4DBBA

The ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
150
Chain Sequence
EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRAINPEDLSQKEYSDLLNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords Amyloid beta A4 precursor protein-binding family A member 1
total genus 36
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dbbA00
5C79A 2GCLA 2YS1A 1FOEA 2D9YA 3ML4A 4YONA 2CAYA 4WSFA 5HE1A 2COCA 2KCJA 3DXCA 4D0NB 1FGYA 2CY4A 4HAXB 2J0JA 4P7IA 2GS0A 3KRWA 2ELAA 1M7RA 3KSYA 3PSCA 1MAIA 2EMTA 1NTVA 3MDBC 1U2BA 3OANA 1RRPB 1I7AA 1UPQA 2MKRA 1WG7A 2H7DA 3N7CA 3GYPA 1Y19B 1LB1A 2G35A 3CIKA 4F7UP 2DLWA 3ULBA 1AQCA 2LG1A 1J19A 3DXEA 2DHJA 3HW2B 1PMSA 4KAXB 3TFMA 2V76A 3RCPA 3PVUA 5KQ1A 5DI9B 1BWNA 1MIXA 2Y8FA 5D3YA 2Z0PA 1U5GA 5DH9B 2VRWB 4ZRJA 2RSGA 4IFSA 5EFXA 4HDOA 2D9WA 3PP2A 4HAYB 1KZGA 5C6RA 2LULA 1FHWA 2DHIA 4DX8A 3T06A 2IFSA 2ROVA 4K2OA 3HQCA 1KI1B 3NSUA 4ZRKA 2DYNA 2AL6A 1P5TA 2D9ZA 4A5KA 3O96A 3QBVB 3FSSA 3KRXA 3ODOA 3PG7A 1OY2A 4CHJA 2W2XC 3F0WA 2Y8GA 3CXBB 4PQ0A 2E2XA 2NZ8B 1WVHA 2J0MA 1I2HA 1NU2A 1FB8A 4A6KA 4NSWA 2D11A 1MKEA 2K2UA 2DKPA 2MFQA 4MY6A 2ADZA 3F5RA 1X05A 1ZC3B 1PLSA 3KY9A 1DROA 1QC6A 1W1HA 1U27A 4A6FA 2Q13A 1DDVA 1U5DA 5D3VA 2DFKA 1P6SA 1WI1A 4Z2NA 5L81A 3ULCA 5CLLB 3U8ZA 3SNHA 3VIAA 2VSZA 1V88A 1Q67A 1MIZB 2JP2A 4NY0A 2HTHB 1NTYA 3SV1A 1X86A 4K17A 2QKLA 4GN1A 1WJ1A 1TQZA 3SYXA 5DHFB 1FGZA 2DX5A 2YT0A 3TW1A 3DXDA 2OQBA 1H4RA 5FI1A 4KHOA 1V5UA 4HAUB 1E5WA 2EC1A 1DBHA 5HE2A 2R0DA 1W1DA 4TKNA 4HB0B 2MWNB 3ZDTA 1MK7B 1FHOA 2EMSA 2FJLA 4MK0A 2I5CA 4XWXA 5KCVA 2YSZA 4HB4B 1TJ6A 1B55A 2P0DA 2LYDA 2Z0QA 4K81A 1ZSQA 1V89A 2VKIA 5FI0A 1RJ2A 5J3YA 3AU5A 3X23A 1P3RA 4GMVA 1X1GA 1LW3A 5GOWB 2I1JA 1V61A 3KZ1A 2YS5A 1TXDA 5JHHA 4HAZB 1SHCA 2X18A 5DIFB 2P0HA 3UZTA 3VOQA 2L2IA 1XD4A 5J3QA 1UEFA 1U29A 2D9XA 2RUKB 2M14A 3TCAA 2RLOA 3D8DA 4C0AA 1U5EA 3PVWA 1DYNA 2GCJA 2KUPA 3ZVRA 1EVHA 3U7DA 2QKMA 4A6HA 2L1CA 3FM8C 5C5BA 4F7HA 5JHGA 2ROZB 4GMXB 4YL8A 4DBBA 4HATB 2LKOA 2D10A 3P6AA 4HDQA 2DYQA 5J3TA 3IVFA 2BCJA 2J0KA 4IAPA 1WGQA 4HAWB 1BTNA 2ELBA 2YS3A 2COFA 2W2WA 2P8VA 3ODWA 1XKEA 4L6EA 2I1KA 3G9WA 4K2PA 2D2QA 2DX1A 2OTXA 3M1IB 4ZRIA 2K00A 5C5BB 5D3XA 2UVMA 5CLQB 3LJUX 1W1GA 3BJIA 3QIJA 4HB3B 1M7EA 4H8SA 4CYEA 2UZRA 4WVFB 2YT1A 1N3HA 4GXBA 1IRSA 1ZM0A 5JLJB 2CRFA 2NMBA 1GC6A 3AU4A 2D9VA 4CHMA 1NI2A 2DTCA 3QWMA 1K5GB 2J59M 4DX90 1Y5OA 4KHAA 3PZDA 2AEHA 3PEGA 2ZPYA 4F7GA 1XCGA 2CODA 3MPXA 3AJ4A 3SO6A 2YF0A 2W2XD 4Z2MB 2RVBB 3ODXA 1FAOA 3A8PA 1XX0A 2RGNB 1FHXA 4HAVB 1KZ7A 2MDXA 4B6HA 1OQNA 5LONB 1WGUA 1MPHA 3WA0A 1BAKA 4EMOA 1EF1A 5LOPB 4KVGB 1X11A 1AWEA 3V5WA 2KGXB 1EGXA 3A8QA 5HE3A 3BINA 3HK0A 2DN6A 2YRYA 3D8FA 2I5FA 3FEHA 4TYZA 4DXAB 3TO1A 2PZ1A 1XODA 3GYOA 1SGHA 1MK9B 4GZUA 2RNRB 1J0WA 2N23A 1UPRA 2DKQA 1GG3A 1DDWA 5KQ4A 1H10A 5D27A 5C16A 2LOZA 4EJNA 1UNRA 2GJYA 5JP4A 3SUZA 4HB2B 4EKUA 1EAZA 3WYFB 1V5PA 4KHBB 2DHKA 2EJ8A 4IOYX 4WJ7A 4PNKA 5DHAB 2CY5A 2XQNM 5HE0A 1ZC4B 4A6FB 2IYBA 2D4QA 2COAA 4HHVA 2Y7BA 2HE7A 4MT7A 3TVVA 1BTKA 1OMWA 1UNPA 2Z0OA 1UNQA 1ZVRA 4BBKA 1GC7A 1QQGA 4Y94A 2H7EA 1DDMA 2DA0A 4GPTB 3A98B 3D8EA 1X1FA 1K5DB 2P0FA 1U5FA 2M38A 2LOXA 1XR0B 3P7ZA 1WJMA 2K2JA 1V5MA 5D3WA 3PVLA 2R09A 1Z87A 2YVCA 2N0YA 1PFJA 1ISNA 2UZSA
chains in the Genus database with same CATH superfamily
5C79A 2GCLA 2YS1A 1FOEA 2D9YA 3ML4A 4YONA 2CAYA 4WSFA 5HE1A 2COCA 2KCJA 3DXCA 4D0NB 1FGYA 2CY4A 4HAXB 2J0JA 5I2MA 4P7IA 2GS0A 3KRWA 2ELAA 2KR0A 1M7RA 3KSYA 3PSCA 1MAIA 2K49A 2EMTA 1NTVA 3MDBC 1U2BA 3OANA 1RRPB 1I7AA 1UPQA 2MKRA 1WG7A 2H7DA 3N7CA 3GYPA 1Y19B 1LB1A 2G35A 3CIKA 4F7UP 2DLWA 2ZKMX 3ULBA 1AQCA 2LG1A 1J19A 3DXEA 2DHJA 4GOUA 3HW2B 1PMSA 4KAXB 3TFMA 2V76A 3RCPA 3PVUA 5KQ1A 5DI9B 1BWNA 1MIXA 2Y8FA 5D3YA 2Z0PA 1U5GA 5DH9B 2VRWB 4ZRJA 2RSGA 4IFSA 5EFXA 4HDOA 2D9WA 3HSAA 3PP2A 1MI1A 1KZGA 4HAYB 5C6RA 2LULA 1FHWA 2DHIA 4DX8A 3T06A 4CSQA 2IFSA 2ROVA 5I2SA 4K2OA 3HQCA 1KI1B 3NSUA 4ZRKA 2DYNA 2AL6A 1P5TA 2D9ZA 4A5KA 3O96A 3QBVB 3FSSA 3KRXA 3ODOA 3PG7A 3DCXA 1OY2A 4CHJA 2W2XC 3F0WA 2Y8GA 3CXBB 4PQ0A 2E2XA 2NZ8B 1WVHA 2J0MA 3FVCA 1I2HA 1NU2A 1FB8A 4A6KA 4NSWA 2D11A 1MKEA 2K2UA 2DKPA 2MFQA 4MY6A 2ADZA 4QJ5B 3F5RA 1X05A 2KUQA 2Z59A 1ZC3B 1T77A 3NWDA 1PLSA 3KY9A 1DROA 1QC6A 1W1HA 1U27A 4A6FA 2Q13A 1DDVA 1U5DA 5D3VA 4KHBA 2Z14A 2DFKA 1P6SA 1WI1A 4Z2NA 5L81A 3ULCA 5CLLB 3U8ZA 3SNHA 3VIAA 2VSZA 1V88A 1Q67A 1MIZB 2JP2A 4NY0A 4DIXA 2HTHB 1NTYA 3A58A 3SV1A 1X86A 4K17A 2QKLA 4GN1A 1WJ1A 1TQZA 3SYXA 5DHFB 1FGZA 2DX5A 2YT0A 3TW1A 3B77A 2RRFA 3DXDA 2OQBA 2GUMA 1H4RA 5FI1A 4KHOA 1V5UA 4HAUB 1E5WA 2EC1A 3NWFA 1DBHA 5HE2A 2R0DA 1W1DA 4TKNA 4HB0B 4OSNA 2MWNB 3ZDTA 1MK7B 5M4YB 1FHOA 2EMSA 2FJLA 4MK0A 2I5CA 4XWXA 2YT2A 5KCVA 2K8EA 2YSZA 4HB4B 3OHMB 1TJ6A 1B55A 2P0DA 2LYDA 2Z0QA 4K81A 1ZSQA 1V89A 2VKIA 5FI0A 1RJ2A 5J3YA 3AU5A 3X23A 1P3RA 4GMVA 1X1GA 4OT1A 1LW3A 5GOWB 2I1JA 1V61A 3KZ1A 2YS5A 1TXDA 5JHHA 4HAZB 1SHCA 2X18A 5DIFB 2P0HA 3UZTA 3VOQA 3NW8A 2L2IA 1XD4A 5J3QA 1UEFA 1U29A 2D9XA 2RUKB 2M14A 3TCAA 2RLOA 3D8DA 4C0AA 1U5EA 3PVWA 1DYNA 2GCJA 2KUPA 3ZVRA 1EVHA 3U7DA 2QKMA 4A6HA 2L1CA 3FM8C 5C5BA 4F7HA 5JHGA 2ROZB 4GMXB 4YL8A 4DBBA 2Z13A 4HATB 2NBVA 2LKOA 2D10A 3P6AA 4HDQA 2DYQA 4L1RA 5J3TA 3IVFA 2BCJA 5IRSA 2J0KA 4IAPA 1WGQA 4HAWB 1BTNA 2ELBA 4QXAB 2YS3A 2COFA 2W2WA 2P8VA 3ODWA 1XKEA 4L6EA 2I1KA 3G9WA 4K2PA 2D2QA 3U12A 2DX1A 2OTXA 2KIGA 3M1IB 4ZRIA 2K00A 5C5BB 5D3XA 2UVMA 5CLQB 3LJUX 1W1GA 3BJIA 3QIJA 4HB3B 1M7EA 4H8SA 4CYEA 2UZRA 4QJ3B 4WVFB 2YT1A 1N3HA 4GXBA 1IRSA 1ZM0A 5JLJB 2CRFA 2NMBA 1GC6A 3AU4A 2D9VA 4CHMA 1NI2A 2DTCA 2R2YA 3QWMA 1K5GB 2J59M 4DX90 1Y5OA 2FJUB 4KHAA 3PZDA 2AEHA 3PEGA 2ZPYA 4F7GA 1XCGA 2CODA 4GNKB 3MPXA 3AJ4A 3SO6A 2YF0A 3HIEA 2W2XD 4Z2MB 2RVBB 3ODXA 1FAOA 5LG4B 3A8PA 1XX0A 2RGNB 1FHXA 4HAVB 1KZ7A 2MDXA 4B6HA 1OQNA 5LONB 1WGUA 1MPHA 3WA0A 1BAKA 4EMOA 1ZYIA 1EF1A 5LOPB 4KVGB 1X11A 1AWEA 3V5WA 2KGXB 1EGXA 3A8QA 5HE3A 3BINA 3HK0A 2DN6A 2YRYA 3D8FA 2I5FA 3FEHA 4TYZA 4DXAB 3TO1A 2PZ1A 1XODA 3GYOA 1SGHA 1MK9B 4GZUA 2RNRB 1J0WA 2N23A 1UPRA 2DKQA 4D6WA 1GG3A 1DDWA 5KQ4A 1H10A 5D27A 5C16A 2LOZA 4EJNA 1UNRA 2GJYA 5JP4A 3SUZA 4HB2B 4EKUA 1EAZA 3WYFB 1V5PA 4KHBB 2Z4DA 2DHKA 2EJ8A 4IOYX 4WJ7A 4PNKA 5DHAB 2CY5A 2XQNM 5HE0A 1ZC4B 4A6FB 2IYBA 2D4QA 2COAA 4HHVA 2Y7BA 2HE7A 4MT7A 3TVVA 1BTKA 1OMWA 1UNPA 2Z0OA 1UNQA 1ZVRA 4BBKA 1GC7A 1QQGA 4Y94A 2H7EA 1DDMA 2DA0A 4GPTB 3A98B 3D8EA 1X1FA 1K5DB 2P0FA 1U5FA 3NWAA 2M38A 2LOXA 1XR0B 3P7ZA 1WJMA 2K2JA 1V5MA 2KIEA 5D3WA 4QJ4B 3PVLA 2R09A 1Z87A 2YVCA 2N0YA 1PFJA 4HSIA 1ISNA 2UZSA
chains in the Genus database with same CATH topology
5C79A 2GCLA 2YS1A 1FOEA 2D9YA 3ML4A 4YONA 2CAYA 4WSFA 5HE1A 2COCA 2KCJA 3DXCA 4D0NB 1FGYA 2CY4A 4HAXB 2J0JA 4P7IA 2GS0A 3KRWA 2ELAA 1M7RA 3KSYA 3PSCA 1MAIA 2EMTA 1NTVA 3MDBC 1U2BA 3OANA 1RRPB 1I7AA 1UPQA 2MKRA 1WG7A 2H7DA 3N7CA 3GYPA 1Y19B 1LB1A 2G35A 3CIKA 4F7UP 2DLWA 3ULBA 1AQCA 2LG1A 1J19A 3DXEA 2DHJA 3HW2B 1PMSA 4KAXB 3TFMA 2V76A 3RCPA 3PVUA 5KQ1A 5DI9B 1BWNA 1MIXA 2Y8FA 5D3YA 2Z0PA 1U5GA 5DH9B 2VRWB 4ZRJA 2RSGA 4IFSA 5EFXA 4HDOA 2D9WA 3PP2A 4HAYB 1KZGA 5C6RA 2LULA 1FHWA 2DHIA 4DX8A 3T06A 2IFSA 2ROVA 4K2OA 3HQCA 1KI1B 3NSUA 4ZRKA 2DYNA 2AL6A 1P5TA 2D9ZA 4A5KA 3O96A 3QBVB 3FSSA 3KRXA 3ODOA 3PG7A 1OY2A 4CHJA 2W2XC 3F0WA 2Y8GA 3CXBB 4PQ0A 2E2XA 2NZ8B 1WVHA 2J0MA 1I2HA 1NU2A 1FB8A 4A6KA 4NSWA 2D11A 1MKEA 2K2UA 2DKPA 2MFQA 4MY6A 2ADZA 3F5RA 1X05A 1ZC3B 1PLSA 3KY9A 1DROA 1QC6A 1W1HA 1U27A 4A6FA 2Q13A 1DDVA 1U5DA 5D3VA 2DFKA 1P6SA 1WI1A 4Z2NA 5L81A 3ULCA 5CLLB 3U8ZA 3SNHA 3VIAA 2VSZA 1V88A 1Q67A 1MIZB 2JP2A 4NY0A 2HTHB 1NTYA 3SV1A 1X86A 4K17A 2QKLA 4GN1A 1WJ1A 1TQZA 3SYXA 5DHFB 1FGZA 2DX5A 2YT0A 3TW1A 3DXDA 2OQBA 1H4RA 5FI1A 4KHOA 1V5UA 4HAUB 1E5WA 2EC1A 1DBHA 5HE2A 2R0DA 1W1DA 4TKNA 4HB0B 2MWNB 3ZDTA 1MK7B 1FHOA 2EMSA 2FJLA 4MK0A 2I5CA 4XWXA 5KCVA 2YSZA 4HB4B 1TJ6A 1B55A 2P0DA 2LYDA 2Z0QA 4K81A 1ZSQA 1V89A 2VKIA 5FI0A 1RJ2A 5J3YA 3AU5A 3X23A 1P3RA 4GMVA 1X1GA 1LW3A 5GOWB 2I1JA 1V61A 3KZ1A 2YS5A 1TXDA 5JHHA 4HAZB 1SHCA 2X18A 5DIFB 2P0HA 3UZTA 3VOQA 2L2IA 1XD4A 5J3QA 1UEFA 1U29A 2D9XA 2RUKB 2M14A 3TCAA 2RLOA 3D8DA 4C0AA 1U5EA 3PVWA 1DYNA 2GCJA 2KUPA 3ZVRA 1EVHA 3U7DA 2QKMA 4A6HA 2L1CA 3FM8C 5C5BA 4F7HA 5JHGA 2ROZB 4GMXB 4YL8A 4DBBA 4HATB 2LKOA 2D10A 3P6AA 4HDQA 2DYQA 5J3TA 3IVFA 2BCJA 2J0KA 4IAPA 1WGQA 4HAWB 1BTNA 2ELBA 2YS3A 2COFA 2W2WA 2P8VA 3ODWA 1XKEA 4L6EA 2I1KA 3G9WA 4K2PA 2D2QA 2DX1A 2OTXA 3M1IB 4ZRIA 2K00A 5C5BB 5D3XA 2UVMA 5CLQB 3LJUX 1W1GA 3BJIA 3QIJA 4HB3B 1M7EA 4H8SA 4CYEA 2UZRA 4WVFB 2YT1A 1N3HA 4GXBA 1IRSA 1ZM0A 5JLJB 2CRFA 2NMBA 1GC6A 3AU4A 2D9VA 4CHMA 1NI2A 2DTCA 3QWMA 1K5GB 2J59M 4DX90 1Y5OA 4KHAA 3PZDA 2AEHA 3PEGA 2ZPYA 4F7GA 1XCGA 2CODA 3MPXA 3AJ4A 3SO6A 2YF0A 2W2XD 4Z2MB 2RVBB 3ODXA 1FAOA 3A8PA 1XX0A 2RGNB 1FHXA 4HAVB 1KZ7A 2MDXA 4B6HA 1OQNA 5LONB 1WGUA 1MPHA 3WA0A 1BAKA 4EMOA 1EF1A 5LOPB 4KVGB 1X11A 1AWEA 3V5WA 2KGXB 1EGXA 3A8QA 5HE3A 3BINA 3HK0A 2DN6A 2YRYA 3D8FA 2I5FA 3FEHA 4TYZA 4DXAB 3TO1A 2PZ1A 1XODA 3GYOA 1SGHA 1MK9B 4GZUA 2RNRB 1J0WA 2N23A 1UPRA 2DKQA 1GG3A 1DDWA 5KQ4A 1H10A 5D27A 5C16A 2LOZA 4EJNA 1UNRA 2GJYA 5JP4A 3SUZA 4HB2B 4EKUA 1EAZA 3WYFB 1V5PA 4KHBB 2DHKA 2EJ8A 4IOYX 4WJ7A 4PNKA 5DHAB 2CY5A 2XQNM 5HE0A 1ZC4B 4A6FB 2IYBA 2D4QA 2COAA 4HHVA 2Y7BA 2HE7A 4MT7A 3TVVA 1BTKA 1OMWA 1UNPA 2Z0OA 1UNQA 1ZVRA 4BBKA 1GC7A 1QQGA 4Y94A 2H7EA 1DDMA 2DA0A 4GPTB 3A98B 3D8EA 1X1FA 1K5DB 2P0FA 1U5FA 2M38A 2LOXA 1XR0B 3P7ZA 1WJMA 2K2JA 1V5MA 5D3WA 3PVLA 2R09A 1Z87A 2YVCA 2N0YA 1PFJA 1ISNA 2UZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C79 A;  2GCL A;  2YS1 A;  1FOE A;  2D9Y A;  3ML4 A;  4YON A;  2CAY A;  4WSF A;  5HE1 A;  2COC A;  2KCJ A;  3DXC A;  4D0N B;  1FGY A;  2CY4 A;  4HAX B;  2J0J A;  4P7I A;  2GS0 A;  3KRW A;  2ELA A;  1M7R A;  3KSY A;  3PSC A;  1MAI A;  2EMT A;  1NTV A;  3MDB C;  1U2B A;  3OAN A;  1RRP B;  1I7A A;  1UPQ A;  2MKR A;  1WG7 A;  2H7D A;  3N7C A;  3GYP A;  1Y19 B;  1LB1 A;  2G35 A;  3CIK A;  4F7U P;  2DLW A;  3ULB A;  1AQC A;  2LG1 A;  1J19 A;  3DXE A;  2DHJ A;  3HW2 B;  1PMS A;  4KAX B;  3TFM A;  2V76 A;  3RCP A;  3PVU A;  5KQ1 A;  5DI9 B;  1BWN A;  1MIX A;  2Y8F A;  5D3Y A;  2Z0P A;  1U5G A;  5DH9 B;  2VRW B;  4ZRJ A;  2RSG A;  4IFS A;  5EFX A;  4HDO A;  2D9W A;  3PP2 A;  4HAY B;  1KZG A;  5C6R A;  2LUL A;  1FHW A;  2DHI A;  4DX8 A;  3T06 A;  2IFS A;  2ROV A;  4K2O A;  3HQC A;  1KI1 B;  3NSU A;  4ZRK A;  2DYN A;  2AL6 A;  1P5T A;  2D9Z A;  4A5K A;  3O96 A;  3QBV B;  3FSS A;  3KRX A;  3ODO A;  3PG7 A;  1OY2 A;  4CHJ A;  2W2X C;  3F0W A;  2Y8G A;  3CXB B;  4PQ0 A;  2E2X A;  2NZ8 B;  1WVH A;  2J0M A;  1I2H A;  1NU2 A;  1FB8 A;  4A6K A;  4NSW A;  2D11 A;  1MKE A;  2K2U A;  2DKP A;  2MFQ A;  4MY6 A;  2ADZ A;  3F5R A;  1X05 A;  1ZC3 B;  1PLS A;  3KY9 A;  1DRO A;  1QC6 A;  1W1H A;  1U27 A;  4A6F A;  2Q13 A;  1DDV A;  1U5D A;  5D3V A;  2DFK A;  1P6S A;  1WI1 A;  4Z2N A;  5L81 A;  3ULC A;  5CLL B;  3U8Z A;  3SNH A;  3VIA A;  2VSZ A;  1V88 A;  1Q67 A;  1MIZ B;  2JP2 A;  4NY0 A;  2HTH B;  1NTY A;  3SV1 A;  1X86 A;  4K17 A;  2QKL A;  4GN1 A;  1WJ1 A;  1TQZ A;  3SYX A;  5DHF B;  1FGZ A;  2DX5 A;  2YT0 A;  3TW1 A;  3DXD A;  2OQB A;  1H4R A;  5FI1 A;  4KHO A;  1V5U A;  4HAU B;  1E5W A;  2EC1 A;  1DBH A;  5HE2 A;  2R0D A;  1W1D A;  4TKN A;  4HB0 B;  2MWN B;  3ZDT A;  1MK7 B;  1FHO A;  2EMS A;  2FJL A;  4MK0 A;  2I5C A;  4XWX A;  5KCV A;  2YSZ A;  4HB4 B;  1TJ6 A;  1B55 A;  2P0D A;  2LYD A;  2Z0Q A;  4K81 A;  1ZSQ A;  1V89 A;  2VKI A;  5FI0 A;  1RJ2 A;  5J3Y A;  3AU5 A;  3X23 A;  1P3R A;  4GMV A;  1X1G A;  1LW3 A;  5GOW B;  2I1J A;  1V61 A;  3KZ1 A;  2YS5 A;  1TXD A;  5JHH A;  4HAZ B;  1SHC A;  2X18 A;  5DIF B;  2P0H A;  3UZT A;  3VOQ A;  2L2I A;  1XD4 A;  5J3Q A;  1UEF A;  1U29 A;  2D9X A;  2RUK B;  2M14 A;  3TCA A;  2RLO A;  3D8D A;  4C0A A;  1U5E A;  3PVW A;  1DYN A;  2GCJ A;  2KUP A;  3ZVR A;  1EVH A;  3U7D A;  2QKM A;  4A6H A;  2L1C A;  3FM8 C;  5C5B A;  4F7H A;  5JHG A;  2ROZ B;  4GMX B;  4YL8 A;  4DBB A;  4HAT B;  2LKO A;  2D10 A;  3P6A A;  4HDQ A;  2DYQ A;  5J3T A;  3IVF A;  2BCJ A;  2J0K A;  4IAP A;  1WGQ A;  4HAW B;  1BTN A;  2ELB A;  2YS3 A;  2COF A;  2W2W A;  2P8V A;  3ODW A;  1XKE A;  4L6E A;  2I1K A;  3G9W A;  4K2P A;  2D2Q A;  2DX1 A;  2OTX A;  3M1I B;  4ZRI A;  2K00 A;  5C5B B;  5D3X A;  2UVM A;  5CLQ B;  3LJU X;  1W1G A;  3BJI A;  3QIJ A;  4HB3 B;  1M7E A;  4H8S A;  4CYE A;  2UZR A;  4WVF B;  2YT1 A;  1N3H A;  4GXB A;  1IRS A;  1ZM0 A;  5JLJ B;  2CRF A;  2NMB A;  1GC6 A;  3AU4 A;  2D9V A;  4CHM A;  1NI2 A;  2DTC A;  3QWM A;  1K5G B;  2J59 M;  4DX9 0;  1Y5O A;  4KHA A;  3PZD A;  2AEH A;  3PEG A;  2ZPY A;  4F7G A;  1XCG A;  2COD A;  3MPX A;  3AJ4 A;  3SO6 A;  2YF0 A;  2W2X D;  4Z2M B;  2RVB B;  3ODX A;  1FAO A;  3A8P A;  1XX0 A;  2RGN B;  1FHX A;  4HAV B;  1KZ7 A;  2MDX A;  4B6H A;  1OQN A;  5LON B;  1WGU A;  1MPH A;  3WA0 A;  1BAK A;  4EMO A;  1EF1 A;  5LOP B;  4KVG B;  1X11 A;  1AWE A;  3V5W A;  2KGX B;  1EGX A;  3A8Q A;  5HE3 A;  3BIN A;  3HK0 A;  2DN6 A;  2YRY A;  3D8F A;  2I5F A;  3FEH A;  4TYZ A;  4DXA B;  3TO1 A;  2PZ1 A;  1XOD A;  3GYO A;  1SGH A;  1MK9 B;  4GZU A;  2RNR B;  1J0W A;  2N23 A;  1UPR A;  2DKQ A;  1GG3 A;  1DDW A;  5KQ4 A;  1H10 A;  5D27 A;  5C16 A;  2LOZ A;  4EJN A;  1UNR A;  2GJY A;  5JP4 A;  3SUZ A;  4HB2 B;  4EKU A;  1EAZ A;  3WYF B;  1V5P A;  4KHB B;  2DHK A;  2EJ8 A;  4IOY X;  4WJ7 A;  4PNK A;  5DHA B;  2CY5 A;  2XQN M;  5HE0 A;  1ZC4 B;  4A6F B;  2IYB A;  2D4Q A;  2COA A;  4HHV A;  2Y7B A;  2HE7 A;  4MT7 A;  3TVV A;  1BTK A;  1OMW A;  1UNP A;  2Z0O A;  1UNQ A;  1ZVR A;  4BBK A;  1GC7 A;  1QQG A;  4Y94 A;  2H7E A;  1DDM A;  2DA0 A;  4GPT B;  3A98 B;  3D8E A;  1X1F A;  1K5D B;  2P0F A;  1U5F A;  2M38 A;  2LOX A;  1XR0 B;  3P7Z A;  1WJM A;  2K2J A;  1V5M A;  5D3W A;  3PVL A;  2R09 A;  1Z87 A;  2YVC A;  2N0Y A;  1PFJ A;  1ISN A;  2UZS A; 
#chains in the Genus database with same CATH topology
 5C79 A;  2GCL A;  2YS1 A;  1FOE A;  2D9Y A;  3ML4 A;  4YON A;  2CAY A;  4WSF A;  5HE1 A;  2COC A;  2KCJ A;  3DXC A;  4D0N B;  1FGY A;  2CY4 A;  4HAX B;  2J0J A;  5I2M A;  4P7I A;  2GS0 A;  3KRW A;  2ELA A;  2KR0 A;  1M7R A;  3KSY A;  3PSC A;  1MAI A;  2K49 A;  2EMT A;  1NTV A;  3MDB C;  1U2B A;  3OAN A;  1RRP B;  1I7A A;  1UPQ A;  2MKR A;  1WG7 A;  2H7D A;  3N7C A;  3GYP A;  1Y19 B;  1LB1 A;  2G35 A;  3CIK A;  4F7U P;  2DLW A;  2ZKM X;  3ULB A;  1AQC A;  2LG1 A;  1J19 A;  3DXE A;  2DHJ A;  4GOU A;  3HW2 B;  1PMS A;  4KAX B;  3TFM A;  2V76 A;  3RCP A;  3PVU A;  5KQ1 A;  5DI9 B;  1BWN A;  1MIX A;  2Y8F A;  5D3Y A;  2Z0P A;  1U5G A;  5DH9 B;  2VRW B;  4ZRJ A;  2RSG A;  4IFS A;  5EFX A;  4HDO A;  2D9W A;  3HSA A;  3PP2 A;  1MI1 A;  1KZG A;  4HAY B;  5C6R A;  2LUL A;  1FHW A;  2DHI A;  4DX8 A;  3T06 A;  4CSQ A;  2IFS A;  2ROV A;  5I2S A;  4K2O A;  3HQC A;  1KI1 B;  3NSU A;  4ZRK A;  2DYN A;  2AL6 A;  1P5T A;  2D9Z A;  4A5K A;  3O96 A;  3QBV B;  3FSS A;  3KRX A;  3ODO A;  3PG7 A;  3DCX A;  1OY2 A;  4CHJ A;  2W2X C;  3F0W A;  2Y8G A;  3CXB B;  4PQ0 A;  2E2X A;  2NZ8 B;  1WVH A;  2J0M A;  3FVC A;  1I2H A;  1NU2 A;  1FB8 A;  4A6K A;  4NSW A;  2D11 A;  1MKE A;  2K2U A;  2DKP A;  2MFQ A;  4MY6 A;  2ADZ A;  4QJ5 B;  3F5R A;  1X05 A;  2KUQ A;  2Z59 A;  1ZC3 B;  1T77 A;  3NWD A;  1PLS A;  3KY9 A;  1DRO A;  1QC6 A;  1W1H A;  1U27 A;  4A6F A;  2Q13 A;  1DDV A;  1U5D A;  5D3V A;  4KHB A;  2Z14 A;  2DFK A;  1P6S A;  1WI1 A;  4Z2N A;  5L81 A;  3ULC A;  5CLL B;  3U8Z A;  3SNH A;  3VIA A;  2VSZ A;  1V88 A;  1Q67 A;  1MIZ B;  2JP2 A;  4NY0 A;  4DIX A;  2HTH B;  1NTY A;  3A58 A;  3SV1 A;  1X86 A;  4K17 A;  2QKL A;  4GN1 A;  1WJ1 A;  1TQZ A;  3SYX A;  5DHF B;  1FGZ A;  2DX5 A;  2YT0 A;  3TW1 A;  3B77 A;  2RRF A;  3DXD A;  2OQB A;  2GUM A;  1H4R A;  5FI1 A;  4KHO A;  1V5U A;  4HAU B;  1E5W A;  2EC1 A;  3NWF A;  1DBH A;  5HE2 A;  2R0D A;  1W1D A;  4TKN A;  4HB0 B;  4OSN A;  2MWN B;  3ZDT A;  1MK7 B;  5M4Y B;  1FHO A;  2EMS A;  2FJL A;  4MK0 A;  2I5C A;  4XWX A;  2YT2 A;  5KCV A;  2K8E A;  2YSZ A;  4HB4 B;  3OHM B;  1TJ6 A;  1B55 A;  2P0D A;  2LYD A;  2Z0Q A;  4K81 A;  1ZSQ A;  1V89 A;  2VKI A;  5FI0 A;  1RJ2 A;  5J3Y A;  3AU5 A;  3X23 A;  1P3R A;  4GMV A;  1X1G A;  4OT1 A;  1LW3 A;  5GOW B;  2I1J A;  1V61 A;  3KZ1 A;  2YS5 A;  1TXD A;  5JHH A;  4HAZ B;  1SHC A;  2X18 A;  5DIF B;  2P0H A;  3UZT A;  3VOQ A;  3NW8 A;  2L2I A;  1XD4 A;  5J3Q A;  1UEF A;  1U29 A;  2D9X A;  2RUK B;  2M14 A;  3TCA A;  2RLO A;  3D8D A;  4C0A A;  1U5E A;  3PVW A;  1DYN A;  2GCJ A;  2KUP A;  3ZVR A;  1EVH A;  3U7D A;  2QKM A;  4A6H A;  2L1C A;  3FM8 C;  5C5B A;  4F7H A;  5JHG A;  2ROZ B;  4GMX B;  4YL8 A;  4DBB A;  2Z13 A;  4HAT B;  2NBV A;  2LKO A;  2D10 A;  3P6A A;  4HDQ A;  2DYQ A;  4L1R A;  5J3T A;  3IVF A;  2BCJ A;  5IRS A;  2J0K A;  4IAP A;  1WGQ A;  4HAW B;  1BTN A;  2ELB A;  4QXA B;  2YS3 A;  2COF A;  2W2W A;  2P8V A;  3ODW A;  1XKE A;  4L6E A;  2I1K A;  3G9W A;  4K2P A;  2D2Q A;  3U12 A;  2DX1 A;  2OTX A;  2KIG A;  3M1I B;  4ZRI A;  2K00 A;  5C5B B;  5D3X A;  2UVM A;  5CLQ B;  3LJU X;  1W1G A;  3BJI A;  3QIJ A;  4HB3 B;  1M7E A;  4H8S A;  4CYE A;  2UZR A;  4QJ3 B;  4WVF B;  2YT1 A;  1N3H A;  4GXB A;  1IRS A;  1ZM0 A;  5JLJ B;  2CRF A;  2NMB A;  1GC6 A;  3AU4 A;  2D9V A;  4CHM A;  1NI2 A;  2DTC A;  2R2Y A;  3QWM A;  1K5G B;  2J59 M;  4DX9 0;  1Y5O A;  2FJU B;  4KHA A;  3PZD A;  2AEH A;  3PEG A;  2ZPY A;  4F7G A;  1XCG A;  2COD A;  4GNK B;  3MPX A;  3AJ4 A;  3SO6 A;  2YF0 A;  3HIE A;  2W2X D;  4Z2M B;  2RVB B;  3ODX A;  1FAO A;  5LG4 B;  3A8P A;  1XX0 A;  2RGN B;  1FHX A;  4HAV B;  1KZ7 A;  2MDX A;  4B6H A;  1OQN A;  5LON B;  1WGU A;  1MPH A;  3WA0 A;  1BAK A;  4EMO A;  1ZYI A;  1EF1 A;  5LOP B;  4KVG B;  1X11 A;  1AWE A;  3V5W A;  2KGX B;  1EGX A;  3A8Q A;  5HE3 A;  3BIN A;  3HK0 A;  2DN6 A;  2YRY A;  3D8F A;  2I5F A;  3FEH A;  4TYZ A;  4DXA B;  3TO1 A;  2PZ1 A;  1XOD A;  3GYO A;  1SGH A;  1MK9 B;  4GZU A;  2RNR B;  1J0W A;  2N23 A;  1UPR A;  2DKQ A;  4D6W A;  1GG3 A;  1DDW A;  5KQ4 A;  1H10 A;  5D27 A;  5C16 A;  2LOZ A;  4EJN A;  1UNR A;  2GJY A;  5JP4 A;  3SUZ A;  4HB2 B;  4EKU A;  1EAZ A;  3WYF B;  1V5P A;  4KHB B;  2Z4D A;  2DHK A;  2EJ8 A;  4IOY X;  4WJ7 A;  4PNK A;  5DHA B;  2CY5 A;  2XQN M;  5HE0 A;  1ZC4 B;  4A6F B;  2IYB A;  2D4Q A;  2COA A;  4HHV A;  2Y7B A;  2HE7 A;  4MT7 A;  3TVV A;  1BTK A;  1OMW A;  1UNP A;  2Z0O A;  1UNQ A;  1ZVR A;  4BBK A;  1GC7 A;  1QQG A;  4Y94 A;  2H7E A;  1DDM A;  2DA0 A;  4GPT B;  3A98 B;  3D8E A;  1X1F A;  1K5D B;  2P0F A;  1U5F A;  3NWA A;  2M38 A;  2LOX A;  1XR0 B;  3P7Z A;  1WJM A;  2K2J A;  1V5M A;  2KIE A;  5D3W A;  4QJ4 B;  3PVL A;  2R09 A;  1Z87 A;  2YVC A;  2N0Y A;  1PFJ A;  4HSI A;  1ISN A;  2UZS A; 
#chains in the Genus database with same CATH homology
 5C79 A;  2GCL A;  2YS1 A;  1FOE A;  2D9Y A;  3ML4 A;  4YON A;  2CAY A;  4WSF A;  5HE1 A;  2COC A;  2KCJ A;  3DXC A;  4D0N B;  1FGY A;  2CY4 A;  4HAX B;  2J0J A;  4P7I A;  2GS0 A;  3KRW A;  2ELA A;  1M7R A;  3KSY A;  3PSC A;  1MAI A;  2EMT A;  1NTV A;  3MDB C;  1U2B A;  3OAN A;  1RRP B;  1I7A A;  1UPQ A;  2MKR A;  1WG7 A;  2H7D A;  3N7C A;  3GYP A;  1Y19 B;  1LB1 A;  2G35 A;  3CIK A;  4F7U P;  2DLW A;  3ULB A;  1AQC A;  2LG1 A;  1J19 A;  3DXE A;  2DHJ A;  3HW2 B;  1PMS A;  4KAX B;  3TFM A;  2V76 A;  3RCP A;  3PVU A;  5KQ1 A;  5DI9 B;  1BWN A;  1MIX A;  2Y8F A;  5D3Y A;  2Z0P A;  1U5G A;  5DH9 B;  2VRW B;  4ZRJ A;  2RSG A;  4IFS A;  5EFX A;  4HDO A;  2D9W A;  3PP2 A;  4HAY B;  1KZG A;  5C6R A;  2LUL A;  1FHW A;  2DHI A;  4DX8 A;  3T06 A;  2IFS A;  2ROV A;  4K2O A;  3HQC A;  1KI1 B;  3NSU A;  4ZRK A;  2DYN A;  2AL6 A;  1P5T A;  2D9Z A;  4A5K A;  3O96 A;  3QBV B;  3FSS A;  3KRX A;  3ODO A;  3PG7 A;  1OY2 A;  4CHJ A;  2W2X C;  3F0W A;  2Y8G A;  3CXB B;  4PQ0 A;  2E2X A;  2NZ8 B;  1WVH A;  2J0M A;  1I2H A;  1NU2 A;  1FB8 A;  4A6K A;  4NSW A;  2D11 A;  1MKE A;  2K2U A;  2DKP A;  2MFQ A;  4MY6 A;  2ADZ A;  3F5R A;  1X05 A;  1ZC3 B;  1PLS A;  3KY9 A;  1DRO A;  1QC6 A;  1W1H A;  1U27 A;  4A6F A;  2Q13 A;  1DDV A;  1U5D A;  5D3V A;  2DFK A;  1P6S A;  1WI1 A;  4Z2N A;  5L81 A;  3ULC A;  5CLL B;  3U8Z A;  3SNH A;  3VIA A;  2VSZ A;  1V88 A;  1Q67 A;  1MIZ B;  2JP2 A;  4NY0 A;  2HTH B;  1NTY A;  3SV1 A;  1X86 A;  4K17 A;  2QKL A;  4GN1 A;  1WJ1 A;  1TQZ A;  3SYX A;  5DHF B;  1FGZ A;  2DX5 A;  2YT0 A;  3TW1 A;  3DXD A;  2OQB A;  1H4R A;  5FI1 A;  4KHO A;  1V5U A;  4HAU B;  1E5W A;  2EC1 A;  1DBH A;  5HE2 A;  2R0D A;  1W1D A;  4TKN A;  4HB0 B;  2MWN B;  3ZDT A;  1MK7 B;  1FHO A;  2EMS A;  2FJL A;  4MK0 A;  2I5C A;  4XWX A;  5KCV A;  2YSZ A;  4HB4 B;  1TJ6 A;  1B55 A;  2P0D A;  2LYD A;  2Z0Q A;  4K81 A;  1ZSQ A;  1V89 A;  2VKI A;  5FI0 A;  1RJ2 A;  5J3Y A;  3AU5 A;  3X23 A;  1P3R A;  4GMV A;  1X1G A;  1LW3 A;  5GOW B;  2I1J A;  1V61 A;  3KZ1 A;  2YS5 A;  1TXD A;  5JHH A;  4HAZ B;  1SHC A;  2X18 A;  5DIF B;  2P0H A;  3UZT A;  3VOQ A;  2L2I A;  1XD4 A;  5J3Q A;  1UEF A;  1U29 A;  2D9X A;  2RUK B;  2M14 A;  3TCA A;  2RLO A;  3D8D A;  4C0A A;  1U5E A;  3PVW A;  1DYN A;  2GCJ A;  2KUP A;  3ZVR A;  1EVH A;  3U7D A;  2QKM A;  4A6H A;  2L1C A;  3FM8 C;  5C5B A;  4F7H A;  5JHG A;  2ROZ B;  4GMX B;  4YL8 A;  4DBB A;  4HAT B;  2LKO A;  2D10 A;  3P6A A;  4HDQ A;  2DYQ A;  5J3T A;  3IVF A;  2BCJ A;  2J0K A;  4IAP A;  1WGQ A;  4HAW B;  1BTN A;  2ELB A;  2YS3 A;  2COF A;  2W2W A;  2P8V A;  3ODW A;  1XKE A;  4L6E A;  2I1K A;  3G9W A;  4K2P A;  2D2Q A;  2DX1 A;  2OTX A;  3M1I B;  4ZRI A;  2K00 A;  5C5B B;  5D3X A;  2UVM A;  5CLQ B;  3LJU X;  1W1G A;  3BJI A;  3QIJ A;  4HB3 B;  1M7E A;  4H8S A;  4CYE A;  2UZR A;  4WVF B;  2YT1 A;  1N3H A;  4GXB A;  1IRS A;  1ZM0 A;  5JLJ B;  2CRF A;  2NMB A;  1GC6 A;  3AU4 A;  2D9V A;  4CHM A;  1NI2 A;  2DTC A;  3QWM A;  1K5G B;  2J59 M;  4DX9 0;  1Y5O A;  4KHA A;  3PZD A;  2AEH A;  3PEG A;  2ZPY A;  4F7G A;  1XCG A;  2COD A;  3MPX A;  3AJ4 A;  3SO6 A;  2YF0 A;  2W2X D;  4Z2M B;  2RVB B;  3ODX A;  1FAO A;  3A8P A;  1XX0 A;  2RGN B;  1FHX A;  4HAV B;  1KZ7 A;  2MDX A;  4B6H A;  1OQN A;  5LON B;  1WGU A;  1MPH A;  3WA0 A;  1BAK A;  4EMO A;  1EF1 A;  5LOP B;  4KVG B;  1X11 A;  1AWE A;  3V5W A;  2KGX B;  1EGX A;  3A8Q A;  5HE3 A;  3BIN A;  3HK0 A;  2DN6 A;  2YRY A;  3D8F A;  2I5F A;  3FEH A;  4TYZ A;  4DXA B;  3TO1 A;  2PZ1 A;  1XOD A;  3GYO A;  1SGH A;  1MK9 B;  4GZU A;  2RNR B;  1J0W A;  2N23 A;  1UPR A;  2DKQ A;  1GG3 A;  1DDW A;  5KQ4 A;  1H10 A;  5D27 A;  5C16 A;  2LOZ A;  4EJN A;  1UNR A;  2GJY A;  5JP4 A;  3SUZ A;  4HB2 B;  4EKU A;  1EAZ A;  3WYF B;  1V5P A;  4KHB B;  2DHK A;  2EJ8 A;  4IOY X;  4WJ7 A;  4PNK A;  5DHA B;  2CY5 A;  2XQN M;  5HE0 A;  1ZC4 B;  4A6F B;  2IYB A;  2D4Q A;  2COA A;  4HHV A;  2Y7B A;  2HE7 A;  4MT7 A;  3TVV A;  1BTK A;  1OMW A;  1UNP A;  2Z0O A;  1UNQ A;  1ZVR A;  4BBK A;  1GC7 A;  1QQG A;  4Y94 A;  2H7E A;  1DDM A;  2DA0 A;  4GPT B;  3A98 B;  3D8E A;  1X1F A;  1K5D B;  2P0F A;  1U5F A;  2M38 A;  2LOX A;  1XR0 B;  3P7Z A;  1WJM A;  2K2J A;  1V5M A;  5D3W A;  3PVL A;  2R09 A;  1Z87 A;  2YVC A;  2N0Y A;  1PFJ A;  1ISN A;  2UZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...