3D8DA

Crystal structure of the human fe65-ptb1 domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
139
Chain Sequence
b'GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 139
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8dA00
2D2QA 2X18A 4MK0A 1FB8A 1BAKA 4DBBA 3P6AA 2DTCA 4GXBA 2RNRB 4CHJA 3D8FA 5JLJB 4F7HA 1U5GA 3KRWA 1U5DA 4H8SA 2L2IA 4HAWB 5KQ1A 1PLSA 2Q13A 3IVFA 2M14A 3ZDTA 3T06A 1NTYA 5CLLB 2G35A 3O96A 4EKUA 3SUZA 3MDBC 3OANA 1TJ6A 2XQNM 5JP4A 2AEHA 2IFSA 4HDOA 4GZUA 2BCJA 2RGNB 3DXDA 1LW3A 1AWEA 2DLWA 4K2OA 1I7AA 1UNPA 4DXAB 5JHHA 3PVLA 2YS5A 4DX8A 1DDMA 3P7ZA 1X05A 2LYDA 1K5GB 1J19A 3TVVA 2GCJA 5HE2A 5C16A 1MKEA 1EAZA 1K5DB 5DI9B 1BTNA 1E5WA 2MFQA 5J3TA 2YS1A 4GMVA 3U7DA 2N0YA 1GG3A 3FEHA 4L6EA 2E2XA 4HDQA 4P7IA 2H7DA 1UPQA 2PZ1A 4GN1A 3D8EA 4MY6A 4D0NB 3PVUA 2CY5A 1V61A 1UNQA 3F5RA 4ZRJA 2UVMA 5D3VA 2EC1A 4C0AA 3ML4A 3DXCA 3M1IB 1QQGA 2DKQA 4PNKA 3ODOA 1EGXA 2V76A 3TCAA 1U29A 2RLOA 4KAXB 2ZPYA 4HATB 3X23A 4BBKA 4WJ7A 2YS3A 1WGQA 1DYNA 3KY9A 2W2WA 2MDXA 4CHMA 3PZDA 4IOYX 2YF0A 5LOPB 2K00A 4NSWA 5CLQB 2D9YA 3SV1A 1KZGA 2COFA 2D9XA 3A98B 5EFXA 3BINA 4K17A 5FI0A 1I2HA 1P6SA 2ELBA 1WJ1A 2JP2A 5DH9B 4WSFA 3PSCA 1NTVA 1RJ2A 1UNRA 3F0WA 5J3QA 1ZC3B 3PG7A 2GJYA 2P0DA 1WG7A 5L81A 2D4QA 2I1KA 2IYBA 1FHOA 2J0MA 4EJNA 5HE0A 3UZTA 2RVBB 2YVCA 2DHKA 4A6HA 3FM8C 3VIAA 3MPXA 2DHIA 2Z0QA 3GYOA 4A6FA 2DHJA 1U5FA 2J0KA 4B6HA 1U27A 4KHBB 3WA0A 3CXBB 3HW2B 2NMBA 1OQNA 2L1CA 5C5BB 1Q67A 5KCVA 2LULA 2P8VA 2YT1A 1U5EA 1W1HA 1NI2A 5C6RA 1KI1B 1ZVRA 4KHAA 2R09A 2DX1A 3PP2A 5D3WA 1U2BA 1FHXA 1DDVA 1MIXA 4HAXB 4Z2MB 4A6KA 1ISNA 2LG1A 3SYXA 1Y5OA 3GYPA 1MK7B 3KZ1A 1N3HA 2AL6A 4GPTB 3G9WA 4F7UP 1XD4A 2DA0A 2LOXA 5C5BA 1AQCA 3KSYA 2EMTA 3WYFB 4HAVB 1MIZB 4HB0B 1EVHA 1ZC4B 4F7GA 1FAOA 2DYQA 4XWXA 1OY2A 1X1GA 3TFMA 2RUKB 2W2XC 2J0JA 2H7EA 5LONB 4Y94A 1MPHA 5D3YA 5HE1A 5DHAB 3RCPA 1B55A 4WVFB 2UZSA 1V89A 1Z87A 2QKMA 4IFSA 2P0FA 5DIFB 1J0WA 1Y19B 3ODXA 1UEFA 1DBHA 1FGYA 1P3RA 2I5CA 3CIKA 4YONA 2RSGA 1X86A 3QIJA 4CYEA 2GCLA 3A8PA 3ULBA 1PFJA 2DN6A 5JHGA 2MWNB 2QKLA 3SNHA 2LKOA 3PVWA 2Z0OA 3AU4A 3QBVB 2DFKA 1WGUA 3ZVRA 2P0HA 1ZSQA 3PEGA 1X1FA 1FOEA 2K2JA 1TQZA 2CODA 3TW1A 1V5UA 2DKPA 2I1JA 2D10A 1PMSA 4TYZA 4ZRIA 1KZ7A 1M7EA 3TO1A 1FGZA 1OMWA 3DXEA 2YSZA 3QWMA 2COCA 1WJMA 2D9WA 2M38A 2D9ZA 1XODA 2DYNA 2COAA 3HK0A 2CY4A 1XR0B 1SHCA 2LOZA 2MKRA 2KUPA 4HHVA 4IAPA 4HAZB 3V5WA 1MK9B 5D27A 4DX90 4HAYB 2GS0A 2KCJA 2R0DA 4TKNA 1WVHA 2I5FA 1W1DA 2Y7BA 3FSSA 5GOWB 2KGXB 2VKIA 2NZ8B 3D8DA 4K81A 4HB4B 1TXDA 4KHOA 2Z0PA 3ULCA 2HE7A 3N7CA 5KQ4A 4Z2NA 1LB1A 4MT7A 3SO6A 1SGHA 1WI1A 2ROVA 4HAUB 2VSZA 1UPRA 1W1GA 4PQ0A 5J3YA 2DX5A 5D3XA 5FI1A 1GC7A 1V5MA 2CAYA 2VRWB 1BTKA 1DROA 3LJUX 1XX0A 3U8ZA 1DDWA 1XKEA 5HE3A 2D9VA 4HB2B 2D11A 1BWNA 2YRYA 3AU5A 1ZM0A 2FJLA 4ZRKA 4K2PA 2J59M 1MAIA 1IRSA 5DHFB 5C79A 2ROZB 1RRPB 3HQCA 1V5PA 4EMOA 1H10A 2ADZA 3ODWA 1X11A 1FHWA 1QC6A 4HB3B 1P5TA 2N23A 4KVGB 4GMXB 2EJ8A 2YT0A 1M7RA 1NU2A 1GC6A 2UZRA 2EMSA 2OTXA 2W2XD 3KRXA 2Y8FA 2Y8GA 1V88A 1XCGA 1H4RA 2CRFA 4NY0A 4YL8A 4A5KA 3AJ4A 3BJIA 3NSUA 2K2UA 3A8QA 2HTHB 4A6FB 1EF1A 2ELAA 3VOQA 2OQBA
chains in the Genus database with same CATH superfamily
2KIEA 2D2QA 2X18A 4MK0A 1FB8A 1BAKA 4DBBA 4D6WA 3P6AA 2DTCA 4GXBA 2RNRB 4CHJA 3D8FA 5JLJB 4F7HA 2GUMA 1U5GA 3NWFA 4QJ4B 3KRWA 1U5DA 4H8SA 2L2IA 4HAWB 5KQ1A 1PLSA 4OT1A 2Q13A 3IVFA 2M14A 3ZDTA 3T06A 1NTYA 5CLLB 2G35A 3O96A 4EKUA 3SUZA 2ZKMX 3MDBC 3OANA 1TJ6A 2XQNM 5JP4A 2AEHA 2IFSA 4HDOA 4GZUA 4DIXA 2BCJA 2RGNB 3DXDA 1LW3A 1AWEA 2DLWA 4K2OA 1I7AA 1UNPA 4DXAB 5JHHA 2RRFA 3PVLA 2YS5A 4GOUA 4DX8A 1DDMA 3P7ZA 1X05A 2LYDA 5LG4B 1K5GB 1J19A 3TVVA 2GCJA 5HE2A 5C16A 1MKEA 1EAZA 3OHMB 1K5DB 5DI9B 1BTNA 1E5WA 2MFQA 5J3TA 2YS1A 4GMVA 3U7DA 4CSQA 2N0YA 1GG3A 3FEHA 4L6EA 2E2XA 4HDQA 4P7IA 5I2SA 2H7DA 1UPQA 2PZ1A 4GN1A 3D8EA 4MY6A 4D0NB 3PVUA 2CY5A 1V61A 1UNQA 3F5RA 4ZRJA 2UVMA 5D3VA 2EC1A 4C0AA 3ML4A 3DXCA 5I2MA 3U12A 3M1IB 1QQGA 2K8EA 2DKQA 4PNKA 3ODOA 1EGXA 2V76A 3TCAA 1U29A 2RLOA 4KAXB 2ZPYA 4HATB 3X23A 4BBKA 4WJ7A 2YS3A 1WGQA 1DYNA 3KY9A 2W2WA 2MDXA 4CHMA 3PZDA 4IOYX 2YF0A 5LOPB 2K00A 3NWDA 4NSWA 5CLQB 3B77A 2D9YA 3SV1A 2Z59A 1KZGA 2COFA 2D9XA 3A98B 5EFXA 2FJUB 1T77A 3BINA 4K17A 5FI0A 1I2HA 1P6SA 2ELBA 2KIGA 1WJ1A 2JP2A 5DH9B 4WSFA 3PSCA 1NTVA 1RJ2A 1UNRA 3F0WA 3HSAA 5J3QA 1ZC3B 3PG7A 2GJYA 2P0DA 1WG7A 5L81A 2D4QA 2I1KA 2IYBA 1FHOA 2J0MA 4EJNA 5HE0A 3UZTA 2RVBB 2R2YA 2YVCA 2DHKA 4A6HA 3FM8C 3VIAA 3MPXA 2DHIA 2Z0QA 3GYOA 4A6FA 2DHJA 1U5FA 2J0KA 4B6HA 1U27A 4KHBB 3WA0A 3CXBB 4HSIA 3HW2B 2NMBA 1OQNA 2L1CA 5C5BB 1Q67A 5KCVA 2LULA 2P8VA 2YT1A 1U5EA 1W1HA 1NI2A 5C6RA 1KI1B 1ZVRA 4L1RA 4KHAA 2R09A 2DX1A 3PP2A 5D3WA 1U2BA 1FHXA 1DDVA 1MIXA 4HAXB 4Z2MB 4A6KA 1ISNA 2LG1A 3SYXA 1MI1A 1Y5OA 3GYPA 4GNKB 3HIEA 1MK7B 2YT2A 3KZ1A 1N3HA 4KHBA 2AL6A 3NW8A 4GPTB 3G9WA 4F7UP 1XD4A 2DA0A 2LOXA 5C5BA 1AQCA 3KSYA 2EMTA 3WYFB 4HAVB 1MIZB 4HB0B 1EVHA 1ZC4B 2KUQA 3DCXA 4F7GA 1FAOA 2DYQA 4XWXA 1OY2A 1X1GA 3TFMA 2RUKB 2W2XC 2J0JA 5M4YB 2H7EA 5LONB 4Y94A 1MPHA 5D3YA 5HE1A 5DHAB 3RCPA 1B55A 2Z4DA 4WVFB 2UZSA 1V89A 1Z87A 2QKMA 4IFSA 2P0FA 5DIFB 1J0WA 1Y19B 3ODXA 1UEFA 1DBHA 1FGYA 1P3RA 2I5CA 3CIKA 4YONA 2RSGA 1X86A 1ZYIA 3QIJA 4CYEA 2GCLA 3A8PA 5IRSA 3ULBA 1PFJA 2DN6A 5JHGA 2MWNB 2QKLA 3SNHA 2LKOA 3PVWA 2Z0OA 3AU4A 3QBVB 2DFKA 1WGUA 3ZVRA 2P0HA 1ZSQA 3PEGA 1X1FA 1FOEA 2K2JA 1TQZA 4QXAB 2CODA 3TW1A 1V5UA 2DKPA 2I1JA 2D10A 1PMSA 4TYZA 4ZRIA 1KZ7A 1M7EA 3TO1A 4QJ5B 1FGZA 1OMWA 3DXEA 3FVCA 2YSZA 3QWMA 2COCA 1WJMA 2D9WA 2M38A 2D9ZA 1XODA 2DYNA 2COAA 3HK0A 2CY4A 1XR0B 1SHCA 2LOZA 2MKRA 2KUPA 4HHVA 4IAPA 4HAZB 3NWAA 3V5WA 1MK9B 5D27A 4DX90 4HAYB 2GS0A 2Z14A 2KCJA 2R0DA 4TKNA 1WVHA 2I5FA 1W1DA 2Y7BA 3FSSA 5GOWB 2KGXB 2VKIA 2NZ8B 3D8DA 4K81A 4HB4B 1TXDA 4KHOA 2Z0PA 3ULCA 2HE7A 3N7CA 5KQ4A 4Z2NA 1LB1A 4MT7A 3SO6A 2Z13A 1SGHA 1WI1A 4OSNA 2ROVA 4HAUB 2VSZA 1UPRA 1W1GA 4PQ0A 5J3YA 2DX5A 5D3XA 5FI1A 1GC7A 1V5MA 2CAYA 2VRWB 1BTKA 1DROA 3LJUX 1XX0A 3U8ZA 1DDWA 1XKEA 5HE3A 2D9VA 4HB2B 2D11A 1BWNA 2YRYA 3AU5A 1ZM0A 2FJLA 4ZRKA 4K2PA 2J59M 1MAIA 2NBVA 1IRSA 5DHFB 5C79A 2ROZB 1RRPB 3HQCA 1V5PA 4EMOA 1H10A 2ADZA 3ODWA 1X11A 1FHWA 1QC6A 4HB3B 1P5TA 2N23A 4KVGB 4GMXB 2EJ8A 2YT0A 1M7RA 1NU2A 1GC6A 2UZRA 2EMSA 2OTXA 2W2XD 2K49A 3KRXA 2Y8FA 2Y8GA 1V88A 2KR0A 1XCGA 1H4RA 2CRFA 4NY0A 4YL8A 4A5KA 3AJ4A 3BJIA 3NSUA 2K2UA 3A8QA 4QJ3B 2HTHB 4A6FB 1EF1A 3A58A 2ELAA 3VOQA 2OQBA
chains in the Genus database with same CATH topology
2D2QA 2X18A 4MK0A 1FB8A 1BAKA 4DBBA 3P6AA 2DTCA 4GXBA 2RNRB 4CHJA 3D8FA 5JLJB 4F7HA 1U5GA 3KRWA 1U5DA 4H8SA 2L2IA 4HAWB 5KQ1A 1PLSA 2Q13A 3IVFA 2M14A 3ZDTA 3T06A 1NTYA 5CLLB 2G35A 3O96A 4EKUA 3SUZA 3MDBC 3OANA 1TJ6A 2XQNM 5JP4A 2AEHA 2IFSA 4HDOA 4GZUA 2BCJA 2RGNB 3DXDA 1LW3A 1AWEA 2DLWA 4K2OA 1I7AA 1UNPA 4DXAB 5JHHA 3PVLA 2YS5A 4DX8A 1DDMA 3P7ZA 1X05A 2LYDA 1K5GB 1J19A 3TVVA 2GCJA 5HE2A 5C16A 1MKEA 1EAZA 1K5DB 5DI9B 1BTNA 1E5WA 2MFQA 5J3TA 2YS1A 4GMVA 3U7DA 2N0YA 1GG3A 3FEHA 4L6EA 2E2XA 4HDQA 4P7IA 2H7DA 1UPQA 2PZ1A 4GN1A 3D8EA 4MY6A 4D0NB 3PVUA 2CY5A 1V61A 1UNQA 3F5RA 4ZRJA 2UVMA 5D3VA 2EC1A 4C0AA 3ML4A 3DXCA 3M1IB 1QQGA 2DKQA 4PNKA 3ODOA 1EGXA 2V76A 3TCAA 1U29A 2RLOA 4KAXB 2ZPYA 4HATB 3X23A 4BBKA 4WJ7A 2YS3A 1WGQA 1DYNA 3KY9A 2W2WA 2MDXA 4CHMA 3PZDA 4IOYX 2YF0A 5LOPB 2K00A 4NSWA 5CLQB 2D9YA 3SV1A 1KZGA 2COFA 2D9XA 3A98B 5EFXA 3BINA 4K17A 5FI0A 1I2HA 1P6SA 2ELBA 1WJ1A 2JP2A 5DH9B 4WSFA 3PSCA 1NTVA 1RJ2A 1UNRA 3F0WA 5J3QA 1ZC3B 3PG7A 2GJYA 2P0DA 1WG7A 5L81A 2D4QA 2I1KA 2IYBA 1FHOA 2J0MA 4EJNA 5HE0A 3UZTA 2RVBB 2YVCA 2DHKA 4A6HA 3FM8C 3VIAA 3MPXA 2DHIA 2Z0QA 3GYOA 4A6FA 2DHJA 1U5FA 2J0KA 4B6HA 1U27A 4KHBB 3WA0A 3CXBB 3HW2B 2NMBA 1OQNA 2L1CA 5C5BB 1Q67A 5KCVA 2LULA 2P8VA 2YT1A 1U5EA 1W1HA 1NI2A 5C6RA 1KI1B 1ZVRA 4KHAA 2R09A 2DX1A 3PP2A 5D3WA 1U2BA 1FHXA 1DDVA 1MIXA 4HAXB 4Z2MB 4A6KA 1ISNA 2LG1A 3SYXA 1Y5OA 3GYPA 1MK7B 3KZ1A 1N3HA 2AL6A 4GPTB 3G9WA 4F7UP 1XD4A 2DA0A 2LOXA 5C5BA 1AQCA 3KSYA 2EMTA 3WYFB 4HAVB 1MIZB 4HB0B 1EVHA 1ZC4B 4F7GA 1FAOA 2DYQA 4XWXA 1OY2A 1X1GA 3TFMA 2RUKB 2W2XC 2J0JA 2H7EA 5LONB 4Y94A 1MPHA 5D3YA 5HE1A 5DHAB 3RCPA 1B55A 4WVFB 2UZSA 1V89A 1Z87A 2QKMA 4IFSA 2P0FA 5DIFB 1J0WA 1Y19B 3ODXA 1UEFA 1DBHA 1FGYA 1P3RA 2I5CA 3CIKA 4YONA 2RSGA 1X86A 3QIJA 4CYEA 2GCLA 3A8PA 3ULBA 1PFJA 2DN6A 5JHGA 2MWNB 2QKLA 3SNHA 2LKOA 3PVWA 2Z0OA 3AU4A 3QBVB 2DFKA 1WGUA 3ZVRA 2P0HA 1ZSQA 3PEGA 1X1FA 1FOEA 2K2JA 1TQZA 2CODA 3TW1A 1V5UA 2DKPA 2I1JA 2D10A 1PMSA 4TYZA 4ZRIA 1KZ7A 1M7EA 3TO1A 1FGZA 1OMWA 3DXEA 2YSZA 3QWMA 2COCA 1WJMA 2D9WA 2M38A 2D9ZA 1XODA 2DYNA 2COAA 3HK0A 2CY4A 1XR0B 1SHCA 2LOZA 2MKRA 2KUPA 4HHVA 4IAPA 4HAZB 3V5WA 1MK9B 5D27A 4DX90 4HAYB 2GS0A 2KCJA 2R0DA 4TKNA 1WVHA 2I5FA 1W1DA 2Y7BA 3FSSA 5GOWB 2KGXB 2VKIA 2NZ8B 3D8DA 4K81A 4HB4B 1TXDA 4KHOA 2Z0PA 3ULCA 2HE7A 3N7CA 5KQ4A 4Z2NA 1LB1A 4MT7A 3SO6A 1SGHA 1WI1A 2ROVA 4HAUB 2VSZA 1UPRA 1W1GA 4PQ0A 5J3YA 2DX5A 5D3XA 5FI1A 1GC7A 1V5MA 2CAYA 2VRWB 1BTKA 1DROA 3LJUX 1XX0A 3U8ZA 1DDWA 1XKEA 5HE3A 2D9VA 4HB2B 2D11A 1BWNA 2YRYA 3AU5A 1ZM0A 2FJLA 4ZRKA 4K2PA 2J59M 1MAIA 1IRSA 5DHFB 5C79A 2ROZB 1RRPB 3HQCA 1V5PA 4EMOA 1H10A 2ADZA 3ODWA 1X11A 1FHWA 1QC6A 4HB3B 1P5TA 2N23A 4KVGB 4GMXB 2EJ8A 2YT0A 1M7RA 1NU2A 1GC6A 2UZRA 2EMSA 2OTXA 2W2XD 3KRXA 2Y8FA 2Y8GA 1V88A 1XCGA 1H4RA 2CRFA 4NY0A 4YL8A 4A5KA 3AJ4A 3BJIA 3NSUA 2K2UA 3A8QA 2HTHB 4A6FB 1EF1A 2ELAA 3VOQA 2OQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2Q A;  2X18 A;  4MK0 A;  1FB8 A;  1BAK A;  4DBB A;  3P6A A;  2DTC A;  4GXB A;  2RNR B;  4CHJ A;  3D8F A;  5JLJ B;  4F7H A;  1U5G A;  3KRW A;  1U5D A;  4H8S A;  2L2I A;  4HAW B;  5KQ1 A;  1PLS A;  2Q13 A;  3IVF A;  2M14 A;  3ZDT A;  3T06 A;  1NTY A;  5CLL B;  2G35 A;  3O96 A;  4EKU A;  3SUZ A;  3MDB C;  3OAN A;  1TJ6 A;  2XQN M;  5JP4 A;  2AEH A;  2IFS A;  4HDO A;  4GZU A;  2BCJ A;  2RGN B;  3DXD A;  1LW3 A;  1AWE A;  2DLW A;  4K2O A;  1I7A A;  1UNP A;  4DXA B;  5JHH A;  3PVL A;  2YS5 A;  4DX8 A;  1DDM A;  3P7Z A;  1X05 A;  2LYD A;  1K5G B;  1J19 A;  3TVV A;  2GCJ A;  5HE2 A;  5C16 A;  1MKE A;  1EAZ A;  1K5D B;  5DI9 B;  1BTN A;  1E5W A;  2MFQ A;  5J3T A;  2YS1 A;  4GMV A;  3U7D A;  2N0Y A;  1GG3 A;  3FEH A;  4L6E A;  2E2X A;  4HDQ A;  4P7I A;  2H7D A;  1UPQ A;  2PZ1 A;  4GN1 A;  3D8E A;  4MY6 A;  4D0N B;  3PVU A;  2CY5 A;  1V61 A;  1UNQ A;  3F5R A;  4ZRJ A;  2UVM A;  5D3V A;  2EC1 A;  4C0A A;  3ML4 A;  3DXC A;  3M1I B;  1QQG A;  2DKQ A;  4PNK A;  3ODO A;  1EGX A;  2V76 A;  3TCA A;  1U29 A;  2RLO A;  4KAX B;  2ZPY A;  4HAT B;  3X23 A;  4BBK A;  4WJ7 A;  2YS3 A;  1WGQ A;  1DYN A;  3KY9 A;  2W2W A;  2MDX A;  4CHM A;  3PZD A;  4IOY X;  2YF0 A;  5LOP B;  2K00 A;  4NSW A;  5CLQ B;  2D9Y A;  3SV1 A;  1KZG A;  2COF A;  2D9X A;  3A98 B;  5EFX A;  3BIN A;  4K17 A;  5FI0 A;  1I2H A;  1P6S A;  2ELB A;  1WJ1 A;  2JP2 A;  5DH9 B;  4WSF A;  3PSC A;  1NTV A;  1RJ2 A;  1UNR A;  3F0W A;  5J3Q A;  1ZC3 B;  3PG7 A;  2GJY A;  2P0D A;  1WG7 A;  5L81 A;  2D4Q A;  2I1K A;  2IYB A;  1FHO A;  2J0M A;  4EJN A;  5HE0 A;  3UZT A;  2RVB B;  2YVC A;  2DHK A;  4A6H A;  3FM8 C;  3VIA A;  3MPX A;  2DHI A;  2Z0Q A;  3GYO A;  4A6F A;  2DHJ A;  1U5F A;  2J0K A;  4B6H A;  1U27 A;  4KHB B;  3WA0 A;  3CXB B;  3HW2 B;  2NMB A;  1OQN A;  2L1C A;  5C5B B;  1Q67 A;  5KCV A;  2LUL A;  2P8V A;  2YT1 A;  1U5E A;  1W1H A;  1NI2 A;  5C6R A;  1KI1 B;  1ZVR A;  4KHA A;  2R09 A;  2DX1 A;  3PP2 A;  5D3W A;  1U2B A;  1FHX A;  1DDV A;  1MIX A;  4HAX B;  4Z2M B;  4A6K A;  1ISN A;  2LG1 A;  3SYX A;  1Y5O A;  3GYP A;  1MK7 B;  3KZ1 A;  1N3H A;  2AL6 A;  4GPT B;  3G9W A;  4F7U P;  1XD4 A;  2DA0 A;  2LOX A;  5C5B A;  1AQC A;  3KSY A;  2EMT A;  3WYF B;  4HAV B;  1MIZ B;  4HB0 B;  1EVH A;  1ZC4 B;  4F7G A;  1FAO A;  2DYQ A;  4XWX A;  1OY2 A;  1X1G A;  3TFM A;  2RUK B;  2W2X C;  2J0J A;  2H7E A;  5LON B;  4Y94 A;  1MPH A;  5D3Y A;  5HE1 A;  5DHA B;  3RCP A;  1B55 A;  4WVF B;  2UZS A;  1V89 A;  1Z87 A;  2QKM A;  4IFS A;  2P0F A;  5DIF B;  1J0W A;  1Y19 B;  3ODX A;  1UEF A;  1DBH A;  1FGY A;  1P3R A;  2I5C A;  3CIK A;  4YON A;  2RSG A;  1X86 A;  3QIJ A;  4CYE A;  2GCL A;  3A8P A;  3ULB A;  1PFJ A;  2DN6 A;  5JHG A;  2MWN B;  2QKL A;  3SNH A;  2LKO A;  3PVW A;  2Z0O A;  3AU4 A;  3QBV B;  2DFK A;  1WGU A;  3ZVR A;  2P0H A;  1ZSQ A;  3PEG A;  1X1F A;  1FOE A;  2K2J A;  1TQZ A;  2COD A;  3TW1 A;  1V5U A;  2DKP A;  2I1J A;  2D10 A;  1PMS A;  4TYZ A;  4ZRI A;  1KZ7 A;  1M7E A;  3TO1 A;  1FGZ A;  1OMW A;  3DXE A;  2YSZ A;  3QWM A;  2COC A;  1WJM A;  2D9W A;  2M38 A;  2D9Z A;  1XOD A;  2DYN A;  2COA A;  3HK0 A;  2CY4 A;  1XR0 B;  1SHC A;  2LOZ A;  2MKR A;  2KUP A;  4HHV A;  4IAP A;  4HAZ B;  3V5W A;  1MK9 B;  5D27 A;  4DX9 0;  4HAY B;  2GS0 A;  2KCJ A;  2R0D A;  4TKN A;  1WVH A;  2I5F A;  1W1D A;  2Y7B A;  3FSS A;  5GOW B;  2KGX B;  2VKI A;  2NZ8 B;  3D8D A;  4K81 A;  4HB4 B;  1TXD A;  4KHO A;  2Z0P A;  3ULC A;  2HE7 A;  3N7C A;  5KQ4 A;  4Z2N A;  1LB1 A;  4MT7 A;  3SO6 A;  1SGH A;  1WI1 A;  2ROV A;  4HAU B;  2VSZ A;  1UPR A;  1W1G A;  4PQ0 A;  5J3Y A;  2DX5 A;  5D3X A;  5FI1 A;  1GC7 A;  1V5M A;  2CAY A;  2VRW B;  1BTK A;  1DRO A;  3LJU X;  1XX0 A;  3U8Z A;  1DDW A;  1XKE A;  5HE3 A;  2D9V A;  4HB2 B;  2D11 A;  1BWN A;  2YRY A;  3AU5 A;  1ZM0 A;  2FJL A;  4ZRK A;  4K2P A;  2J59 M;  1MAI A;  1IRS A;  5DHF B;  5C79 A;  2ROZ B;  1RRP B;  3HQC A;  1V5P A;  4EMO A;  1H10 A;  2ADZ A;  3ODW A;  1X11 A;  1FHW A;  1QC6 A;  4HB3 B;  1P5T A;  2N23 A;  4KVG B;  4GMX B;  2EJ8 A;  2YT0 A;  1M7R A;  1NU2 A;  1GC6 A;  2UZR A;  2EMS A;  2OTX A;  2W2X D;  3KRX A;  2Y8F A;  2Y8G A;  1V88 A;  1XCG A;  1H4R A;  2CRF A;  4NY0 A;  4YL8 A;  4A5K A;  3AJ4 A;  3BJI A;  3NSU A;  2K2U A;  3A8Q A;  2HTH B;  4A6F B;  1EF1 A;  2ELA A;  3VOQ A;  2OQB A; 
#chains in the Genus database with same CATH topology
 2KIE A;  2D2Q A;  2X18 A;  4MK0 A;  1FB8 A;  1BAK A;  4DBB A;  4D6W A;  3P6A A;  2DTC A;  4GXB A;  2RNR B;  4CHJ A;  3D8F A;  5JLJ B;  4F7H A;  2GUM A;  1U5G A;  3NWF A;  4QJ4 B;  3KRW A;  1U5D A;  4H8S A;  2L2I A;  4HAW B;  5KQ1 A;  1PLS A;  4OT1 A;  2Q13 A;  3IVF A;  2M14 A;  3ZDT A;  3T06 A;  1NTY A;  5CLL B;  2G35 A;  3O96 A;  4EKU A;  3SUZ A;  2ZKM X;  3MDB C;  3OAN A;  1TJ6 A;  2XQN M;  5JP4 A;  2AEH A;  2IFS A;  4HDO A;  4GZU A;  4DIX A;  2BCJ A;  2RGN B;  3DXD A;  1LW3 A;  1AWE A;  2DLW A;  4K2O A;  1I7A A;  1UNP A;  4DXA B;  5JHH A;  2RRF A;  3PVL A;  2YS5 A;  4GOU A;  4DX8 A;  1DDM A;  3P7Z A;  1X05 A;  2LYD A;  5LG4 B;  1K5G B;  1J19 A;  3TVV A;  2GCJ A;  5HE2 A;  5C16 A;  1MKE A;  1EAZ A;  3OHM B;  1K5D B;  5DI9 B;  1BTN A;  1E5W A;  2MFQ A;  5J3T A;  2YS1 A;  4GMV A;  3U7D A;  4CSQ A;  2N0Y A;  1GG3 A;  3FEH A;  4L6E A;  2E2X A;  4HDQ A;  4P7I A;  5I2S A;  2H7D A;  1UPQ A;  2PZ1 A;  4GN1 A;  3D8E A;  4MY6 A;  4D0N B;  3PVU A;  2CY5 A;  1V61 A;  1UNQ A;  3F5R A;  4ZRJ A;  2UVM A;  5D3V A;  2EC1 A;  4C0A A;  3ML4 A;  3DXC A;  5I2M A;  3U12 A;  3M1I B;  1QQG A;  2K8E A;  2DKQ A;  4PNK A;  3ODO A;  1EGX A;  2V76 A;  3TCA A;  1U29 A;  2RLO A;  4KAX B;  2ZPY A;  4HAT B;  3X23 A;  4BBK A;  4WJ7 A;  2YS3 A;  1WGQ A;  1DYN A;  3KY9 A;  2W2W A;  2MDX A;  4CHM A;  3PZD A;  4IOY X;  2YF0 A;  5LOP B;  2K00 A;  3NWD A;  4NSW A;  5CLQ B;  3B77 A;  2D9Y A;  3SV1 A;  2Z59 A;  1KZG A;  2COF A;  2D9X A;  3A98 B;  5EFX A;  2FJU B;  1T77 A;  3BIN A;  4K17 A;  5FI0 A;  1I2H A;  1P6S A;  2ELB A;  2KIG A;  1WJ1 A;  2JP2 A;  5DH9 B;  4WSF A;  3PSC A;  1NTV A;  1RJ2 A;  1UNR A;  3F0W A;  3HSA A;  5J3Q A;  1ZC3 B;  3PG7 A;  2GJY A;  2P0D A;  1WG7 A;  5L81 A;  2D4Q A;  2I1K A;  2IYB A;  1FHO A;  2J0M A;  4EJN A;  5HE0 A;  3UZT A;  2RVB B;  2R2Y A;  2YVC A;  2DHK A;  4A6H A;  3FM8 C;  3VIA A;  3MPX A;  2DHI A;  2Z0Q A;  3GYO A;  4A6F A;  2DHJ A;  1U5F A;  2J0K A;  4B6H A;  1U27 A;  4KHB B;  3WA0 A;  3CXB B;  4HSI A;  3HW2 B;  2NMB A;  1OQN A;  2L1C A;  5C5B B;  1Q67 A;  5KCV A;  2LUL A;  2P8V A;  2YT1 A;  1U5E A;  1W1H A;  1NI2 A;  5C6R A;  1KI1 B;  1ZVR A;  4L1R A;  4KHA A;  2R09 A;  2DX1 A;  3PP2 A;  5D3W A;  1U2B A;  1FHX A;  1DDV A;  1MIX A;  4HAX B;  4Z2M B;  4A6K A;  1ISN A;  2LG1 A;  3SYX A;  1MI1 A;  1Y5O A;  3GYP A;  4GNK B;  3HIE A;  1MK7 B;  2YT2 A;  3KZ1 A;  1N3H A;  4KHB A;  2AL6 A;  3NW8 A;  4GPT B;  3G9W A;  4F7U P;  1XD4 A;  2DA0 A;  2LOX A;  5C5B A;  1AQC A;  3KSY A;  2EMT A;  3WYF B;  4HAV B;  1MIZ B;  4HB0 B;  1EVH A;  1ZC4 B;  2KUQ A;  3DCX A;  4F7G A;  1FAO A;  2DYQ A;  4XWX A;  1OY2 A;  1X1G A;  3TFM A;  2RUK B;  2W2X C;  2J0J A;  5M4Y B;  2H7E A;  5LON B;  4Y94 A;  1MPH A;  5D3Y A;  5HE1 A;  5DHA B;  3RCP A;  1B55 A;  2Z4D A;  4WVF B;  2UZS A;  1V89 A;  1Z87 A;  2QKM A;  4IFS A;  2P0F A;  5DIF B;  1J0W A;  1Y19 B;  3ODX A;  1UEF A;  1DBH A;  1FGY A;  1P3R A;  2I5C A;  3CIK A;  4YON A;  2RSG A;  1X86 A;  1ZYI A;  3QIJ A;  4CYE A;  2GCL A;  3A8P A;  5IRS A;  3ULB A;  1PFJ A;  2DN6 A;  5JHG A;  2MWN B;  2QKL A;  3SNH A;  2LKO A;  3PVW A;  2Z0O A;  3AU4 A;  3QBV B;  2DFK A;  1WGU A;  3ZVR A;  2P0H A;  1ZSQ A;  3PEG A;  1X1F A;  1FOE A;  2K2J A;  1TQZ A;  4QXA B;  2COD A;  3TW1 A;  1V5U A;  2DKP A;  2I1J A;  2D10 A;  1PMS A;  4TYZ A;  4ZRI A;  1KZ7 A;  1M7E A;  3TO1 A;  4QJ5 B;  1FGZ A;  1OMW A;  3DXE A;  3FVC A;  2YSZ A;  3QWM A;  2COC A;  1WJM A;  2D9W A;  2M38 A;  2D9Z A;  1XOD A;  2DYN A;  2COA A;  3HK0 A;  2CY4 A;  1XR0 B;  1SHC A;  2LOZ A;  2MKR A;  2KUP A;  4HHV A;  4IAP A;  4HAZ B;  3NWA A;  3V5W A;  1MK9 B;  5D27 A;  4DX9 0;  4HAY B;  2GS0 A;  2Z14 A;  2KCJ A;  2R0D A;  4TKN A;  1WVH A;  2I5F A;  1W1D A;  2Y7B A;  3FSS A;  5GOW B;  2KGX B;  2VKI A;  2NZ8 B;  3D8D A;  4K81 A;  4HB4 B;  1TXD A;  4KHO A;  2Z0P A;  3ULC A;  2HE7 A;  3N7C A;  5KQ4 A;  4Z2N A;  1LB1 A;  4MT7 A;  3SO6 A;  2Z13 A;  1SGH A;  1WI1 A;  4OSN A;  2ROV A;  4HAU B;  2VSZ A;  1UPR A;  1W1G A;  4PQ0 A;  5J3Y A;  2DX5 A;  5D3X A;  5FI1 A;  1GC7 A;  1V5M A;  2CAY A;  2VRW B;  1BTK A;  1DRO A;  3LJU X;  1XX0 A;  3U8Z A;  1DDW A;  1XKE A;  5HE3 A;  2D9V A;  4HB2 B;  2D11 A;  1BWN A;  2YRY A;  3AU5 A;  1ZM0 A;  2FJL A;  4ZRK A;  4K2P A;  2J59 M;  1MAI A;  2NBV A;  1IRS A;  5DHF B;  5C79 A;  2ROZ B;  1RRP B;  3HQC A;  1V5P A;  4EMO A;  1H10 A;  2ADZ A;  3ODW A;  1X11 A;  1FHW A;  1QC6 A;  4HB3 B;  1P5T A;  2N23 A;  4KVG B;  4GMX B;  2EJ8 A;  2YT0 A;  1M7R A;  1NU2 A;  1GC6 A;  2UZR A;  2EMS A;  2OTX A;  2W2X D;  2K49 A;  3KRX A;  2Y8F A;  2Y8G A;  1V88 A;  2KR0 A;  1XCG A;  1H4R A;  2CRF A;  4NY0 A;  4YL8 A;  4A5K A;  3AJ4 A;  3BJI A;  3NSU A;  2K2U A;  3A8Q A;  4QJ3 B;  2HTH B;  4A6F B;  1EF1 A;  3A58 A;  2ELA A;  3VOQ A;  2OQB A; 
#chains in the Genus database with same CATH homology
 2D2Q A;  2X18 A;  4MK0 A;  1FB8 A;  1BAK A;  4DBB A;  3P6A A;  2DTC A;  4GXB A;  2RNR B;  4CHJ A;  3D8F A;  5JLJ B;  4F7H A;  1U5G A;  3KRW A;  1U5D A;  4H8S A;  2L2I A;  4HAW B;  5KQ1 A;  1PLS A;  2Q13 A;  3IVF A;  2M14 A;  3ZDT A;  3T06 A;  1NTY A;  5CLL B;  2G35 A;  3O96 A;  4EKU A;  3SUZ A;  3MDB C;  3OAN A;  1TJ6 A;  2XQN M;  5JP4 A;  2AEH A;  2IFS A;  4HDO A;  4GZU A;  2BCJ A;  2RGN B;  3DXD A;  1LW3 A;  1AWE A;  2DLW A;  4K2O A;  1I7A A;  1UNP A;  4DXA B;  5JHH A;  3PVL A;  2YS5 A;  4DX8 A;  1DDM A;  3P7Z A;  1X05 A;  2LYD A;  1K5G B;  1J19 A;  3TVV A;  2GCJ A;  5HE2 A;  5C16 A;  1MKE A;  1EAZ A;  1K5D B;  5DI9 B;  1BTN A;  1E5W A;  2MFQ A;  5J3T A;  2YS1 A;  4GMV A;  3U7D A;  2N0Y A;  1GG3 A;  3FEH A;  4L6E A;  2E2X A;  4HDQ A;  4P7I A;  2H7D A;  1UPQ A;  2PZ1 A;  4GN1 A;  3D8E A;  4MY6 A;  4D0N B;  3PVU A;  2CY5 A;  1V61 A;  1UNQ A;  3F5R A;  4ZRJ A;  2UVM A;  5D3V A;  2EC1 A;  4C0A A;  3ML4 A;  3DXC A;  3M1I B;  1QQG A;  2DKQ A;  4PNK A;  3ODO A;  1EGX A;  2V76 A;  3TCA A;  1U29 A;  2RLO A;  4KAX B;  2ZPY A;  4HAT B;  3X23 A;  4BBK A;  4WJ7 A;  2YS3 A;  1WGQ A;  1DYN A;  3KY9 A;  2W2W A;  2MDX A;  4CHM A;  3PZD A;  4IOY X;  2YF0 A;  5LOP B;  2K00 A;  4NSW A;  5CLQ B;  2D9Y A;  3SV1 A;  1KZG A;  2COF A;  2D9X A;  3A98 B;  5EFX A;  3BIN A;  4K17 A;  5FI0 A;  1I2H A;  1P6S A;  2ELB A;  1WJ1 A;  2JP2 A;  5DH9 B;  4WSF A;  3PSC A;  1NTV A;  1RJ2 A;  1UNR A;  3F0W A;  5J3Q A;  1ZC3 B;  3PG7 A;  2GJY A;  2P0D A;  1WG7 A;  5L81 A;  2D4Q A;  2I1K A;  2IYB A;  1FHO A;  2J0M A;  4EJN A;  5HE0 A;  3UZT A;  2RVB B;  2YVC A;  2DHK A;  4A6H A;  3FM8 C;  3VIA A;  3MPX A;  2DHI A;  2Z0Q A;  3GYO A;  4A6F A;  2DHJ A;  1U5F A;  2J0K A;  4B6H A;  1U27 A;  4KHB B;  3WA0 A;  3CXB B;  3HW2 B;  2NMB A;  1OQN A;  2L1C A;  5C5B B;  1Q67 A;  5KCV A;  2LUL A;  2P8V A;  2YT1 A;  1U5E A;  1W1H A;  1NI2 A;  5C6R A;  1KI1 B;  1ZVR A;  4KHA A;  2R09 A;  2DX1 A;  3PP2 A;  5D3W A;  1U2B A;  1FHX A;  1DDV A;  1MIX A;  4HAX B;  4Z2M B;  4A6K A;  1ISN A;  2LG1 A;  3SYX A;  1Y5O A;  3GYP A;  1MK7 B;  3KZ1 A;  1N3H A;  2AL6 A;  4GPT B;  3G9W A;  4F7U P;  1XD4 A;  2DA0 A;  2LOX A;  5C5B A;  1AQC A;  3KSY A;  2EMT A;  3WYF B;  4HAV B;  1MIZ B;  4HB0 B;  1EVH A;  1ZC4 B;  4F7G A;  1FAO A;  2DYQ A;  4XWX A;  1OY2 A;  1X1G A;  3TFM A;  2RUK B;  2W2X C;  2J0J A;  2H7E A;  5LON B;  4Y94 A;  1MPH A;  5D3Y A;  5HE1 A;  5DHA B;  3RCP A;  1B55 A;  4WVF B;  2UZS A;  1V89 A;  1Z87 A;  2QKM A;  4IFS A;  2P0F A;  5DIF B;  1J0W A;  1Y19 B;  3ODX A;  1UEF A;  1DBH A;  1FGY A;  1P3R A;  2I5C A;  3CIK A;  4YON A;  2RSG A;  1X86 A;  3QIJ A;  4CYE A;  2GCL A;  3A8P A;  3ULB A;  1PFJ A;  2DN6 A;  5JHG A;  2MWN B;  2QKL A;  3SNH A;  2LKO A;  3PVW A;  2Z0O A;  3AU4 A;  3QBV B;  2DFK A;  1WGU A;  3ZVR A;  2P0H A;  1ZSQ A;  3PEG A;  1X1F A;  1FOE A;  2K2J A;  1TQZ A;  2COD A;  3TW1 A;  1V5U A;  2DKP A;  2I1J A;  2D10 A;  1PMS A;  4TYZ A;  4ZRI A;  1KZ7 A;  1M7E A;  3TO1 A;  1FGZ A;  1OMW A;  3DXE A;  2YSZ A;  3QWM A;  2COC A;  1WJM A;  2D9W A;  2M38 A;  2D9Z A;  1XOD A;  2DYN A;  2COA A;  3HK0 A;  2CY4 A;  1XR0 B;  1SHC A;  2LOZ A;  2MKR A;  2KUP A;  4HHV A;  4IAP A;  4HAZ B;  3V5W A;  1MK9 B;  5D27 A;  4DX9 0;  4HAY B;  2GS0 A;  2KCJ A;  2R0D A;  4TKN A;  1WVH A;  2I5F A;  1W1D A;  2Y7B A;  3FSS A;  5GOW B;  2KGX B;  2VKI A;  2NZ8 B;  3D8D A;  4K81 A;  4HB4 B;  1TXD A;  4KHO A;  2Z0P A;  3ULC A;  2HE7 A;  3N7C A;  5KQ4 A;  4Z2N A;  1LB1 A;  4MT7 A;  3SO6 A;  1SGH A;  1WI1 A;  2ROV A;  4HAU B;  2VSZ A;  1UPR A;  1W1G A;  4PQ0 A;  5J3Y A;  2DX5 A;  5D3X A;  5FI1 A;  1GC7 A;  1V5M A;  2CAY A;  2VRW B;  1BTK A;  1DRO A;  3LJU X;  1XX0 A;  3U8Z A;  1DDW A;  1XKE A;  5HE3 A;  2D9V A;  4HB2 B;  2D11 A;  1BWN A;  2YRY A;  3AU5 A;  1ZM0 A;  2FJL A;  4ZRK A;  4K2P A;  2J59 M;  1MAI A;  1IRS A;  5DHF B;  5C79 A;  2ROZ B;  1RRP B;  3HQC A;  1V5P A;  4EMO A;  1H10 A;  2ADZ A;  3ODW A;  1X11 A;  1FHW A;  1QC6 A;  4HB3 B;  1P5T A;  2N23 A;  4KVG B;  4GMX B;  2EJ8 A;  2YT0 A;  1M7R A;  1NU2 A;  1GC6 A;  2UZR A;  2EMS A;  2OTX A;  2W2X D;  3KRX A;  2Y8F A;  2Y8G A;  1V88 A;  1XCG A;  1H4R A;  2CRF A;  4NY0 A;  4YL8 A;  4A5K A;  3AJ4 A;  3BJI A;  3NSU A;  2K2U A;  3A8Q A;  2HTH B;  4A6F B;  1EF1 A;  2ELA A;  3VOQ A;  2OQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...