1U2BA

Triglycine variant of the grp1 pleckstrin homology domain unliganded
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
TFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytohesin 3
publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid binding protein
total genus 22
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u2bA00
2DLWA 1U5EA 2ELAA 1TQZA 4WSFA 3GYOA 2K00A 2Z0PA 3N7CA 4CHMA 5JHGA 2GJYA 4CHJA 3AU5A 4HB2B 5KQ4A 2UZRA 5DHAB 3PEGA 2R0DA 1WJ1A 1ZC3B 1NTYA 3V5WA 4H8SA 2D9VA 4Z2MB 1ISNA 3HW2B 4F7UP 1M7RA 1U5GA 3PVUA 2I5CA 4GZUA 2D10A 3SYXA 2I5FA 2Y7BA 2D4QA 4PQ0A 1Q67A 1BAKA 1FHOA 2D9YA 1UPRA 2DTCA 2D9XA 1ZM0A 2DA0A 5HE1A 2KCJA 2OQBA 1LW3A 3PZDA 1DYNA 1FGYA 3KY9A 5C79A 2CAYA 2CODA 1I7AA 1K5GB 2LOXA 2J0MA 4HDOA 3PVWA 5LOPB 3TCAA 3ZDTA 1BTNA 1DROA 4NY0A 4GMXB 2IFSA 4HDQA 5KCVA 3F0WA 1Y19B 2Q13A 2DX5A 2DHJA 2Y8FA 1V88A 5D3VA 2QKMA 1N3HA 1EVHA 1PLSA 2UZSA 1EF1A 3PSCA 1MPHA 1MIZB 2ADZA 1J19A 2RVBB 2I1KA 1TJ6A 1P5TA 4ZRKA 2W2XC 2VRWB 4D0NB 4HAZB 1U27A 2N23A 1FOEA 3BJIA 3DXEA 2R09A 4KHOA 1GC7A 3CXBB 1U29A 4DBBA 3ML4A 2P8VA 1MKEA 2P0FA 1XCGA 4DX90 2DHIA 1V89A 3P6AA 1AQCA 3A8QA 2DYQA 2PZ1A 2NZ8B 1K5DB 3FM8C 1KZ7A 4F7GA 2LOZA 1X05A 5GOWB 3IVFA 3LJUX 1X1GA 1MAIA 2M38A 1PFJA 2K2UA 4WJ7A 4P7IA 2LKOA 4YL8A 4DX8A 4GMVA 2DN6A 1KZGA 1OMWA 3SO6A 5J3TA 1MK7B 5JLJB 1RJ2A 1V5MA 4Z2NA 1WJMA 1PMSA 1UEFA 1E5WA 1NU2A 4HATB 2V76A 2QKLA 3FSSA 2GCLA 1WGUA 5C6RA 2M14A 3NSUA 1EGXA 1NI2A 1FHWA 1MK9B 2J59M 2YT0A 5HE3A 2Y8GA 1X1FA 4MK0A 2W2XD 4A6HA 3TO1A 2Z0QA 3PP2A 4IFSA 4YONA 2L1CA 2NMBA 3X23A 2MDXA 1I2HA 4K2PA 3QBVB 4GXBA 1H4RA 1DDWA 1V5PA 2RUKB 3UZTA 1FB8A 2JP2A 1QC6A 2HTHB 1BTKA 2D9ZA 2DX1A 2ZPYA 4EKUA 2YVCA 2D2QA 4A6FB 1WGQA 1P6SA 5DH9B 2YS5A 2LYDA 3DXCA 2Z0OA 3PG7A 2YS3A 2RLOA 1ZVRA 3D8EA 4Y94A 4EMOA 2P0DA 1W1HA 3AJ4A 1J0WA 2ROZB 2VSZA 5EFXA 4EJNA 3WA0A 1KI1B 1P3RA 5C5BB 3TFMA 2I1JA 4C0AA 5CLLB 3T06A 4HAXB 3ULBA 1H10A 2IYBA 1UNPA 5LONB 2W2WA 3ODOA 1UNRA 4HB3B 5DIFB 2KUPA 1X11A 1FGZA 3PVLA 5D3YA 2GCJA 4PNKA 4ZRJA 1M7EA 3AU4A 2YT1A 2AL6A 2J0JA 2P0HA 3ZVRA 2H7EA 2LG1A 1XR0B 1U5DA 5C16A 1XKEA 5CLQB 1XD4A 1OQNA 1UPQA 4A6FA 5D3XA 1W1GA 2DHKA 3RCPA 5JP4A 2YS1A 3O96A 4L6EA 1WI1A 2LULA 4HAUB 4XWXA 2X18A 5FI1A 2DYNA 3P7ZA 3SV1A 3VOQA 4K2OA 5KQ1A 2G35A 3GYPA 4HB4B 5C5BA 5J3QA 1B55A 1RRPB 2COAA 3HQCA 2OTXA 3G9WA 1Z87A 3ODXA 1DDMA 3WYFB 3OANA 3M1IB 3MDBC 4K81A 3QIJA 2EMSA 2FJLA 4HB0B 1IRSA 4K17A 3ULCA 5D27A 5DHFB 2J0KA 3SUZA 2H7DA 1NTVA 4WVFB 2D11A 3U7DA 3U8ZA 3MPXA 4KVGB 4DXAB 2YSZA 3KRXA 4A5KA 2N0YA 3SNHA 4F7HA 1LB1A 1SGHA 2MWNB 4HHVA 4IOYX 1EAZA 1Y5OA 3ODWA 2L2IA 2RSGA 2XQNM 2CY5A 2HE7A 4TKNA 2RNRB 2DFKA 1U5FA 4NSWA 1DDVA 4KHBB 1BWNA 1WVHA 3D8DA 2EMTA 4BBKA 1XODA 5J3YA 1V61A 2RGNB 1V5UA 4B6HA 4HAYB 1FAOA 4KHAA 4TYZA 4KAXB 5HE0A 3TVVA 2DKPA 4CYEA 1QQGA 4MT7A 4GPTB 5JHHA 3A98B 2EC1A 4MY6A 5FI0A 1ZSQA 3DXDA 3D8FA 2YRYA 2E2XA 2UVMA 4A6KA 1X86A 2KGXB 5DI9B 1U2BA 1UNQA 3CIKA 2MFQA 2DKQA 3F5RA 1SHCA 1WG7A 2CY4A 1XX0A 2MKRA 4HAWB 2K2JA 1W1DA 2ROVA 4GN1A 2BCJA 3A8PA 2VKIA 3QWMA 1GC6A 3KSYA 1GG3A 2YF0A 3VIAA 3TW1A 1DBHA 1FHXA 2CRFA 3FEHA 3KZ1A 1OY2A 4IAPA 2EJ8A 1AWEA 2COCA 2AEHA 5HE2A 2ELBA 4ZRIA 4HAVB 3HK0A 1TXDA 1MIXA 5L81A 3BINA 3KRWA 1ZC4B 2D9WA 2COFA 2GS0A 5D3WA
chains in the Genus database with same CATH superfamily
2DLWA 1U5EA 2ELAA 1TQZA 4WSFA 3GYOA 4QXAB 2K00A 1ZYIA 2Z0PA 3N7CA 5LG4B 4CHMA 5JHGA 2GJYA 4CHJA 3AU5A 4HB2B 5KQ4A 2UZRA 5DHAB 3PEGA 2R0DA 1WJ1A 5I2SA 1ZC3B 1NTYA 3V5WA 4H8SA 2D9VA 4Z2MB 1ISNA 3HW2B 4F7UP 1M7RA 1U5GA 3PVUA 2I5CA 4GZUA 2D10A 3SYXA 2I5FA 2Y7BA 3A58A 2D4QA 4PQ0A 1Q67A 1BAKA 1FHOA 2NBVA 2D9YA 1UPRA 2DTCA 2D9XA 1ZM0A 2DA0A 4QJ4B 5HE1A 2KCJA 2OQBA 1LW3A 3PZDA 1DYNA 1FGYA 3KY9A 5C79A 4HSIA 2CAYA 2CODA 1I7AA 1K5GB 2LOXA 2J0MA 2YT2A 4HDOA 3PVWA 4QJ5B 5LOPB 3TCAA 3ZDTA 1BTNA 1DROA 4NY0A 4GMXB 2IFSA 4HDQA 5KCVA 3F0WA 1Y19B 2Q13A 2DX5A 2DHJA 3NWFA 2Y8FA 1V88A 3NW8A 5D3VA 2QKMA 1N3HA 1EVHA 1PLSA 2UZSA 1EF1A 3PSCA 1MPHA 1MIZB 2ADZA 1J19A 2RVBB 2I1KA 1TJ6A 1P5TA 1MI1A 4ZRKA 2W2XC 2VRWB 4D0NB 4HAZB 1U27A 4DIXA 2N23A 3B77A 1FOEA 3BJIA 3DXEA 2R09A 4KHOA 1GC7A 3CXBB 1U29A 4DBBA 3ML4A 2P8VA 1MKEA 2P0FA 1XCGA 4GOUA 4DX90 2DHIA 1V89A 3P6AA 2Z14A 1AQCA 3A8QA 2DYQA 2PZ1A 2NZ8B 1K5DB 3FM8C 1KZ7A 4F7GA 2LOZA 1X05A 5GOWB 2FJUB 3IVFA 3LJUX 1X1GA 1MAIA 2M38A 1PFJA 2K2UA 4WJ7A 4P7IA 2LKOA 4YL8A 4DX8A 4GMVA 2DN6A 1KZGA 1OMWA 3SO6A 5J3TA 1MK7B 5JLJB 1RJ2A 1V5MA 4Z2NA 1WJMA 3NWAA 1PMSA 1UEFA 1E5WA 1NU2A 4HATB 2Z13A 2V76A 2QKLA 3FSSA 2GCLA 1WGUA 5C6RA 2M14A 3NSUA 1EGXA 1NI2A 1FHWA 1MK9B 2J59M 2YT0A 5HE3A 2Y8GA 1X1FA 4MK0A 2W2XD 4A6HA 3TO1A 2Z0QA 3PP2A 4IFSA 4YONA 2L1CA 2NMBA 3X23A 2KIEA 2MDXA 1I2HA 4K2PA 3QBVB 4GXBA 1H4RA 1DDWA 1V5PA 2RUKB 3UZTA 1FB8A 2JP2A 1QC6A 2HTHB 1BTKA 2D9ZA 2DX1A 2ZPYA 4EKUA 2YVCA 2D2QA 4A6FB 1WGQA 1P6SA 2K49A 5DH9B 2YS5A 2LYDA 3DXCA 2Z0OA 3PG7A 2YS3A 2RLOA 2R2YA 2K8EA 1ZVRA 3D8EA 4Y94A 4EMOA 2P0DA 1W1HA 3AJ4A 1J0WA 2ROZB 2VSZA 5EFXA 4EJNA 2RRFA 3WA0A 1KI1B 1P3RA 5C5BB 3TFMA 2I1JA 4C0AA 2GUMA 5CLLB 3T06A 3HIEA 4HAXB 3ULBA 1H10A 2Z4DA 2IYBA 1UNPA 5LONB 2W2WA 3ODOA 1UNRA 4HB3B 5DIFB 2KUPA 1X11A 5M4YB 1FGZA 2KR0A 3PVLA 5D3YA 2GCJA 4PNKA 4ZRJA 1M7EA 3AU4A 2YT1A 2AL6A 2J0JA 2P0HA 3ZVRA 2H7EA 2LG1A 1XR0B 1U5DA 5C16A 1XKEA 5CLQB 4GNKB 1XD4A 1OQNA 1UPQA 4A6FA 5D3XA 1W1GA 2DHKA 3RCPA 5JP4A 2YS1A 2KIGA 3O96A 4L6EA 1WI1A 2LULA 4HAUB 4XWXA 2X18A 3DCXA 5FI1A 1T77A 2DYNA 3P7ZA 2Z59A 3SV1A 4CSQA 3VOQA 4K2OA 5KQ1A 2G35A 3GYPA 4HB4B 5C5BA 5J3QA 4L1RA 1B55A 1RRPB 2COAA 3HQCA 2OTXA 3G9WA 1Z87A 3ODXA 1DDMA 3WYFB 3FVCA 3OANA 3M1IB 3MDBC 4K81A 3QIJA 3HSAA 2EMSA 2FJLA 4HB0B 1IRSA 4QJ3B 3U12A 4K17A 3ULCA 5D27A 5DHFB 2J0KA 3SUZA 2H7DA 1NTVA 4WVFB 3NWDA 2D11A 3U7DA 3U8ZA 3MPXA 4KVGB 4DXAB 5IRSA 2YSZA 3KRXA 4A5KA 2N0YA 3SNHA 4F7HA 1LB1A 1SGHA 2MWNB 4HHVA 4IOYX 1EAZA 1Y5OA 3ODWA 2L2IA 2RSGA 2XQNM 2CY5A 2HE7A 4TKNA 2ZKMX 2RNRB 2DFKA 1U5FA 4NSWA 1DDVA 4KHBB 1BWNA 1WVHA 4D6WA 3D8DA 2EMTA 4BBKA 1XODA 5J3YA 1V61A 2RGNB 1V5UA 4B6HA 4HAYB 1FAOA 4KHAA 3OHMB 4TYZA 4KAXB 5HE0A 3TVVA 2DKPA 4CYEA 1QQGA 4MT7A 4GPTB 5JHHA 3A98B 2EC1A 4MY6A 5FI0A 1ZSQA 3DXDA 3D8FA 2YRYA 2E2XA 2UVMA 4A6KA 1X86A 2KGXB 5DI9B 1U2BA 2KUQA 1UNQA 3CIKA 2MFQA 2DKQA 3F5RA 1SHCA 1WG7A 2CY4A 5I2MA 1XX0A 2MKRA 4HAWB 4OSNA 2K2JA 1W1DA 2ROVA 4GN1A 2BCJA 3A8PA 2VKIA 3QWMA 4OT1A 1GC6A 3KSYA 1GG3A 2YF0A 3VIAA 3TW1A 1DBHA 1FHXA 2CRFA 3FEHA 3KZ1A 1OY2A 4IAPA 2EJ8A 1AWEA 2COCA 2AEHA 5HE2A 2ELBA 4ZRIA 4HAVB 3HK0A 4KHBA 1TXDA 1MIXA 5L81A 3BINA 3KRWA 1ZC4B 2D9WA 2COFA 2GS0A 5D3WA
chains in the Genus database with same CATH topology
2DLWA 1U5EA 2ELAA 1TQZA 4WSFA 3GYOA 2K00A 2Z0PA 3N7CA 4CHMA 5JHGA 2GJYA 4CHJA 3AU5A 4HB2B 5KQ4A 2UZRA 5DHAB 3PEGA 2R0DA 1WJ1A 1ZC3B 1NTYA 3V5WA 4H8SA 2D9VA 4Z2MB 1ISNA 3HW2B 4F7UP 1M7RA 1U5GA 3PVUA 2I5CA 4GZUA 2D10A 3SYXA 2I5FA 2Y7BA 2D4QA 4PQ0A 1Q67A 1BAKA 1FHOA 2D9YA 1UPRA 2DTCA 2D9XA 1ZM0A 2DA0A 5HE1A 2KCJA 2OQBA 1LW3A 3PZDA 1DYNA 1FGYA 3KY9A 5C79A 2CAYA 2CODA 1I7AA 1K5GB 2LOXA 2J0MA 4HDOA 3PVWA 5LOPB 3TCAA 3ZDTA 1BTNA 1DROA 4NY0A 4GMXB 2IFSA 4HDQA 5KCVA 3F0WA 1Y19B 2Q13A 2DX5A 2DHJA 2Y8FA 1V88A 5D3VA 2QKMA 1N3HA 1EVHA 1PLSA 2UZSA 1EF1A 3PSCA 1MPHA 1MIZB 2ADZA 1J19A 2RVBB 2I1KA 1TJ6A 1P5TA 4ZRKA 2W2XC 2VRWB 4D0NB 4HAZB 1U27A 2N23A 1FOEA 3BJIA 3DXEA 2R09A 4KHOA 1GC7A 3CXBB 1U29A 4DBBA 3ML4A 2P8VA 1MKEA 2P0FA 1XCGA 4DX90 2DHIA 1V89A 3P6AA 1AQCA 3A8QA 2DYQA 2PZ1A 2NZ8B 1K5DB 3FM8C 1KZ7A 4F7GA 2LOZA 1X05A 5GOWB 3IVFA 3LJUX 1X1GA 1MAIA 2M38A 1PFJA 2K2UA 4WJ7A 4P7IA 2LKOA 4YL8A 4DX8A 4GMVA 2DN6A 1KZGA 1OMWA 3SO6A 5J3TA 1MK7B 5JLJB 1RJ2A 1V5MA 4Z2NA 1WJMA 1PMSA 1UEFA 1E5WA 1NU2A 4HATB 2V76A 2QKLA 3FSSA 2GCLA 1WGUA 5C6RA 2M14A 3NSUA 1EGXA 1NI2A 1FHWA 1MK9B 2J59M 2YT0A 5HE3A 2Y8GA 1X1FA 4MK0A 2W2XD 4A6HA 3TO1A 2Z0QA 3PP2A 4IFSA 4YONA 2L1CA 2NMBA 3X23A 2MDXA 1I2HA 4K2PA 3QBVB 4GXBA 1H4RA 1DDWA 1V5PA 2RUKB 3UZTA 1FB8A 2JP2A 1QC6A 2HTHB 1BTKA 2D9ZA 2DX1A 2ZPYA 4EKUA 2YVCA 2D2QA 4A6FB 1WGQA 1P6SA 5DH9B 2YS5A 2LYDA 3DXCA 2Z0OA 3PG7A 2YS3A 2RLOA 1ZVRA 3D8EA 4Y94A 4EMOA 2P0DA 1W1HA 3AJ4A 1J0WA 2ROZB 2VSZA 5EFXA 4EJNA 3WA0A 1KI1B 1P3RA 5C5BB 3TFMA 2I1JA 4C0AA 5CLLB 3T06A 4HAXB 3ULBA 1H10A 2IYBA 1UNPA 5LONB 2W2WA 3ODOA 1UNRA 4HB3B 5DIFB 2KUPA 1X11A 1FGZA 3PVLA 5D3YA 2GCJA 4PNKA 4ZRJA 1M7EA 3AU4A 2YT1A 2AL6A 2J0JA 2P0HA 3ZVRA 2H7EA 2LG1A 1XR0B 1U5DA 5C16A 1XKEA 5CLQB 1XD4A 1OQNA 1UPQA 4A6FA 5D3XA 1W1GA 2DHKA 3RCPA 5JP4A 2YS1A 3O96A 4L6EA 1WI1A 2LULA 4HAUB 4XWXA 2X18A 5FI1A 2DYNA 3P7ZA 3SV1A 3VOQA 4K2OA 5KQ1A 2G35A 3GYPA 4HB4B 5C5BA 5J3QA 1B55A 1RRPB 2COAA 3HQCA 2OTXA 3G9WA 1Z87A 3ODXA 1DDMA 3WYFB 3OANA 3M1IB 3MDBC 4K81A 3QIJA 2EMSA 2FJLA 4HB0B 1IRSA 4K17A 3ULCA 5D27A 5DHFB 2J0KA 3SUZA 2H7DA 1NTVA 4WVFB 2D11A 3U7DA 3U8ZA 3MPXA 4KVGB 4DXAB 2YSZA 3KRXA 4A5KA 2N0YA 3SNHA 4F7HA 1LB1A 1SGHA 2MWNB 4HHVA 4IOYX 1EAZA 1Y5OA 3ODWA 2L2IA 2RSGA 2XQNM 2CY5A 2HE7A 4TKNA 2RNRB 2DFKA 1U5FA 4NSWA 1DDVA 4KHBB 1BWNA 1WVHA 3D8DA 2EMTA 4BBKA 1XODA 5J3YA 1V61A 2RGNB 1V5UA 4B6HA 4HAYB 1FAOA 4KHAA 4TYZA 4KAXB 5HE0A 3TVVA 2DKPA 4CYEA 1QQGA 4MT7A 4GPTB 5JHHA 3A98B 2EC1A 4MY6A 5FI0A 1ZSQA 3DXDA 3D8FA 2YRYA 2E2XA 2UVMA 4A6KA 1X86A 2KGXB 5DI9B 1U2BA 1UNQA 3CIKA 2MFQA 2DKQA 3F5RA 1SHCA 1WG7A 2CY4A 1XX0A 2MKRA 4HAWB 2K2JA 1W1DA 2ROVA 4GN1A 2BCJA 3A8PA 2VKIA 3QWMA 1GC6A 3KSYA 1GG3A 2YF0A 3VIAA 3TW1A 1DBHA 1FHXA 2CRFA 3FEHA 3KZ1A 1OY2A 4IAPA 2EJ8A 1AWEA 2COCA 2AEHA 5HE2A 2ELBA 4ZRIA 4HAVB 3HK0A 1TXDA 1MIXA 5L81A 3BINA 3KRWA 1ZC4B 2D9WA 2COFA 2GS0A 5D3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  1U5E A;  2ELA A;  1TQZ A;  4WSF A;  3GYO A;  2K00 A;  2Z0P A;  3N7C A;  4CHM A;  5JHG A;  2GJY A;  4CHJ A;  3AU5 A;  4HB2 B;  5KQ4 A;  2UZR A;  5DHA B;  3PEG A;  2R0D A;  1WJ1 A;  1ZC3 B;  1NTY A;  3V5W A;  4H8S A;  2D9V A;  4Z2M B;  1ISN A;  3HW2 B;  4F7U P;  1M7R A;  1U5G A;  3PVU A;  2I5C A;  4GZU A;  2D10 A;  3SYX A;  2I5F A;  2Y7B A;  2D4Q A;  4PQ0 A;  1Q67 A;  1BAK A;  1FHO A;  2D9Y A;  1UPR A;  2DTC A;  2D9X A;  1ZM0 A;  2DA0 A;  5HE1 A;  2KCJ A;  2OQB A;  1LW3 A;  3PZD A;  1DYN A;  1FGY A;  3KY9 A;  5C79 A;  2CAY A;  2COD A;  1I7A A;  1K5G B;  2LOX A;  2J0M A;  4HDO A;  3PVW A;  5LOP B;  3TCA A;  3ZDT A;  1BTN A;  1DRO A;  4NY0 A;  4GMX B;  2IFS A;  4HDQ A;  5KCV A;  3F0W A;  1Y19 B;  2Q13 A;  2DX5 A;  2DHJ A;  2Y8F A;  1V88 A;  5D3V A;  2QKM A;  1N3H A;  1EVH A;  1PLS A;  2UZS A;  1EF1 A;  3PSC A;  1MPH A;  1MIZ B;  2ADZ A;  1J19 A;  2RVB B;  2I1K A;  1TJ6 A;  1P5T A;  4ZRK A;  2W2X C;  2VRW B;  4D0N B;  4HAZ B;  1U27 A;  2N23 A;  1FOE A;  3BJI A;  3DXE A;  2R09 A;  4KHO A;  1GC7 A;  3CXB B;  1U29 A;  4DBB A;  3ML4 A;  2P8V A;  1MKE A;  2P0F A;  1XCG A;  4DX9 0;  2DHI A;  1V89 A;  3P6A A;  1AQC A;  3A8Q A;  2DYQ A;  2PZ1 A;  2NZ8 B;  1K5D B;  3FM8 C;  1KZ7 A;  4F7G A;  2LOZ A;  1X05 A;  5GOW B;  3IVF A;  3LJU X;  1X1G A;  1MAI A;  2M38 A;  1PFJ A;  2K2U A;  4WJ7 A;  4P7I A;  2LKO A;  4YL8 A;  4DX8 A;  4GMV A;  2DN6 A;  1KZG A;  1OMW A;  3SO6 A;  5J3T A;  1MK7 B;  5JLJ B;  1RJ2 A;  1V5M A;  4Z2N A;  1WJM A;  1PMS A;  1UEF A;  1E5W A;  1NU2 A;  4HAT B;  2V76 A;  2QKL A;  3FSS A;  2GCL A;  1WGU A;  5C6R A;  2M14 A;  3NSU A;  1EGX A;  1NI2 A;  1FHW A;  1MK9 B;  2J59 M;  2YT0 A;  5HE3 A;  2Y8G A;  1X1F A;  4MK0 A;  2W2X D;  4A6H A;  3TO1 A;  2Z0Q A;  3PP2 A;  4IFS A;  4YON A;  2L1C A;  2NMB A;  3X23 A;  2MDX A;  1I2H A;  4K2P A;  3QBV B;  4GXB A;  1H4R A;  1DDW A;  1V5P A;  2RUK B;  3UZT A;  1FB8 A;  2JP2 A;  1QC6 A;  2HTH B;  1BTK A;  2D9Z A;  2DX1 A;  2ZPY A;  4EKU A;  2YVC A;  2D2Q A;  4A6F B;  1WGQ A;  1P6S A;  5DH9 B;  2YS5 A;  2LYD A;  3DXC A;  2Z0O A;  3PG7 A;  2YS3 A;  2RLO A;  1ZVR A;  3D8E A;  4Y94 A;  4EMO A;  2P0D A;  1W1H A;  3AJ4 A;  1J0W A;  2ROZ B;  2VSZ A;  5EFX A;  4EJN A;  3WA0 A;  1KI1 B;  1P3R A;  5C5B B;  3TFM A;  2I1J A;  4C0A A;  5CLL B;  3T06 A;  4HAX B;  3ULB A;  1H10 A;  2IYB A;  1UNP A;  5LON B;  2W2W A;  3ODO A;  1UNR A;  4HB3 B;  5DIF B;  2KUP A;  1X11 A;  1FGZ A;  3PVL A;  5D3Y A;  2GCJ A;  4PNK A;  4ZRJ A;  1M7E A;  3AU4 A;  2YT1 A;  2AL6 A;  2J0J A;  2P0H A;  3ZVR A;  2H7E A;  2LG1 A;  1XR0 B;  1U5D A;  5C16 A;  1XKE A;  5CLQ B;  1XD4 A;  1OQN A;  1UPQ A;  4A6F A;  5D3X A;  1W1G A;  2DHK A;  3RCP A;  5JP4 A;  2YS1 A;  3O96 A;  4L6E A;  1WI1 A;  2LUL A;  4HAU B;  4XWX A;  2X18 A;  5FI1 A;  2DYN A;  3P7Z A;  3SV1 A;  3VOQ A;  4K2O A;  5KQ1 A;  2G35 A;  3GYP A;  4HB4 B;  5C5B A;  5J3Q A;  1B55 A;  1RRP B;  2COA A;  3HQC A;  2OTX A;  3G9W A;  1Z87 A;  3ODX A;  1DDM A;  3WYF B;  3OAN A;  3M1I B;  3MDB C;  4K81 A;  3QIJ A;  2EMS A;  2FJL A;  4HB0 B;  1IRS A;  4K17 A;  3ULC A;  5D27 A;  5DHF B;  2J0K A;  3SUZ A;  2H7D A;  1NTV A;  4WVF B;  2D11 A;  3U7D A;  3U8Z A;  3MPX A;  4KVG B;  4DXA B;  2YSZ A;  3KRX A;  4A5K A;  2N0Y A;  3SNH A;  4F7H A;  1LB1 A;  1SGH A;  2MWN B;  4HHV A;  4IOY X;  1EAZ A;  1Y5O A;  3ODW A;  2L2I A;  2RSG A;  2XQN M;  2CY5 A;  2HE7 A;  4TKN A;  2RNR B;  2DFK A;  1U5F A;  4NSW A;  1DDV A;  4KHB B;  1BWN A;  1WVH A;  3D8D A;  2EMT A;  4BBK A;  1XOD A;  5J3Y A;  1V61 A;  2RGN B;  1V5U A;  4B6H A;  4HAY B;  1FAO A;  4KHA A;  4TYZ A;  4KAX B;  5HE0 A;  3TVV A;  2DKP A;  4CYE A;  1QQG A;  4MT7 A;  4GPT B;  5JHH A;  3A98 B;  2EC1 A;  4MY6 A;  5FI0 A;  1ZSQ A;  3DXD A;  3D8F A;  2YRY A;  2E2X A;  2UVM A;  4A6K A;  1X86 A;  2KGX B;  5DI9 B;  1U2B A;  1UNQ A;  3CIK A;  2MFQ A;  2DKQ A;  3F5R A;  1SHC A;  1WG7 A;  2CY4 A;  1XX0 A;  2MKR A;  4HAW B;  2K2J A;  1W1D A;  2ROV A;  4GN1 A;  2BCJ A;  3A8P A;  2VKI A;  3QWM A;  1GC6 A;  3KSY A;  1GG3 A;  2YF0 A;  3VIA A;  3TW1 A;  1DBH A;  1FHX A;  2CRF A;  3FEH A;  3KZ1 A;  1OY2 A;  4IAP A;  2EJ8 A;  1AWE A;  2COC A;  2AEH A;  5HE2 A;  2ELB A;  4ZRI A;  4HAV B;  3HK0 A;  1TXD A;  1MIX A;  5L81 A;  3BIN A;  3KRW A;  1ZC4 B;  2D9W A;  2COF A;  2GS0 A;  5D3W A; 
#chains in the Genus database with same CATH topology
 2DLW A;  1U5E A;  2ELA A;  1TQZ A;  4WSF A;  3GYO A;  4QXA B;  2K00 A;  1ZYI A;  2Z0P A;  3N7C A;  5LG4 B;  4CHM A;  5JHG A;  2GJY A;  4CHJ A;  3AU5 A;  4HB2 B;  5KQ4 A;  2UZR A;  5DHA B;  3PEG A;  2R0D A;  1WJ1 A;  5I2S A;  1ZC3 B;  1NTY A;  3V5W A;  4H8S A;  2D9V A;  4Z2M B;  1ISN A;  3HW2 B;  4F7U P;  1M7R A;  1U5G A;  3PVU A;  2I5C A;  4GZU A;  2D10 A;  3SYX A;  2I5F A;  2Y7B A;  3A58 A;  2D4Q A;  4PQ0 A;  1Q67 A;  1BAK A;  1FHO A;  2NBV A;  2D9Y A;  1UPR A;  2DTC A;  2D9X A;  1ZM0 A;  2DA0 A;  4QJ4 B;  5HE1 A;  2KCJ A;  2OQB A;  1LW3 A;  3PZD A;  1DYN A;  1FGY A;  3KY9 A;  5C79 A;  4HSI A;  2CAY A;  2COD A;  1I7A A;  1K5G B;  2LOX A;  2J0M A;  2YT2 A;  4HDO A;  3PVW A;  4QJ5 B;  5LOP B;  3TCA A;  3ZDT A;  1BTN A;  1DRO A;  4NY0 A;  4GMX B;  2IFS A;  4HDQ A;  5KCV A;  3F0W A;  1Y19 B;  2Q13 A;  2DX5 A;  2DHJ A;  3NWF A;  2Y8F A;  1V88 A;  3NW8 A;  5D3V A;  2QKM A;  1N3H A;  1EVH A;  1PLS A;  2UZS A;  1EF1 A;  3PSC A;  1MPH A;  1MIZ B;  2ADZ A;  1J19 A;  2RVB B;  2I1K A;  1TJ6 A;  1P5T A;  1MI1 A;  4ZRK A;  2W2X C;  2VRW B;  4D0N B;  4HAZ B;  1U27 A;  4DIX A;  2N23 A;  3B77 A;  1FOE A;  3BJI A;  3DXE A;  2R09 A;  4KHO A;  1GC7 A;  3CXB B;  1U29 A;  4DBB A;  3ML4 A;  2P8V A;  1MKE A;  2P0F A;  1XCG A;  4GOU A;  4DX9 0;  2DHI A;  1V89 A;  3P6A A;  2Z14 A;  1AQC A;  3A8Q A;  2DYQ A;  2PZ1 A;  2NZ8 B;  1K5D B;  3FM8 C;  1KZ7 A;  4F7G A;  2LOZ A;  1X05 A;  5GOW B;  2FJU B;  3IVF A;  3LJU X;  1X1G A;  1MAI A;  2M38 A;  1PFJ A;  2K2U A;  4WJ7 A;  4P7I A;  2LKO A;  4YL8 A;  4DX8 A;  4GMV A;  2DN6 A;  1KZG A;  1OMW A;  3SO6 A;  5J3T A;  1MK7 B;  5JLJ B;  1RJ2 A;  1V5M A;  4Z2N A;  1WJM A;  3NWA A;  1PMS A;  1UEF A;  1E5W A;  1NU2 A;  4HAT B;  2Z13 A;  2V76 A;  2QKL A;  3FSS A;  2GCL A;  1WGU A;  5C6R A;  2M14 A;  3NSU A;  1EGX A;  1NI2 A;  1FHW A;  1MK9 B;  2J59 M;  2YT0 A;  5HE3 A;  2Y8G A;  1X1F A;  4MK0 A;  2W2X D;  4A6H A;  3TO1 A;  2Z0Q A;  3PP2 A;  4IFS A;  4YON A;  2L1C A;  2NMB A;  3X23 A;  2KIE A;  2MDX A;  1I2H A;  4K2P A;  3QBV B;  4GXB A;  1H4R A;  1DDW A;  1V5P A;  2RUK B;  3UZT A;  1FB8 A;  2JP2 A;  1QC6 A;  2HTH B;  1BTK A;  2D9Z A;  2DX1 A;  2ZPY A;  4EKU A;  2YVC A;  2D2Q A;  4A6F B;  1WGQ A;  1P6S A;  2K49 A;  5DH9 B;  2YS5 A;  2LYD A;  3DXC A;  2Z0O A;  3PG7 A;  2YS3 A;  2RLO A;  2R2Y A;  2K8E A;  1ZVR A;  3D8E A;  4Y94 A;  4EMO A;  2P0D A;  1W1H A;  3AJ4 A;  1J0W A;  2ROZ B;  2VSZ A;  5EFX A;  4EJN A;  2RRF A;  3WA0 A;  1KI1 B;  1P3R A;  5C5B B;  3TFM A;  2I1J A;  4C0A A;  2GUM A;  5CLL B;  3T06 A;  3HIE A;  4HAX B;  3ULB A;  1H10 A;  2Z4D A;  2IYB A;  1UNP A;  5LON B;  2W2W A;  3ODO A;  1UNR A;  4HB3 B;  5DIF B;  2KUP A;  1X11 A;  5M4Y B;  1FGZ A;  2KR0 A;  3PVL A;  5D3Y A;  2GCJ A;  4PNK A;  4ZRJ A;  1M7E A;  3AU4 A;  2YT1 A;  2AL6 A;  2J0J A;  2P0H A;  3ZVR A;  2H7E A;  2LG1 A;  1XR0 B;  1U5D A;  5C16 A;  1XKE A;  5CLQ B;  4GNK B;  1XD4 A;  1OQN A;  1UPQ A;  4A6F A;  5D3X A;  1W1G A;  2DHK A;  3RCP A;  5JP4 A;  2YS1 A;  2KIG A;  3O96 A;  4L6E A;  1WI1 A;  2LUL A;  4HAU B;  4XWX A;  2X18 A;  3DCX A;  5FI1 A;  1T77 A;  2DYN A;  3P7Z A;  2Z59 A;  3SV1 A;  4CSQ A;  3VOQ A;  4K2O A;  5KQ1 A;  2G35 A;  3GYP A;  4HB4 B;  5C5B A;  5J3Q A;  4L1R A;  1B55 A;  1RRP B;  2COA A;  3HQC A;  2OTX A;  3G9W A;  1Z87 A;  3ODX A;  1DDM A;  3WYF B;  3FVC A;  3OAN A;  3M1I B;  3MDB C;  4K81 A;  3QIJ A;  3HSA A;  2EMS A;  2FJL A;  4HB0 B;  1IRS A;  4QJ3 B;  3U12 A;  4K17 A;  3ULC A;  5D27 A;  5DHF B;  2J0K A;  3SUZ A;  2H7D A;  1NTV A;  4WVF B;  3NWD A;  2D11 A;  3U7D A;  3U8Z A;  3MPX A;  4KVG B;  4DXA B;  5IRS A;  2YSZ A;  3KRX A;  4A5K A;  2N0Y A;  3SNH A;  4F7H A;  1LB1 A;  1SGH A;  2MWN B;  4HHV A;  4IOY X;  1EAZ A;  1Y5O A;  3ODW A;  2L2I A;  2RSG A;  2XQN M;  2CY5 A;  2HE7 A;  4TKN A;  2ZKM X;  2RNR B;  2DFK A;  1U5F A;  4NSW A;  1DDV A;  4KHB B;  1BWN A;  1WVH A;  4D6W A;  3D8D A;  2EMT A;  4BBK A;  1XOD A;  5J3Y A;  1V61 A;  2RGN B;  1V5U A;  4B6H A;  4HAY B;  1FAO A;  4KHA A;  3OHM B;  4TYZ A;  4KAX B;  5HE0 A;  3TVV A;  2DKP A;  4CYE A;  1QQG A;  4MT7 A;  4GPT B;  5JHH A;  3A98 B;  2EC1 A;  4MY6 A;  5FI0 A;  1ZSQ A;  3DXD A;  3D8F A;  2YRY A;  2E2X A;  2UVM A;  4A6K A;  1X86 A;  2KGX B;  5DI9 B;  1U2B A;  2KUQ A;  1UNQ A;  3CIK A;  2MFQ A;  2DKQ A;  3F5R A;  1SHC A;  1WG7 A;  2CY4 A;  5I2M A;  1XX0 A;  2MKR A;  4HAW B;  4OSN A;  2K2J A;  1W1D A;  2ROV A;  4GN1 A;  2BCJ A;  3A8P A;  2VKI A;  3QWM A;  4OT1 A;  1GC6 A;  3KSY A;  1GG3 A;  2YF0 A;  3VIA A;  3TW1 A;  1DBH A;  1FHX A;  2CRF A;  3FEH A;  3KZ1 A;  1OY2 A;  4IAP A;  2EJ8 A;  1AWE A;  2COC A;  2AEH A;  5HE2 A;  2ELB A;  4ZRI A;  4HAV B;  3HK0 A;  4KHB A;  1TXD A;  1MIX A;  5L81 A;  3BIN A;  3KRW A;  1ZC4 B;  2D9W A;  2COF A;  2GS0 A;  5D3W A; 
#chains in the Genus database with same CATH homology
 2DLW A;  1U5E A;  2ELA A;  1TQZ A;  4WSF A;  3GYO A;  2K00 A;  2Z0P A;  3N7C A;  4CHM A;  5JHG A;  2GJY A;  4CHJ A;  3AU5 A;  4HB2 B;  5KQ4 A;  2UZR A;  5DHA B;  3PEG A;  2R0D A;  1WJ1 A;  1ZC3 B;  1NTY A;  3V5W A;  4H8S A;  2D9V A;  4Z2M B;  1ISN A;  3HW2 B;  4F7U P;  1M7R A;  1U5G A;  3PVU A;  2I5C A;  4GZU A;  2D10 A;  3SYX A;  2I5F A;  2Y7B A;  2D4Q A;  4PQ0 A;  1Q67 A;  1BAK A;  1FHO A;  2D9Y A;  1UPR A;  2DTC A;  2D9X A;  1ZM0 A;  2DA0 A;  5HE1 A;  2KCJ A;  2OQB A;  1LW3 A;  3PZD A;  1DYN A;  1FGY A;  3KY9 A;  5C79 A;  2CAY A;  2COD A;  1I7A A;  1K5G B;  2LOX A;  2J0M A;  4HDO A;  3PVW A;  5LOP B;  3TCA A;  3ZDT A;  1BTN A;  1DRO A;  4NY0 A;  4GMX B;  2IFS A;  4HDQ A;  5KCV A;  3F0W A;  1Y19 B;  2Q13 A;  2DX5 A;  2DHJ A;  2Y8F A;  1V88 A;  5D3V A;  2QKM A;  1N3H A;  1EVH A;  1PLS A;  2UZS A;  1EF1 A;  3PSC A;  1MPH A;  1MIZ B;  2ADZ A;  1J19 A;  2RVB B;  2I1K A;  1TJ6 A;  1P5T A;  4ZRK A;  2W2X C;  2VRW B;  4D0N B;  4HAZ B;  1U27 A;  2N23 A;  1FOE A;  3BJI A;  3DXE A;  2R09 A;  4KHO A;  1GC7 A;  3CXB B;  1U29 A;  4DBB A;  3ML4 A;  2P8V A;  1MKE A;  2P0F A;  1XCG A;  4DX9 0;  2DHI A;  1V89 A;  3P6A A;  1AQC A;  3A8Q A;  2DYQ A;  2PZ1 A;  2NZ8 B;  1K5D B;  3FM8 C;  1KZ7 A;  4F7G A;  2LOZ A;  1X05 A;  5GOW B;  3IVF A;  3LJU X;  1X1G A;  1MAI A;  2M38 A;  1PFJ A;  2K2U A;  4WJ7 A;  4P7I A;  2LKO A;  4YL8 A;  4DX8 A;  4GMV A;  2DN6 A;  1KZG A;  1OMW A;  3SO6 A;  5J3T A;  1MK7 B;  5JLJ B;  1RJ2 A;  1V5M A;  4Z2N A;  1WJM A;  1PMS A;  1UEF A;  1E5W A;  1NU2 A;  4HAT B;  2V76 A;  2QKL A;  3FSS A;  2GCL A;  1WGU A;  5C6R A;  2M14 A;  3NSU A;  1EGX A;  1NI2 A;  1FHW A;  1MK9 B;  2J59 M;  2YT0 A;  5HE3 A;  2Y8G A;  1X1F A;  4MK0 A;  2W2X D;  4A6H A;  3TO1 A;  2Z0Q A;  3PP2 A;  4IFS A;  4YON A;  2L1C A;  2NMB A;  3X23 A;  2MDX A;  1I2H A;  4K2P A;  3QBV B;  4GXB A;  1H4R A;  1DDW A;  1V5P A;  2RUK B;  3UZT A;  1FB8 A;  2JP2 A;  1QC6 A;  2HTH B;  1BTK A;  2D9Z A;  2DX1 A;  2ZPY A;  4EKU A;  2YVC A;  2D2Q A;  4A6F B;  1WGQ A;  1P6S A;  5DH9 B;  2YS5 A;  2LYD A;  3DXC A;  2Z0O A;  3PG7 A;  2YS3 A;  2RLO A;  1ZVR A;  3D8E A;  4Y94 A;  4EMO A;  2P0D A;  1W1H A;  3AJ4 A;  1J0W A;  2ROZ B;  2VSZ A;  5EFX A;  4EJN A;  3WA0 A;  1KI1 B;  1P3R A;  5C5B B;  3TFM A;  2I1J A;  4C0A A;  5CLL B;  3T06 A;  4HAX B;  3ULB A;  1H10 A;  2IYB A;  1UNP A;  5LON B;  2W2W A;  3ODO A;  1UNR A;  4HB3 B;  5DIF B;  2KUP A;  1X11 A;  1FGZ A;  3PVL A;  5D3Y A;  2GCJ A;  4PNK A;  4ZRJ A;  1M7E A;  3AU4 A;  2YT1 A;  2AL6 A;  2J0J A;  2P0H A;  3ZVR A;  2H7E A;  2LG1 A;  1XR0 B;  1U5D A;  5C16 A;  1XKE A;  5CLQ B;  1XD4 A;  1OQN A;  1UPQ A;  4A6F A;  5D3X A;  1W1G A;  2DHK A;  3RCP A;  5JP4 A;  2YS1 A;  3O96 A;  4L6E A;  1WI1 A;  2LUL A;  4HAU B;  4XWX A;  2X18 A;  5FI1 A;  2DYN A;  3P7Z A;  3SV1 A;  3VOQ A;  4K2O A;  5KQ1 A;  2G35 A;  3GYP A;  4HB4 B;  5C5B A;  5J3Q A;  1B55 A;  1RRP B;  2COA A;  3HQC A;  2OTX A;  3G9W A;  1Z87 A;  3ODX A;  1DDM A;  3WYF B;  3OAN A;  3M1I B;  3MDB C;  4K81 A;  3QIJ A;  2EMS A;  2FJL A;  4HB0 B;  1IRS A;  4K17 A;  3ULC A;  5D27 A;  5DHF B;  2J0K A;  3SUZ A;  2H7D A;  1NTV A;  4WVF B;  2D11 A;  3U7D A;  3U8Z A;  3MPX A;  4KVG B;  4DXA B;  2YSZ A;  3KRX A;  4A5K A;  2N0Y A;  3SNH A;  4F7H A;  1LB1 A;  1SGH A;  2MWN B;  4HHV A;  4IOY X;  1EAZ A;  1Y5O A;  3ODW A;  2L2I A;  2RSG A;  2XQN M;  2CY5 A;  2HE7 A;  4TKN A;  2RNR B;  2DFK A;  1U5F A;  4NSW A;  1DDV A;  4KHB B;  1BWN A;  1WVH A;  3D8D A;  2EMT A;  4BBK A;  1XOD A;  5J3Y A;  1V61 A;  2RGN B;  1V5U A;  4B6H A;  4HAY B;  1FAO A;  4KHA A;  4TYZ A;  4KAX B;  5HE0 A;  3TVV A;  2DKP A;  4CYE A;  1QQG A;  4MT7 A;  4GPT B;  5JHH A;  3A98 B;  2EC1 A;  4MY6 A;  5FI0 A;  1ZSQ A;  3DXD A;  3D8F A;  2YRY A;  2E2X A;  2UVM A;  4A6K A;  1X86 A;  2KGX B;  5DI9 B;  1U2B A;  1UNQ A;  3CIK A;  2MFQ A;  2DKQ A;  3F5R A;  1SHC A;  1WG7 A;  2CY4 A;  1XX0 A;  2MKR A;  4HAW B;  2K2J A;  1W1D A;  2ROV A;  4GN1 A;  2BCJ A;  3A8P A;  2VKI A;  3QWM A;  1GC6 A;  3KSY A;  1GG3 A;  2YF0 A;  3VIA A;  3TW1 A;  1DBH A;  1FHX A;  2CRF A;  3FEH A;  3KZ1 A;  1OY2 A;  4IAP A;  2EJ8 A;  1AWE A;  2COC A;  2AEH A;  5HE2 A;  2ELB A;  4ZRI A;  4HAV B;  3HK0 A;  1TXD A;  1MIX A;  5L81 A;  3BIN A;  3KRW A;  1ZC4 B;  2D9W A;  2COF A;  2GS0 A;  5D3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...