4DBBA

The ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
150
Chain Sequence
EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRAINPEDLSQKEYSDLLNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Amyloid beta A4 precursor protein-binding family A member 1
publication title Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 36
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dbbA00
2DKPA 1FGZA 2ROZB 5J3YA 1AQCA 5DIFB 3F5RA 4P7IA 4B6HA 3U8ZA 1FHOA 2DA0A 1U2BA 1EF1A 2DHKA 2DYQA 2KUPA 2ZPYA 1U5GA 4L6EA 2E2XA 2Z0OA 4K2PA 1E5WA 1M7RA 1W1DA 3PZDA 4GMXB 5GOWB 1N3HA 4K2OA 4HAVB 3M1IB 4HB2B 1GC6A 3HK0A 5J3QA 4EMOA 2J0MA 3HW2B 4Y94A 2R0DA 1MPHA 4NSWA 4CHJA 5CLQB 4Z2NA 1WGQA 2UVMA 1EVHA 5HE2A 2YRYA 4TKNA 1MKEA 1UNPA 3ZVRA 4MY6A 1X86A 1DDMA 4HB3B 5EFXA 1BTKA 2D10A 1OQNA 2UZSA 2Y8GA 4KAXB 2K2JA 4A6KA 1U5EA 2YS3A 2IFSA 5KQ1A 1UPRA 3TCAA 4ZRIA 2YF0A 1I2HA 1DROA 4YL8A 3TO1A 3WYFB 1ZC3B 1XCGA 4MK0A 4K17A 2D9ZA 5D3WA 4PQ0A 2P8VA 2D4QA 2LOXA 2I1KA 2N0YA 3PVWA 1ZSQA 3SNHA 2MKRA 4H8SA 5JLJB 5DHFB 2LYDA 4XWXA 4IAPA 3TVVA 1BAKA 3KZ1A 1MAIA 3GYPA 2DHJA 4C0AA 5LONB 4HDQA 3D8FA 4KVGB 3SV1A 2L2IA 5JHGA 1K5GB 4A6HA 1UEFA 2X18A 1DBHA 3G9WA 4GN1A 2D9WA 4BBKA 1RRPB 3KSYA 1UPQA 1W1GA 2I1JA 4KHAA 1WJMA 1DDWA 4CYEA 3TFMA 1X11A 2P0HA 1FOEA 3D8DA 5JP4A 1ZVRA 3U7DA 3KRXA 2NZ8B 2MDXA 3QIJA 2FJLA 1FHXA 2P0DA 2MWNB 2RLOA 3F0WA 1U27A 1ISNA 1U5FA 2DN6A 1J0WA 2GCJA 2BCJA 3VOQA 1WG7A 3ZDTA 3ML4A 3A98B 2W2XC 5JHHA 2JP2A 4A6FA 2CRFA 1WVHA 2RGNB 2V76A 4YONA 1RJ2A 2XQNM 3AU5A 1DYNA 3BJIA 2L1CA 1TJ6A 3P7ZA 2GS0A 3ODWA 3PVLA 4HAYB 5KCVA 2HTHB 5C5BA 2ELAA 5D3YA 3P6AA 1TXDA 1P3RA 2G35A 1NTYA 4A6FB 2ELBA 4HB4B 5CLLB 4HDOA 1X05A 1XX0A 1P6SA 4GXBA 4ZRJA 1KZ7A 2LG1A 3ULCA 2DHIA 2MFQA 1V61A 4WVFB 1QQGA 1WJ1A 1XR0B 2RUKB 5FI1A 5FI0A 1MK9B 3ULBA 5C5BB 1XKEA 2ADZA 2D11A 1FGYA 1ZM0A 2VKIA 2J0JA 5HE0A 4DX8A 2YSZA 2I5CA 1NU2A 1NI2A 1H10A 2GCLA 2NMBA 2Z0PA 1QC6A 3LJUX 3QBVB 2RVBB 2QKMA 2COFA 2M14A 1U5DA 3A8PA 2EJ8A 1Y5OA 1UNQA 2Y8FA 2IYBA 1P5TA 4ZRKA 1XD4A 3MDBC 3IVFA 2RSGA 4WSFA 3KRWA 3FEHA 3OANA 2OQBA 4DBBA 3CXBB 1WI1A 2GJYA 1KI1B 3O96A 1DDVA 2K00A 5LOPB 1MK7B 2DFKA 1Y19B 4D0NB 1V5PA 3PSCA 3RCPA 4GZUA 3PP2A 4MT7A 3DXEA 1EAZA 1J19A 2HE7A 2CAYA 3SO6A 2I5FA 2J59M 5D3XA 2VSZA 5DH9B 1M7EA 1PMSA 4TYZA 2EC1A 1PFJA 2CY4A 2EMTA 5HE1A 2W2WA 2Q13A 1W1HA 1TQZA 2Y7BA 5L81A 3AU4A 1EGXA 1I7AA 2UZRA 2P0FA 4HB0B 1BWNA 2LULA 3SYXA 1Q67A 3A8QA 1BTNA 3ODOA 3TW1A 1OY2A 2DX1A 2LKOA 3DXCA 5C79A 1K5DB 2VRWB 1H4RA 3ODXA 1U29A 1OMWA 1SGHA 2Z0QA 1GC7A 1X1FA 2D9XA 3FSSA 1X1GA 1GG3A 4IOYX 2DLWA 3MPXA 2K2UA 2AL6A 1KZGA 2J0KA 2H7DA 2ROVA 5DI9B 2DYNA 4K81A 2RNRB 3PG7A 5C16A 1ZC4B 3N7CA 1SHCA 3WA0A 2N23A 2EMSA 3D8EA 1LW3A 2DX5A 2YT1A 5D3VA 4A5KA 2QKLA 5C6RA 2CODA 2LOZA 3PEGA 5HE3A 4HATB 1UNRA 1V89A 1FB8A 1NTVA 3FM8C 1MIXA 1AWEA 4HAWB 3DXDA 4PNKA 1B55A 5DHAB 2CY5A 4HHVA 2YT0A 1XODA 5D27A 2KCJA 3AJ4A 4GMVA 4EJNA 3UZTA 2COAA 1V5MA 3T06A 1IRSA 1PLSA 3HQCA 4IFSA 2YS5A 4DXAB 2D9VA 2D9YA 3PVUA 4HAZB 4CHMA 3BINA 2PZ1A 4KHBB 3CIKA 2AEHA 2M38A 1V88A 3QWMA 3GYOA 4HAUB 4DX90 2DKQA 2KGXB 4WJ7A 2D2QA 1V5UA 1FAOA 3NSUA 2COCA 4GPTB 2H7EA 5KQ4A 2W2XD 4KHOA 2YS1A 3VIAA 4F7HA 2R09A 1LB1A 4F7GA 3KY9A 4Z2MB 4F7UP 1MIZB 3SUZA 3X23A 4HAXB 1WGUA 3V5WA 4EKUA 2YVCA 2DTCA 2OTXA 4NY0A 5J3TA 1Z87A 1FHWA
chains in the Genus database with same CATH superfamily
2DKPA 1FGZA 2ROZB 3A58A 5J3YA 1AQCA 5DIFB 3F5RA 4P7IA 4B6HA 3U8ZA 1FHOA 2DA0A 1U2BA 1EF1A 2DHKA 2DYQA 2KUPA 2ZPYA 1U5GA 4L6EA 2E2XA 2Z0OA 4CSQA 4K2PA 1E5WA 1M7RA 1W1DA 3PZDA 4GMXB 5GOWB 1N3HA 4K2OA 4HAVB 3M1IB 4HB2B 1GC6A 3HK0A 5J3QA 4EMOA 2J0MA 2Z13A 3HW2B 4Y94A 2R0DA 1MPHA 4NSWA 4CHJA 5CLQB 4Z2NA 1WGQA 2UVMA 1EVHA 5HE2A 2YRYA 4TKNA 1MKEA 1UNPA 3ZVRA 4MY6A 1X86A 1DDMA 4HB3B 4HSIA 5EFXA 1BTKA 2D10A 1OQNA 2UZSA 2Y8GA 4KAXB 2K2JA 4A6KA 1U5EA 2YS3A 2IFSA 5KQ1A 1UPRA 3TCAA 4ZRIA 2YF0A 1I2HA 1DROA 4YL8A 3HSAA 3NW8A 3TO1A 3WYFB 1ZC3B 1XCGA 4MK0A 4K17A 2D9ZA 5D3WA 3NWDA 4PQ0A 2P8VA 2D4QA 2LOXA 2I1KA 2N0YA 3PVWA 1ZSQA 3SNHA 5I2MA 2MKRA 4H8SA 5JLJB 5DHFB 2LYDA 4XWXA 4IAPA 3TVVA 1BAKA 3KZ1A 1MAIA 3GYPA 2DHJA 4C0AA 5LONB 4HDQA 3D8FA 4KVGB 3SV1A 2L2IA 5JHGA 1K5GB 4A6HA 1UEFA 2X18A 1DBHA 3G9WA 4GN1A 4QXAB 2D9WA 4BBKA 1RRPB 3KSYA 1UPQA 1W1GA 2I1JA 4KHAA 1WJMA 1DDWA 2KUQA 4CYEA 3TFMA 1X11A 2P0HA 2KIEA 1FOEA 3D8DA 5JP4A 1ZVRA 3U7DA 3KRXA 2NZ8B 2MDXA 2R2YA 3QIJA 2FJLA 1FHXA 2P0DA 3NWFA 2MWNB 1MI1A 2RLOA 3F0WA 1U27A 1ISNA 1U5FA 2DN6A 1J0WA 2GCJA 2K49A 2BCJA 3VOQA 1WG7A 3ZDTA 3ML4A 3A98B 2W2XC 5JHHA 2JP2A 4A6FA 2CRFA 1WVHA 2RGNB 2V76A 4YONA 2K8EA 4OT1A 1RJ2A 2XQNM 3AU5A 1DYNA 3BJIA 2L1CA 1TJ6A 3P7ZA 2GS0A 3HIEA 3ODWA 2Z59A 3PVLA 4HAYB 5KCVA 2HTHB 5C5BA 2ELAA 5D3YA 3P6AA 5LG4B 1TXDA 1P3RA 2G35A 1NTYA 4A6FB 2ELBA 4HB4B 2YT2A 2RRFA 4HDOA 1X05A 5CLLB 1XX0A 1P6SA 4GXBA 4ZRJA 1KZ7A 2LG1A 2NBVA 3ULCA 2DHIA 2MFQA 1V61A 4WVFB 1QQGA 1WJ1A 1XR0B 2RUKB 5FI1A 5FI0A 1MK9B 3ULBA 5C5BB 1XKEA 2ADZA 2D11A 1FGYA 1ZM0A 2VKIA 2J0JA 5HE0A 4DX8A 2YSZA 2I5CA 1NU2A 1NI2A 1H10A 2GCLA 2NMBA 2Z0PA 1QC6A 3LJUX 3QBVB 2RVBB 4KHBA 2QKMA 2COFA 2M14A 1U5DA 3A8PA 2EJ8A 1Y5OA 1UNQA 1T77A 2Y8FA 2IYBA 1P5TA 4ZRKA 1XD4A 3MDBC 3IVFA 2RSGA 4WSFA 3KRWA 3FEHA 3OANA 2OQBA 4DBBA 4D6WA 3CXBB 1WI1A 2GJYA 1KI1B 3O96A 1DDVA 2K00A 3DCXA 5LOPB 1MK7B 2DFKA 1Y19B 4D0NB 1V5PA 3PSCA 3RCPA 4GZUA 3PP2A 4MT7A 3DXEA 4GOUA 1EAZA 1J19A 2HE7A 2CAYA 3SO6A 2I5FA 2J59M 5D3XA 2VSZA 5DH9B 4QJ4B 1M7EA 2GUMA 1PMSA 4TYZA 2EC1A 1PFJA 2CY4A 2EMTA 5HE1A 2W2WA 2Q13A 1W1HA 5IRSA 1TQZA 2FJUB 2Y7BA 5L81A 3AU4A 1EGXA 3B77A 1I7AA 2UZRA 2P0FA 4HB0B 1BWNA 2LULA 3SYXA 1Q67A 3A8QA 1BTNA 3ODOA 3TW1A 1OY2A 2DX1A 2LKOA 2ZKMX 3DXCA 5C79A 1K5DB 3FVCA 2VRWB 1H4RA 3ODXA 1U29A 1OMWA 1SGHA 4QJ5B 2Z0QA 1GC7A 1X1FA 2D9XA 1ZYIA 3FSSA 1X1GA 4DIXA 1GG3A 4IOYX 2DLWA 3MPXA 2K2UA 2AL6A 1KZGA 2J0KA 2Z4DA 2H7DA 2ROVA 5DI9B 2DYNA 4K81A 2RNRB 3PG7A 5C16A 1ZC4B 3N7CA 1SHCA 3WA0A 2N23A 2EMSA 3D8EA 1LW3A 2DX5A 2YT1A 5D3VA 3NWAA 4A5KA 2QKLA 5C6RA 2CODA 2LOZA 3PEGA 5HE3A 4HATB 1UNRA 4OSNA 1V89A 1FB8A 1NTVA 3FM8C 1MIXA 1AWEA 4HAWB 3DXDA 4PNKA 1B55A 5DHAB 2CY5A 4HHVA 2Z14A 2YT0A 2KR0A 1XODA 5D27A 2KCJA 3AJ4A 4GMVA 4EJNA 3UZTA 2COAA 1V5MA 3T06A 1IRSA 2KIGA 1PLSA 3HQCA 4IFSA 2YS5A 4DXAB 2D9VA 2D9YA 3PVUA 4HAZB 4CHMA 3BINA 3U12A 2PZ1A 4KHBB 3CIKA 4L1RA 2AEHA 2M38A 1V88A 3QWMA 3GYOA 4HAUB 4DX90 2DKQA 2KGXB 5M4YB 4WJ7A 2D2QA 1V5UA 1FAOA 3NSUA 2COCA 4GPTB 2H7EA 5KQ4A 2W2XD 4KHOA 4QJ3B 2YS1A 3VIAA 4F7HA 2R09A 1LB1A 4F7GA 3KY9A 4Z2MB 4F7UP 1MIZB 3SUZA 3X23A 4HAXB 1WGUA 5I2SA 3V5WA 3OHMB 4EKUA 2YVCA 2DTCA 2OTXA 4NY0A 5J3TA 1Z87A 4GNKB 1FHWA
chains in the Genus database with same CATH topology
2DKPA 1FGZA 2ROZB 5J3YA 1AQCA 5DIFB 3F5RA 4P7IA 4B6HA 3U8ZA 1FHOA 2DA0A 1U2BA 1EF1A 2DHKA 2DYQA 2KUPA 2ZPYA 1U5GA 4L6EA 2E2XA 2Z0OA 4K2PA 1E5WA 1M7RA 1W1DA 3PZDA 4GMXB 5GOWB 1N3HA 4K2OA 4HAVB 3M1IB 4HB2B 1GC6A 3HK0A 5J3QA 4EMOA 2J0MA 3HW2B 4Y94A 2R0DA 1MPHA 4NSWA 4CHJA 5CLQB 4Z2NA 1WGQA 2UVMA 1EVHA 5HE2A 2YRYA 4TKNA 1MKEA 1UNPA 3ZVRA 4MY6A 1X86A 1DDMA 4HB3B 5EFXA 1BTKA 2D10A 1OQNA 2UZSA 2Y8GA 4KAXB 2K2JA 4A6KA 1U5EA 2YS3A 2IFSA 5KQ1A 1UPRA 3TCAA 4ZRIA 2YF0A 1I2HA 1DROA 4YL8A 3TO1A 3WYFB 1ZC3B 1XCGA 4MK0A 4K17A 2D9ZA 5D3WA 4PQ0A 2P8VA 2D4QA 2LOXA 2I1KA 2N0YA 3PVWA 1ZSQA 3SNHA 2MKRA 4H8SA 5JLJB 5DHFB 2LYDA 4XWXA 4IAPA 3TVVA 1BAKA 3KZ1A 1MAIA 3GYPA 2DHJA 4C0AA 5LONB 4HDQA 3D8FA 4KVGB 3SV1A 2L2IA 5JHGA 1K5GB 4A6HA 1UEFA 2X18A 1DBHA 3G9WA 4GN1A 2D9WA 4BBKA 1RRPB 3KSYA 1UPQA 1W1GA 2I1JA 4KHAA 1WJMA 1DDWA 4CYEA 3TFMA 1X11A 2P0HA 1FOEA 3D8DA 5JP4A 1ZVRA 3U7DA 3KRXA 2NZ8B 2MDXA 3QIJA 2FJLA 1FHXA 2P0DA 2MWNB 2RLOA 3F0WA 1U27A 1ISNA 1U5FA 2DN6A 1J0WA 2GCJA 2BCJA 3VOQA 1WG7A 3ZDTA 3ML4A 3A98B 2W2XC 5JHHA 2JP2A 4A6FA 2CRFA 1WVHA 2RGNB 2V76A 4YONA 1RJ2A 2XQNM 3AU5A 1DYNA 3BJIA 2L1CA 1TJ6A 3P7ZA 2GS0A 3ODWA 3PVLA 4HAYB 5KCVA 2HTHB 5C5BA 2ELAA 5D3YA 3P6AA 1TXDA 1P3RA 2G35A 1NTYA 4A6FB 2ELBA 4HB4B 5CLLB 4HDOA 1X05A 1XX0A 1P6SA 4GXBA 4ZRJA 1KZ7A 2LG1A 3ULCA 2DHIA 2MFQA 1V61A 4WVFB 1QQGA 1WJ1A 1XR0B 2RUKB 5FI1A 5FI0A 1MK9B 3ULBA 5C5BB 1XKEA 2ADZA 2D11A 1FGYA 1ZM0A 2VKIA 2J0JA 5HE0A 4DX8A 2YSZA 2I5CA 1NU2A 1NI2A 1H10A 2GCLA 2NMBA 2Z0PA 1QC6A 3LJUX 3QBVB 2RVBB 2QKMA 2COFA 2M14A 1U5DA 3A8PA 2EJ8A 1Y5OA 1UNQA 2Y8FA 2IYBA 1P5TA 4ZRKA 1XD4A 3MDBC 3IVFA 2RSGA 4WSFA 3KRWA 3FEHA 3OANA 2OQBA 4DBBA 3CXBB 1WI1A 2GJYA 1KI1B 3O96A 1DDVA 2K00A 5LOPB 1MK7B 2DFKA 1Y19B 4D0NB 1V5PA 3PSCA 3RCPA 4GZUA 3PP2A 4MT7A 3DXEA 1EAZA 1J19A 2HE7A 2CAYA 3SO6A 2I5FA 2J59M 5D3XA 2VSZA 5DH9B 1M7EA 1PMSA 4TYZA 2EC1A 1PFJA 2CY4A 2EMTA 5HE1A 2W2WA 2Q13A 1W1HA 1TQZA 2Y7BA 5L81A 3AU4A 1EGXA 1I7AA 2UZRA 2P0FA 4HB0B 1BWNA 2LULA 3SYXA 1Q67A 3A8QA 1BTNA 3ODOA 3TW1A 1OY2A 2DX1A 2LKOA 3DXCA 5C79A 1K5DB 2VRWB 1H4RA 3ODXA 1U29A 1OMWA 1SGHA 2Z0QA 1GC7A 1X1FA 2D9XA 3FSSA 1X1GA 1GG3A 4IOYX 2DLWA 3MPXA 2K2UA 2AL6A 1KZGA 2J0KA 2H7DA 2ROVA 5DI9B 2DYNA 4K81A 2RNRB 3PG7A 5C16A 1ZC4B 3N7CA 1SHCA 3WA0A 2N23A 2EMSA 3D8EA 1LW3A 2DX5A 2YT1A 5D3VA 4A5KA 2QKLA 5C6RA 2CODA 2LOZA 3PEGA 5HE3A 4HATB 1UNRA 1V89A 1FB8A 1NTVA 3FM8C 1MIXA 1AWEA 4HAWB 3DXDA 4PNKA 1B55A 5DHAB 2CY5A 4HHVA 2YT0A 1XODA 5D27A 2KCJA 3AJ4A 4GMVA 4EJNA 3UZTA 2COAA 1V5MA 3T06A 1IRSA 1PLSA 3HQCA 4IFSA 2YS5A 4DXAB 2D9VA 2D9YA 3PVUA 4HAZB 4CHMA 3BINA 2PZ1A 4KHBB 3CIKA 2AEHA 2M38A 1V88A 3QWMA 3GYOA 4HAUB 4DX90 2DKQA 2KGXB 4WJ7A 2D2QA 1V5UA 1FAOA 3NSUA 2COCA 4GPTB 2H7EA 5KQ4A 2W2XD 4KHOA 2YS1A 3VIAA 4F7HA 2R09A 1LB1A 4F7GA 3KY9A 4Z2MB 4F7UP 1MIZB 3SUZA 3X23A 4HAXB 1WGUA 3V5WA 4EKUA 2YVCA 2DTCA 2OTXA 4NY0A 5J3TA 1Z87A 1FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKP A;  1FGZ A;  2ROZ B;  5J3Y A;  1AQC A;  5DIF B;  3F5R A;  4P7I A;  4B6H A;  3U8Z A;  1FHO A;  2DA0 A;  1U2B A;  1EF1 A;  2DHK A;  2DYQ A;  2KUP A;  2ZPY A;  1U5G A;  4L6E A;  2E2X A;  2Z0O A;  4K2P A;  1E5W A;  1M7R A;  1W1D A;  3PZD A;  4GMX B;  5GOW B;  1N3H A;  4K2O A;  4HAV B;  3M1I B;  4HB2 B;  1GC6 A;  3HK0 A;  5J3Q A;  4EMO A;  2J0M A;  3HW2 B;  4Y94 A;  2R0D A;  1MPH A;  4NSW A;  4CHJ A;  5CLQ B;  4Z2N A;  1WGQ A;  2UVM A;  1EVH A;  5HE2 A;  2YRY A;  4TKN A;  1MKE A;  1UNP A;  3ZVR A;  4MY6 A;  1X86 A;  1DDM A;  4HB3 B;  5EFX A;  1BTK A;  2D10 A;  1OQN A;  2UZS A;  2Y8G A;  4KAX B;  2K2J A;  4A6K A;  1U5E A;  2YS3 A;  2IFS A;  5KQ1 A;  1UPR A;  3TCA A;  4ZRI A;  2YF0 A;  1I2H A;  1DRO A;  4YL8 A;  3TO1 A;  3WYF B;  1ZC3 B;  1XCG A;  4MK0 A;  4K17 A;  2D9Z A;  5D3W A;  4PQ0 A;  2P8V A;  2D4Q A;  2LOX A;  2I1K A;  2N0Y A;  3PVW A;  1ZSQ A;  3SNH A;  2MKR A;  4H8S A;  5JLJ B;  5DHF B;  2LYD A;  4XWX A;  4IAP A;  3TVV A;  1BAK A;  3KZ1 A;  1MAI A;  3GYP A;  2DHJ A;  4C0A A;  5LON B;  4HDQ A;  3D8F A;  4KVG B;  3SV1 A;  2L2I A;  5JHG A;  1K5G B;  4A6H A;  1UEF A;  2X18 A;  1DBH A;  3G9W A;  4GN1 A;  2D9W A;  4BBK A;  1RRP B;  3KSY A;  1UPQ A;  1W1G A;  2I1J A;  4KHA A;  1WJM A;  1DDW A;  4CYE A;  3TFM A;  1X11 A;  2P0H A;  1FOE A;  3D8D A;  5JP4 A;  1ZVR A;  3U7D A;  3KRX A;  2NZ8 B;  2MDX A;  3QIJ A;  2FJL A;  1FHX A;  2P0D A;  2MWN B;  2RLO A;  3F0W A;  1U27 A;  1ISN A;  1U5F A;  2DN6 A;  1J0W A;  2GCJ A;  2BCJ A;  3VOQ A;  1WG7 A;  3ZDT A;  3ML4 A;  3A98 B;  2W2X C;  5JHH A;  2JP2 A;  4A6F A;  2CRF A;  1WVH A;  2RGN B;  2V76 A;  4YON A;  1RJ2 A;  2XQN M;  3AU5 A;  1DYN A;  3BJI A;  2L1C A;  1TJ6 A;  3P7Z A;  2GS0 A;  3ODW A;  3PVL A;  4HAY B;  5KCV A;  2HTH B;  5C5B A;  2ELA A;  5D3Y A;  3P6A A;  1TXD A;  1P3R A;  2G35 A;  1NTY A;  4A6F B;  2ELB A;  4HB4 B;  5CLL B;  4HDO A;  1X05 A;  1XX0 A;  1P6S A;  4GXB A;  4ZRJ A;  1KZ7 A;  2LG1 A;  3ULC A;  2DHI A;  2MFQ A;  1V61 A;  4WVF B;  1QQG A;  1WJ1 A;  1XR0 B;  2RUK B;  5FI1 A;  5FI0 A;  1MK9 B;  3ULB A;  5C5B B;  1XKE A;  2ADZ A;  2D11 A;  1FGY A;  1ZM0 A;  2VKI A;  2J0J A;  5HE0 A;  4DX8 A;  2YSZ A;  2I5C A;  1NU2 A;  1NI2 A;  1H10 A;  2GCL A;  2NMB A;  2Z0P A;  1QC6 A;  3LJU X;  3QBV B;  2RVB B;  2QKM A;  2COF A;  2M14 A;  1U5D A;  3A8P A;  2EJ8 A;  1Y5O A;  1UNQ A;  2Y8F A;  2IYB A;  1P5T A;  4ZRK A;  1XD4 A;  3MDB C;  3IVF A;  2RSG A;  4WSF A;  3KRW A;  3FEH A;  3OAN A;  2OQB A;  4DBB A;  3CXB B;  1WI1 A;  2GJY A;  1KI1 B;  3O96 A;  1DDV A;  2K00 A;  5LOP B;  1MK7 B;  2DFK A;  1Y19 B;  4D0N B;  1V5P A;  3PSC A;  3RCP A;  4GZU A;  3PP2 A;  4MT7 A;  3DXE A;  1EAZ A;  1J19 A;  2HE7 A;  2CAY A;  3SO6 A;  2I5F A;  2J59 M;  5D3X A;  2VSZ A;  5DH9 B;  1M7E A;  1PMS A;  4TYZ A;  2EC1 A;  1PFJ A;  2CY4 A;  2EMT A;  5HE1 A;  2W2W A;  2Q13 A;  1W1H A;  1TQZ A;  2Y7B A;  5L81 A;  3AU4 A;  1EGX A;  1I7A A;  2UZR A;  2P0F A;  4HB0 B;  1BWN A;  2LUL A;  3SYX A;  1Q67 A;  3A8Q A;  1BTN A;  3ODO A;  3TW1 A;  1OY2 A;  2DX1 A;  2LKO A;  3DXC A;  5C79 A;  1K5D B;  2VRW B;  1H4R A;  3ODX A;  1U29 A;  1OMW A;  1SGH A;  2Z0Q A;  1GC7 A;  1X1F A;  2D9X A;  3FSS A;  1X1G A;  1GG3 A;  4IOY X;  2DLW A;  3MPX A;  2K2U A;  2AL6 A;  1KZG A;  2J0K A;  2H7D A;  2ROV A;  5DI9 B;  2DYN A;  4K81 A;  2RNR B;  3PG7 A;  5C16 A;  1ZC4 B;  3N7C A;  1SHC A;  3WA0 A;  2N23 A;  2EMS A;  3D8E A;  1LW3 A;  2DX5 A;  2YT1 A;  5D3V A;  4A5K A;  2QKL A;  5C6R A;  2COD A;  2LOZ A;  3PEG A;  5HE3 A;  4HAT B;  1UNR A;  1V89 A;  1FB8 A;  1NTV A;  3FM8 C;  1MIX A;  1AWE A;  4HAW B;  3DXD A;  4PNK A;  1B55 A;  5DHA B;  2CY5 A;  4HHV A;  2YT0 A;  1XOD A;  5D27 A;  2KCJ A;  3AJ4 A;  4GMV A;  4EJN A;  3UZT A;  2COA A;  1V5M A;  3T06 A;  1IRS A;  1PLS A;  3HQC A;  4IFS A;  2YS5 A;  4DXA B;  2D9V A;  2D9Y A;  3PVU A;  4HAZ B;  4CHM A;  3BIN A;  2PZ1 A;  4KHB B;  3CIK A;  2AEH A;  2M38 A;  1V88 A;  3QWM A;  3GYO A;  4HAU B;  4DX9 0;  2DKQ A;  2KGX B;  4WJ7 A;  2D2Q A;  1V5U A;  1FAO A;  3NSU A;  2COC A;  4GPT B;  2H7E A;  5KQ4 A;  2W2X D;  4KHO A;  2YS1 A;  3VIA A;  4F7H A;  2R09 A;  1LB1 A;  4F7G A;  3KY9 A;  4Z2M B;  4F7U P;  1MIZ B;  3SUZ A;  3X23 A;  4HAX B;  1WGU A;  3V5W A;  4EKU A;  2YVC A;  2DTC A;  2OTX A;  4NY0 A;  5J3T A;  1Z87 A;  1FHW A; 
#chains in the Genus database with same CATH topology
 2DKP A;  1FGZ A;  2ROZ B;  3A58 A;  5J3Y A;  1AQC A;  5DIF B;  3F5R A;  4P7I A;  4B6H A;  3U8Z A;  1FHO A;  2DA0 A;  1U2B A;  1EF1 A;  2DHK A;  2DYQ A;  2KUP A;  2ZPY A;  1U5G A;  4L6E A;  2E2X A;  2Z0O A;  4CSQ A;  4K2P A;  1E5W A;  1M7R A;  1W1D A;  3PZD A;  4GMX B;  5GOW B;  1N3H A;  4K2O A;  4HAV B;  3M1I B;  4HB2 B;  1GC6 A;  3HK0 A;  5J3Q A;  4EMO A;  2J0M A;  2Z13 A;  3HW2 B;  4Y94 A;  2R0D A;  1MPH A;  4NSW A;  4CHJ A;  5CLQ B;  4Z2N A;  1WGQ A;  2UVM A;  1EVH A;  5HE2 A;  2YRY A;  4TKN A;  1MKE A;  1UNP A;  3ZVR A;  4MY6 A;  1X86 A;  1DDM A;  4HB3 B;  4HSI A;  5EFX A;  1BTK A;  2D10 A;  1OQN A;  2UZS A;  2Y8G A;  4KAX B;  2K2J A;  4A6K A;  1U5E A;  2YS3 A;  2IFS A;  5KQ1 A;  1UPR A;  3TCA A;  4ZRI A;  2YF0 A;  1I2H A;  1DRO A;  4YL8 A;  3HSA A;  3NW8 A;  3TO1 A;  3WYF B;  1ZC3 B;  1XCG A;  4MK0 A;  4K17 A;  2D9Z A;  5D3W A;  3NWD A;  4PQ0 A;  2P8V A;  2D4Q A;  2LOX A;  2I1K A;  2N0Y A;  3PVW A;  1ZSQ A;  3SNH A;  5I2M A;  2MKR A;  4H8S A;  5JLJ B;  5DHF B;  2LYD A;  4XWX A;  4IAP A;  3TVV A;  1BAK A;  3KZ1 A;  1MAI A;  3GYP A;  2DHJ A;  4C0A A;  5LON B;  4HDQ A;  3D8F A;  4KVG B;  3SV1 A;  2L2I A;  5JHG A;  1K5G B;  4A6H A;  1UEF A;  2X18 A;  1DBH A;  3G9W A;  4GN1 A;  4QXA B;  2D9W A;  4BBK A;  1RRP B;  3KSY A;  1UPQ A;  1W1G A;  2I1J A;  4KHA A;  1WJM A;  1DDW A;  2KUQ A;  4CYE A;  3TFM A;  1X11 A;  2P0H A;  2KIE A;  1FOE A;  3D8D A;  5JP4 A;  1ZVR A;  3U7D A;  3KRX A;  2NZ8 B;  2MDX A;  2R2Y A;  3QIJ A;  2FJL A;  1FHX A;  2P0D A;  3NWF A;  2MWN B;  1MI1 A;  2RLO A;  3F0W A;  1U27 A;  1ISN A;  1U5F A;  2DN6 A;  1J0W A;  2GCJ A;  2K49 A;  2BCJ A;  3VOQ A;  1WG7 A;  3ZDT A;  3ML4 A;  3A98 B;  2W2X C;  5JHH A;  2JP2 A;  4A6F A;  2CRF A;  1WVH A;  2RGN B;  2V76 A;  4YON A;  2K8E A;  4OT1 A;  1RJ2 A;  2XQN M;  3AU5 A;  1DYN A;  3BJI A;  2L1C A;  1TJ6 A;  3P7Z A;  2GS0 A;  3HIE A;  3ODW A;  2Z59 A;  3PVL A;  4HAY B;  5KCV A;  2HTH B;  5C5B A;  2ELA A;  5D3Y A;  3P6A A;  5LG4 B;  1TXD A;  1P3R A;  2G35 A;  1NTY A;  4A6F B;  2ELB A;  4HB4 B;  2YT2 A;  2RRF A;  4HDO A;  1X05 A;  5CLL B;  1XX0 A;  1P6S A;  4GXB A;  4ZRJ A;  1KZ7 A;  2LG1 A;  2NBV A;  3ULC A;  2DHI A;  2MFQ A;  1V61 A;  4WVF B;  1QQG A;  1WJ1 A;  1XR0 B;  2RUK B;  5FI1 A;  5FI0 A;  1MK9 B;  3ULB A;  5C5B B;  1XKE A;  2ADZ A;  2D11 A;  1FGY A;  1ZM0 A;  2VKI A;  2J0J A;  5HE0 A;  4DX8 A;  2YSZ A;  2I5C A;  1NU2 A;  1NI2 A;  1H10 A;  2GCL A;  2NMB A;  2Z0P A;  1QC6 A;  3LJU X;  3QBV B;  2RVB B;  4KHB A;  2QKM A;  2COF A;  2M14 A;  1U5D A;  3A8P A;  2EJ8 A;  1Y5O A;  1UNQ A;  1T77 A;  2Y8F A;  2IYB A;  1P5T A;  4ZRK A;  1XD4 A;  3MDB C;  3IVF A;  2RSG A;  4WSF A;  3KRW A;  3FEH A;  3OAN A;  2OQB A;  4DBB A;  4D6W A;  3CXB B;  1WI1 A;  2GJY A;  1KI1 B;  3O96 A;  1DDV A;  2K00 A;  3DCX A;  5LOP B;  1MK7 B;  2DFK A;  1Y19 B;  4D0N B;  1V5P A;  3PSC A;  3RCP A;  4GZU A;  3PP2 A;  4MT7 A;  3DXE A;  4GOU A;  1EAZ A;  1J19 A;  2HE7 A;  2CAY A;  3SO6 A;  2I5F A;  2J59 M;  5D3X A;  2VSZ A;  5DH9 B;  4QJ4 B;  1M7E A;  2GUM A;  1PMS A;  4TYZ A;  2EC1 A;  1PFJ A;  2CY4 A;  2EMT A;  5HE1 A;  2W2W A;  2Q13 A;  1W1H A;  5IRS A;  1TQZ A;  2FJU B;  2Y7B A;  5L81 A;  3AU4 A;  1EGX A;  3B77 A;  1I7A A;  2UZR A;  2P0F A;  4HB0 B;  1BWN A;  2LUL A;  3SYX A;  1Q67 A;  3A8Q A;  1BTN A;  3ODO A;  3TW1 A;  1OY2 A;  2DX1 A;  2LKO A;  2ZKM X;  3DXC A;  5C79 A;  1K5D B;  3FVC A;  2VRW B;  1H4R A;  3ODX A;  1U29 A;  1OMW A;  1SGH A;  4QJ5 B;  2Z0Q A;  1GC7 A;  1X1F A;  2D9X A;  1ZYI A;  3FSS A;  1X1G A;  4DIX A;  1GG3 A;  4IOY X;  2DLW A;  3MPX A;  2K2U A;  2AL6 A;  1KZG A;  2J0K A;  2Z4D A;  2H7D A;  2ROV A;  5DI9 B;  2DYN A;  4K81 A;  2RNR B;  3PG7 A;  5C16 A;  1ZC4 B;  3N7C A;  1SHC A;  3WA0 A;  2N23 A;  2EMS A;  3D8E A;  1LW3 A;  2DX5 A;  2YT1 A;  5D3V A;  3NWA A;  4A5K A;  2QKL A;  5C6R A;  2COD A;  2LOZ A;  3PEG A;  5HE3 A;  4HAT B;  1UNR A;  4OSN A;  1V89 A;  1FB8 A;  1NTV A;  3FM8 C;  1MIX A;  1AWE A;  4HAW B;  3DXD A;  4PNK A;  1B55 A;  5DHA B;  2CY5 A;  4HHV A;  2Z14 A;  2YT0 A;  2KR0 A;  1XOD A;  5D27 A;  2KCJ A;  3AJ4 A;  4GMV A;  4EJN A;  3UZT A;  2COA A;  1V5M A;  3T06 A;  1IRS A;  2KIG A;  1PLS A;  3HQC A;  4IFS A;  2YS5 A;  4DXA B;  2D9V A;  2D9Y A;  3PVU A;  4HAZ B;  4CHM A;  3BIN A;  3U12 A;  2PZ1 A;  4KHB B;  3CIK A;  4L1R A;  2AEH A;  2M38 A;  1V88 A;  3QWM A;  3GYO A;  4HAU B;  4DX9 0;  2DKQ A;  2KGX B;  5M4Y B;  4WJ7 A;  2D2Q A;  1V5U A;  1FAO A;  3NSU A;  2COC A;  4GPT B;  2H7E A;  5KQ4 A;  2W2X D;  4KHO A;  4QJ3 B;  2YS1 A;  3VIA A;  4F7H A;  2R09 A;  1LB1 A;  4F7G A;  3KY9 A;  4Z2M B;  4F7U P;  1MIZ B;  3SUZ A;  3X23 A;  4HAX B;  1WGU A;  5I2S A;  3V5W A;  3OHM B;  4EKU A;  2YVC A;  2DTC A;  2OTX A;  4NY0 A;  5J3T A;  1Z87 A;  4GNK B;  1FHW A; 
#chains in the Genus database with same CATH homology
 2DKP A;  1FGZ A;  2ROZ B;  5J3Y A;  1AQC A;  5DIF B;  3F5R A;  4P7I A;  4B6H A;  3U8Z A;  1FHO A;  2DA0 A;  1U2B A;  1EF1 A;  2DHK A;  2DYQ A;  2KUP A;  2ZPY A;  1U5G A;  4L6E A;  2E2X A;  2Z0O A;  4K2P A;  1E5W A;  1M7R A;  1W1D A;  3PZD A;  4GMX B;  5GOW B;  1N3H A;  4K2O A;  4HAV B;  3M1I B;  4HB2 B;  1GC6 A;  3HK0 A;  5J3Q A;  4EMO A;  2J0M A;  3HW2 B;  4Y94 A;  2R0D A;  1MPH A;  4NSW A;  4CHJ A;  5CLQ B;  4Z2N A;  1WGQ A;  2UVM A;  1EVH A;  5HE2 A;  2YRY A;  4TKN A;  1MKE A;  1UNP A;  3ZVR A;  4MY6 A;  1X86 A;  1DDM A;  4HB3 B;  5EFX A;  1BTK A;  2D10 A;  1OQN A;  2UZS A;  2Y8G A;  4KAX B;  2K2J A;  4A6K A;  1U5E A;  2YS3 A;  2IFS A;  5KQ1 A;  1UPR A;  3TCA A;  4ZRI A;  2YF0 A;  1I2H A;  1DRO A;  4YL8 A;  3TO1 A;  3WYF B;  1ZC3 B;  1XCG A;  4MK0 A;  4K17 A;  2D9Z A;  5D3W A;  4PQ0 A;  2P8V A;  2D4Q A;  2LOX A;  2I1K A;  2N0Y A;  3PVW A;  1ZSQ A;  3SNH A;  2MKR A;  4H8S A;  5JLJ B;  5DHF B;  2LYD A;  4XWX A;  4IAP A;  3TVV A;  1BAK A;  3KZ1 A;  1MAI A;  3GYP A;  2DHJ A;  4C0A A;  5LON B;  4HDQ A;  3D8F A;  4KVG B;  3SV1 A;  2L2I A;  5JHG A;  1K5G B;  4A6H A;  1UEF A;  2X18 A;  1DBH A;  3G9W A;  4GN1 A;  2D9W A;  4BBK A;  1RRP B;  3KSY A;  1UPQ A;  1W1G A;  2I1J A;  4KHA A;  1WJM A;  1DDW A;  4CYE A;  3TFM A;  1X11 A;  2P0H A;  1FOE A;  3D8D A;  5JP4 A;  1ZVR A;  3U7D A;  3KRX A;  2NZ8 B;  2MDX A;  3QIJ A;  2FJL A;  1FHX A;  2P0D A;  2MWN B;  2RLO A;  3F0W A;  1U27 A;  1ISN A;  1U5F A;  2DN6 A;  1J0W A;  2GCJ A;  2BCJ A;  3VOQ A;  1WG7 A;  3ZDT A;  3ML4 A;  3A98 B;  2W2X C;  5JHH A;  2JP2 A;  4A6F A;  2CRF A;  1WVH A;  2RGN B;  2V76 A;  4YON A;  1RJ2 A;  2XQN M;  3AU5 A;  1DYN A;  3BJI A;  2L1C A;  1TJ6 A;  3P7Z A;  2GS0 A;  3ODW A;  3PVL A;  4HAY B;  5KCV A;  2HTH B;  5C5B A;  2ELA A;  5D3Y A;  3P6A A;  1TXD A;  1P3R A;  2G35 A;  1NTY A;  4A6F B;  2ELB A;  4HB4 B;  5CLL B;  4HDO A;  1X05 A;  1XX0 A;  1P6S A;  4GXB A;  4ZRJ A;  1KZ7 A;  2LG1 A;  3ULC A;  2DHI A;  2MFQ A;  1V61 A;  4WVF B;  1QQG A;  1WJ1 A;  1XR0 B;  2RUK B;  5FI1 A;  5FI0 A;  1MK9 B;  3ULB A;  5C5B B;  1XKE A;  2ADZ A;  2D11 A;  1FGY A;  1ZM0 A;  2VKI A;  2J0J A;  5HE0 A;  4DX8 A;  2YSZ A;  2I5C A;  1NU2 A;  1NI2 A;  1H10 A;  2GCL A;  2NMB A;  2Z0P A;  1QC6 A;  3LJU X;  3QBV B;  2RVB B;  2QKM A;  2COF A;  2M14 A;  1U5D A;  3A8P A;  2EJ8 A;  1Y5O A;  1UNQ A;  2Y8F A;  2IYB A;  1P5T A;  4ZRK A;  1XD4 A;  3MDB C;  3IVF A;  2RSG A;  4WSF A;  3KRW A;  3FEH A;  3OAN A;  2OQB A;  4DBB A;  3CXB B;  1WI1 A;  2GJY A;  1KI1 B;  3O96 A;  1DDV A;  2K00 A;  5LOP B;  1MK7 B;  2DFK A;  1Y19 B;  4D0N B;  1V5P A;  3PSC A;  3RCP A;  4GZU A;  3PP2 A;  4MT7 A;  3DXE A;  1EAZ A;  1J19 A;  2HE7 A;  2CAY A;  3SO6 A;  2I5F A;  2J59 M;  5D3X A;  2VSZ A;  5DH9 B;  1M7E A;  1PMS A;  4TYZ A;  2EC1 A;  1PFJ A;  2CY4 A;  2EMT A;  5HE1 A;  2W2W A;  2Q13 A;  1W1H A;  1TQZ A;  2Y7B A;  5L81 A;  3AU4 A;  1EGX A;  1I7A A;  2UZR A;  2P0F A;  4HB0 B;  1BWN A;  2LUL A;  3SYX A;  1Q67 A;  3A8Q A;  1BTN A;  3ODO A;  3TW1 A;  1OY2 A;  2DX1 A;  2LKO A;  3DXC A;  5C79 A;  1K5D B;  2VRW B;  1H4R A;  3ODX A;  1U29 A;  1OMW A;  1SGH A;  2Z0Q A;  1GC7 A;  1X1F A;  2D9X A;  3FSS A;  1X1G A;  1GG3 A;  4IOY X;  2DLW A;  3MPX A;  2K2U A;  2AL6 A;  1KZG A;  2J0K A;  2H7D A;  2ROV A;  5DI9 B;  2DYN A;  4K81 A;  2RNR B;  3PG7 A;  5C16 A;  1ZC4 B;  3N7C A;  1SHC A;  3WA0 A;  2N23 A;  2EMS A;  3D8E A;  1LW3 A;  2DX5 A;  2YT1 A;  5D3V A;  4A5K A;  2QKL A;  5C6R A;  2COD A;  2LOZ A;  3PEG A;  5HE3 A;  4HAT B;  1UNR A;  1V89 A;  1FB8 A;  1NTV A;  3FM8 C;  1MIX A;  1AWE A;  4HAW B;  3DXD A;  4PNK A;  1B55 A;  5DHA B;  2CY5 A;  4HHV A;  2YT0 A;  1XOD A;  5D27 A;  2KCJ A;  3AJ4 A;  4GMV A;  4EJN A;  3UZT A;  2COA A;  1V5M A;  3T06 A;  1IRS A;  1PLS A;  3HQC A;  4IFS A;  2YS5 A;  4DXA B;  2D9V A;  2D9Y A;  3PVU A;  4HAZ B;  4CHM A;  3BIN A;  2PZ1 A;  4KHB B;  3CIK A;  2AEH A;  2M38 A;  1V88 A;  3QWM A;  3GYO A;  4HAU B;  4DX9 0;  2DKQ A;  2KGX B;  4WJ7 A;  2D2Q A;  1V5U A;  1FAO A;  3NSU A;  2COC A;  4GPT B;  2H7E A;  5KQ4 A;  2W2X D;  4KHO A;  2YS1 A;  3VIA A;  4F7H A;  2R09 A;  1LB1 A;  4F7G A;  3KY9 A;  4Z2M B;  4F7U P;  1MIZ B;  3SUZ A;  3X23 A;  4HAX B;  1WGU A;  3V5W A;  4EKU A;  2YVC A;  2DTC A;  2OTX A;  4NY0 A;  5J3T A;  1Z87 A;  1FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...