1U2BA

Triglycine variant of the grp1 pleckstrin homology domain unliganded
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
TFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid binding protein
molecule keywords Cytohesin 3
total genus 22
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u2bA00
3O96A 1DDMA 3CXBB 4Z2MB 3DXDA 1TXDA 1ZM0A 1P3RA 5DI9B 1UNRA 5DH9B 2LULA 3BJIA 2DFKA 1EF1A 2Z0QA 1XCGA 2Y7BA 3VOQA 3KSYA 3D8DA 2I1KA 3KRXA 4HAUB 1BAKA 1TJ6A 2MFQA 4BBKA 1V5PA 4CHMA 5C5BB 1GG3A 4YONA 5J3YA 4KHAA 1U27A 4HAXB 1AWEA 2VRWB 1BTNA 2RLOA 3ULBA 4DX90 2X18A 3HK0A 4WVFB 2DKPA 2G35A 4P7IA 2IYBA 5D3YA 4MK0A 5L81A 1LB1A 2EMTA 2W2XC 4GMVA 2YF0A 2W2WA 2CY5A 2J0KA 5FI0A 4GXBA 2LOZA 2AL6A 2RVBB 3PVWA 3GYOA 4ZRKA 5CLQB 5D3WA 2D11A 2Q13A 2Y8FA 5JHHA 3DXCA 2K2JA 5J3QA 3KRWA 2W2XD 1PFJA 1AQCA 1QQGA 3TFMA 4YL8A 1X86A 2DHJA 3FM8C 4L6EA 3T06A 1NTVA 4ZRIA 1SHCA 5LOPB 4HDQA 2H7EA 3G9WA 2DHIA 1U5DA 2LOXA 5DIFB 1DYNA 1UNQA 2R0DA 2DX5A 2D2QA 4NSWA 5J3TA 3CIKA 3ZDTA 3WYFB 2RSGA 1FHOA 2K2UA 2LKOA 1W1HA 2D9XA 1KZGA 2YS3A 1NU2A 5LONB 5CLLB 2HTHB 2Z0OA 1M7RA 2D9YA 4HATB 4KVGB 3QWMA 2Y8GA 2YT0A 4HB4B 1XR0B 4A6KA 2QKMA 1XKEA 4PQ0A 1OMWA 1X05A 1Q67A 1J19A 4CYEA 4HAVB 4MT7A 2COCA 3MPXA 5EFXA 5C79A 3F0WA 4A6HA 1IRSA 2DN6A 4H8SA 2ADZA 3FEHA 2DA0A 1DDWA 3PZDA 2D9VA 2YS5A 4IFSA 1BWNA 4EMOA 2GS0A 1OQNA 2NMBA 1V88A 2IFSA 1U5FA 1B55A 1W1GA 2R09A 1DDVA 1K5GB 2V76A 1MKEA 2I5FA 3NSUA 1N3HA 2XQNM 2H7DA 2Z0PA 4HB2B 4K81A 2COAA 2D10A 1ISNA 5KQ4A 1EGXA 4DX8A 1KZ7A 4D0NB 3VIAA 4XWXA 3D8EA 3ODXA 4NY0A 3PG7A 3PSCA 2P0HA 1K5DB 4DXAB 2RNRB 4HAYB 2E2XA 1FHWA 2J0JA 3P6AA 2FJLA 2CAYA 3TVVA 2D9WA 2YSZA 3ULCA 2YRYA 3OANA 3SNHA 2RUKB 2CRFA 4HHVA 1FHXA 3U7DA 4K2OA 1J0WA 1MPHA 1E5WA 2MKRA 3AU4A 3M1IB 1X1GA 2N23A 3TW1A 4A6FB 4HB3B 1Y19B 4DBBA 2L2IA 2JP2A 3SO6A 3V5WA 1V5MA 1FGYA 3IVFA 3PP2A 4MY6A 3PEGA 4ZRJA 3HQCA 2QKLA 1WGUA 3KY9A 1U5EA 2KGXB 2BCJA 1TQZA 1U2BA 2P8VA 2OTXA 1WJ1A 1RRPB 4TYZA 2YT1A 2K00A 1ZVRA 2NZ8B 1UPQA 1H10A 3UZTA 1UPRA 3PVLA 1WVHA 4HDOA 3PVUA 2DKQA 1NI2A 1OY2A 1M7EA 1WG7A 3ODWA 1WI1A 3QIJA 4F7UP 4K17A 2EJ8A 2DLWA 1PMSA 2EMSA 4PNKA 4HAZB 4GZUA 2CY4A 1RJ2A 3X23A 1H4RA 1GC7A 2LYDA 1Y5OA 3TCAA 2AEHA 3A8PA 3P7ZA 2EC1A 2KUPA 4B6HA 2UVMA 1NTYA 2COFA 3ML4A 5DHAB 1FGZA 3SYXA 1KI1B 1DBHA 1WJMA 2M38A 2M14A 5GOWB 2LG1A 2ELBA 4WJ7A 4Y94A 1MAIA 5HE2A 5JLJB 1W1DA 1P5TA 1V61A 3DXEA 4A6FA 4KHBB 4TKNA 1MK9B 1EVHA 2D4QA 2RGNB 3QBVB 5D3XA 2KCJA 2ELAA 5C16A 2ROVA 2HE7A 1V89A 2GCLA 4CHJA 3U8ZA 2CODA 3TO1A 3ODOA 4GMXB 5D27A 3AJ4A 3KZ1A 2DX1A 3WA0A 1X1FA 1BTKA 2P0DA 3A8QA 4IAPA 4K2PA 3ZVRA 1SGHA 4WSFA 1MK7B 1UNPA 5HE0A 1WGQA 2YS1A 1V5UA 2J59M 2DTCA 5D3VA 5HE1A 2ROZB 2UZSA 3SUZA 2L1CA 2D9ZA 2GJYA 3F5RA 2P0FA 4GN1A 2MWNB 3FSSA 4EJNA 2I1JA 1EAZA 4A5KA 2I5CA 2MDXA 1U5GA 2J0MA 1GC6A 4C0AA 2DHKA 1MIXA 1U29A 1FAOA 1ZC4B 1XODA 2GCJA 3N7CA 4HAWB 2VSZA 2DYNA 5KQ1A 2UZRA 4F7HA 4HB0B 2ZPYA 1MIZB 1I7AA 1DROA 2YVCA 3MDBC 4EKUA 1UEFA 1Z87A 2DYQA 3A98B 5HE3A 1FB8A 1XD4A 3GYPA 4F7GA 4Z2NA 3D8FA 2OQBA 3HW2B 1I2HA 1X11A 5FI1A 3LJUX 2VKIA 1ZSQA 3RCPA 5JP4A 1ZC3B 4GPTB 4IOYX 5KCVA 1LW3A 5JHGA 5DHFB 1P6SA 5C6RA 1PLSA 5C5BA 2N0YA 1QC6A 4KAXB 4KHOA 3AU5A 1XX0A 3SV1A 1FOEA 3BINA 2PZ1A
chains in the Genus database with same CATH superfamily
3O96A 1DDMA 3CXBB 3A58A 4Z2MB 3DXDA 4QJ3B 1TXDA 3HSAA 1ZM0A 1P3RA 5DI9B 1UNRA 5DH9B 2LULA 3BJIA 2DFKA 1EF1A 2Z0QA 1XCGA 2Y7BA 3VOQA 3KSYA 3D8DA 2I1KA 3KRXA 4HAUB 1BAKA 1TJ6A 2MFQA 4BBKA 2FJUB 1V5PA 4CHMA 5C5BB 1GG3A 4YONA 5J3YA 4KHAA 1U27A 4HAXB 4DIXA 1AWEA 2VRWB 1BTNA 2RLOA 3ULBA 4DX90 2X18A 3HK0A 4WVFB 2DKPA 2G35A 4P7IA 2IYBA 2GUMA 5D3YA 3NWAA 4MK0A 4QJ4B 5L81A 1LB1A 2KUQA 2EMTA 2W2XC 4GMVA 2YF0A 2W2WA 2CY5A 2J0KA 5FI0A 5LG4B 4GXBA 2KIEA 2LOZA 2AL6A 2RVBB 3PVWA 3GYOA 4ZRKA 5CLQB 5D3WA 2D11A 2Q13A 2Y8FA 5JHHA 2YT2A 2K2JA 3DXCA 5J3QA 3KRWA 2W2XD 1PFJA 1AQCA 1QQGA 3TFMA 4YL8A 1X86A 2R2YA 2DHJA 3FM8C 4QXAB 4L6EA 2RRFA 3T06A 1NTVA 4ZRIA 1SHCA 5LOPB 4HDQA 2H7EA 3G9WA 2DHIA 1U5DA 2KIGA 2LOXA 5DIFB 1DYNA 1UNQA 2R0DA 2DX5A 2D2QA 4NSWA 5J3TA 3CIKA 3ZDTA 3WYFB 2RSGA 1FHOA 2K2UA 2LKOA 1W1HA 2D9XA 1KZGA 2YS3A 1NU2A 5LONB 5CLLB 2HTHB 2Z0OA 1M7RA 2D9YA 3OHMB 4HATB 4KVGB 3QWMA 2Y8GA 2YT0A 4HB4B 1XR0B 4A6KA 2QKMA 4KHBA 1XKEA 3HIEA 4PQ0A 1OMWA 1X05A 1Q67A 1J19A 4CYEA 4HAVB 4MT7A 2K49A 2COCA 3MPXA 5EFXA 5C79A 1T77A 3F0WA 4A6HA 1IRSA 2DN6A 4H8SA 2ADZA 3FEHA 2Z13A 2NBVA 2DA0A 1DDWA 3PZDA 3NWFA 3NW8A 2D9VA 2YS5A 5IRSA 4IFSA 1BWNA 4EMOA 2GS0A 1OQNA 2NMBA 1V88A 2IFSA 1U5FA 1B55A 1W1GA 2R09A 1DDVA 1K5GB 2V76A 1MKEA 5I2MA 2I5FA 3NSUA 1N3HA 2XQNM 2H7DA 2Z0PA 4HB2B 4K81A 2COAA 2D10A 1ISNA 5KQ4A 1EGXA 4CSQA 4DX8A 1KZ7A 3NWDA 4D0NB 3VIAA 4XWXA 3D8EA 3ODXA 4HSIA 4NY0A 3PG7A 3PSCA 2P0HA 1K5DB 4DXAB 2RNRB 4HAYB 2E2XA 1FHWA 2J0JA 3P6AA 2FJLA 2CAYA 3TVVA 2D9WA 2YSZA 3ULCA 2YRYA 3OANA 4OT1A 3SNHA 2RUKB 2CRFA 4HHVA 1ZYIA 1FHXA 4D6WA 3U7DA 4K2OA 1J0WA 1MPHA 1E5WA 2MKRA 3AU4A 3M1IB 1X1GA 2Z14A 2N23A 3TW1A 4A6FB 4HB3B 1Y19B 4DBBA 2L2IA 2JP2A 3SO6A 3V5WA 1V5MA 1FGYA 3IVFA 3PP2A 4MY6A 3PEGA 4ZRJA 3HQCA 2QKLA 1WGUA 3KY9A 1U5EA 2KGXB 2BCJA 2ZKMX 3FVCA 1TQZA 1U2BA 2P8VA 2OTXA 1WJ1A 1RRPB 2Z59A 4TYZA 2YT1A 2K00A 1ZVRA 2NZ8B 1UPQA 1H10A 3UZTA 1UPRA 3PVLA 1WVHA 4HDOA 3PVUA 2K8EA 2DKQA 1NI2A 1OY2A 1M7EA 1WG7A 3ODWA 1WI1A 3QIJA 4F7UP 4K17A 2EJ8A 2DLWA 1PMSA 3DCXA 2EMSA 4PNKA 4HAZB 4GZUA 2CY4A 2Z4DA 1RJ2A 3X23A 1H4RA 5I2SA 1GC7A 2LYDA 1Y5OA 3TCAA 2AEHA 3A8PA 3P7ZA 2EC1A 2KR0A 2KUPA 4B6HA 2UVMA 1NTYA 2COFA 3ML4A 5DHAB 1FGZA 3SYXA 1KI1B 1DBHA 1WJMA 2M38A 4L1RA 2M14A 4GNKB 5GOWB 2LG1A 2ELBA 4WJ7A 4Y94A 1MAIA 5HE2A 5JLJB 1W1DA 1P5TA 1V61A 3DXEA 4A6FA 4KHBB 4TKNA 1MK9B 1EVHA 2D4QA 2RGNB 3QBVB 5D3XA 2KCJA 2ELAA 5C16A 2ROVA 2HE7A 1V89A 2GCLA 4CHJA 3U8ZA 2CODA 3TO1A 3ODOA 4GMXB 5D27A 3AJ4A 3KZ1A 2DX1A 4QJ5B 3WA0A 1X1FA 1BTKA 2P0DA 3A8QA 4IAPA 4K2PA 3ZVRA 1SGHA 4WSFA 1MK7B 1UNPA 5HE0A 1WGQA 2YS1A 1V5UA 2J59M 2DTCA 5D3VA 5HE1A 2ROZB 2UZSA 3SUZA 2L1CA 2D9ZA 5M4YB 2GJYA 3F5RA 2P0FA 4GN1A 2MWNB 3FSSA 4EJNA 2I1JA 1EAZA 4A5KA 2I5CA 2MDXA 1U5GA 2J0MA 1GC6A 4C0AA 2DHKA 1MIXA 1U29A 1FAOA 1ZC4B 1XODA 2GCJA 3N7CA 4HAWB 2VSZA 2DYNA 5KQ1A 3B77A 2UZRA 4F7HA 4HB0B 4OSNA 2ZPYA 1MIZB 1I7AA 1DROA 2YVCA 3MDBC 4EKUA 1UEFA 1Z87A 2DYQA 3A98B 5HE3A 1FB8A 1XD4A 3GYPA 4F7GA 4Z2NA 3D8FA 2OQBA 3HW2B 1I2HA 1MI1A 1X11A 5FI1A 3LJUX 3U12A 2VKIA 1ZSQA 3RCPA 5JP4A 1ZC3B 4GPTB 4IOYX 4GOUA 5KCVA 1LW3A 5JHGA 5DHFB 1P6SA 5C6RA 1PLSA 5C5BA 2N0YA 1QC6A 4KAXB 4KHOA 3AU5A 1XX0A 3SV1A 1FOEA 3BINA 2PZ1A
chains in the Genus database with same CATH topology
3O96A 1DDMA 3CXBB 4Z2MB 3DXDA 1TXDA 1ZM0A 1P3RA 5DI9B 1UNRA 5DH9B 2LULA 3BJIA 2DFKA 1EF1A 2Z0QA 1XCGA 2Y7BA 3VOQA 3KSYA 3D8DA 2I1KA 3KRXA 4HAUB 1BAKA 1TJ6A 2MFQA 4BBKA 1V5PA 4CHMA 5C5BB 1GG3A 4YONA 5J3YA 4KHAA 1U27A 4HAXB 1AWEA 2VRWB 1BTNA 2RLOA 3ULBA 4DX90 2X18A 3HK0A 4WVFB 2DKPA 2G35A 4P7IA 2IYBA 5D3YA 4MK0A 5L81A 1LB1A 2EMTA 2W2XC 4GMVA 2YF0A 2W2WA 2CY5A 2J0KA 5FI0A 4GXBA 2LOZA 2AL6A 2RVBB 3PVWA 3GYOA 4ZRKA 5CLQB 5D3WA 2D11A 2Q13A 2Y8FA 5JHHA 3DXCA 2K2JA 5J3QA 3KRWA 2W2XD 1PFJA 1AQCA 1QQGA 3TFMA 4YL8A 1X86A 2DHJA 3FM8C 4L6EA 3T06A 1NTVA 4ZRIA 1SHCA 5LOPB 4HDQA 2H7EA 3G9WA 2DHIA 1U5DA 2LOXA 5DIFB 1DYNA 1UNQA 2R0DA 2DX5A 2D2QA 4NSWA 5J3TA 3CIKA 3ZDTA 3WYFB 2RSGA 1FHOA 2K2UA 2LKOA 1W1HA 2D9XA 1KZGA 2YS3A 1NU2A 5LONB 5CLLB 2HTHB 2Z0OA 1M7RA 2D9YA 4HATB 4KVGB 3QWMA 2Y8GA 2YT0A 4HB4B 1XR0B 4A6KA 2QKMA 1XKEA 4PQ0A 1OMWA 1X05A 1Q67A 1J19A 4CYEA 4HAVB 4MT7A 2COCA 3MPXA 5EFXA 5C79A 3F0WA 4A6HA 1IRSA 2DN6A 4H8SA 2ADZA 3FEHA 2DA0A 1DDWA 3PZDA 2D9VA 2YS5A 4IFSA 1BWNA 4EMOA 2GS0A 1OQNA 2NMBA 1V88A 2IFSA 1U5FA 1B55A 1W1GA 2R09A 1DDVA 1K5GB 2V76A 1MKEA 2I5FA 3NSUA 1N3HA 2XQNM 2H7DA 2Z0PA 4HB2B 4K81A 2COAA 2D10A 1ISNA 5KQ4A 1EGXA 4DX8A 1KZ7A 4D0NB 3VIAA 4XWXA 3D8EA 3ODXA 4NY0A 3PG7A 3PSCA 2P0HA 1K5DB 4DXAB 2RNRB 4HAYB 2E2XA 1FHWA 2J0JA 3P6AA 2FJLA 2CAYA 3TVVA 2D9WA 2YSZA 3ULCA 2YRYA 3OANA 3SNHA 2RUKB 2CRFA 4HHVA 1FHXA 3U7DA 4K2OA 1J0WA 1MPHA 1E5WA 2MKRA 3AU4A 3M1IB 1X1GA 2N23A 3TW1A 4A6FB 4HB3B 1Y19B 4DBBA 2L2IA 2JP2A 3SO6A 3V5WA 1V5MA 1FGYA 3IVFA 3PP2A 4MY6A 3PEGA 4ZRJA 3HQCA 2QKLA 1WGUA 3KY9A 1U5EA 2KGXB 2BCJA 1TQZA 1U2BA 2P8VA 2OTXA 1WJ1A 1RRPB 4TYZA 2YT1A 2K00A 1ZVRA 2NZ8B 1UPQA 1H10A 3UZTA 1UPRA 3PVLA 1WVHA 4HDOA 3PVUA 2DKQA 1NI2A 1OY2A 1M7EA 1WG7A 3ODWA 1WI1A 3QIJA 4F7UP 4K17A 2EJ8A 2DLWA 1PMSA 2EMSA 4PNKA 4HAZB 4GZUA 2CY4A 1RJ2A 3X23A 1H4RA 1GC7A 2LYDA 1Y5OA 3TCAA 2AEHA 3A8PA 3P7ZA 2EC1A 2KUPA 4B6HA 2UVMA 1NTYA 2COFA 3ML4A 5DHAB 1FGZA 3SYXA 1KI1B 1DBHA 1WJMA 2M38A 2M14A 5GOWB 2LG1A 2ELBA 4WJ7A 4Y94A 1MAIA 5HE2A 5JLJB 1W1DA 1P5TA 1V61A 3DXEA 4A6FA 4KHBB 4TKNA 1MK9B 1EVHA 2D4QA 2RGNB 3QBVB 5D3XA 2KCJA 2ELAA 5C16A 2ROVA 2HE7A 1V89A 2GCLA 4CHJA 3U8ZA 2CODA 3TO1A 3ODOA 4GMXB 5D27A 3AJ4A 3KZ1A 2DX1A 3WA0A 1X1FA 1BTKA 2P0DA 3A8QA 4IAPA 4K2PA 3ZVRA 1SGHA 4WSFA 1MK7B 1UNPA 5HE0A 1WGQA 2YS1A 1V5UA 2J59M 2DTCA 5D3VA 5HE1A 2ROZB 2UZSA 3SUZA 2L1CA 2D9ZA 2GJYA 3F5RA 2P0FA 4GN1A 2MWNB 3FSSA 4EJNA 2I1JA 1EAZA 4A5KA 2I5CA 2MDXA 1U5GA 2J0MA 1GC6A 4C0AA 2DHKA 1MIXA 1U29A 1FAOA 1ZC4B 1XODA 2GCJA 3N7CA 4HAWB 2VSZA 2DYNA 5KQ1A 2UZRA 4F7HA 4HB0B 2ZPYA 1MIZB 1I7AA 1DROA 2YVCA 3MDBC 4EKUA 1UEFA 1Z87A 2DYQA 3A98B 5HE3A 1FB8A 1XD4A 3GYPA 4F7GA 4Z2NA 3D8FA 2OQBA 3HW2B 1I2HA 1X11A 5FI1A 3LJUX 2VKIA 1ZSQA 3RCPA 5JP4A 1ZC3B 4GPTB 4IOYX 5KCVA 1LW3A 5JHGA 5DHFB 1P6SA 5C6RA 1PLSA 5C5BA 2N0YA 1QC6A 4KAXB 4KHOA 3AU5A 1XX0A 3SV1A 1FOEA 3BINA 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O96 A;  1DDM A;  3CXB B;  4Z2M B;  3DXD A;  1TXD A;  1ZM0 A;  1P3R A;  5DI9 B;  1UNR A;  5DH9 B;  2LUL A;  3BJI A;  2DFK A;  1EF1 A;  2Z0Q A;  1XCG A;  2Y7B A;  3VOQ A;  3KSY A;  3D8D A;  2I1K A;  3KRX A;  4HAU B;  1BAK A;  1TJ6 A;  2MFQ A;  4BBK A;  1V5P A;  4CHM A;  5C5B B;  1GG3 A;  4YON A;  5J3Y A;  4KHA A;  1U27 A;  4HAX B;  1AWE A;  2VRW B;  1BTN A;  2RLO A;  3ULB A;  4DX9 0;  2X18 A;  3HK0 A;  4WVF B;  2DKP A;  2G35 A;  4P7I A;  2IYB A;  5D3Y A;  4MK0 A;  5L81 A;  1LB1 A;  2EMT A;  2W2X C;  4GMV A;  2YF0 A;  2W2W A;  2CY5 A;  2J0K A;  5FI0 A;  4GXB A;  2LOZ A;  2AL6 A;  2RVB B;  3PVW A;  3GYO A;  4ZRK A;  5CLQ B;  5D3W A;  2D11 A;  2Q13 A;  2Y8F A;  5JHH A;  3DXC A;  2K2J A;  5J3Q A;  3KRW A;  2W2X D;  1PFJ A;  1AQC A;  1QQG A;  3TFM A;  4YL8 A;  1X86 A;  2DHJ A;  3FM8 C;  4L6E A;  3T06 A;  1NTV A;  4ZRI A;  1SHC A;  5LOP B;  4HDQ A;  2H7E A;  3G9W A;  2DHI A;  1U5D A;  2LOX A;  5DIF B;  1DYN A;  1UNQ A;  2R0D A;  2DX5 A;  2D2Q A;  4NSW A;  5J3T A;  3CIK A;  3ZDT A;  3WYF B;  2RSG A;  1FHO A;  2K2U A;  2LKO A;  1W1H A;  2D9X A;  1KZG A;  2YS3 A;  1NU2 A;  5LON B;  5CLL B;  2HTH B;  2Z0O A;  1M7R A;  2D9Y A;  4HAT B;  4KVG B;  3QWM A;  2Y8G A;  2YT0 A;  4HB4 B;  1XR0 B;  4A6K A;  2QKM A;  1XKE A;  4PQ0 A;  1OMW A;  1X05 A;  1Q67 A;  1J19 A;  4CYE A;  4HAV B;  4MT7 A;  2COC A;  3MPX A;  5EFX A;  5C79 A;  3F0W A;  4A6H A;  1IRS A;  2DN6 A;  4H8S A;  2ADZ A;  3FEH A;  2DA0 A;  1DDW A;  3PZD A;  2D9V A;  2YS5 A;  4IFS A;  1BWN A;  4EMO A;  2GS0 A;  1OQN A;  2NMB A;  1V88 A;  2IFS A;  1U5F A;  1B55 A;  1W1G A;  2R09 A;  1DDV A;  1K5G B;  2V76 A;  1MKE A;  2I5F A;  3NSU A;  1N3H A;  2XQN M;  2H7D A;  2Z0P A;  4HB2 B;  4K81 A;  2COA A;  2D10 A;  1ISN A;  5KQ4 A;  1EGX A;  4DX8 A;  1KZ7 A;  4D0N B;  3VIA A;  4XWX A;  3D8E A;  3ODX A;  4NY0 A;  3PG7 A;  3PSC A;  2P0H A;  1K5D B;  4DXA B;  2RNR B;  4HAY B;  2E2X A;  1FHW A;  2J0J A;  3P6A A;  2FJL A;  2CAY A;  3TVV A;  2D9W A;  2YSZ A;  3ULC A;  2YRY A;  3OAN A;  3SNH A;  2RUK B;  2CRF A;  4HHV A;  1FHX A;  3U7D A;  4K2O A;  1J0W A;  1MPH A;  1E5W A;  2MKR A;  3AU4 A;  3M1I B;  1X1G A;  2N23 A;  3TW1 A;  4A6F B;  4HB3 B;  1Y19 B;  4DBB A;  2L2I A;  2JP2 A;  3SO6 A;  3V5W A;  1V5M A;  1FGY A;  3IVF A;  3PP2 A;  4MY6 A;  3PEG A;  4ZRJ A;  3HQC A;  2QKL A;  1WGU A;  3KY9 A;  1U5E A;  2KGX B;  2BCJ A;  1TQZ A;  1U2B A;  2P8V A;  2OTX A;  1WJ1 A;  1RRP B;  4TYZ A;  2YT1 A;  2K00 A;  1ZVR A;  2NZ8 B;  1UPQ A;  1H10 A;  3UZT A;  1UPR A;  3PVL A;  1WVH A;  4HDO A;  3PVU A;  2DKQ A;  1NI2 A;  1OY2 A;  1M7E A;  1WG7 A;  3ODW A;  1WI1 A;  3QIJ A;  4F7U P;  4K17 A;  2EJ8 A;  2DLW A;  1PMS A;  2EMS A;  4PNK A;  4HAZ B;  4GZU A;  2CY4 A;  1RJ2 A;  3X23 A;  1H4R A;  1GC7 A;  2LYD A;  1Y5O A;  3TCA A;  2AEH A;  3A8P A;  3P7Z A;  2EC1 A;  2KUP A;  4B6H A;  2UVM A;  1NTY A;  2COF A;  3ML4 A;  5DHA B;  1FGZ A;  3SYX A;  1KI1 B;  1DBH A;  1WJM A;  2M38 A;  2M14 A;  5GOW B;  2LG1 A;  2ELB A;  4WJ7 A;  4Y94 A;  1MAI A;  5HE2 A;  5JLJ B;  1W1D A;  1P5T A;  1V61 A;  3DXE A;  4A6F A;  4KHB B;  4TKN A;  1MK9 B;  1EVH A;  2D4Q A;  2RGN B;  3QBV B;  5D3X A;  2KCJ A;  2ELA A;  5C16 A;  2ROV A;  2HE7 A;  1V89 A;  2GCL A;  4CHJ A;  3U8Z A;  2COD A;  3TO1 A;  3ODO A;  4GMX B;  5D27 A;  3AJ4 A;  3KZ1 A;  2DX1 A;  3WA0 A;  1X1F A;  1BTK A;  2P0D A;  3A8Q A;  4IAP A;  4K2P A;  3ZVR A;  1SGH A;  4WSF A;  1MK7 B;  1UNP A;  5HE0 A;  1WGQ A;  2YS1 A;  1V5U A;  2J59 M;  2DTC A;  5D3V A;  5HE1 A;  2ROZ B;  2UZS A;  3SUZ A;  2L1C A;  2D9Z A;  2GJY A;  3F5R A;  2P0F A;  4GN1 A;  2MWN B;  3FSS A;  4EJN A;  2I1J A;  1EAZ A;  4A5K A;  2I5C A;  2MDX A;  1U5G A;  2J0M A;  1GC6 A;  4C0A A;  2DHK A;  1MIX A;  1U29 A;  1FAO A;  1ZC4 B;  1XOD A;  2GCJ A;  3N7C A;  4HAW B;  2VSZ A;  2DYN A;  5KQ1 A;  2UZR A;  4F7H A;  4HB0 B;  2ZPY A;  1MIZ B;  1I7A A;  1DRO A;  2YVC A;  3MDB C;  4EKU A;  1UEF A;  1Z87 A;  2DYQ A;  3A98 B;  5HE3 A;  1FB8 A;  1XD4 A;  3GYP A;  4F7G A;  4Z2N A;  3D8F A;  2OQB A;  3HW2 B;  1I2H A;  1X11 A;  5FI1 A;  3LJU X;  2VKI A;  1ZSQ A;  3RCP A;  5JP4 A;  1ZC3 B;  4GPT B;  4IOY X;  5KCV A;  1LW3 A;  5JHG A;  5DHF B;  1P6S A;  5C6R A;  1PLS A;  5C5B A;  2N0Y A;  1QC6 A;  4KAX B;  4KHO A;  3AU5 A;  1XX0 A;  3SV1 A;  1FOE A;  3BIN A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 3O96 A;  1DDM A;  3CXB B;  3A58 A;  4Z2M B;  3DXD A;  4QJ3 B;  1TXD A;  3HSA A;  1ZM0 A;  1P3R A;  5DI9 B;  1UNR A;  5DH9 B;  2LUL A;  3BJI A;  2DFK A;  1EF1 A;  2Z0Q A;  1XCG A;  2Y7B A;  3VOQ A;  3KSY A;  3D8D A;  2I1K A;  3KRX A;  4HAU B;  1BAK A;  1TJ6 A;  2MFQ A;  4BBK A;  2FJU B;  1V5P A;  4CHM A;  5C5B B;  1GG3 A;  4YON A;  5J3Y A;  4KHA A;  1U27 A;  4HAX B;  4DIX A;  1AWE A;  2VRW B;  1BTN A;  2RLO A;  3ULB A;  4DX9 0;  2X18 A;  3HK0 A;  4WVF B;  2DKP A;  2G35 A;  4P7I A;  2IYB A;  2GUM A;  5D3Y A;  3NWA A;  4MK0 A;  4QJ4 B;  5L81 A;  1LB1 A;  2KUQ A;  2EMT A;  2W2X C;  4GMV A;  2YF0 A;  2W2W A;  2CY5 A;  2J0K A;  5FI0 A;  5LG4 B;  4GXB A;  2KIE A;  2LOZ A;  2AL6 A;  2RVB B;  3PVW A;  3GYO A;  4ZRK A;  5CLQ B;  5D3W A;  2D11 A;  2Q13 A;  2Y8F A;  5JHH A;  2YT2 A;  2K2J A;  3DXC A;  5J3Q A;  3KRW A;  2W2X D;  1PFJ A;  1AQC A;  1QQG A;  3TFM A;  4YL8 A;  1X86 A;  2R2Y A;  2DHJ A;  3FM8 C;  4QXA B;  4L6E A;  2RRF A;  3T06 A;  1NTV A;  4ZRI A;  1SHC A;  5LOP B;  4HDQ A;  2H7E A;  3G9W A;  2DHI A;  1U5D A;  2KIG A;  2LOX A;  5DIF B;  1DYN A;  1UNQ A;  2R0D A;  2DX5 A;  2D2Q A;  4NSW A;  5J3T A;  3CIK A;  3ZDT A;  3WYF B;  2RSG A;  1FHO A;  2K2U A;  2LKO A;  1W1H A;  2D9X A;  1KZG A;  2YS3 A;  1NU2 A;  5LON B;  5CLL B;  2HTH B;  2Z0O A;  1M7R A;  2D9Y A;  3OHM B;  4HAT B;  4KVG B;  3QWM A;  2Y8G A;  2YT0 A;  4HB4 B;  1XR0 B;  4A6K A;  2QKM A;  4KHB A;  1XKE A;  3HIE A;  4PQ0 A;  1OMW A;  1X05 A;  1Q67 A;  1J19 A;  4CYE A;  4HAV B;  4MT7 A;  2K49 A;  2COC A;  3MPX A;  5EFX A;  5C79 A;  1T77 A;  3F0W A;  4A6H A;  1IRS A;  2DN6 A;  4H8S A;  2ADZ A;  3FEH A;  2Z13 A;  2NBV A;  2DA0 A;  1DDW A;  3PZD A;  3NWF A;  3NW8 A;  2D9V A;  2YS5 A;  5IRS A;  4IFS A;  1BWN A;  4EMO A;  2GS0 A;  1OQN A;  2NMB A;  1V88 A;  2IFS A;  1U5F A;  1B55 A;  1W1G A;  2R09 A;  1DDV A;  1K5G B;  2V76 A;  1MKE A;  5I2M A;  2I5F A;  3NSU A;  1N3H A;  2XQN M;  2H7D A;  2Z0P A;  4HB2 B;  4K81 A;  2COA A;  2D10 A;  1ISN A;  5KQ4 A;  1EGX A;  4CSQ A;  4DX8 A;  1KZ7 A;  3NWD A;  4D0N B;  3VIA A;  4XWX A;  3D8E A;  3ODX A;  4HSI A;  4NY0 A;  3PG7 A;  3PSC A;  2P0H A;  1K5D B;  4DXA B;  2RNR B;  4HAY B;  2E2X A;  1FHW A;  2J0J A;  3P6A A;  2FJL A;  2CAY A;  3TVV A;  2D9W A;  2YSZ A;  3ULC A;  2YRY A;  3OAN A;  4OT1 A;  3SNH A;  2RUK B;  2CRF A;  4HHV A;  1ZYI A;  1FHX A;  4D6W A;  3U7D A;  4K2O A;  1J0W A;  1MPH A;  1E5W A;  2MKR A;  3AU4 A;  3M1I B;  1X1G A;  2Z14 A;  2N23 A;  3TW1 A;  4A6F B;  4HB3 B;  1Y19 B;  4DBB A;  2L2I A;  2JP2 A;  3SO6 A;  3V5W A;  1V5M A;  1FGY A;  3IVF A;  3PP2 A;  4MY6 A;  3PEG A;  4ZRJ A;  3HQC A;  2QKL A;  1WGU A;  3KY9 A;  1U5E A;  2KGX B;  2BCJ A;  2ZKM X;  3FVC A;  1TQZ A;  1U2B A;  2P8V A;  2OTX A;  1WJ1 A;  1RRP B;  2Z59 A;  4TYZ A;  2YT1 A;  2K00 A;  1ZVR A;  2NZ8 B;  1UPQ A;  1H10 A;  3UZT A;  1UPR A;  3PVL A;  1WVH A;  4HDO A;  3PVU A;  2K8E A;  2DKQ A;  1NI2 A;  1OY2 A;  1M7E A;  1WG7 A;  3ODW A;  1WI1 A;  3QIJ A;  4F7U P;  4K17 A;  2EJ8 A;  2DLW A;  1PMS A;  3DCX A;  2EMS A;  4PNK A;  4HAZ B;  4GZU A;  2CY4 A;  2Z4D A;  1RJ2 A;  3X23 A;  1H4R A;  5I2S A;  1GC7 A;  2LYD A;  1Y5O A;  3TCA A;  2AEH A;  3A8P A;  3P7Z A;  2EC1 A;  2KR0 A;  2KUP A;  4B6H A;  2UVM A;  1NTY A;  2COF A;  3ML4 A;  5DHA B;  1FGZ A;  3SYX A;  1KI1 B;  1DBH A;  1WJM A;  2M38 A;  4L1R A;  2M14 A;  4GNK B;  5GOW B;  2LG1 A;  2ELB A;  4WJ7 A;  4Y94 A;  1MAI A;  5HE2 A;  5JLJ B;  1W1D A;  1P5T A;  1V61 A;  3DXE A;  4A6F A;  4KHB B;  4TKN A;  1MK9 B;  1EVH A;  2D4Q A;  2RGN B;  3QBV B;  5D3X A;  2KCJ A;  2ELA A;  5C16 A;  2ROV A;  2HE7 A;  1V89 A;  2GCL A;  4CHJ A;  3U8Z A;  2COD A;  3TO1 A;  3ODO A;  4GMX B;  5D27 A;  3AJ4 A;  3KZ1 A;  2DX1 A;  4QJ5 B;  3WA0 A;  1X1F A;  1BTK A;  2P0D A;  3A8Q A;  4IAP A;  4K2P A;  3ZVR A;  1SGH A;  4WSF A;  1MK7 B;  1UNP A;  5HE0 A;  1WGQ A;  2YS1 A;  1V5U A;  2J59 M;  2DTC A;  5D3V A;  5HE1 A;  2ROZ B;  2UZS A;  3SUZ A;  2L1C A;  2D9Z A;  5M4Y B;  2GJY A;  3F5R A;  2P0F A;  4GN1 A;  2MWN B;  3FSS A;  4EJN A;  2I1J A;  1EAZ A;  4A5K A;  2I5C A;  2MDX A;  1U5G A;  2J0M A;  1GC6 A;  4C0A A;  2DHK A;  1MIX A;  1U29 A;  1FAO A;  1ZC4 B;  1XOD A;  2GCJ A;  3N7C A;  4HAW B;  2VSZ A;  2DYN A;  5KQ1 A;  3B77 A;  2UZR A;  4F7H A;  4HB0 B;  4OSN A;  2ZPY A;  1MIZ B;  1I7A A;  1DRO A;  2YVC A;  3MDB C;  4EKU A;  1UEF A;  1Z87 A;  2DYQ A;  3A98 B;  5HE3 A;  1FB8 A;  1XD4 A;  3GYP A;  4F7G A;  4Z2N A;  3D8F A;  2OQB A;  3HW2 B;  1I2H A;  1MI1 A;  1X11 A;  5FI1 A;  3LJU X;  3U12 A;  2VKI A;  1ZSQ A;  3RCP A;  5JP4 A;  1ZC3 B;  4GPT B;  4IOY X;  4GOU A;  5KCV A;  1LW3 A;  5JHG A;  5DHF B;  1P6S A;  5C6R A;  1PLS A;  5C5B A;  2N0Y A;  1QC6 A;  4KAX B;  4KHO A;  3AU5 A;  1XX0 A;  3SV1 A;  1FOE A;  3BIN A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 3O96 A;  1DDM A;  3CXB B;  4Z2M B;  3DXD A;  1TXD A;  1ZM0 A;  1P3R A;  5DI9 B;  1UNR A;  5DH9 B;  2LUL A;  3BJI A;  2DFK A;  1EF1 A;  2Z0Q A;  1XCG A;  2Y7B A;  3VOQ A;  3KSY A;  3D8D A;  2I1K A;  3KRX A;  4HAU B;  1BAK A;  1TJ6 A;  2MFQ A;  4BBK A;  1V5P A;  4CHM A;  5C5B B;  1GG3 A;  4YON A;  5J3Y A;  4KHA A;  1U27 A;  4HAX B;  1AWE A;  2VRW B;  1BTN A;  2RLO A;  3ULB A;  4DX9 0;  2X18 A;  3HK0 A;  4WVF B;  2DKP A;  2G35 A;  4P7I A;  2IYB A;  5D3Y A;  4MK0 A;  5L81 A;  1LB1 A;  2EMT A;  2W2X C;  4GMV A;  2YF0 A;  2W2W A;  2CY5 A;  2J0K A;  5FI0 A;  4GXB A;  2LOZ A;  2AL6 A;  2RVB B;  3PVW A;  3GYO A;  4ZRK A;  5CLQ B;  5D3W A;  2D11 A;  2Q13 A;  2Y8F A;  5JHH A;  3DXC A;  2K2J A;  5J3Q A;  3KRW A;  2W2X D;  1PFJ A;  1AQC A;  1QQG A;  3TFM A;  4YL8 A;  1X86 A;  2DHJ A;  3FM8 C;  4L6E A;  3T06 A;  1NTV A;  4ZRI A;  1SHC A;  5LOP B;  4HDQ A;  2H7E A;  3G9W A;  2DHI A;  1U5D A;  2LOX A;  5DIF B;  1DYN A;  1UNQ A;  2R0D A;  2DX5 A;  2D2Q A;  4NSW A;  5J3T A;  3CIK A;  3ZDT A;  3WYF B;  2RSG A;  1FHO A;  2K2U A;  2LKO A;  1W1H A;  2D9X A;  1KZG A;  2YS3 A;  1NU2 A;  5LON B;  5CLL B;  2HTH B;  2Z0O A;  1M7R A;  2D9Y A;  4HAT B;  4KVG B;  3QWM A;  2Y8G A;  2YT0 A;  4HB4 B;  1XR0 B;  4A6K A;  2QKM A;  1XKE A;  4PQ0 A;  1OMW A;  1X05 A;  1Q67 A;  1J19 A;  4CYE A;  4HAV B;  4MT7 A;  2COC A;  3MPX A;  5EFX A;  5C79 A;  3F0W A;  4A6H A;  1IRS A;  2DN6 A;  4H8S A;  2ADZ A;  3FEH A;  2DA0 A;  1DDW A;  3PZD A;  2D9V A;  2YS5 A;  4IFS A;  1BWN A;  4EMO A;  2GS0 A;  1OQN A;  2NMB A;  1V88 A;  2IFS A;  1U5F A;  1B55 A;  1W1G A;  2R09 A;  1DDV A;  1K5G B;  2V76 A;  1MKE A;  2I5F A;  3NSU A;  1N3H A;  2XQN M;  2H7D A;  2Z0P A;  4HB2 B;  4K81 A;  2COA A;  2D10 A;  1ISN A;  5KQ4 A;  1EGX A;  4DX8 A;  1KZ7 A;  4D0N B;  3VIA A;  4XWX A;  3D8E A;  3ODX A;  4NY0 A;  3PG7 A;  3PSC A;  2P0H A;  1K5D B;  4DXA B;  2RNR B;  4HAY B;  2E2X A;  1FHW A;  2J0J A;  3P6A A;  2FJL A;  2CAY A;  3TVV A;  2D9W A;  2YSZ A;  3ULC A;  2YRY A;  3OAN A;  3SNH A;  2RUK B;  2CRF A;  4HHV A;  1FHX A;  3U7D A;  4K2O A;  1J0W A;  1MPH A;  1E5W A;  2MKR A;  3AU4 A;  3M1I B;  1X1G A;  2N23 A;  3TW1 A;  4A6F B;  4HB3 B;  1Y19 B;  4DBB A;  2L2I A;  2JP2 A;  3SO6 A;  3V5W A;  1V5M A;  1FGY A;  3IVF A;  3PP2 A;  4MY6 A;  3PEG A;  4ZRJ A;  3HQC A;  2QKL A;  1WGU A;  3KY9 A;  1U5E A;  2KGX B;  2BCJ A;  1TQZ A;  1U2B A;  2P8V A;  2OTX A;  1WJ1 A;  1RRP B;  4TYZ A;  2YT1 A;  2K00 A;  1ZVR A;  2NZ8 B;  1UPQ A;  1H10 A;  3UZT A;  1UPR A;  3PVL A;  1WVH A;  4HDO A;  3PVU A;  2DKQ A;  1NI2 A;  1OY2 A;  1M7E A;  1WG7 A;  3ODW A;  1WI1 A;  3QIJ A;  4F7U P;  4K17 A;  2EJ8 A;  2DLW A;  1PMS A;  2EMS A;  4PNK A;  4HAZ B;  4GZU A;  2CY4 A;  1RJ2 A;  3X23 A;  1H4R A;  1GC7 A;  2LYD A;  1Y5O A;  3TCA A;  2AEH A;  3A8P A;  3P7Z A;  2EC1 A;  2KUP A;  4B6H A;  2UVM A;  1NTY A;  2COF A;  3ML4 A;  5DHA B;  1FGZ A;  3SYX A;  1KI1 B;  1DBH A;  1WJM A;  2M38 A;  2M14 A;  5GOW B;  2LG1 A;  2ELB A;  4WJ7 A;  4Y94 A;  1MAI A;  5HE2 A;  5JLJ B;  1W1D A;  1P5T A;  1V61 A;  3DXE A;  4A6F A;  4KHB B;  4TKN A;  1MK9 B;  1EVH A;  2D4Q A;  2RGN B;  3QBV B;  5D3X A;  2KCJ A;  2ELA A;  5C16 A;  2ROV A;  2HE7 A;  1V89 A;  2GCL A;  4CHJ A;  3U8Z A;  2COD A;  3TO1 A;  3ODO A;  4GMX B;  5D27 A;  3AJ4 A;  3KZ1 A;  2DX1 A;  3WA0 A;  1X1F A;  1BTK A;  2P0D A;  3A8Q A;  4IAP A;  4K2P A;  3ZVR A;  1SGH A;  4WSF A;  1MK7 B;  1UNP A;  5HE0 A;  1WGQ A;  2YS1 A;  1V5U A;  2J59 M;  2DTC A;  5D3V A;  5HE1 A;  2ROZ B;  2UZS A;  3SUZ A;  2L1C A;  2D9Z A;  2GJY A;  3F5R A;  2P0F A;  4GN1 A;  2MWN B;  3FSS A;  4EJN A;  2I1J A;  1EAZ A;  4A5K A;  2I5C A;  2MDX A;  1U5G A;  2J0M A;  1GC6 A;  4C0A A;  2DHK A;  1MIX A;  1U29 A;  1FAO A;  1ZC4 B;  1XOD A;  2GCJ A;  3N7C A;  4HAW B;  2VSZ A;  2DYN A;  5KQ1 A;  2UZR A;  4F7H A;  4HB0 B;  2ZPY A;  1MIZ B;  1I7A A;  1DRO A;  2YVC A;  3MDB C;  4EKU A;  1UEF A;  1Z87 A;  2DYQ A;  3A98 B;  5HE3 A;  1FB8 A;  1XD4 A;  3GYP A;  4F7G A;  4Z2N A;  3D8F A;  2OQB A;  3HW2 B;  1I2H A;  1X11 A;  5FI1 A;  3LJU X;  2VKI A;  1ZSQ A;  3RCP A;  5JP4 A;  1ZC3 B;  4GPT B;  4IOY X;  5KCV A;  1LW3 A;  5JHG A;  5DHF B;  1P6S A;  5C6R A;  1PLS A;  5C5B A;  2N0Y A;  1QC6 A;  4KAX B;  4KHO A;  3AU5 A;  1XX0 A;  3SV1 A;  1FOE A;  3BIN A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...