3D8DA

Crystal structure of the human fe65-ptb1 domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
139
Chain Sequence
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 139
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8dA00
1MK9B 1X11A 2DHKA 2HE7A 1MAIA 3NSUA 4HB3B 3AU5A 3TFMA 2Y8FA 2COAA 1WGUA 1TXDA 1RJ2A 2LULA 4HDOA 5FI0A 1PFJA 4PQ0A 4GZUA 2J0MA 2M14A 4CHJA 2YS1A 5D3WA 5CLLB 1B55A 1ZC4B 1OY2A 1WJ1A 4TYZA 2Z0QA 2ZPYA 2XQNM 2D9XA 2I5CA 1DYNA 1UNPA 3U8ZA 2DKQA 2MDXA 1I2HA 3F5RA 3PEGA 1P5TA 3X23A 1FB8A 1X1GA 2L2IA 2IYBA 4KVGB 1PMSA 2LG1A 4GXBA 2D9VA 2H7DA 3OANA 4HAVB 2RUKB 2UVMA 2DYQA 3AJ4A 3ODXA 1MIZB 3U7DA 1BAKA 1N3HA 4XWXA 4K2PA 2VSZA 1GC7A 1DDVA 1ZSQA 4GMVA 3HW2B 2K2UA 1DBHA 2P0FA 2PZ1A 4F7GA 4HATB 4Y94A 1AWEA 3SUZA 3ULBA 1OMWA 2Y8GA 2YRYA 2GCLA 5LONB 3LJUX 1KI1B 4YONA 4IOYX 4EJNA 1U5FA 1U27A 4GPTB 3SO6A 2GJYA 2D9WA 1SHCA 2K00A 1TJ6A 3KY9A 1KZGA 5HE0A 4KHAA 1X86A 2MKRA 3KRXA 1Z87A 3AU4A 1IRSA 1QQGA 1EGXA 3SYXA 1WJMA 5JHHA 3PSCA 4WSFA 3SV1A 2CODA 2AEHA 5D27A 2RNRB 1H10A 1BTNA 3T06A 2RGNB 4PNKA 1P6SA 5J3YA 1UPQA 2UZRA 4K2OA 2YF0A 2D2QA 2DHJA 2I1JA 2CY5A 3TCAA 4EKUA 4L6EA 5D3VA 2ROVA 2IFSA 4K17A 1NI2A 2DX1A 2Z0OA 1FOEA 2N23A 1WG7A 1XKEA 2MFQA 2QKMA 1M7EA 3F0WA 5JLJB 1Y19B 2LYDA 2P8VA 2OTXA 1XODA 1ISNA 2X18A 2RSGA 2GCJA 2I5FA 1GC6A 3DXEA 2N0YA 5KQ4A 2Y7BA 1OQNA 5FI1A 4GMXB 2J0JA 1U5GA 1XR0B 3N7CA 4H8SA 2DX5A 1V5UA 1MK7B 3PZDA 2W2XD 2Z0PA 3ZDTA 5DIFB 2AL6A 3V5WA 1J0WA 1BTKA 3DXCA 5CLQB 5JHGA 2DN6A 2R09A 5KCVA 5D3YA 3A98B 4HHVA 1U5EA 2JP2A 5C6RA 1ZVRA 2G35A 2E2XA 3SNHA 2K2JA 2D4QA 1FAOA 4A6FA 3D8FA 1V5MA 1W1HA 2J0KA 1U2BA 2OQBA 2R0DA 2V76A 2DA0A 4IAPA 4NSWA 4HDQA 1Q67A 1QC6A 1WGQA 2YT0A 1UEFA 1U5DA 1MIXA 4A6FB 4CHMA 1V5PA 3ODOA 4EMOA 2YT1A 1XD4A 2DFKA 2RLOA 4MK0A 1FHOA 2EJ8A 4K81A 3IVFA 2CY4A 3WYFB 1V89A 4CYEA 3QWMA 5HE1A 1FHXA 3CXBB 5DI9B 2Q13A 1H4RA 1NTVA 5D3XA 4NY0A 2NZ8B 4BBKA 2DHIA 2VRWB 5HE2A 4HB2B 4HAXB 4DX90 2L1CA 2DTCA 3VIAA 5L81A 1RRPB 1ZC3B 1GG3A 2COFA 3ULCA 4HB4B 1K5GB 5J3TA 1SGHA 4Z2MB 2RVBB 3A8QA 1AQCA 2EC1A 2MWNB 2ELBA 3QBVB 2W2WA 3CIKA 4P7IA 4Z2NA 2P0HA 3KZ1A 1DDMA 3PVLA 5C16A 3MPXA 1W1DA 3VOQA 2VKIA 4D0NB 1XX0A 5EFXA 5DH9B 3ODWA 4HAUB 5C5BA 2ELAA 1LB1A 4HAWB 5LOPB 2D9YA 1U29A 1WVHA 2I1KA 3KRWA 3BINA 2CAYA 1X1FA 3P6AA 1DROA 2KGXB 3ML4A 5JP4A 4A6HA 1X05A 3P7ZA 1KZ7A 1E5WA 5GOWB 2CRFA 2KUPA 5C5BB 1V61A 2NMBA 2LOZA 3UZTA 2YS5A 2LOXA 1ZM0A 2YVCA 3D8EA 2YSZA 1UPRA 4F7UP 4HAZB 3GYPA 3FSSA 2COCA 1BWNA 1DDWA 3PP2A 2DKPA 2FJLA 4HAYB 3BJIA 2M38A 4DBBA 4DXAB 1EAZA 3TO1A 2H7EA 1EVHA 3D8DA 2ROZB 3FEHA 1M7RA 2EMSA 4KAXB 4YL8A 1FGZA 1NU2A 1Y5OA 3G9WA 2DLWA 2W2XC 4HB0B 1LW3A 3A8PA 4KHBB 2J59M 1TQZA 2UZSA 2BCJA 1XCGA 1FGYA 1V88A 1UNRA 3GYOA 3FM8C 4MY6A 1PLSA 3MDBC 4B6HA 3PVWA 4A5KA 3HQCA 1W1GA 5HE3A 4MT7A 3WA0A 2QKLA 1K5DB 1FHWA 4IFSA 1EF1A 1WI1A 1I7AA 2YS3A 3HK0A 3TW1A 3PVUA 5DHAB 4KHOA 2LKOA 1MPHA 1NTYA 3DXDA 3QIJA 4GN1A 4WVFB 4F7HA 3KSYA 2D11A 2HTHB 5J3QA 2KCJA 2D10A 4WJ7A 3O96A 3PG7A 5C79A 1J19A 3ZVRA 2GS0A 5KQ1A 2DYNA 4ZRJA 4DX8A 4TKNA 1UNQA 3TVVA 1P3RA 2ADZA 4A6KA 2EMTA 5DHFB 4C0AA 2D9ZA 2P0DA 3RCPA 3M1IB 4ZRKA 1MKEA 4ZRIA
chains in the Genus database with same CATH superfamily
1MK9B 1X11A 2DHKA 2HE7A 3NWAA 1MAIA 3NSUA 4HB3B 3AU5A 3TFMA 2Y8FA 2COAA 1WGUA 1TXDA 1RJ2A 5LG4B 2LULA 4HDOA 2K49A 5FI0A 1PFJA 4PQ0A 4GZUA 2J0MA 2M14A 4CHJA 2YS1A 5D3WA 5CLLB 1B55A 1ZC4B 1OY2A 2RRFA 1WJ1A 4TYZA 2Z0QA 2ZPYA 2XQNM 2D9XA 2I5CA 2GUMA 1DYNA 1UNPA 3U8ZA 2DKQA 2MDXA 1I2HA 3F5RA 3PEGA 1P5TA 3X23A 1FB8A 1X1GA 2L2IA 2IYBA 4KVGB 1PMSA 2LG1A 4GXBA 2D9VA 2H7DA 3OANA 4HAVB 2RUKB 2UVMA 2DYQA 3AJ4A 3ODXA 1MIZB 4GNKB 3U7DA 1BAKA 1N3HA 4XWXA 4K2PA 2VSZA 1GC7A 1DDVA 1ZSQA 2Z13A 4GMVA 3FVCA 3HW2B 2K2UA 1DBHA 2P0FA 2PZ1A 4F7GA 4HATB 4Y94A 1AWEA 1T77A 3SUZA 3ULBA 1OMWA 2Y8GA 2YRYA 2GCLA 5LONB 3LJUX 1KI1B 4YONA 4IOYX 4EJNA 1U5FA 1U27A 4GPTB 3SO6A 2GJYA 2D9WA 1SHCA 2Z14A 3HSAA 2K00A 1TJ6A 3KY9A 1KZGA 5HE0A 4KHAA 1X86A 2MKRA 3KRXA 1Z87A 3AU4A 1IRSA 1QQGA 1EGXA 3SYXA 1WJMA 5JHHA 3PSCA 4WSFA 3SV1A 2CODA 2AEHA 5D27A 2RNRB 1H10A 1BTNA 3T06A 2RGNB 4PNKA 1P6SA 5J3YA 1UPQA 2UZRA 4K2OA 2YF0A 2D2QA 2DHJA 2I1JA 2CY5A 3TCAA 2NBVA 4EKUA 4L6EA 5D3VA 2ROVA 4QJ5B 2IFSA 4K17A 1NI2A 2DX1A 2Z0OA 1FOEA 2N23A 1WG7A 1XKEA 2MFQA 2QKMA 1M7EA 3F0WA 5I2SA 5JLJB 1Y19B 2LYDA 2P8VA 2OTXA 1XODA 1ISNA 2X18A 2RSGA 2GCJA 2I5FA 1GC6A 3DXEA 2N0YA 5KQ4A 2Y7BA 1OQNA 5FI1A 4GMXB 2J0JA 1U5GA 1XR0B 3N7CA 4H8SA 2DX5A 1V5UA 1MK7B 3PZDA 2W2XD 2Z0PA 3ZDTA 5DIFB 2AL6A 3V5WA 1J0WA 1BTKA 1ZYIA 3DXCA 5CLQB 3B77A 5JHGA 2DN6A 2R09A 5KCVA 5D3YA 4L1RA 3A98B 4HHVA 1U5EA 2JP2A 5C6RA 1ZVRA 2G35A 2E2XA 3SNHA 2K2JA 2D4QA 1FAOA 4A6FA 4OSNA 3D8FA 1V5MA 1W1HA 2J0KA 1U2BA 2OQBA 2R0DA 3U12A 2V76A 3NWFA 2DA0A 4IAPA 4NSWA 4HDQA 1Q67A 1QC6A 1WGQA 2YT0A 3HIEA 4QJ4B 4QXAB 1UEFA 1U5DA 1MIXA 4A6FB 4CHMA 1V5PA 3ODOA 4EMOA 2YT1A 1XD4A 2DFKA 2RLOA 4MK0A 1FHOA 2EJ8A 4K81A 4D6WA 3IVFA 2CY4A 3WYFB 1V89A 4CYEA 3QWMA 5HE1A 1FHXA 3CXBB 5DI9B 2Q13A 1H4RA 1NTVA 5D3XA 4CSQA 4NY0A 2NZ8B 3A58A 4BBKA 2DHIA 2VRWB 5HE2A 4HB2B 4HAXB 4DX90 2L1CA 2YT2A 2DTCA 3VIAA 5L81A 1RRPB 1ZC3B 1GG3A 2COFA 3ULCA 4HB4B 2FJUB 1K5GB 5J3TA 1SGHA 4Z2MB 2RVBB 3A8QA 1AQCA 2EC1A 2MWNB 2ELBA 3QBVB 2W2WA 3CIKA 4P7IA 4Z2NA 2P0HA 3KZ1A 1DDMA 3PVLA 5C16A 4DIXA 3MPXA 1W1DA 3VOQA 4GOUA 2VKIA 4D0NB 1XX0A 5EFXA 5DH9B 3ODWA 4OT1A 4HSIA 4HAUB 5C5BA 2ELAA 1LB1A 4HAWB 5LOPB 2D9YA 1U29A 1WVHA 2I1KA 3KRWA 3BINA 2CAYA 1X1FA 3P6AA 1DROA 2KGXB 3ML4A 5JP4A 4A6HA 2KUQA 1X05A 3P7ZA 1KZ7A 1E5WA 5GOWB 2CRFA 2KUPA 5IRSA 5C5BB 1V61A 2NMBA 2LOZA 3UZTA 2YS5A 2LOXA 1ZM0A 3OHMB 2YVCA 3D8EA 2YSZA 1UPRA 4F7UP 4HAZB 3GYPA 3FSSA 2COCA 1BWNA 1DDWA 3PP2A 2DKPA 2FJLA 4HAYB 3BJIA 2M38A 4DBBA 4DXAB 1EAZA 2KIGA 3TO1A 2H7EA 1EVHA 4KHBA 3D8DA 2ROZB 5M4YB 3FEHA 1M7RA 2EMSA 4KAXB 4YL8A 3NW8A 4QJ3B 1FGZA 1NU2A 1Y5OA 3G9WA 2DLWA 2W2XC 4HB0B 1LW3A 2KR0A 3A8PA 4KHBB 2J59M 1TQZA 2UZSA 2KIEA 2BCJA 3DCXA 1XCGA 1FGYA 1V88A 1UNRA 3GYOA 3FM8C 4MY6A 1PLSA 3MDBC 4B6HA 3PVWA 2R2YA 4A5KA 3HQCA 1W1GA 5HE3A 4MT7A 3WA0A 2QKLA 1K5DB 1FHWA 4IFSA 1EF1A 1WI1A 1I7AA 2YS3A 3HK0A 3TW1A 3PVUA 5DHAB 4KHOA 2LKOA 1MPHA 1NTYA 3DXDA 3QIJA 4GN1A 4WVFB 5I2MA 4F7HA 3KSYA 2D11A 2HTHB 5J3QA 2KCJA 1MI1A 2D10A 4WJ7A 3O96A 3PG7A 5C79A 1J19A 3ZVRA 2GS0A 5KQ1A 2DYNA 2K8EA 4ZRJA 4DX8A 2Z59A 4TKNA 3NWDA 1UNQA 2ZKMX 3TVVA 1P3RA 2ADZA 4A6KA 2EMTA 2Z4DA 5DHFB 4C0AA 2D9ZA 2P0DA 3RCPA 3M1IB 4ZRKA 1MKEA 4ZRIA
chains in the Genus database with same CATH topology
1MK9B 1X11A 2DHKA 2HE7A 1MAIA 3NSUA 4HB3B 3AU5A 3TFMA 2Y8FA 2COAA 1WGUA 1TXDA 1RJ2A 2LULA 4HDOA 5FI0A 1PFJA 4PQ0A 4GZUA 2J0MA 2M14A 4CHJA 2YS1A 5D3WA 5CLLB 1B55A 1ZC4B 1OY2A 1WJ1A 4TYZA 2Z0QA 2ZPYA 2XQNM 2D9XA 2I5CA 1DYNA 1UNPA 3U8ZA 2DKQA 2MDXA 1I2HA 3F5RA 3PEGA 1P5TA 3X23A 1FB8A 1X1GA 2L2IA 2IYBA 4KVGB 1PMSA 2LG1A 4GXBA 2D9VA 2H7DA 3OANA 4HAVB 2RUKB 2UVMA 2DYQA 3AJ4A 3ODXA 1MIZB 3U7DA 1BAKA 1N3HA 4XWXA 4K2PA 2VSZA 1GC7A 1DDVA 1ZSQA 4GMVA 3HW2B 2K2UA 1DBHA 2P0FA 2PZ1A 4F7GA 4HATB 4Y94A 1AWEA 3SUZA 3ULBA 1OMWA 2Y8GA 2YRYA 2GCLA 5LONB 3LJUX 1KI1B 4YONA 4IOYX 4EJNA 1U5FA 1U27A 4GPTB 3SO6A 2GJYA 2D9WA 1SHCA 2K00A 1TJ6A 3KY9A 1KZGA 5HE0A 4KHAA 1X86A 2MKRA 3KRXA 1Z87A 3AU4A 1IRSA 1QQGA 1EGXA 3SYXA 1WJMA 5JHHA 3PSCA 4WSFA 3SV1A 2CODA 2AEHA 5D27A 2RNRB 1H10A 1BTNA 3T06A 2RGNB 4PNKA 1P6SA 5J3YA 1UPQA 2UZRA 4K2OA 2YF0A 2D2QA 2DHJA 2I1JA 2CY5A 3TCAA 4EKUA 4L6EA 5D3VA 2ROVA 2IFSA 4K17A 1NI2A 2DX1A 2Z0OA 1FOEA 2N23A 1WG7A 1XKEA 2MFQA 2QKMA 1M7EA 3F0WA 5JLJB 1Y19B 2LYDA 2P8VA 2OTXA 1XODA 1ISNA 2X18A 2RSGA 2GCJA 2I5FA 1GC6A 3DXEA 2N0YA 5KQ4A 2Y7BA 1OQNA 5FI1A 4GMXB 2J0JA 1U5GA 1XR0B 3N7CA 4H8SA 2DX5A 1V5UA 1MK7B 3PZDA 2W2XD 2Z0PA 3ZDTA 5DIFB 2AL6A 3V5WA 1J0WA 1BTKA 3DXCA 5CLQB 5JHGA 2DN6A 2R09A 5KCVA 5D3YA 3A98B 4HHVA 1U5EA 2JP2A 5C6RA 1ZVRA 2G35A 2E2XA 3SNHA 2K2JA 2D4QA 1FAOA 4A6FA 3D8FA 1V5MA 1W1HA 2J0KA 1U2BA 2OQBA 2R0DA 2V76A 2DA0A 4IAPA 4NSWA 4HDQA 1Q67A 1QC6A 1WGQA 2YT0A 1UEFA 1U5DA 1MIXA 4A6FB 4CHMA 1V5PA 3ODOA 4EMOA 2YT1A 1XD4A 2DFKA 2RLOA 4MK0A 1FHOA 2EJ8A 4K81A 3IVFA 2CY4A 3WYFB 1V89A 4CYEA 3QWMA 5HE1A 1FHXA 3CXBB 5DI9B 2Q13A 1H4RA 1NTVA 5D3XA 4NY0A 2NZ8B 4BBKA 2DHIA 2VRWB 5HE2A 4HB2B 4HAXB 4DX90 2L1CA 2DTCA 3VIAA 5L81A 1RRPB 1ZC3B 1GG3A 2COFA 3ULCA 4HB4B 1K5GB 5J3TA 1SGHA 4Z2MB 2RVBB 3A8QA 1AQCA 2EC1A 2MWNB 2ELBA 3QBVB 2W2WA 3CIKA 4P7IA 4Z2NA 2P0HA 3KZ1A 1DDMA 3PVLA 5C16A 3MPXA 1W1DA 3VOQA 2VKIA 4D0NB 1XX0A 5EFXA 5DH9B 3ODWA 4HAUB 5C5BA 2ELAA 1LB1A 4HAWB 5LOPB 2D9YA 1U29A 1WVHA 2I1KA 3KRWA 3BINA 2CAYA 1X1FA 3P6AA 1DROA 2KGXB 3ML4A 5JP4A 4A6HA 1X05A 3P7ZA 1KZ7A 1E5WA 5GOWB 2CRFA 2KUPA 5C5BB 1V61A 2NMBA 2LOZA 3UZTA 2YS5A 2LOXA 1ZM0A 2YVCA 3D8EA 2YSZA 1UPRA 4F7UP 4HAZB 3GYPA 3FSSA 2COCA 1BWNA 1DDWA 3PP2A 2DKPA 2FJLA 4HAYB 3BJIA 2M38A 4DBBA 4DXAB 1EAZA 3TO1A 2H7EA 1EVHA 3D8DA 2ROZB 3FEHA 1M7RA 2EMSA 4KAXB 4YL8A 1FGZA 1NU2A 1Y5OA 3G9WA 2DLWA 2W2XC 4HB0B 1LW3A 3A8PA 4KHBB 2J59M 1TQZA 2UZSA 2BCJA 1XCGA 1FGYA 1V88A 1UNRA 3GYOA 3FM8C 4MY6A 1PLSA 3MDBC 4B6HA 3PVWA 4A5KA 3HQCA 1W1GA 5HE3A 4MT7A 3WA0A 2QKLA 1K5DB 1FHWA 4IFSA 1EF1A 1WI1A 1I7AA 2YS3A 3HK0A 3TW1A 3PVUA 5DHAB 4KHOA 2LKOA 1MPHA 1NTYA 3DXDA 3QIJA 4GN1A 4WVFB 4F7HA 3KSYA 2D11A 2HTHB 5J3QA 2KCJA 2D10A 4WJ7A 3O96A 3PG7A 5C79A 1J19A 3ZVRA 2GS0A 5KQ1A 2DYNA 4ZRJA 4DX8A 4TKNA 1UNQA 3TVVA 1P3RA 2ADZA 4A6KA 2EMTA 5DHFB 4C0AA 2D9ZA 2P0DA 3RCPA 3M1IB 4ZRKA 1MKEA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK9 B;  1X11 A;  2DHK A;  2HE7 A;  1MAI A;  3NSU A;  4HB3 B;  3AU5 A;  3TFM A;  2Y8F A;  2COA A;  1WGU A;  1TXD A;  1RJ2 A;  2LUL A;  4HDO A;  5FI0 A;  1PFJ A;  4PQ0 A;  4GZU A;  2J0M A;  2M14 A;  4CHJ A;  2YS1 A;  5D3W A;  5CLL B;  1B55 A;  1ZC4 B;  1OY2 A;  1WJ1 A;  4TYZ A;  2Z0Q A;  2ZPY A;  2XQN M;  2D9X A;  2I5C A;  1DYN A;  1UNP A;  3U8Z A;  2DKQ A;  2MDX A;  1I2H A;  3F5R A;  3PEG A;  1P5T A;  3X23 A;  1FB8 A;  1X1G A;  2L2I A;  2IYB A;  4KVG B;  1PMS A;  2LG1 A;  4GXB A;  2D9V A;  2H7D A;  3OAN A;  4HAV B;  2RUK B;  2UVM A;  2DYQ A;  3AJ4 A;  3ODX A;  1MIZ B;  3U7D A;  1BAK A;  1N3H A;  4XWX A;  4K2P A;  2VSZ A;  1GC7 A;  1DDV A;  1ZSQ A;  4GMV A;  3HW2 B;  2K2U A;  1DBH A;  2P0F A;  2PZ1 A;  4F7G A;  4HAT B;  4Y94 A;  1AWE A;  3SUZ A;  3ULB A;  1OMW A;  2Y8G A;  2YRY A;  2GCL A;  5LON B;  3LJU X;  1KI1 B;  4YON A;  4IOY X;  4EJN A;  1U5F A;  1U27 A;  4GPT B;  3SO6 A;  2GJY A;  2D9W A;  1SHC A;  2K00 A;  1TJ6 A;  3KY9 A;  1KZG A;  5HE0 A;  4KHA A;  1X86 A;  2MKR A;  3KRX A;  1Z87 A;  3AU4 A;  1IRS A;  1QQG A;  1EGX A;  3SYX A;  1WJM A;  5JHH A;  3PSC A;  4WSF A;  3SV1 A;  2COD A;  2AEH A;  5D27 A;  2RNR B;  1H10 A;  1BTN A;  3T06 A;  2RGN B;  4PNK A;  1P6S A;  5J3Y A;  1UPQ A;  2UZR A;  4K2O A;  2YF0 A;  2D2Q A;  2DHJ A;  2I1J A;  2CY5 A;  3TCA A;  4EKU A;  4L6E A;  5D3V A;  2ROV A;  2IFS A;  4K17 A;  1NI2 A;  2DX1 A;  2Z0O A;  1FOE A;  2N23 A;  1WG7 A;  1XKE A;  2MFQ A;  2QKM A;  1M7E A;  3F0W A;  5JLJ B;  1Y19 B;  2LYD A;  2P8V A;  2OTX A;  1XOD A;  1ISN A;  2X18 A;  2RSG A;  2GCJ A;  2I5F A;  1GC6 A;  3DXE A;  2N0Y A;  5KQ4 A;  2Y7B A;  1OQN A;  5FI1 A;  4GMX B;  2J0J A;  1U5G A;  1XR0 B;  3N7C A;  4H8S A;  2DX5 A;  1V5U A;  1MK7 B;  3PZD A;  2W2X D;  2Z0P A;  3ZDT A;  5DIF B;  2AL6 A;  3V5W A;  1J0W A;  1BTK A;  3DXC A;  5CLQ B;  5JHG A;  2DN6 A;  2R09 A;  5KCV A;  5D3Y A;  3A98 B;  4HHV A;  1U5E A;  2JP2 A;  5C6R A;  1ZVR A;  2G35 A;  2E2X A;  3SNH A;  2K2J A;  2D4Q A;  1FAO A;  4A6F A;  3D8F A;  1V5M A;  1W1H A;  2J0K A;  1U2B A;  2OQB A;  2R0D A;  2V76 A;  2DA0 A;  4IAP A;  4NSW A;  4HDQ A;  1Q67 A;  1QC6 A;  1WGQ A;  2YT0 A;  1UEF A;  1U5D A;  1MIX A;  4A6F B;  4CHM A;  1V5P A;  3ODO A;  4EMO A;  2YT1 A;  1XD4 A;  2DFK A;  2RLO A;  4MK0 A;  1FHO A;  2EJ8 A;  4K81 A;  3IVF A;  2CY4 A;  3WYF B;  1V89 A;  4CYE A;  3QWM A;  5HE1 A;  1FHX A;  3CXB B;  5DI9 B;  2Q13 A;  1H4R A;  1NTV A;  5D3X A;  4NY0 A;  2NZ8 B;  4BBK A;  2DHI A;  2VRW B;  5HE2 A;  4HB2 B;  4HAX B;  4DX9 0;  2L1C A;  2DTC A;  3VIA A;  5L81 A;  1RRP B;  1ZC3 B;  1GG3 A;  2COF A;  3ULC A;  4HB4 B;  1K5G B;  5J3T A;  1SGH A;  4Z2M B;  2RVB B;  3A8Q A;  1AQC A;  2EC1 A;  2MWN B;  2ELB A;  3QBV B;  2W2W A;  3CIK A;  4P7I A;  4Z2N A;  2P0H A;  3KZ1 A;  1DDM A;  3PVL A;  5C16 A;  3MPX A;  1W1D A;  3VOQ A;  2VKI A;  4D0N B;  1XX0 A;  5EFX A;  5DH9 B;  3ODW A;  4HAU B;  5C5B A;  2ELA A;  1LB1 A;  4HAW B;  5LOP B;  2D9Y A;  1U29 A;  1WVH A;  2I1K A;  3KRW A;  3BIN A;  2CAY A;  1X1F A;  3P6A A;  1DRO A;  2KGX B;  3ML4 A;  5JP4 A;  4A6H A;  1X05 A;  3P7Z A;  1KZ7 A;  1E5W A;  5GOW B;  2CRF A;  2KUP A;  5C5B B;  1V61 A;  2NMB A;  2LOZ A;  3UZT A;  2YS5 A;  2LOX A;  1ZM0 A;  2YVC A;  3D8E A;  2YSZ A;  1UPR A;  4F7U P;  4HAZ B;  3GYP A;  3FSS A;  2COC A;  1BWN A;  1DDW A;  3PP2 A;  2DKP A;  2FJL A;  4HAY B;  3BJI A;  2M38 A;  4DBB A;  4DXA B;  1EAZ A;  3TO1 A;  2H7E A;  1EVH A;  3D8D A;  2ROZ B;  3FEH A;  1M7R A;  2EMS A;  4KAX B;  4YL8 A;  1FGZ A;  1NU2 A;  1Y5O A;  3G9W A;  2DLW A;  2W2X C;  4HB0 B;  1LW3 A;  3A8P A;  4KHB B;  2J59 M;  1TQZ A;  2UZS A;  2BCJ A;  1XCG A;  1FGY A;  1V88 A;  1UNR A;  3GYO A;  3FM8 C;  4MY6 A;  1PLS A;  3MDB C;  4B6H A;  3PVW A;  4A5K A;  3HQC A;  1W1G A;  5HE3 A;  4MT7 A;  3WA0 A;  2QKL A;  1K5D B;  1FHW A;  4IFS A;  1EF1 A;  1WI1 A;  1I7A A;  2YS3 A;  3HK0 A;  3TW1 A;  3PVU A;  5DHA B;  4KHO A;  2LKO A;  1MPH A;  1NTY A;  3DXD A;  3QIJ A;  4GN1 A;  4WVF B;  4F7H A;  3KSY A;  2D11 A;  2HTH B;  5J3Q A;  2KCJ A;  2D10 A;  4WJ7 A;  3O96 A;  3PG7 A;  5C79 A;  1J19 A;  3ZVR A;  2GS0 A;  5KQ1 A;  2DYN A;  4ZRJ A;  4DX8 A;  4TKN A;  1UNQ A;  3TVV A;  1P3R A;  2ADZ A;  4A6K A;  2EMT A;  5DHF B;  4C0A A;  2D9Z A;  2P0D A;  3RCP A;  3M1I B;  4ZRK A;  1MKE A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 1MK9 B;  1X11 A;  2DHK A;  2HE7 A;  3NWA A;  1MAI A;  3NSU A;  4HB3 B;  3AU5 A;  3TFM A;  2Y8F A;  2COA A;  1WGU A;  1TXD A;  1RJ2 A;  5LG4 B;  2LUL A;  4HDO A;  2K49 A;  5FI0 A;  1PFJ A;  4PQ0 A;  4GZU A;  2J0M A;  2M14 A;  4CHJ A;  2YS1 A;  5D3W A;  5CLL B;  1B55 A;  1ZC4 B;  1OY2 A;  2RRF A;  1WJ1 A;  4TYZ A;  2Z0Q A;  2ZPY A;  2XQN M;  2D9X A;  2I5C A;  2GUM A;  1DYN A;  1UNP A;  3U8Z A;  2DKQ A;  2MDX A;  1I2H A;  3F5R A;  3PEG A;  1P5T A;  3X23 A;  1FB8 A;  1X1G A;  2L2I A;  2IYB A;  4KVG B;  1PMS A;  2LG1 A;  4GXB A;  2D9V A;  2H7D A;  3OAN A;  4HAV B;  2RUK B;  2UVM A;  2DYQ A;  3AJ4 A;  3ODX A;  1MIZ B;  4GNK B;  3U7D A;  1BAK A;  1N3H A;  4XWX A;  4K2P A;  2VSZ A;  1GC7 A;  1DDV A;  1ZSQ A;  2Z13 A;  4GMV A;  3FVC A;  3HW2 B;  2K2U A;  1DBH A;  2P0F A;  2PZ1 A;  4F7G A;  4HAT B;  4Y94 A;  1AWE A;  1T77 A;  3SUZ A;  3ULB A;  1OMW A;  2Y8G A;  2YRY A;  2GCL A;  5LON B;  3LJU X;  1KI1 B;  4YON A;  4IOY X;  4EJN A;  1U5F A;  1U27 A;  4GPT B;  3SO6 A;  2GJY A;  2D9W A;  1SHC A;  2Z14 A;  3HSA A;  2K00 A;  1TJ6 A;  3KY9 A;  1KZG A;  5HE0 A;  4KHA A;  1X86 A;  2MKR A;  3KRX A;  1Z87 A;  3AU4 A;  1IRS A;  1QQG A;  1EGX A;  3SYX A;  1WJM A;  5JHH A;  3PSC A;  4WSF A;  3SV1 A;  2COD A;  2AEH A;  5D27 A;  2RNR B;  1H10 A;  1BTN A;  3T06 A;  2RGN B;  4PNK A;  1P6S A;  5J3Y A;  1UPQ A;  2UZR A;  4K2O A;  2YF0 A;  2D2Q A;  2DHJ A;  2I1J A;  2CY5 A;  3TCA A;  2NBV A;  4EKU A;  4L6E A;  5D3V A;  2ROV A;  4QJ5 B;  2IFS A;  4K17 A;  1NI2 A;  2DX1 A;  2Z0O A;  1FOE A;  2N23 A;  1WG7 A;  1XKE A;  2MFQ A;  2QKM A;  1M7E A;  3F0W A;  5I2S A;  5JLJ B;  1Y19 B;  2LYD A;  2P8V A;  2OTX A;  1XOD A;  1ISN A;  2X18 A;  2RSG A;  2GCJ A;  2I5F A;  1GC6 A;  3DXE A;  2N0Y A;  5KQ4 A;  2Y7B A;  1OQN A;  5FI1 A;  4GMX B;  2J0J A;  1U5G A;  1XR0 B;  3N7C A;  4H8S A;  2DX5 A;  1V5U A;  1MK7 B;  3PZD A;  2W2X D;  2Z0P A;  3ZDT A;  5DIF B;  2AL6 A;  3V5W A;  1J0W A;  1BTK A;  1ZYI A;  3DXC A;  5CLQ B;  3B77 A;  5JHG A;  2DN6 A;  2R09 A;  5KCV A;  5D3Y A;  4L1R A;  3A98 B;  4HHV A;  1U5E A;  2JP2 A;  5C6R A;  1ZVR A;  2G35 A;  2E2X A;  3SNH A;  2K2J A;  2D4Q A;  1FAO A;  4A6F A;  4OSN A;  3D8F A;  1V5M A;  1W1H A;  2J0K A;  1U2B A;  2OQB A;  2R0D A;  3U12 A;  2V76 A;  3NWF A;  2DA0 A;  4IAP A;  4NSW A;  4HDQ A;  1Q67 A;  1QC6 A;  1WGQ A;  2YT0 A;  3HIE A;  4QJ4 B;  4QXA B;  1UEF A;  1U5D A;  1MIX A;  4A6F B;  4CHM A;  1V5P A;  3ODO A;  4EMO A;  2YT1 A;  1XD4 A;  2DFK A;  2RLO A;  4MK0 A;  1FHO A;  2EJ8 A;  4K81 A;  4D6W A;  3IVF A;  2CY4 A;  3WYF B;  1V89 A;  4CYE A;  3QWM A;  5HE1 A;  1FHX A;  3CXB B;  5DI9 B;  2Q13 A;  1H4R A;  1NTV A;  5D3X A;  4CSQ A;  4NY0 A;  2NZ8 B;  3A58 A;  4BBK A;  2DHI A;  2VRW B;  5HE2 A;  4HB2 B;  4HAX B;  4DX9 0;  2L1C A;  2YT2 A;  2DTC A;  3VIA A;  5L81 A;  1RRP B;  1ZC3 B;  1GG3 A;  2COF A;  3ULC A;  4HB4 B;  2FJU B;  1K5G B;  5J3T A;  1SGH A;  4Z2M B;  2RVB B;  3A8Q A;  1AQC A;  2EC1 A;  2MWN B;  2ELB A;  3QBV B;  2W2W A;  3CIK A;  4P7I A;  4Z2N A;  2P0H A;  3KZ1 A;  1DDM A;  3PVL A;  5C16 A;  4DIX A;  3MPX A;  1W1D A;  3VOQ A;  4GOU A;  2VKI A;  4D0N B;  1XX0 A;  5EFX A;  5DH9 B;  3ODW A;  4OT1 A;  4HSI A;  4HAU B;  5C5B A;  2ELA A;  1LB1 A;  4HAW B;  5LOP B;  2D9Y A;  1U29 A;  1WVH A;  2I1K A;  3KRW A;  3BIN A;  2CAY A;  1X1F A;  3P6A A;  1DRO A;  2KGX B;  3ML4 A;  5JP4 A;  4A6H A;  2KUQ A;  1X05 A;  3P7Z A;  1KZ7 A;  1E5W A;  5GOW B;  2CRF A;  2KUP A;  5IRS A;  5C5B B;  1V61 A;  2NMB A;  2LOZ A;  3UZT A;  2YS5 A;  2LOX A;  1ZM0 A;  3OHM B;  2YVC A;  3D8E A;  2YSZ A;  1UPR A;  4F7U P;  4HAZ B;  3GYP A;  3FSS A;  2COC A;  1BWN A;  1DDW A;  3PP2 A;  2DKP A;  2FJL A;  4HAY B;  3BJI A;  2M38 A;  4DBB A;  4DXA B;  1EAZ A;  2KIG A;  3TO1 A;  2H7E A;  1EVH A;  4KHB A;  3D8D A;  2ROZ B;  5M4Y B;  3FEH A;  1M7R A;  2EMS A;  4KAX B;  4YL8 A;  3NW8 A;  4QJ3 B;  1FGZ A;  1NU2 A;  1Y5O A;  3G9W A;  2DLW A;  2W2X C;  4HB0 B;  1LW3 A;  2KR0 A;  3A8P A;  4KHB B;  2J59 M;  1TQZ A;  2UZS A;  2KIE A;  2BCJ A;  3DCX A;  1XCG A;  1FGY A;  1V88 A;  1UNR A;  3GYO A;  3FM8 C;  4MY6 A;  1PLS A;  3MDB C;  4B6H A;  3PVW A;  2R2Y A;  4A5K A;  3HQC A;  1W1G A;  5HE3 A;  4MT7 A;  3WA0 A;  2QKL A;  1K5D B;  1FHW A;  4IFS A;  1EF1 A;  1WI1 A;  1I7A A;  2YS3 A;  3HK0 A;  3TW1 A;  3PVU A;  5DHA B;  4KHO A;  2LKO A;  1MPH A;  1NTY A;  3DXD A;  3QIJ A;  4GN1 A;  4WVF B;  5I2M A;  4F7H A;  3KSY A;  2D11 A;  2HTH B;  5J3Q A;  2KCJ A;  1MI1 A;  2D10 A;  4WJ7 A;  3O96 A;  3PG7 A;  5C79 A;  1J19 A;  3ZVR A;  2GS0 A;  5KQ1 A;  2DYN A;  2K8E A;  4ZRJ A;  4DX8 A;  2Z59 A;  4TKN A;  3NWD A;  1UNQ A;  2ZKM X;  3TVV A;  1P3R A;  2ADZ A;  4A6K A;  2EMT A;  2Z4D A;  5DHF B;  4C0A A;  2D9Z A;  2P0D A;  3RCP A;  3M1I B;  4ZRK A;  1MKE A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 1MK9 B;  1X11 A;  2DHK A;  2HE7 A;  1MAI A;  3NSU A;  4HB3 B;  3AU5 A;  3TFM A;  2Y8F A;  2COA A;  1WGU A;  1TXD A;  1RJ2 A;  2LUL A;  4HDO A;  5FI0 A;  1PFJ A;  4PQ0 A;  4GZU A;  2J0M A;  2M14 A;  4CHJ A;  2YS1 A;  5D3W A;  5CLL B;  1B55 A;  1ZC4 B;  1OY2 A;  1WJ1 A;  4TYZ A;  2Z0Q A;  2ZPY A;  2XQN M;  2D9X A;  2I5C A;  1DYN A;  1UNP A;  3U8Z A;  2DKQ A;  2MDX A;  1I2H A;  3F5R A;  3PEG A;  1P5T A;  3X23 A;  1FB8 A;  1X1G A;  2L2I A;  2IYB A;  4KVG B;  1PMS A;  2LG1 A;  4GXB A;  2D9V A;  2H7D A;  3OAN A;  4HAV B;  2RUK B;  2UVM A;  2DYQ A;  3AJ4 A;  3ODX A;  1MIZ B;  3U7D A;  1BAK A;  1N3H A;  4XWX A;  4K2P A;  2VSZ A;  1GC7 A;  1DDV A;  1ZSQ A;  4GMV A;  3HW2 B;  2K2U A;  1DBH A;  2P0F A;  2PZ1 A;  4F7G A;  4HAT B;  4Y94 A;  1AWE A;  3SUZ A;  3ULB A;  1OMW A;  2Y8G A;  2YRY A;  2GCL A;  5LON B;  3LJU X;  1KI1 B;  4YON A;  4IOY X;  4EJN A;  1U5F A;  1U27 A;  4GPT B;  3SO6 A;  2GJY A;  2D9W A;  1SHC A;  2K00 A;  1TJ6 A;  3KY9 A;  1KZG A;  5HE0 A;  4KHA A;  1X86 A;  2MKR A;  3KRX A;  1Z87 A;  3AU4 A;  1IRS A;  1QQG A;  1EGX A;  3SYX A;  1WJM A;  5JHH A;  3PSC A;  4WSF A;  3SV1 A;  2COD A;  2AEH A;  5D27 A;  2RNR B;  1H10 A;  1BTN A;  3T06 A;  2RGN B;  4PNK A;  1P6S A;  5J3Y A;  1UPQ A;  2UZR A;  4K2O A;  2YF0 A;  2D2Q A;  2DHJ A;  2I1J A;  2CY5 A;  3TCA A;  4EKU A;  4L6E A;  5D3V A;  2ROV A;  2IFS A;  4K17 A;  1NI2 A;  2DX1 A;  2Z0O A;  1FOE A;  2N23 A;  1WG7 A;  1XKE A;  2MFQ A;  2QKM A;  1M7E A;  3F0W A;  5JLJ B;  1Y19 B;  2LYD A;  2P8V A;  2OTX A;  1XOD A;  1ISN A;  2X18 A;  2RSG A;  2GCJ A;  2I5F A;  1GC6 A;  3DXE A;  2N0Y A;  5KQ4 A;  2Y7B A;  1OQN A;  5FI1 A;  4GMX B;  2J0J A;  1U5G A;  1XR0 B;  3N7C A;  4H8S A;  2DX5 A;  1V5U A;  1MK7 B;  3PZD A;  2W2X D;  2Z0P A;  3ZDT A;  5DIF B;  2AL6 A;  3V5W A;  1J0W A;  1BTK A;  3DXC A;  5CLQ B;  5JHG A;  2DN6 A;  2R09 A;  5KCV A;  5D3Y A;  3A98 B;  4HHV A;  1U5E A;  2JP2 A;  5C6R A;  1ZVR A;  2G35 A;  2E2X A;  3SNH A;  2K2J A;  2D4Q A;  1FAO A;  4A6F A;  3D8F A;  1V5M A;  1W1H A;  2J0K A;  1U2B A;  2OQB A;  2R0D A;  2V76 A;  2DA0 A;  4IAP A;  4NSW A;  4HDQ A;  1Q67 A;  1QC6 A;  1WGQ A;  2YT0 A;  1UEF A;  1U5D A;  1MIX A;  4A6F B;  4CHM A;  1V5P A;  3ODO A;  4EMO A;  2YT1 A;  1XD4 A;  2DFK A;  2RLO A;  4MK0 A;  1FHO A;  2EJ8 A;  4K81 A;  3IVF A;  2CY4 A;  3WYF B;  1V89 A;  4CYE A;  3QWM A;  5HE1 A;  1FHX A;  3CXB B;  5DI9 B;  2Q13 A;  1H4R A;  1NTV A;  5D3X A;  4NY0 A;  2NZ8 B;  4BBK A;  2DHI A;  2VRW B;  5HE2 A;  4HB2 B;  4HAX B;  4DX9 0;  2L1C A;  2DTC A;  3VIA A;  5L81 A;  1RRP B;  1ZC3 B;  1GG3 A;  2COF A;  3ULC A;  4HB4 B;  1K5G B;  5J3T A;  1SGH A;  4Z2M B;  2RVB B;  3A8Q A;  1AQC A;  2EC1 A;  2MWN B;  2ELB A;  3QBV B;  2W2W A;  3CIK A;  4P7I A;  4Z2N A;  2P0H A;  3KZ1 A;  1DDM A;  3PVL A;  5C16 A;  3MPX A;  1W1D A;  3VOQ A;  2VKI A;  4D0N B;  1XX0 A;  5EFX A;  5DH9 B;  3ODW A;  4HAU B;  5C5B A;  2ELA A;  1LB1 A;  4HAW B;  5LOP B;  2D9Y A;  1U29 A;  1WVH A;  2I1K A;  3KRW A;  3BIN A;  2CAY A;  1X1F A;  3P6A A;  1DRO A;  2KGX B;  3ML4 A;  5JP4 A;  4A6H A;  1X05 A;  3P7Z A;  1KZ7 A;  1E5W A;  5GOW B;  2CRF A;  2KUP A;  5C5B B;  1V61 A;  2NMB A;  2LOZ A;  3UZT A;  2YS5 A;  2LOX A;  1ZM0 A;  2YVC A;  3D8E A;  2YSZ A;  1UPR A;  4F7U P;  4HAZ B;  3GYP A;  3FSS A;  2COC A;  1BWN A;  1DDW A;  3PP2 A;  2DKP A;  2FJL A;  4HAY B;  3BJI A;  2M38 A;  4DBB A;  4DXA B;  1EAZ A;  3TO1 A;  2H7E A;  1EVH A;  3D8D A;  2ROZ B;  3FEH A;  1M7R A;  2EMS A;  4KAX B;  4YL8 A;  1FGZ A;  1NU2 A;  1Y5O A;  3G9W A;  2DLW A;  2W2X C;  4HB0 B;  1LW3 A;  3A8P A;  4KHB B;  2J59 M;  1TQZ A;  2UZS A;  2BCJ A;  1XCG A;  1FGY A;  1V88 A;  1UNR A;  3GYO A;  3FM8 C;  4MY6 A;  1PLS A;  3MDB C;  4B6H A;  3PVW A;  4A5K A;  3HQC A;  1W1G A;  5HE3 A;  4MT7 A;  3WA0 A;  2QKL A;  1K5D B;  1FHW A;  4IFS A;  1EF1 A;  1WI1 A;  1I7A A;  2YS3 A;  3HK0 A;  3TW1 A;  3PVU A;  5DHA B;  4KHO A;  2LKO A;  1MPH A;  1NTY A;  3DXD A;  3QIJ A;  4GN1 A;  4WVF B;  4F7H A;  3KSY A;  2D11 A;  2HTH B;  5J3Q A;  2KCJ A;  2D10 A;  4WJ7 A;  3O96 A;  3PG7 A;  5C79 A;  1J19 A;  3ZVR A;  2GS0 A;  5KQ1 A;  2DYN A;  4ZRJ A;  4DX8 A;  4TKN A;  1UNQ A;  3TVV A;  1P3R A;  2ADZ A;  4A6K A;  2EMT A;  5DHF B;  4C0A A;  2D9Z A;  2P0D A;  3RCP A;  3M1I B;  4ZRK A;  1MKE A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...