA 3A98B 5HE1A 3SO6A 2KUPA 4IAPA 2M14A 1MK7B 3BJIA 4ZRJA 3LJUX 1V89A 4K81A 1P3RA 5KCVA 3SUZA 4MT7A 4EJNA 3D8EA 1W1DA 1MI1A 3NWDA 3ODXA 3CIKA 2KGXB 4DBBA 5C6RA 1EF1A 2ELBA 2Z59A 3ULBA 5JLJB 1FGYA 2GJYA 1WJ1A 1U2BA 1V88A 5LOPB 2D9WA 1WVHA 2MFQA 2DX5A 3VOQA 2DHJA 3N7CA 1FB8A 1TXDA 1LB1A 4CHMA 5I2MA 5LG4B 3A58A 1KZ7A 3X23A 1WGQA 2IFSA 2Z4DA 3ODWA 1UEFA 3BINA 1ISNA 3GYPA 4XWXA 2YT2A 2RNRB 5KQ4A 2D2QA 3KRXA 4F7HA 4HB4B 2LG1A 2I1JA 2N23A 1XX0A 5JHHA 2ZKMX 2DA0A 2AEHA 1U5DA 1UNRA 2D10A 1MPHA 3TW1A 4EMOA 1OQNA 3NWFA 4OT1A 3TFMA 2YVCA 2D4QA 2HTHB 2H7EA 1PMSA 1QC6A 2OTXA 2R09A 4KHOA 1Q67A 1Z87A 2E2XA 5CLLB 1MK9B 2DX1A 2L1CA 2FJUB 2DHIA 2ROVA 1DYNA 3TCAA 5HE3A 1WG7A 1B55A 3PZDA 3AJ4A 1LW3A 5JP4A 1MIXA 1P5TA 2RLOA 2COFA 3DXEA 1WI1A 4D6WA 3WYFB 1QQGA 5DH9B 5HE0A 1NI2A 2RGNB 4DXAB 4GOUA 2J0KA 1ZVRA 4NSWA 1U5GA 1X11A 1H4RA 4WSFA 2COCA 5EFXA 4HAXB 1FGZA 4KAXB 3A8PA 3OANA 1P6SA 4WVFB 4DIXA 1FOEA 1I2HA 4CYEA 4P7IA 2W2WA 4A6HA 3CXBB 4HB0B 4A6KA 2DKPA 1PFJA 3HK0A 4K2PA 2MWNB 4WJ7A 2QKMA 4GXBA 5DHAB 2I5FA 1W1HA 4YONA 2Y8FA 2J0MA 3MDBC 2YS5A 4KVGB 2KIEA 2Z14A 4QJ3B 1V5MA 4QJ4B 4GMXB 2KCJA 2PZ1A 4Z2MB 1V5UA 4MK0A 3PP2A 1SGHA 1UNQA 2DKQA 3PVUA 4MY6A 4NY0A 5D3YA 1X1FA 2Z0OA 4BBKA 4GMVA 2DYQA 2BCJA 1ZYIA 5C79A 2RUKB 2P0DA 1XKEA 2UZSA 2H7DA 5D3XA 1Y5OA 1FHWA 1KZGA 3NWAA 4GNKB 3KRWA 3O96A 4HDQA 1OY2A 2ELAA 1GG3A 4EKUA 3ODOA 3SYXA 3B77A 1TJ6A 4HDOA 3NW8A 4QJ5B 4YL8A 3PSCA 5J3TA 2Z13A 1RRPB 2GCLA 2R0DA 1UPRA 2J0JA 1Y19B 3HQCA 5I2SA 5DHFB 2CRFA 1SHCA 1IRSA 5GOWB 4A5KA 1KI1B 4B6HA 5IRSA 1J19A 1WGUA 2YSZA 1ZC3B 1TQZA 3ZVRA 2NZ8B 5C5BB 2K2JA 5LONB 2LYDA 3P7ZA 5M4YB 2I1KA 3FVCA 2W2XC 1X86A 2K2UA 4KHBB 1M7RA 2Z0QA 2P0FA 2COAA 3KSYA 4HATB 3IVFA 2VRWB 1X05A 1X1GA 1H10A 3PVLA 4L1RA 3UZTA 2LKOA 3FSSA 1T77A 2D9ZA 3TVVA 5D3VA 3G9WA 3P6AA 3V5WA 2CODA 2EC1A 1DDMA 4IFSA 2NBVA 5J3YA 1UPQA 4CSQA 1FHOA 5DI9B 2ROZB 3FM8C 3PG7A 2EMTA 4KHAA 2KIGA 1XD4A 3QWMA 2K00A 1GC7A 2KR0A 1MAIA 2XQNM 1AQCA 1FAOA 4H8SA 2NMBA 3MPXA 1AWEA 5CLQB 3RCPA 4PQ0A 2RSGA 2GCJA 2IYBA 1K5GB 2X18A 3DXDA 2VSZA 3WA0A 3AU5A 4A6FB 3F0WA 4ZRIA 1U5EA 2OQBA 1BTKA 3HIEA 2L2IA 1ZC4B 2R2YA 5FI0A 4PNKA 3KZ1A 1V5PA 2D9YA 2EMSA 2YT1A 3T06A 2UVMA 2EJ8A 1ZSQA 4Y94A 2V76A 4HSIA 2MKRA 2DN6A 3U7DA 1NTVA 2UZRA 4F7UP 1WJMA 3AU4A 1DDWA 1EGXA 1OMWA 1FHXA 1E5WA 2Y8GA 4CHJA 1EAZA 4A6FA 2D11A 2YS3A 3NSUA 5FI1A 2DFKA 1XODA 2DHKA 2RRFA 1U29A 4TYZA 1PLSA 5HE2A 2RVBB 1MIZB 4HAWB 1DROA 4DX90 2CY5A 2GUMA 2ADZA 2M38A 1BWNA 1BAKA 4OSNA 2K49A 5KQ1A 3D8DA 4HHVA 1DDVA 2AL6A 3F5RA 4L6EA 4F7GA 3GYOA 2N0YA 2D9XA 5D3WA 2Z0PA 4ZRKA 2YRYA 2HE7A 3A8QA 2CAYA 1RJ2A 1N3HA 4HAYB 2G35A 1V61A
chains in the Genus database with same CATH topology
3M1IB 2DTCA 2DYNA 4HB3B 4TKNA 5C16A 2ZPYA 2YT0A 2Q13A 3ML4A 4K17A 2LOXA 3QBVB 1MKEA 5D27A 3ULCA 3FEHA 2I5CA 1NTYA 2Y7BA 2LULA 3KY9A 2J59M 2QKLA 4D0NB 3DXCA 4GPTB 4GN1A 2P0HA 3HW2B 4GZUA 1I7AA 4IOYX 1GC6A 1U5FA 4HAZB 1DBHA 1M7EA 2GS0A 3U8ZA 1UNPA 2JP2A 3QIJA 4HB2B 5DIFB 5C5BA 4K2OA 4DX8A 2LOZA 1W1GA 3SNHA 3SV1A 2YS1A 3PEGA 1J0WA 2FJLA 1XR0B 4HAVB 3VIAA 2MDXA 4C0AA 1BTNA 5J3QA 1ZM0A 2CY4A 1EVHA 3D8FA 2VKIA 4HAUB 5JHGA 1K5DB 3TO1A 5L81A 2DLWA 3PVWA 2YF0A 4Z2NA 1U27A 2D9VA 3ZDTA 2W2XD 1NU2A 2P8VA 1XCGA 3A98B 5HE1A 3SO6A 2KUPA 4IAPA 2M14A 1MK7B 3BJIA 4ZRJA 3LJUX 1V89A 4K81A 1P3RA 5KCVA 3SUZA 4MT7A 4EJNA 3D8EA 1W1DA 3ODXA 3CIKA 2KGXB 4DBBA 5C6RA 1EF1A 2ELBA 3ULBA 5JLJB 1FGYA 2GJYA 1WJ1A 1U2BA 1V88A 5LOPB 2D9WA 1WVHA 2MFQA 2DX5A 3VOQA 2DHJA 3N7CA 1FB8A 1TXDA 1LB1A 4CHMA 1KZ7A 3X23A 1WGQA 2IFSA 3ODWA 1UEFA 3BINA 1ISNA 3GYPA 4XWXA 2RNRB 5KQ4A 2D2QA 3KRXA 4F7HA 4HB4B 2LG1A 2I1JA 2N23A 1XX0A 5JHHA 2DA0A 2AEHA 1U5DA 1UNRA 2D10A 1MPHA 3TW1A 4EMOA 1OQNA 3TFMA 2YVCA 2D4QA 2HTHB 2H7EA 1PMSA 1QC6A 2OTXA 2R09A 4KHOA 1Q67A 1Z87A 2E2XA 5CLLB 1MK9B 2DX1A 2L1CA 2DHIA 2ROVA 1DYNA 3TCAA 5HE3A 1WG7A 1B55A 3PZDA 3AJ4A 1LW3A 5JP4A 1MIXA 1P5TA 2RLOA 2COFA 3DXEA 1WI1A 3WYFB 1QQGA 5DH9B 5HE0A 1NI2A 2RGNB 4DXAB 2J0KA 1ZVRA 4NSWA 1U5GA 1X11A 1H4RA 4WSFA 2COCA 5EFXA 4HAXB 1FGZA 4KAXB 3A8PA 3OANA 1P6SA 4WVFB 1FOEA 1I2HA 4CYEA 4P7IA 2W2WA 4A6HA 3CXBB 4HB0B 4A6KA 2DKPA 1PFJA 3HK0A 4K2PA 2MWNB 4WJ7A 2QKMA 4GXBA 5DHAB 2I5FA 1W1HA 4YONA 2Y8FA 2J0MA 3MDBC 2YS5A 4KVGB 1V5MA 4GMXB 2KCJA 2PZ1A 4Z2MB 1V5UA 4MK0A 3PP2A 1SGHA 1UNQA 2DKQA 3PVUA 4MY6A 4NY0A 5D3YA 1X1FA 2Z0OA 4BBKA 4GMVA 2DYQA 2BCJA 5C79A 2RUKB 2P0DA 1XKEA 2UZSA 2H7DA 5D3XA 1Y5OA 1FHWA 1KZGA 3KRWA 3O96A 4HDQA 1OY2A 2ELAA 1GG3A 4EKUA 3ODOA 3SYXA 1TJ6A 4HDOA 4YL8A 3PSCA 5J3TA 1RRPB 2GCLA 2R0DA 1UPRA 2J0JA 1Y19B 3HQCA 5DHFB 2CRFA 1SHCA 1IRSA 5GOWB 4A5KA 1KI1B 4B6HA 1J19A 1WGUA 2YSZA 1ZC3B 1TQZA 3ZVRA 2NZ8B 5C5BB 2K2JA 5LONB 2LYDA 3P7ZA 2I1KA 2W2XC 1X86A 2K2UA 4KHBB 1M7RA 2Z0QA 2P0FA 2COAA 3KSYA 4HATB 3IVFA 2VRWB 1X05A 1X1GA 1H10A 3PVLA 3UZTA 2LKOA 3FSSA 2D9ZA 3TVVA 5D3VA 3G9WA 3P6AA 3V5WA 2CODA 2EC1A 1DDMA 4IFSA 5J3YA 1UPQA 1FHOA 5DI9B 2ROZB 3FM8C 3PG7A 2EMTA 4KHAA 1XD4A 3QWMA 2K00A 1GC7A 1MAIA 2XQNM 1AQCA 1FAOA 4H8SA 2NMBA 3MPXA 1AWEA 5CLQB 3RCPA 4PQ0A 2RSGA 2GCJA 2IYBA 1K5GB 2X18A 3DXDA 2VSZA 3WA0A 3AU5A 4A6FB 3F0WA 4ZRIA 1U5EA 2OQBA 1BTKA 2L2IA 1ZC4B 5FI0A 4PNKA 3KZ1A 1V5PA 2D9YA 2EMSA 2YT1A 3T06A 2UVMA 2EJ8A 1ZSQA 4Y94A 2V76A 2MKRA 2DN6A 3U7DA 1NTVA 2UZRA 4F7UP 1WJMA 3AU4A 1DDWA 1EGXA 1OMWA 1FHXA 1E5WA 2Y8GA 4CHJA 1EAZA 4A6FA 2D11A 2YS3A 3NSUA 5FI1A 2DFKA 1XODA 2DHKA 1U29A 4TYZA 1PLSA 5HE2A 2RVBB 1MIZB 4HAWB 1DROA 4DX90 2CY5A 2ADZA 2M38A 1BWNA 1BAKA 5KQ1A 3D8DA 4HHVA 1DDVA 2AL6A 3F5RA 4L6EA 4F7GA 3GYOA 2N0YA 2D9XA 5D3WA 2Z0PA 4ZRKA 2YRYA 2HE7A 3A8QA 2CAYA 1RJ2A 1N3HA 4HAYB 2G35A 1V61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1I B;  2DTC A;  2DYN A;  4HB3 B;  4TKN A;  5C16 A;  2ZPY A;  2YT0 A;  2Q13 A;  3ML4 A;  4K17 A;  2LOX A;  3QBV B;  1MKE A;  5D27 A;  3ULC A;  3FEH A;  2I5C A;  1NTY A;  2Y7B A;  2LUL A;  3KY9 A;  2J59 M;  2QKL A;  4D0N B;  3DXC A;  4GPT B;  4GN1 A;  2P0H A;  3HW2 B;  4GZU A;  1I7A A;  4IOY X;  1GC6 A;  1U5F A;  4HAZ B;  1DBH A;  1M7E A;  2GS0 A;  3U8Z A;  1UNP A;  2JP2 A;  3QIJ A;  4HB2 B;  5DIF B;  5C5B A;  4K2O A;  4DX8 A;  2LOZ A;  1W1G A;  3SNH A;  3SV1 A;  2YS1 A;  3PEG A;  1J0W A;  2FJL A;  1XR0 B;  4HAV B;  3VIA A;  2MDX A;  4C0A A;  1BTN A;  5J3Q A;  1ZM0 A;  2CY4 A;  1EVH A;  3D8F A;  2VKI A;  4HAU B;  5JHG A;  1K5D B;  3TO1 A;  5L81 A;  2DLW A;  3PVW A;  2YF0 A;  4Z2N A;  1U27 A;  2D9V A;  3ZDT A;  2W2X D;  1NU2 A;  2P8V A;  1XCG A;  3A98 B;  5HE1 A;  3SO6 A;  2KUP A;  4IAP A;  2M14 A;  1MK7 B;  3BJI A;  4ZRJ A;  3LJU X;  1V89 A;  4K81 A;  1P3R A;  5KCV A;  3SUZ A;  4MT7 A;  4EJN A;  3D8E A;  1W1D A;  3ODX A;  3CIK A;  2KGX B;  4DBB A;  5C6R A;  1EF1 A;  2ELB A;  3ULB A;  5JLJ B;  1FGY A;  2GJY A;  1WJ1 A;  1U2B A;  1V88 A;  5LOP B;  2D9W A;  1WVH A;  2MFQ A;  2DX5 A;  3VOQ A;  2DHJ A;  3N7C A;  1FB8 A;  1TXD A;  1LB1 A;  4CHM A;  1KZ7 A;  3X23 A;  1WGQ A;  2IFS A;  3ODW A;  1UEF A;  3BIN A;  1ISN A;  3GYP A;  4XWX A;  2RNR B;  5KQ4 A;  2D2Q A;  3KRX A;  4F7H A;  4HB4 B;  2LG1 A;  2I1J A;  2N23 A;  1XX0 A;  5JHH A;  2DA0 A;  2AEH A;  1U5D A;  1UNR A;  2D10 A;  1MPH A;  3TW1 A;  4EMO A;  1OQN A;  3TFM A;  2YVC A;  2D4Q A;  2HTH B;  2H7E A;  1PMS A;  1QC6 A;  2OTX A;  2R09 A;  4KHO A;  1Q67 A;  1Z87 A;  2E2X A;  5CLL B;  1MK9 B;  2DX1 A;  2L1C A;  2DHI A;  2ROV A;  1DYN A;  3TCA A;  5HE3 A;  1WG7 A;  1B55 A;  3PZD A;  3AJ4 A;  1LW3 A;  5JP4 A;  1MIX A;  1P5T A;  2RLO A;  2COF A;  3DXE A;  1WI1 A;  3WYF B;  1QQG A;  5DH9 B;  5HE0 A;  1NI2 A;  2RGN B;  4DXA B;  2J0K A;  1ZVR A;  4NSW A;  1U5G A;  1X11 A;  1H4R A;  4WSF A;  2COC A;  5EFX A;  4HAX B;  1FGZ A;  4KAX B;  3A8P A;  3OAN A;  1P6S A;  4WVF B;  1FOE A;  1I2H A;  4CYE A;  4P7I A;  2W2W A;  4A6H A;  3CXB B;  4HB0 B;  4A6K A;  2DKP A;  1PFJ A;  3HK0 A;  4K2P A;  2MWN B;  4WJ7 A;  2QKM A;  4GXB A;  5DHA B;  2I5F A;  1W1H A;  4YON A;  2Y8F A;  2J0M A;  3MDB C;  2YS5 A;  4KVG B;  1V5M A;  4GMX B;  2KCJ A;  2PZ1 A;  4Z2M B;  1V5U A;  4MK0 A;  3PP2 A;  1SGH A;  1UNQ A;  2DKQ A;  3PVU A;  4MY6 A;  4NY0 A;  5D3Y A;  1X1F A;  2Z0O A;  4BBK A;  4GMV A;  2DYQ A;  2BCJ A;  5C79 A;  2RUK B;  2P0D A;  1XKE A;  2UZS A;  2H7D A;  5D3X A;  1Y5O A;  1FHW A;  1KZG A;  3KRW A;  3O96 A;  4HDQ A;  1OY2 A;  2ELA A;  1GG3 A;  4EKU A;  3ODO A;  3SYX A;  1TJ6 A;  4HDO A;  4YL8 A;  3PSC A;  5J3T A;  1RRP B;  2GCL A;  2R0D A;  1UPR A;  2J0J A;  1Y19 B;  3HQC A;  5DHF B;  2CRF A;  1SHC A;  1IRS A;  5GOW B;  4A5K A;  1KI1 B;  4B6H A;  1J19 A;  1WGU A;  2YSZ A;  1ZC3 B;  1TQZ A;  3ZVR A;  2NZ8 B;  5C5B B;  2K2J A;  5LON B;  2LYD A;  3P7Z A;  2I1K A;  2W2X C;  1X86 A;  2K2U A;  4KHB B;  1M7R A;  2Z0Q A;  2P0F A;  2COA A;  3KSY A;  4HAT B;  3IVF A;  2VRW B;  1X05 A;  1X1G A;  1H10 A;  3PVL A;  3UZT A;  2LKO A;  3FSS A;  2D9Z A;  3TVV A;  5D3V A;  3G9W A;  3P6A A;  3V5W A;  2COD A;  2EC1 A;  1DDM A;  4IFS A;  5J3Y A;  1UPQ A;  1FHO A;  5DI9 B;  2ROZ B;  3FM8 C;  3PG7 A;  2EMT A;  4KHA A;  1XD4 A;  3QWM A;  2K00 A;  1GC7 A;  1MAI A;  2XQN M;  1AQC A;  1FAO A;  4H8S A;  2NMB A;  3MPX A;  1AWE A;  5CLQ B;  3RCP A;  4PQ0 A;  2RSG A;  2GCJ A;  2IYB A;  1K5G B;  2X18 A;  3DXD A;  2VSZ A;  3WA0 A;  3AU5 A;  4A6F B;  3F0W A;  4ZRI A;  1U5E A;  2OQB A;  1BTK A;  2L2I A;  1ZC4 B;  5FI0 A;  4PNK A;  3KZ1 A;  1V5P A;  2D9Y A;  2EMS A;  2YT1 A;  3T06 A;  2UVM A;  2EJ8 A;  1ZSQ A;  4Y94 A;  2V76 A;  2MKR A;  2DN6 A;  3U7D A;  1NTV A;  2UZR A;  4F7U P;  1WJM A;  3AU4 A;  1DDW A;  1EGX A;  1OMW A;  1FHX A;  1E5W A;  2Y8G A;  4CHJ A;  1EAZ A;  4A6F A;  2D11 A;  2YS3 A;  3NSU A;  5FI1 A;  2DFK A;  1XOD A;  2DHK A;  1U29 A;  4TYZ A;  1PLS A;  5HE2 A;  2RVB B;  1MIZ B;  4HAW B;  1DRO A;  4DX9 0;  2CY5 A;  2ADZ A;  2M38 A;  1BWN A;  1BAK A;  5KQ1 A;  3D8D A;  4HHV A;  1DDV A;  2AL6 A;  3F5R A;  4L6E A;  4F7G A;  3GYO A;  2N0Y A;  2D9X A;  5D3W A;  2Z0P A;  4ZRK A;  2YRY A;  2HE7 A;  3A8Q A;  2CAY A;  1RJ2 A;  1N3H A;  4HAY B;  2G35 A;  1V61 A; 
#chains in the Genus database with same CATH topology
 3M1I B;  2DTC A;  2DYN A;  4HB3 B;  4TKN A;  5C16 A;  2ZPY A;  2YT0 A;  2Q13 A;  3ML4 A;  4K17 A;  2LOX A;  3QBV B;  1MKE A;  5D27 A;  3ULC A;  3FEH A;  2I5C A;  1NTY A;  2Y7B A;  2LUL A;  3KY9 A;  2J59 M;  2QKL A;  4D0N B;  3DXC A;  4GPT B;  4GN1 A;  2K8E A;  2P0H A;  3HW2 B;  4GZU A;  1I7A A;  4IOY X;  1GC6 A;  1U5F A;  4HAZ B;  1DBH A;  1M7E A;  2GS0 A;  3U8Z A;  1UNP A;  2JP2 A;  3QIJ A;  4HB2 B;  5DIF B;  5C5B A;  4K2O A;  3OHM B;  2LOZ A;  4DX8 A;  1W1G A;  3SNH A;  3SV1 A;  2YS1 A;  3PEG A;  1J0W A;  2FJL A;  3U12 A;  1XR0 B;  4HAV B;  4QXA B;  3VIA A;  2MDX A;  4C0A A;  1BTN A;  5J3Q A;  1ZM0 A;  2CY4 A;  4KHB A;  1EVH A;  3D8F A;  2VKI A;  4HAU B;  5JHG A;  1K5D B;  3DCX A;  3TO1 A;  5L81 A;  2DLW A;  3PVW A;  2YF0 A;  4Z2N A;  1U27 A;  2KUQ A;  2D9V A;  3ZDT A;  3HSA A;  2W2X D;  1NU2 A;  2P8V A;  1XCG A;  3A98 B;  5HE1 A;  3SO6 A;  2KUP A;  4IAP A;  2M14 A;  1MK7 B;  3BJI A;  4ZRJ A;  3LJU X;  1V89 A;  4K81 A;  1P3R A;  5KCV A;  3SUZ A;  4MT7 A;  4EJN A;  3D8E A;  1W1D A;  1MI1 A;  3NWD A;  3ODX A;  3CIK A;  2KGX B;  4DBB A;  5C6R A;  1EF1 A;  2ELB A;  2Z59 A;  3ULB A;  5JLJ B;  1FGY A;  2GJY A;  1WJ1 A;  1U2B A;  1V88 A;  5LOP B;  2D9W A;  1WVH A;  2MFQ A;  2DX5 A;  3VOQ A;  2DHJ A;  3N7C A;  1FB8 A;  1TXD A;  1LB1 A;  4CHM A;  5I2M A;  5LG4 B;  3A58 A;  1KZ7 A;  3X23 A;  1WGQ A;  2IFS A;  2Z4D A;  3ODW A;  1UEF A;  3BIN A;  1ISN A;  3GYP A;  4XWX A;  2YT2 A;  2RNR B;  5KQ4 A;  2D2Q A;  3KRX A;  4F7H A;  4HB4 B;  2LG1 A;  2I1J A;  2N23 A;  1XX0 A;  5JHH A;  2ZKM X;  2DA0 A;  2AEH A;  1U5D A;  1UNR A;  2D10 A;  1MPH A;  3TW1 A;  4EMO A;  1OQN A;  3NWF A;  4OT1 A;  3TFM A;  2YVC A;  2D4Q A;  2HTH B;  2H7E A;  1PMS A;  1QC6 A;  2OTX A;  2R09 A;  4KHO A;  1Q67 A;  1Z87 A;  2E2X A;  5CLL B;  1MK9 B;  2DX1 A;  2L1C A;  2FJU B;  2DHI A;  2ROV A;  1DYN A;  3TCA A;  5HE3 A;  1WG7 A;  1B55 A;  3PZD A;  3AJ4 A;  1LW3 A;  5JP4 A;  1MIX A;  1P5T A;  2RLO A;  2COF A;  3DXE A;  1WI1 A;  4D6W A;  3WYF B;  1QQG A;  5DH9 B;  5HE0 A;  1NI2 A;  2RGN B;  4DXA B;  4GOU A;  2J0K A;  1ZVR A;  4NSW A;  1U5G A;  1X11 A;  1H4R A;  4WSF A;  2COC A;  5EFX A;  4HAX B;  1FGZ A;  4KAX B;  3A8P A;  3OAN A;  1P6S A;  4WVF B;  4DIX A;  1FOE A;  1I2H A;  4CYE A;  4P7I A;  2W2W A;  4A6H A;  3CXB B;  4HB0 B;  4A6K A;  2DKP A;  1PFJ A;  3HK0 A;  4K2P A;  2MWN B;  4WJ7 A;  2QKM A;  4GXB A;  5DHA B;  2I5F A;  1W1H A;  4YON A;  2Y8F A;  2J0M A;  3MDB C;  2YS5 A;  4KVG B;  2KIE A;  2Z14 A;  4QJ3 B;  1V5M A;  4QJ4 B;  4GMX B;  2KCJ A;  2PZ1 A;  4Z2M B;  1V5U A;  4MK0 A;  3PP2 A;  1SGH A;  1UNQ A;  2DKQ A;  3PVU A;  4MY6 A;  4NY0 A;  5D3Y A;  1X1F A;  2Z0O A;  4BBK A;  4GMV A;  2DYQ A;  2BCJ A;  1ZYI A;  5C79 A;  2RUK B;  2P0D A;  1XKE A;  2UZS A;  2H7D A;  5D3X A;  1Y5O A;  1FHW A;  1KZG A;  3NWA A;  4GNK B;  3KRW A;  3O96 A;  4HDQ A;  1OY2 A;  2ELA A;  1GG3 A;  4EKU A;  3ODO A;  3SYX A;  3B77 A;  1TJ6 A;  4HDO A;  3NW8 A;  4QJ5 B;  4YL8 A;  3PSC A;  5J3T A;  2Z13 A;  1RRP B;  2GCL A;  2R0D A;  1UPR A;  2J0J A;  1Y19 B;  3HQC A;  5I2S A;  5DHF B;  2CRF A;  1SHC A;  1IRS A;  5GOW B;  4A5K A;  1KI1 B;  4B6H A;  5IRS A;  1J19 A;  1WGU A;  2YSZ A;  1ZC3 B;  1TQZ A;  3ZVR A;  2NZ8 B;  5C5B B;  2K2J A;  5LON B;  2LYD A;  3P7Z A;  5M4Y B;  2I1K A;  3FVC A;  2W2X C;  1X86 A;  2K2U A;  4KHB B;  1M7R A;  2Z0Q A;  2P0F A;  2COA A;  3KSY A;  4HAT B;  3IVF A;  2VRW B;  1X05 A;  1X1G A;  1H10 A;  3PVL A;  4L1R A;  3UZT A;  2LKO A;  3FSS A;  1T77 A;  2D9Z A;  3TVV A;  5D3V A;  3G9W A;  3P6A A;  3V5W A;  2COD A;  2EC1 A;  1DDM A;  4IFS A;  2NBV A;  5J3Y A;  1UPQ A;  4CSQ A;  1FHO A;  5DI9 B;  2ROZ B;  3FM8 C;  3PG7 A;  2EMT A;  4KHA A;  2KIG A;  1XD4 A;  3QWM A;  2K00 A;  1GC7 A;  2KR0 A;  1MAI A;  2XQN M;  1AQC A;  1FAO A;  4H8S A;  2NMB A;  3MPX A;  1AWE A;  5CLQ B;  3RCP A;  4PQ0 A;  2RSG A;  2GCJ A;  2IYB A;  1K5G B;  2X18 A;  3DXD A;  2VSZ A;  3WA0 A;  3AU5 A;  4A6F B;  3F0W A;  4ZRI A;  1U5E A;  2OQB A;  1BTK A;  3HIE A;  2L2I A;  1ZC4 B;  2R2Y A;  5FI0 A;  4PNK A;  3KZ1 A;  1V5P A;  2D9Y A;  2EMS A;  2YT1 A;  3T06 A;  2UVM A;  2EJ8 A;  1ZSQ A;  4Y94 A;  2V76 A;  4HSI A;  2MKR A;  2DN6 A;  3U7D A;  1NTV A;  2UZR A;  4F7U P;  1WJM A;  3AU4 A;  1DDW A;  1EGX A;  1OMW A;  1FHX A;  1E5W A;  2Y8G A;  4CHJ A;  1EAZ A;  4A6F A;  2D11 A;  2YS3 A;  3NSU A;  5FI1 A;  2DFK A;  1XOD A;  2DHK A;  2RRF A;  1U29 A;  4TYZ A;  1PLS A;  5HE2 A;  2RVB B;  1MIZ B;  4HAW B;  1DRO A;  4DX9 0;  2CY5 A;  2GUM A;  2ADZ A;  2M38 A;  1BWN A;  1BAK A;  4OSN A;  2K49 A;  5KQ1 A;  3D8D A;  4HHV A;  1DDV A;  2AL6 A;  3F5R A;  4L6E A;  4F7G A;  3GYO A;  2N0Y A;  2D9X A;  5D3W A;  2Z0P A;  4ZRK A;  2YRY A;  2HE7 A;  3A8Q A;  2CAY A;  1RJ2 A;  1N3H A;  4HAY B;  2G35 A;  1V61 A; 
#chains in the Genus database with same CATH homology
 3M1I B;  2DTC A;  2DYN A;  4HB3 B;  4TKN A;  5C16 A;  2ZPY A;  2YT0 A;  2Q13 A;  3ML4 A;  4K17 A;  2LOX A;  3QBV B;  1MKE A;  5D27 A;  3ULC A;  3FEH A;  2I5C A;  1NTY A;  2Y7B A;  2LUL A;  3KY9 A;  2J59 M;  2QKL A;  4D0N B;  3DXC A;  4GPT B;  4GN1 A;  2P0H A;  3HW2 B;  4GZU A;  1I7A A;  4IOY X;  1GC6 A;  1U5F A;  4HAZ B;  1DBH A;  1M7E A;  2GS0 A;  3U8Z A;  1UNP A;  2JP2 A;  3QIJ A;  4HB2 B;  5DIF B;  5C5B A;  4K2O A;  4DX8 A;  2LOZ A;  1W1G A;  3SNH A;  3SV1 A;  2YS1 A;  3PEG A;  1J0W A;  2FJL A;  1XR0 B;  4HAV B;  3VIA A;  2MDX A;  4C0A A;  1BTN A;  5J3Q A;  1ZM0 A;  2CY4 A;  1EVH A;  3D8F A;  2VKI A;  4HAU B;  5JHG A;  1K5D B;  3TO1 A;  5L81 A;  2DLW A;  3PVW A;  2YF0 A;  4Z2N A;  1U27 A;  2D9V A;  3ZDT A;  2W2X D;  1NU2 A;  2P8V A;  1XCG A;  3A98 B;  5HE1 A;  3SO6 A;  2KUP A;  4IAP A;  2M14 A;  1MK7 B;  3BJI A;  4ZRJ A;  3LJU X;  1V89 A;  4K81 A;  1P3R A;  5KCV A;  3SUZ A;  4MT7 A;  4EJN A;  3D8E A;  1W1D A;  3ODX A;  3CIK A;  2KGX B;  4DBB A;  5C6R A;  1EF1 A;  2ELB A;  3ULB A;  5JLJ B;  1FGY A;  2GJY A;  1WJ1 A;  1U2B A;  1V88 A;  5LOP B;  2D9W A;  1WVH A;  2MFQ A;  2DX5 A;  3VOQ A;  2DHJ A;  3N7C A;  1FB8 A;  1TXD A;  1LB1 A;  4CHM A;  1KZ7 A;  3X23 A;  1WGQ A;  2IFS A;  3ODW A;  1UEF A;  3BIN A;  1ISN A;  3GYP A;  4XWX A;  2RNR B;  5KQ4 A;  2D2Q A;  3KRX A;  4F7H A;  4HB4 B;  2LG1 A;  2I1J A;  2N23 A;  1XX0 A;  5JHH A;  2DA0 A;  2AEH A;  1U5D A;  1UNR A;  2D10 A;  1MPH A;  3TW1 A;  4EMO A;  1OQN A;  3TFM A;  2YVC A;  2D4Q A;  2HTH B;  2H7E A;  1PMS A;  1QC6 A;  2OTX A;  2R09 A;  4KHO A;  1Q67 A;  1Z87 A;  2E2X A;  5CLL B;  1MK9 B;  2DX1 A;  2L1C A;  2DHI A;  2ROV A;  1DYN A;  3TCA A;  5HE3 A;  1WG7 A;  1B55 A;  3PZD A;  3AJ4 A;  1LW3 A;  5JP4 A;  1MIX A;  1P5T A;  2RLO A;  2COF A;  3DXE A;  1WI1 A;  3WYF B;  1QQG A;  5DH9 B;  5HE0 A;  1NI2 A;  2RGN B;  4DXA B;  2J0K A;  1ZVR A;  4NSW A;  1U5G A;  1X11 A;  1H4R A;  4WSF A;  2COC A;  5EFX A;  4HAX B;  1FGZ A;  4KAX B;  3A8P A;  3OAN A;  1P6S A;  4WVF B;  1FOE A;  1I2H A;  4CYE A;  4P7I A;  2W2W A;  4A6H A;  3CXB B;  4HB0 B;  4A6K A;  2DKP A;  1PFJ A;  3HK0 A;  4K2P A;  2MWN B;  4WJ7 A;  2QKM A;  4GXB A;  5DHA B;  2I5F A;  1W1H A;  4YON A;  2Y8F A;  2J0M A;  3MDB C;  2YS5 A;  4KVG B;  1V5M A;  4GMX B;  2KCJ A;  2PZ1 A;  4Z2M B;  1V5U A;  4MK0 A;  3PP2 A;  1SGH A;  1UNQ A;  2DKQ A;  3PVU A;  4MY6 A;  4NY0 A;  5D3Y A;  1X1F A;  2Z0O A;  4BBK A;  4GMV A;  2DYQ A;  2BCJ A;  5C79 A;  2RUK B;  2P0D A;  1XKE A;  2UZS A;  2H7D A;  5D3X A;  1Y5O A;  1FHW A;  1KZG A;  3KRW A;  3O96 A;  4HDQ A;  1OY2 A;  2ELA A;  1GG3 A;  4EKU A;  3ODO A;  3SYX A;  1TJ6 A;  4HDO A;  4YL8 A;  3PSC A;  5J3T A;  1RRP B;  2GCL A;  2R0D A;  1UPR A;  2J0J A;  1Y19 B;  3HQC A;  5DHF B;  2CRF A;  1SHC A;  1IRS A;  5GOW B;  4A5K A;  1KI1 B;  4B6H A;  1J19 A;  1WGU A;  2YSZ A;  1ZC3 B;  1TQZ A;  3ZVR A;  2NZ8 B;  5C5B B;  2K2J A;  5LON B;  2LYD A;  3P7Z A;  2I1K A;  2W2X C;  1X86 A;  2K2U A;  4KHB B;  1M7R A;  2Z0Q A;  2P0F A;  2COA A;  3KSY A;  4HAT B;  3IVF A;  2VRW B;  1X05 A;  1X1G A;  1H10 A;  3PVL A;  3UZT A;  2LKO A;  3FSS A;  2D9Z A;  3TVV A;  5D3V A;  3G9W A;  3P6A A;  3V5W A;  2COD A;  2EC1 A;  1DDM A;  4IFS A;  5J3Y A;  1UPQ A;  1FHO A;  5DI9 B;  2ROZ B;  3FM8 C;  3PG7 A;  2EMT A;  4KHA A;  1XD4 A;  3QWM A;  2K00 A;  1GC7 A;  1MAI A;  2XQN M;  1AQC A;  1FAO A;  4H8S A;  2NMB A;  3MPX A;  1AWE A;  5CLQ B;  3RCP A;  4PQ0 A;  2RSG A;  2GCJ A;  2IYB A;  1K5G B;  2X18 A;  3DXD A;  2VSZ A;  3WA0 A;  3AU5 A;  4A6F B;  3F0W A;  4ZRI A;  1U5E A;  2OQB A;  1BTK A;  2L2I A;  1ZC4 B;  5FI0 A;  4PNK A;  3KZ1 A;  1V5P A;  2D9Y A;  2EMS A;  2YT1 A;  3T06 A;  2UVM A;  2EJ8 A;  1ZSQ A;  4Y94 A;  2V76 A;  2MKR A;  2DN6 A;  3U7D A;  1NTV A;  2UZR A;  4F7U P;  1WJM A;  3AU4 A;  1DDW A;  1EGX A;  1OMW A;  1FHX A;  1E5W A;  2Y8G A;  4CHJ A;  1EAZ A;  4A6F A;  2D11 A;  2YS3 A;  3NSU A;  5FI1 A;  2DFK A;  1XOD A;  2DHK A;  1U29 A;  4TYZ A;  1PLS A;  5HE2 A;  2RVB B;  1MIZ B;  4HAW B;  1DRO A;  4DX9 0;  2CY5 A;  2ADZ A;  2M38 A;  1BWN A;  1BAK A;  5KQ1 A;  3D8D A;  4HHV A;  1DDV A;  2AL6 A;  3F5R A;  4L6E A;  4F7G A;  3GYO A;  2N0Y A;  2D9X A;  5D3W A;  2Z0P A;  4ZRK A;  2YRY A;  2HE7 A;  3A8Q A;  2CAY A;  1RJ2 A;  1N3H A;  4HAY B;  2G35 A;  1V61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...