3D8DA

Crystal structure of the human fe65-ptb1 domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
139
Chain Sequence
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
total genus 31
structure length 139
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8dA00
2CODA 2X18A 3CIKA 4WSFA 2VKIA 4HAZB 3D8EA 1MAIA 4HHVA 2DX1A 1XKEA 1M7EA 4EJNA 3A8QA 2VRWB 1WGQA 3TW1A 2UVMA 5DI9B 4GXBA 2W2XC 2IYBA 2W2WA 2K2JA 1ZC3B 3A8PA 2MKRA 4NSWA 4ZRJA 1WI1A 3GYPA 3DXDA 1WGUA 1TXDA 2D2QA 4CYEA 2J0MA 2Z0PA 5LOPB 4HAXB 1V89A 4GN1A 5C6RA 5KQ1A 2I1KA 2YRYA 4PQ0A 3FSSA 3NSUA 4NY0A 2D9XA 2E2XA 3PVLA 2ELAA 4WJ7A 2QKLA 1FGYA 4HB0B 2VSZA 3KY9A 3QIJA 1U29A 5J3QA 2CRFA 1FOEA 3RCPA 2YS5A 5D3YA 4GMXB 2YS1A 2D9YA 4A6HA 5KCVA 1ZC4B 2P0FA 3PP2A 1U27A 3M1IB 5D27A 2ROZB 3AU5A 3QWMA 4KVGB 2I1JA 1SGHA 1NU2A 1H10A 2JP2A 3ML4A 2RSGA 3KRXA 3U8ZA 3TFMA 2YVCA 4ZRKA 3OANA 2EMSA 5HE2A 4H8SA 2Y7BA 1XCGA 1DYNA 2ZPYA 1KZGA 1ISNA 4HAUB 2LYDA 5HE0A 5HE3A 2OQBA 1DDWA 1P6SA 2I5CA 3LJUX 1U5FA 4A6FA 2Z0OA 3HQCA 3V5WA 2P0DA 5DIFB 1XD4A 1BTNA 1BTKA 4C0AA 3HK0A 1AQCA 5FI0A 1ZM0A 3ULCA 4B6HA 1MK7B 4K17A 2MFQA 1NTVA 2N0YA 2ROVA 3F5RA 1I2HA 1Z87A 5J3YA 2AEHA 3SO6A 3PSCA 4DX90 3KZ1A 2PZ1A 4F7GA 2N23A 2D11A 1X1FA 3QBVB 4YONA 2D9VA 1X11A 5DHFB 1UNQA 4MK0A 2DN6A 1EGXA 5JLJB 3ZDTA 2K2UA 5JHHA 1QQGA 1LW3A 3WA0A 2RUKB 1J0WA 1U2BA 4HB2B 1X05A 1NTYA 1QC6A 1MIZB 3UZTA 3PVWA 2R0DA 4TKNA 2D4QA 3VIAA 2YS3A 3IVFA 1OQNA 2DHIA 2CAYA 1V61A 2J0JA 3HW2B 2Y8FA 2DX5A 1MPHA 2P8VA 1SHCA 5KQ4A 1IRSA 5C16A 4GMVA 5L81A 3DXEA 4CHJA 4F7UP 3VOQA 4DXAB 3T06A 4HAYB 2LULA 1K5DB 2EC1A 4P7IA 1AWEA 3G9WA 2D10A 1DBHA 1LB1A 1XR0B 1WJMA 3SUZA 1GC7A 1M7RA 4HB4B 4HDQA 5FI1A 2BCJA 2W2XD 5JHGA 1DDVA 2COAA 2RNRB 2XQNM 1WG7A 3SNHA 4IOYX 3BINA 3A98B 1UPQA 2H7EA 3SYXA 4Y94A 2DKPA 1WJ1A 3D8FA 1I7AA 2H7DA 3U7DA 2M38A 5D3WA 1P5TA 4D0NB 1P3RA 4KHAA 4A5KA 2GCJA 1OMWA 1W1DA 4ZRIA 5C5BA 1Y5OA 1MIXA 2DLWA 2HTHB 4IFSA 1U5EA 2KCJA 2DHKA 2UZRA 4WVFB 2DKQA 2LOZA 1V5UA 3ODOA 5DHAB 1ZVRA 1PMSA 2L1CA 2RLOA 3PZDA 3KSYA 5CLLB 2RGNB 4XWXA 5D3XA 1V88A 3BJIA 3TO1A 1WVHA 2P0HA 1KZ7A 2DYNA 1X1GA 3FEHA 2EMTA 2KGXB 4PNKA 3PVUA 3X23A 4GZUA 4HAWB 2GS0A 3SV1A 5C79A 3CXBB 1PLSA 1FAOA 4K81A 1FHOA 2DTCA 3D8DA 4Z2MB 1U5DA 2YF0A 1X86A 1FGZA 1EAZA 5LONB 2DYQA 1FB8A 5GOWB 4F7HA 2AL6A 1DROA 1B55A 2YT1A 1UEFA 3P7ZA 1GC6A 1W1GA 4TYZA 4KHBB 3GYOA 3MDBC 2Y8GA 4EKUA 5CLQB 2G35A 3ODWA 4GPTB 4HAVB 2IFSA 4BBKA 1U5GA 2GJYA 4Z2NA 1NI2A 2YT0A 2I5FA 3WYFB 4DX8A 2CY5A 2GCLA 2CY4A 3ODXA 2M14A 2COCA 1Y19B 4KHOA 1EF1A 1FHXA 5D3VA 5DH9B 4K2OA 1E5WA 2NZ8B 1PFJA 3AJ4A 1UNRA 1W1HA 5HE1A 2Z0QA 2HE7A 4K2PA 4MT7A 3PEGA 2NMBA 4KAXB 1OY2A 1K5GB 1KI1B 1BWNA 1UNPA 1TJ6A 3TCAA 2ADZA 1DDMA 1Q67A 5J3TA 4L6EA 3ULBA 1RJ2A 2UZSA 5C5BB 4CHMA 1J19A 2KUPA 3N7CA 1GG3A 3FM8C 2DFKA 3F0WA 4EMOA 2K00A 3DXCA 2YSZA 1ZSQA 1MKEA 3AU4A 1BAKA 1FHWA 3O96A 1EVHA 1XODA 2OTXA 2EJ8A 3ZVRA 1N3HA 2FJLA 2ELBA 2D9ZA 3MPXA 5JP4A 2DHJA 3TVVA 2D9WA 2RVBB 4HATB 1RRPB 1V5PA 4A6FB 2QKMA 1TQZA 2J59M 2LKOA 2Q13A 4YL8A 2COFA 3P6AA 2R09A 2LG1A 3PG7A 1V5MA 3KRWA 4DBBA 4A6KA 1H4RA 1XX0A 5EFXA 2DA0A 2MDXA 2MWNB 4HDOA 2LOXA 1MK9B 1UPRA 4IAPA 2J0KA 4HB3B 2V76A 4MY6A 2L2IA
chains in the Genus database with same CATH superfamily
2CODA 2X18A 3CIKA 4WSFA 2VKIA 3U12A 4HAZB 3D8EA 4QJ4B 1MAIA 4HHVA 2DX1A 1XKEA 1M7EA 4EJNA 3A8QA 2VRWB 1WGQA 3TW1A 2UVMA 5DI9B 4GXBA 2W2XC 2IYBA 2W2WA 2K2JA 1ZC3B 3A8PA 2MKRA 4NSWA 4ZRJA 1WI1A 3GYPA 3DXDA 1WGUA 2GUMA 1TXDA 2D2QA 4CYEA 2J0MA 2Z0PA 3FVCA 4CSQA 5LOPB 4HAXB 1V89A 4GN1A 5C6RA 5KQ1A 2I1KA 2YRYA 4PQ0A 3FSSA 3NSUA 4NY0A 2D9XA 2E2XA 3DCXA 3PVLA 2ELAA 4DIXA 4OSNA 4WJ7A 2QKLA 4OT1A 1FGYA 4HB0B 2VSZA 3KY9A 3QIJA 1U29A 5J3QA 1MI1A 2CRFA 1FOEA 3RCPA 2YS5A 5D3YA 4GMXB 2YS1A 2D9YA 4A6HA 4GOUA 5KCVA 1ZC4B 2P0FA 3PP2A 1U27A 3M1IB 5D27A 2ROZB 3AU5A 3QWMA 4KVGB 2I1JA 1SGHA 1NU2A 1H10A 2JP2A 3ML4A 2RSGA 3KRXA 3U8ZA 3TFMA 2YVCA 4ZRKA 3OANA 2EMSA 5HE2A 5LG4B 4H8SA 2Y7BA 5I2MA 1XCGA 1DYNA 2ZPYA 1KZGA 1ISNA 4HAUB 2LYDA 3HSAA 5HE0A 5HE3A 2OQBA 1DDWA 1P6SA 4QJ3B 4QJ5B 2I5CA 3LJUX 1U5FA 4D6WA 4A6FA 2Z0OA 3HQCA 3V5WA 3NW8A 2P0DA 5DIFB 1XD4A 1BTNA 1BTKA 4C0AA 3HK0A 1AQCA 5FI0A 1ZM0A 3ULCA 4B6HA 1MK7B 4K17A 2NBVA 2MFQA 1NTVA 2N0YA 2ROVA 3F5RA 1I2HA 1Z87A 5J3YA 2AEHA 2Z59A 3HIEA 3SO6A 3PSCA 4DX90 3KZ1A 2PZ1A 4F7GA 2N23A 2D11A 1X1FA 3QBVB 4YONA 2D9VA 1X11A 2Z13A 5DHFB 1UNQA 4MK0A 2DN6A 1EGXA 5JLJB 3ZDTA 4GNKB 2K2UA 5JHHA 1QQGA 1LW3A 3WA0A 2RUKB 1J0WA 1U2BA 4HB2B 1X05A 1NTYA 1QC6A 1MIZB 3UZTA 3PVWA 2R0DA 4TKNA 2D4QA 3VIAA 2YS3A 3B77A 3IVFA 2KR0A 1OQNA 2DHIA 2Z4DA 2CAYA 1V61A 2J0JA 3HW2B 2Y8FA 2DX5A 1MPHA 2P8VA 1SHCA 5KQ4A 1IRSA 5C16A 4GMVA 5L81A 3DXEA 4CHJA 4F7UP 3VOQA 4DXAB 4HSIA 3T06A 4HAYB 2LULA 1K5DB 2EC1A 4P7IA 3A58A 1AWEA 3G9WA 2D10A 1DBHA 1LB1A 1XR0B 1WJMA 3SUZA 1GC7A 1M7RA 4HB4B 4HDQA 5FI1A 2BCJA 2W2XD 5JHGA 1DDVA 2COAA 2RNRB 2XQNM 1WG7A 3SNHA 4IOYX 3BINA 3A98B 1UPQA 2H7EA 3SYXA 4Y94A 2DKPA 1WJ1A 4QXAB 3D8FA 1I7AA 2H7DA 3U7DA 2M38A 5D3WA 1P5TA 2KIEA 4D0NB 1P3RA 4KHAA 4A5KA 2GCJA 3NWAA 1OMWA 1W1DA 2FJUB 4ZRIA 5C5BA 1Y5OA 1MIXA 5I2SA 2DLWA 2HTHB 1U5EA 2KCJA 4IFSA 2DHKA 2UZRA 2ZKMX 2RRFA 4WVFB 4KHBA 2DKQA 2LOZA 1V5UA 3ODOA 5DHAB 1ZVRA 1PMSA 2L1CA 2RLOA 3PZDA 3KSYA 5CLLB 2RGNB 4XWXA 5D3XA 1V88A 2KUQA 3OHMB 3BJIA 3TO1A 1WVHA 2P0HA 1KZ7A 2DYNA 1X1GA 3FEHA 2EMTA 2KGXB 4PNKA 3PVUA 3X23A 4GZUA 4HAWB 2GS0A 3SV1A 5C79A 3CXBB 1PLSA 1FAOA 4K81A 1FHOA 2DTCA 3D8DA 4Z2MB 1U5DA 5IRSA 2YF0A 1X86A 1FGZA 1EAZA 5LONB 2DYQA 1FB8A 5GOWB 4F7HA 2AL6A 1DROA 1B55A 2YT1A 1UEFA 3P7ZA 1GC6A 1W1GA 4TYZA 4KHBB 3GYOA 3MDBC 2Y8GA 4EKUA 5CLQB 2G35A 3ODWA 4GPTB 4HAVB 2Z14A 2IFSA 1T77A 2YT2A 4BBKA 1U5GA 2GJYA 4Z2NA 1NI2A 2YT0A 2I5FA 3WYFB 4DX8A 2CY5A 2GCLA 2CY4A 3ODXA 2M14A 2COCA 1Y19B 4KHOA 1EF1A 1FHXA 5D3VA 5DH9B 4K2OA 1E5WA 2NZ8B 1PFJA 3AJ4A 1UNRA 1W1HA 5HE1A 2Z0QA 2HE7A 4K2PA 4MT7A 3PEGA 1ZYIA 2NMBA 4KAXB 1OY2A 1K5GB 1KI1B 2K8EA 1BWNA 1UNPA 1TJ6A 3NWFA 3TCAA 2ADZA 1DDMA 1Q67A 5J3TA 4L6EA 3ULBA 1RJ2A 2UZSA 5C5BB 4CHMA 1J19A 2KUPA 3N7CA 1GG3A 3FM8C 2DFKA 3F0WA 3NWDA 4EMOA 2K00A 3DXCA 2YSZA 1ZSQA 4L1RA 1MKEA 3AU4A 1BAKA 3O96A 1FHWA 1EVHA 1XODA 2OTXA 2EJ8A 3ZVRA 1N3HA 2FJLA 2ELBA 2D9ZA 3MPXA 5JP4A 2DHJA 3TVVA 2D9WA 2RVBB 4HATB 2K49A 1RRPB 1V5PA 4A6FB 2QKMA 1TQZA 2J59M 2LKOA 2Q13A 4YL8A 2COFA 5M4YB 3P6AA 2R09A 2LG1A 3PG7A 1V5MA 3KRWA 4DBBA 4A6KA 2KIGA 2R2YA 1H4RA 1XX0A 5EFXA 2DA0A 2MDXA 2MWNB 4HDOA 2LOXA 1MK9B 1UPRA 4IAPA 2J0KA 4HB3B 2V76A 4MY6A 2L2IA
chains in the Genus database with same CATH topology
2CODA 2X18A 3CIKA 4WSFA 2VKIA 4HAZB 3D8EA 1MAIA 4HHVA 2DX1A 1XKEA 1M7EA 4EJNA 3A8QA 2VRWB 1WGQA 3TW1A 2UVMA 5DI9B 4GXBA 2W2XC 2IYBA 2W2WA 2K2JA 1ZC3B 3A8PA 2MKRA 4NSWA 4ZRJA 1WI1A 3GYPA 3DXDA 1WGUA 1TXDA 2D2QA 4CYEA 2J0MA 2Z0PA 5LOPB 4HAXB 1V89A 4GN1A 5C6RA 5KQ1A 2I1KA 2YRYA 4PQ0A 3FSSA 3NSUA 4NY0A 2D9XA 2E2XA 3PVLA 2ELAA 4WJ7A 2QKLA 1FGYA 4HB0B 2VSZA 3KY9A 3QIJA 1U29A 5J3QA 2CRFA 1FOEA 3RCPA 2YS5A 5D3YA 4GMXB 2YS1A 2D9YA 4A6HA 5KCVA 1ZC4B 2P0FA 3PP2A 1U27A 3M1IB 5D27A 2ROZB 3AU5A 3QWMA 4KVGB 2I1JA 1SGHA 1NU2A 1H10A 2JP2A 3ML4A 2RSGA 3KRXA 3U8ZA 3TFMA 2YVCA 4ZRKA 3OANA 2EMSA 5HE2A 4H8SA 2Y7BA 1XCGA 1DYNA 2ZPYA 1KZGA 1ISNA 4HAUB 2LYDA 5HE0A 5HE3A 2OQBA 1DDWA 1P6SA 2I5CA 3LJUX 1U5FA 4A6FA 2Z0OA 3HQCA 3V5WA 2P0DA 5DIFB 1XD4A 1BTNA 1BTKA 4C0AA 3HK0A 1AQCA 5FI0A 1ZM0A 3ULCA 4B6HA 1MK7B 4K17A 2MFQA 1NTVA 2N0YA 2ROVA 3F5RA 1I2HA 1Z87A 5J3YA 2AEHA 3SO6A 3PSCA 4DX90 3KZ1A 2PZ1A 4F7GA 2N23A 2D11A 1X1FA 3QBVB 4YONA 2D9VA 1X11A 5DHFB 1UNQA 4MK0A 2DN6A 1EGXA 5JLJB 3ZDTA 2K2UA 5JHHA 1QQGA 1LW3A 3WA0A 2RUKB 1J0WA 1U2BA 4HB2B 1X05A 1NTYA 1QC6A 1MIZB 3UZTA 3PVWA 2R0DA 4TKNA 2D4QA 3VIAA 2YS3A 3IVFA 1OQNA 2DHIA 2CAYA 1V61A 2J0JA 3HW2B 2Y8FA 2DX5A 1MPHA 2P8VA 1SHCA 5KQ4A 1IRSA 5C16A 4GMVA 5L81A 3DXEA 4CHJA 4F7UP 3VOQA 4DXAB 3T06A 4HAYB 2LULA 1K5DB 2EC1A 4P7IA 1AWEA 3G9WA 2D10A 1DBHA 1LB1A 1XR0B 1WJMA 3SUZA 1GC7A 1M7RA 4HB4B 4HDQA 5FI1A 2BCJA 2W2XD 5JHGA 1DDVA 2COAA 2RNRB 2XQNM 1WG7A 3SNHA 4IOYX 3BINA 3A98B 1UPQA 2H7EA 3SYXA 4Y94A 2DKPA 1WJ1A 3D8FA 1I7AA 2H7DA 3U7DA 2M38A 5D3WA 1P5TA 4D0NB 1P3RA 4KHAA 4A5KA 2GCJA 1OMWA 1W1DA 4ZRIA 5C5BA 1Y5OA 1MIXA 2DLWA 2HTHB 4IFSA 1U5EA 2KCJA 2DHKA 2UZRA 4WVFB 2DKQA 2LOZA 1V5UA 3ODOA 5DHAB 1ZVRA 1PMSA 2L1CA 2RLOA 3PZDA 3KSYA 5CLLB 2RGNB 4XWXA 5D3XA 1V88A 3BJIA 3TO1A 1WVHA 2P0HA 1KZ7A 2DYNA 1X1GA 3FEHA 2EMTA 2KGXB 4PNKA 3PVUA 3X23A 4GZUA 4HAWB 2GS0A 3SV1A 5C79A 3CXBB 1PLSA 1FAOA 4K81A 1FHOA 2DTCA 3D8DA 4Z2MB 1U5DA 2YF0A 1X86A 1FGZA 1EAZA 5LONB 2DYQA 1FB8A 5GOWB 4F7HA 2AL6A 1DROA 1B55A 2YT1A 1UEFA 3P7ZA 1GC6A 1W1GA 4TYZA 4KHBB 3GYOA 3MDBC 2Y8GA 4EKUA 5CLQB 2G35A 3ODWA 4GPTB 4HAVB 2IFSA 4BBKA 1U5GA 2GJYA 4Z2NA 1NI2A 2YT0A 2I5FA 3WYFB 4DX8A 2CY5A 2GCLA 2CY4A 3ODXA 2M14A 2COCA 1Y19B 4KHOA 1EF1A 1FHXA 5D3VA 5DH9B 4K2OA 1E5WA 2NZ8B 1PFJA 3AJ4A 1UNRA 1W1HA 5HE1A 2Z0QA 2HE7A 4K2PA 4MT7A 3PEGA 2NMBA 4KAXB 1OY2A 1K5GB 1KI1B 1BWNA 1UNPA 1TJ6A 3TCAA 2ADZA 1DDMA 1Q67A 5J3TA 4L6EA 3ULBA 1RJ2A 2UZSA 5C5BB 4CHMA 1J19A 2KUPA 3N7CA 1GG3A 3FM8C 2DFKA 3F0WA 4EMOA 2K00A 3DXCA 2YSZA 1ZSQA 1MKEA 3AU4A 1BAKA 1FHWA 3O96A 1EVHA 1XODA 2OTXA 2EJ8A 3ZVRA 1N3HA 2FJLA 2ELBA 2D9ZA 3MPXA 5JP4A 2DHJA 3TVVA 2D9WA 2RVBB 4HATB 1RRPB 1V5PA 4A6FB 2QKMA 1TQZA 2J59M 2LKOA 2Q13A 4YL8A 2COFA 3P6AA 2R09A 2LG1A 3PG7A 1V5MA 3KRWA 4DBBA 4A6KA 1H4RA 1XX0A 5EFXA 2DA0A 2MDXA 2MWNB 4HDOA 2LOXA 1MK9B 1UPRA 4IAPA 2J0KA 4HB3B 2V76A 4MY6A 2L2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COD A;  2X18 A;  3CIK A;  4WSF A;  2VKI A;  4HAZ B;  3D8E A;  1MAI A;  4HHV A;  2DX1 A;  1XKE A;  1M7E A;  4EJN A;  3A8Q A;  2VRW B;  1WGQ A;  3TW1 A;  2UVM A;  5DI9 B;  4GXB A;  2W2X C;  2IYB A;  2W2W A;  2K2J A;  1ZC3 B;  3A8P A;  2MKR A;  4NSW A;  4ZRJ A;  1WI1 A;  3GYP A;  3DXD A;  1WGU A;  1TXD A;  2D2Q A;  4CYE A;  2J0M A;  2Z0P A;  5LOP B;  4HAX B;  1V89 A;  4GN1 A;  5C6R A;  5KQ1 A;  2I1K A;  2YRY A;  4PQ0 A;  3FSS A;  3NSU A;  4NY0 A;  2D9X A;  2E2X A;  3PVL A;  2ELA A;  4WJ7 A;  2QKL A;  1FGY A;  4HB0 B;  2VSZ A;  3KY9 A;  3QIJ A;  1U29 A;  5J3Q A;  2CRF A;  1FOE A;  3RCP A;  2YS5 A;  5D3Y A;  4GMX B;  2YS1 A;  2D9Y A;  4A6H A;  5KCV A;  1ZC4 B;  2P0F A;  3PP2 A;  1U27 A;  3M1I B;  5D27 A;  2ROZ B;  3AU5 A;  3QWM A;  4KVG B;  2I1J A;  1SGH A;  1NU2 A;  1H10 A;  2JP2 A;  3ML4 A;  2RSG A;  3KRX A;  3U8Z A;  3TFM A;  2YVC A;  4ZRK A;  3OAN A;  2EMS A;  5HE2 A;  4H8S A;  2Y7B A;  1XCG A;  1DYN A;  2ZPY A;  1KZG A;  1ISN A;  4HAU B;  2LYD A;  5HE0 A;  5HE3 A;  2OQB A;  1DDW A;  1P6S A;  2I5C A;  3LJU X;  1U5F A;  4A6F A;  2Z0O A;  3HQC A;  3V5W A;  2P0D A;  5DIF B;  1XD4 A;  1BTN A;  1BTK A;  4C0A A;  3HK0 A;  1AQC A;  5FI0 A;  1ZM0 A;  3ULC A;  4B6H A;  1MK7 B;  4K17 A;  2MFQ A;  1NTV A;  2N0Y A;  2ROV A;  3F5R A;  1I2H A;  1Z87 A;  5J3Y A;  2AEH A;  3SO6 A;  3PSC A;  4DX9 0;  3KZ1 A;  2PZ1 A;  4F7G A;  2N23 A;  2D11 A;  1X1F A;  3QBV B;  4YON A;  2D9V A;  1X11 A;  5DHF B;  1UNQ A;  4MK0 A;  2DN6 A;  1EGX A;  5JLJ B;  3ZDT A;  2K2U A;  5JHH A;  1QQG A;  1LW3 A;  3WA0 A;  2RUK B;  1J0W A;  1U2B A;  4HB2 B;  1X05 A;  1NTY A;  1QC6 A;  1MIZ B;  3UZT A;  3PVW A;  2R0D A;  4TKN A;  2D4Q A;  3VIA A;  2YS3 A;  3IVF A;  1OQN A;  2DHI A;  2CAY A;  1V61 A;  2J0J A;  3HW2 B;  2Y8F A;  2DX5 A;  1MPH A;  2P8V A;  1SHC A;  5KQ4 A;  1IRS A;  5C16 A;  4GMV A;  5L81 A;  3DXE A;  4CHJ A;  4F7U P;  3VOQ A;  4DXA B;  3T06 A;  4HAY B;  2LUL A;  1K5D B;  2EC1 A;  4P7I A;  1AWE A;  3G9W A;  2D10 A;  1DBH A;  1LB1 A;  1XR0 B;  1WJM A;  3SUZ A;  1GC7 A;  1M7R A;  4HB4 B;  4HDQ A;  5FI1 A;  2BCJ A;  2W2X D;  5JHG A;  1DDV A;  2COA A;  2RNR B;  2XQN M;  1WG7 A;  3SNH A;  4IOY X;  3BIN A;  3A98 B;  1UPQ A;  2H7E A;  3SYX A;  4Y94 A;  2DKP A;  1WJ1 A;  3D8F A;  1I7A A;  2H7D A;  3U7D A;  2M38 A;  5D3W A;  1P5T A;  4D0N B;  1P3R A;  4KHA A;  4A5K A;  2GCJ A;  1OMW A;  1W1D A;  4ZRI A;  5C5B A;  1Y5O A;  1MIX A;  2DLW A;  2HTH B;  4IFS A;  1U5E A;  2KCJ A;  2DHK A;  2UZR A;  4WVF B;  2DKQ A;  2LOZ A;  1V5U A;  3ODO A;  5DHA B;  1ZVR A;  1PMS A;  2L1C A;  2RLO A;  3PZD A;  3KSY A;  5CLL B;  2RGN B;  4XWX A;  5D3X A;  1V88 A;  3BJI A;  3TO1 A;  1WVH A;  2P0H A;  1KZ7 A;  2DYN A;  1X1G A;  3FEH A;  2EMT A;  2KGX B;  4PNK A;  3PVU A;  3X23 A;  4GZU A;  4HAW B;  2GS0 A;  3SV1 A;  5C79 A;  3CXB B;  1PLS A;  1FAO A;  4K81 A;  1FHO A;  2DTC A;  3D8D A;  4Z2M B;  1U5D A;  2YF0 A;  1X86 A;  1FGZ A;  1EAZ A;  5LON B;  2DYQ A;  1FB8 A;  5GOW B;  4F7H A;  2AL6 A;  1DRO A;  1B55 A;  2YT1 A;  1UEF A;  3P7Z A;  1GC6 A;  1W1G A;  4TYZ A;  4KHB B;  3GYO A;  3MDB C;  2Y8G A;  4EKU A;  5CLQ B;  2G35 A;  3ODW A;  4GPT B;  4HAV B;  2IFS A;  4BBK A;  1U5G A;  2GJY A;  4Z2N A;  1NI2 A;  2YT0 A;  2I5F A;  3WYF B;  4DX8 A;  2CY5 A;  2GCL A;  2CY4 A;  3ODX A;  2M14 A;  2COC A;  1Y19 B;  4KHO A;  1EF1 A;  1FHX A;  5D3V A;  5DH9 B;  4K2O A;  1E5W A;  2NZ8 B;  1PFJ A;  3AJ4 A;  1UNR A;  1W1H A;  5HE1 A;  2Z0Q A;  2HE7 A;  4K2P A;  4MT7 A;  3PEG A;  2NMB A;  4KAX B;  1OY2 A;  1K5G B;  1KI1 B;  1BWN A;  1UNP A;  1TJ6 A;  3TCA A;  2ADZ A;  1DDM A;  1Q67 A;  5J3T A;  4L6E A;  3ULB A;  1RJ2 A;  2UZS A;  5C5B B;  4CHM A;  1J19 A;  2KUP A;  3N7C A;  1GG3 A;  3FM8 C;  2DFK A;  3F0W A;  4EMO A;  2K00 A;  3DXC A;  2YSZ A;  1ZSQ A;  1MKE A;  3AU4 A;  1BAK A;  1FHW A;  3O96 A;  1EVH A;  1XOD A;  2OTX A;  2EJ8 A;  3ZVR A;  1N3H A;  2FJL A;  2ELB A;  2D9Z A;  3MPX A;  5JP4 A;  2DHJ A;  3TVV A;  2D9W A;  2RVB B;  4HAT B;  1RRP B;  1V5P A;  4A6F B;  2QKM A;  1TQZ A;  2J59 M;  2LKO A;  2Q13 A;  4YL8 A;  2COF A;  3P6A A;  2R09 A;  2LG1 A;  3PG7 A;  1V5M A;  3KRW A;  4DBB A;  4A6K A;  1H4R A;  1XX0 A;  5EFX A;  2DA0 A;  2MDX A;  2MWN B;  4HDO A;  2LOX A;  1MK9 B;  1UPR A;  4IAP A;  2J0K A;  4HB3 B;  2V76 A;  4MY6 A;  2L2I A; 
#chains in the Genus database with same CATH topology
 2COD A;  2X18 A;  3CIK A;  4WSF A;  2VKI A;  3U12 A;  4HAZ B;  3D8E A;  4QJ4 B;  1MAI A;  4HHV A;  2DX1 A;  1XKE A;  1M7E A;  4EJN A;  3A8Q A;  2VRW B;  1WGQ A;  3TW1 A;  2UVM A;  5DI9 B;  4GXB A;  2W2X C;  2IYB A;  2W2W A;  2K2J A;  1ZC3 B;  3A8P A;  2MKR A;  4NSW A;  4ZRJ A;  1WI1 A;  3GYP A;  3DXD A;  1WGU A;  2GUM A;  1TXD A;  2D2Q A;  4CYE A;  2J0M A;  2Z0P A;  3FVC A;  4CSQ A;  5LOP B;  4HAX B;  1V89 A;  4GN1 A;  5C6R A;  5KQ1 A;  2I1K A;  2YRY A;  4PQ0 A;  3FSS A;  3NSU A;  4NY0 A;  2D9X A;  2E2X A;  3DCX A;  3PVL A;  2ELA A;  4DIX A;  4OSN A;  4WJ7 A;  2QKL A;  4OT1 A;  1FGY A;  4HB0 B;  2VSZ A;  3KY9 A;  3QIJ A;  1U29 A;  5J3Q A;  1MI1 A;  2CRF A;  1FOE A;  3RCP A;  2YS5 A;  5D3Y A;  4GMX B;  2YS1 A;  2D9Y A;  4A6H A;  4GOU A;  5KCV A;  1ZC4 B;  2P0F A;  3PP2 A;  1U27 A;  3M1I B;  5D27 A;  2ROZ B;  3AU5 A;  3QWM A;  4KVG B;  2I1J A;  1SGH A;  1NU2 A;  1H10 A;  2JP2 A;  3ML4 A;  2RSG A;  3KRX A;  3U8Z A;  3TFM A;  2YVC A;  4ZRK A;  3OAN A;  2EMS A;  5HE2 A;  5LG4 B;  4H8S A;  2Y7B A;  5I2M A;  1XCG A;  1DYN A;  2ZPY A;  1KZG A;  1ISN A;  4HAU B;  2LYD A;  3HSA A;  5HE0 A;  5HE3 A;  2OQB A;  1DDW A;  1P6S A;  4QJ3 B;  4QJ5 B;  2I5C A;  3LJU X;  1U5F A;  4D6W A;  4A6F A;  2Z0O A;  3HQC A;  3V5W A;  3NW8 A;  2P0D A;  5DIF B;  1XD4 A;  1BTN A;  1BTK A;  4C0A A;  3HK0 A;  1AQC A;  5FI0 A;  1ZM0 A;  3ULC A;  4B6H A;  1MK7 B;  4K17 A;  2NBV A;  2MFQ A;  1NTV A;  2N0Y A;  2ROV A;  3F5R A;  1I2H A;  1Z87 A;  5J3Y A;  2AEH A;  2Z59 A;  3HIE A;  3SO6 A;  3PSC A;  4DX9 0;  3KZ1 A;  2PZ1 A;  4F7G A;  2N23 A;  2D11 A;  1X1F A;  3QBV B;  4YON A;  2D9V A;  1X11 A;  2Z13 A;  5DHF B;  1UNQ A;  4MK0 A;  2DN6 A;  1EGX A;  5JLJ B;  3ZDT A;  4GNK B;  2K2U A;  5JHH A;  1QQG A;  1LW3 A;  3WA0 A;  2RUK B;  1J0W A;  1U2B A;  4HB2 B;  1X05 A;  1NTY A;  1QC6 A;  1MIZ B;  3UZT A;  3PVW A;  2R0D A;  4TKN A;  2D4Q A;  3VIA A;  2YS3 A;  3B77 A;  3IVF A;  2KR0 A;  1OQN A;  2DHI A;  2Z4D A;  2CAY A;  1V61 A;  2J0J A;  3HW2 B;  2Y8F A;  2DX5 A;  1MPH A;  2P8V A;  1SHC A;  5KQ4 A;  1IRS A;  5C16 A;  4GMV A;  5L81 A;  3DXE A;  4CHJ A;  4F7U P;  3VOQ A;  4DXA B;  4HSI A;  3T06 A;  4HAY B;  2LUL A;  1K5D B;  2EC1 A;  4P7I A;  3A58 A;  1AWE A;  3G9W A;  2D10 A;  1DBH A;  1LB1 A;  1XR0 B;  1WJM A;  3SUZ A;  1GC7 A;  1M7R A;  4HB4 B;  4HDQ A;  5FI1 A;  2BCJ A;  2W2X D;  5JHG A;  1DDV A;  2COA A;  2RNR B;  2XQN M;  1WG7 A;  3SNH A;  4IOY X;  3BIN A;  3A98 B;  1UPQ A;  2H7E A;  3SYX A;  4Y94 A;  2DKP A;  1WJ1 A;  4QXA B;  3D8F A;  1I7A A;  2H7D A;  3U7D A;  2M38 A;  5D3W A;  1P5T A;  2KIE A;  4D0N B;  1P3R A;  4KHA A;  4A5K A;  2GCJ A;  3NWA A;  1OMW A;  1W1D A;  2FJU B;  4ZRI A;  5C5B A;  1Y5O A;  1MIX A;  5I2S A;  2DLW A;  2HTH B;  1U5E A;  2KCJ A;  4IFS A;  2DHK A;  2UZR A;  2ZKM X;  2RRF A;  4WVF B;  4KHB A;  2DKQ A;  2LOZ A;  1V5U A;  3ODO A;  5DHA B;  1ZVR A;  1PMS A;  2L1C A;  2RLO A;  3PZD A;  3KSY A;  5CLL B;  2RGN B;  4XWX A;  5D3X A;  1V88 A;  2KUQ A;  3OHM B;  3BJI A;  3TO1 A;  1WVH A;  2P0H A;  1KZ7 A;  2DYN A;  1X1G A;  3FEH A;  2EMT A;  2KGX B;  4PNK A;  3PVU A;  3X23 A;  4GZU A;  4HAW B;  2GS0 A;  3SV1 A;  5C79 A;  3CXB B;  1PLS A;  1FAO A;  4K81 A;  1FHO A;  2DTC A;  3D8D A;  4Z2M B;  1U5D A;  5IRS A;  2YF0 A;  1X86 A;  1FGZ A;  1EAZ A;  5LON B;  2DYQ A;  1FB8 A;  5GOW B;  4F7H A;  2AL6 A;  1DRO A;  1B55 A;  2YT1 A;  1UEF A;  3P7Z A;  1GC6 A;  1W1G A;  4TYZ A;  4KHB B;  3GYO A;  3MDB C;  2Y8G A;  4EKU A;  5CLQ B;  2G35 A;  3ODW A;  4GPT B;  4HAV B;  2Z14 A;  2IFS A;  1T77 A;  2YT2 A;  4BBK A;  1U5G A;  2GJY A;  4Z2N A;  1NI2 A;  2YT0 A;  2I5F A;  3WYF B;  4DX8 A;  2CY5 A;  2GCL A;  2CY4 A;  3ODX A;  2M14 A;  2COC A;  1Y19 B;  4KHO A;  1EF1 A;  1FHX A;  5D3V A;  5DH9 B;  4K2O A;  1E5W A;  2NZ8 B;  1PFJ A;  3AJ4 A;  1UNR A;  1W1H A;  5HE1 A;  2Z0Q A;  2HE7 A;  4K2P A;  4MT7 A;  3PEG A;  1ZYI A;  2NMB A;  4KAX B;  1OY2 A;  1K5G B;  1KI1 B;  2K8E A;  1BWN A;  1UNP A;  1TJ6 A;  3NWF A;  3TCA A;  2ADZ A;  1DDM A;  1Q67 A;  5J3T A;  4L6E A;  3ULB A;  1RJ2 A;  2UZS A;  5C5B B;  4CHM A;  1J19 A;  2KUP A;  3N7C A;  1GG3 A;  3FM8 C;  2DFK A;  3F0W A;  3NWD A;  4EMO A;  2K00 A;  3DXC A;  2YSZ A;  1ZSQ A;  4L1R A;  1MKE A;  3AU4 A;  1BAK A;  3O96 A;  1FHW A;  1EVH A;  1XOD A;  2OTX A;  2EJ8 A;  3ZVR A;  1N3H A;  2FJL A;  2ELB A;  2D9Z A;  3MPX A;  5JP4 A;  2DHJ A;  3TVV A;  2D9W A;  2RVB B;  4HAT B;  2K49 A;  1RRP B;  1V5P A;  4A6F B;  2QKM A;  1TQZ A;  2J59 M;  2LKO A;  2Q13 A;  4YL8 A;  2COF A;  5M4Y B;  3P6A A;  2R09 A;  2LG1 A;  3PG7 A;  1V5M A;  3KRW A;  4DBB A;  4A6K A;  2KIG A;  2R2Y A;  1H4R A;  1XX0 A;  5EFX A;  2DA0 A;  2MDX A;  2MWN B;  4HDO A;  2LOX A;  1MK9 B;  1UPR A;  4IAP A;  2J0K A;  4HB3 B;  2V76 A;  4MY6 A;  2L2I A; 
#chains in the Genus database with same CATH homology
 2COD A;  2X18 A;  3CIK A;  4WSF A;  2VKI A;  4HAZ B;  3D8E A;  1MAI A;  4HHV A;  2DX1 A;  1XKE A;  1M7E A;  4EJN A;  3A8Q A;  2VRW B;  1WGQ A;  3TW1 A;  2UVM A;  5DI9 B;  4GXB A;  2W2X C;  2IYB A;  2W2W A;  2K2J A;  1ZC3 B;  3A8P A;  2MKR A;  4NSW A;  4ZRJ A;  1WI1 A;  3GYP A;  3DXD A;  1WGU A;  1TXD A;  2D2Q A;  4CYE A;  2J0M A;  2Z0P A;  5LOP B;  4HAX B;  1V89 A;  4GN1 A;  5C6R A;  5KQ1 A;  2I1K A;  2YRY A;  4PQ0 A;  3FSS A;  3NSU A;  4NY0 A;  2D9X A;  2E2X A;  3PVL A;  2ELA A;  4WJ7 A;  2QKL A;  1FGY A;  4HB0 B;  2VSZ A;  3KY9 A;  3QIJ A;  1U29 A;  5J3Q A;  2CRF A;  1FOE A;  3RCP A;  2YS5 A;  5D3Y A;  4GMX B;  2YS1 A;  2D9Y A;  4A6H A;  5KCV A;  1ZC4 B;  2P0F A;  3PP2 A;  1U27 A;  3M1I B;  5D27 A;  2ROZ B;  3AU5 A;  3QWM A;  4KVG B;  2I1J A;  1SGH A;  1NU2 A;  1H10 A;  2JP2 A;  3ML4 A;  2RSG A;  3KRX A;  3U8Z A;  3TFM A;  2YVC A;  4ZRK A;  3OAN A;  2EMS A;  5HE2 A;  4H8S A;  2Y7B A;  1XCG A;  1DYN A;  2ZPY A;  1KZG A;  1ISN A;  4HAU B;  2LYD A;  5HE0 A;  5HE3 A;  2OQB A;  1DDW A;  1P6S A;  2I5C A;  3LJU X;  1U5F A;  4A6F A;  2Z0O A;  3HQC A;  3V5W A;  2P0D A;  5DIF B;  1XD4 A;  1BTN A;  1BTK A;  4C0A A;  3HK0 A;  1AQC A;  5FI0 A;  1ZM0 A;  3ULC A;  4B6H A;  1MK7 B;  4K17 A;  2MFQ A;  1NTV A;  2N0Y A;  2ROV A;  3F5R A;  1I2H A;  1Z87 A;  5J3Y A;  2AEH A;  3SO6 A;  3PSC A;  4DX9 0;  3KZ1 A;  2PZ1 A;  4F7G A;  2N23 A;  2D11 A;  1X1F A;  3QBV B;  4YON A;  2D9V A;  1X11 A;  5DHF B;  1UNQ A;  4MK0 A;  2DN6 A;  1EGX A;  5JLJ B;  3ZDT A;  2K2U A;  5JHH A;  1QQG A;  1LW3 A;  3WA0 A;  2RUK B;  1J0W A;  1U2B A;  4HB2 B;  1X05 A;  1NTY A;  1QC6 A;  1MIZ B;  3UZT A;  3PVW A;  2R0D A;  4TKN A;  2D4Q A;  3VIA A;  2YS3 A;  3IVF A;  1OQN A;  2DHI A;  2CAY A;  1V61 A;  2J0J A;  3HW2 B;  2Y8F A;  2DX5 A;  1MPH A;  2P8V A;  1SHC A;  5KQ4 A;  1IRS A;  5C16 A;  4GMV A;  5L81 A;  3DXE A;  4CHJ A;  4F7U P;  3VOQ A;  4DXA B;  3T06 A;  4HAY B;  2LUL A;  1K5D B;  2EC1 A;  4P7I A;  1AWE A;  3G9W A;  2D10 A;  1DBH A;  1LB1 A;  1XR0 B;  1WJM A;  3SUZ A;  1GC7 A;  1M7R A;  4HB4 B;  4HDQ A;  5FI1 A;  2BCJ A;  2W2X D;  5JHG A;  1DDV A;  2COA A;  2RNR B;  2XQN M;  1WG7 A;  3SNH A;  4IOY X;  3BIN A;  3A98 B;  1UPQ A;  2H7E A;  3SYX A;  4Y94 A;  2DKP A;  1WJ1 A;  3D8F A;  1I7A A;  2H7D A;  3U7D A;  2M38 A;  5D3W A;  1P5T A;  4D0N B;  1P3R A;  4KHA A;  4A5K A;  2GCJ A;  1OMW A;  1W1D A;  4ZRI A;  5C5B A;  1Y5O A;  1MIX A;  2DLW A;  2HTH B;  4IFS A;  1U5E A;  2KCJ A;  2DHK A;  2UZR A;  4WVF B;  2DKQ A;  2LOZ A;  1V5U A;  3ODO A;  5DHA B;  1ZVR A;  1PMS A;  2L1C A;  2RLO A;  3PZD A;  3KSY A;  5CLL B;  2RGN B;  4XWX A;  5D3X A;  1V88 A;  3BJI A;  3TO1 A;  1WVH A;  2P0H A;  1KZ7 A;  2DYN A;  1X1G A;  3FEH A;  2EMT A;  2KGX B;  4PNK A;  3PVU A;  3X23 A;  4GZU A;  4HAW B;  2GS0 A;  3SV1 A;  5C79 A;  3CXB B;  1PLS A;  1FAO A;  4K81 A;  1FHO A;  2DTC A;  3D8D A;  4Z2M B;  1U5D A;  2YF0 A;  1X86 A;  1FGZ A;  1EAZ A;  5LON B;  2DYQ A;  1FB8 A;  5GOW B;  4F7H A;  2AL6 A;  1DRO A;  1B55 A;  2YT1 A;  1UEF A;  3P7Z A;  1GC6 A;  1W1G A;  4TYZ A;  4KHB B;  3GYO A;  3MDB C;  2Y8G A;  4EKU A;  5CLQ B;  2G35 A;  3ODW A;  4GPT B;  4HAV B;  2IFS A;  4BBK A;  1U5G A;  2GJY A;  4Z2N A;  1NI2 A;  2YT0 A;  2I5F A;  3WYF B;  4DX8 A;  2CY5 A;  2GCL A;  2CY4 A;  3ODX A;  2M14 A;  2COC A;  1Y19 B;  4KHO A;  1EF1 A;  1FHX A;  5D3V A;  5DH9 B;  4K2O A;  1E5W A;  2NZ8 B;  1PFJ A;  3AJ4 A;  1UNR A;  1W1H A;  5HE1 A;  2Z0Q A;  2HE7 A;  4K2P A;  4MT7 A;  3PEG A;  2NMB A;  4KAX B;  1OY2 A;  1K5G B;  1KI1 B;  1BWN A;  1UNP A;  1TJ6 A;  3TCA A;  2ADZ A;  1DDM A;  1Q67 A;  5J3T A;  4L6E A;  3ULB A;  1RJ2 A;  2UZS A;  5C5B B;  4CHM A;  1J19 A;  2KUP A;  3N7C A;  1GG3 A;  3FM8 C;  2DFK A;  3F0W A;  4EMO A;  2K00 A;  3DXC A;  2YSZ A;  1ZSQ A;  1MKE A;  3AU4 A;  1BAK A;  1FHW A;  3O96 A;  1EVH A;  1XOD A;  2OTX A;  2EJ8 A;  3ZVR A;  1N3H A;  2FJL A;  2ELB A;  2D9Z A;  3MPX A;  5JP4 A;  2DHJ A;  3TVV A;  2D9W A;  2RVB B;  4HAT B;  1RRP B;  1V5P A;  4A6F B;  2QKM A;  1TQZ A;  2J59 M;  2LKO A;  2Q13 A;  4YL8 A;  2COF A;  3P6A A;  2R09 A;  2LG1 A;  3PG7 A;  1V5M A;  3KRW A;  4DBB A;  4A6K A;  1H4R A;  1XX0 A;  5EFX A;  2DA0 A;  2MDX A;  2MWN B;  4HDO A;  2LOX A;  1MK9 B;  1UPR A;  4IAP A;  2J0K A;  4HB3 B;  2V76 A;  4MY6 A;  2L2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...