4DBBA

The ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
150
Chain Sequence
b'EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRAINPEDLSQKEYSDLLNTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family A member 1
publication title Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 36
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dbbA00
3GYOA 4A6FA 2DKQA 2IYBA 3TFMA 3WYFB 1U5DA 1EAZA 4F7HA 2R09A 4KHBB 1KZGA 1DBHA 2JP2A 1FAOA 3N7CA 2HTHB 3G9WA 2P0DA 2DHKA 2CODA 5L81A 2MDXA 2W2WA 2UZRA 2YS1A 1FHWA 5J3TA 4L6EA 2LOXA 2J59M 3SO6A 2RSGA 1WG7A 2KGXB 5C16A 5FI0A 1BWNA 1ZVRA 4IFSA 4DX8A 2FJLA 1NI2A 3UZTA 5DIFB 4HATB 1PLSA 5DI9B 1MIZB 3IVFA 5LONB 4WVFB 3TVVA 2AEHA 4CHJA 2EMSA 4Z2NA 5LOPB 4F7UP 4KVGB 1K5GB 5HE3A 1Z87A 1H4RA 1B55A 1H10A 2UVMA 1X11A 2D9WA 2Y8FA 4ZRJA 4GPTB 2EMTA 2D10A 2BCJA 3HQCA 4NY0A 1OY2A 3ZDTA 2CY5A 2RLOA 2J0MA 3DXEA 5GOWB 1XD4A 2H7EA 1X1GA 4EJNA 2D2QA 1OQNA 3PVUA 4K81A 5C5BB 1RJ2A 3F5RA 1WJMA 3VIAA 2Y7BA 1UNRA 4KAXB 3TCAA 2GCLA 3BINA 2RNRB 4PQ0A 1P6SA 1E5WA 2AL6A 3BJIA 4H8SA 3ULBA 2OQBA 1V5MA 1ISNA 5KQ4A 4A6FB 5J3QA 3M1IB 5C5BA 2Z0OA 4HHVA 1J19A 1SGHA 1EF1A 4F7GA 2VKIA 2D11A 1MK7B 3O96A 3V5WA 3ZVRA 3VOQA 4GZUA 3D8DA 3HK0A 4D0NB 4IAPA 5JHHA 1FB8A 2ADZA 1RRPB 2NMBA 1NU2A 3SNHA 4PNKA 1V61A 1ZC3B 4MT7A 2I1JA 3A8QA 4GN1A 4KHAA 2RUKB 2DKPA 4A5KA 4ZRIA 3PZDA 3PP2A 4K2OA 1M7EA 2ROVA 5D3WA 4Z2MB 3FM8C 4BBKA 1BAKA 1K5DB 4HDQA 2DYNA 1Y5OA 4HB3B 4TYZA 1P3RA 3RCPA 2LG1A 1U29A 3DXCA 1W1HA 4GXBA 5JP4A 1X05A 1UEFA 4YL8A 4HB2B 1MKEA 3FEHA 1U2BA 4K17A 2QKMA 2K00A 1FGZA 4A6HA 4B6HA 4IOYX 1ZC4B 2E2XA 2PZ1A 3U8ZA 1AWEA 2KCJA 3AJ4A 3HW2B 5DH9B 1UPQA 2YT1A 2DYQA 1MAIA 1V89A 1DYNA 2GS0A 1KI1B 3ULCA 4DBBA 2P0HA 4HB4B 1XX0A 2DX1A 3X23A 1M7RA 1I2HA 2NZ8B 2COFA 2GJYA 2CRFA 2Y8GA 3ODWA 4Y94A 4HAXB 1QC6A 1W1GA 2MKRA 5FI1A 1U5FA 3PVLA 1UPRA 5HE2A 1J0WA 3KY9A 1ZSQA 2X18A 5DHAB 2D9XA 4K2PA 1BTKA 3SYXA 2UZSA 2DLWA 2IFSA 3PEGA 2GCJA 3CIKA 4WSFA 2KUPA 5D3VA 1FHXA 1KZ7A 1NTVA 2V76A 1TQZA 2EJ8A 3D8EA 5D3XA 3P6AA 5HE0A 5C6RA 4ZRKA 2DN6A 4GMXB 1DDWA 1UNQA 2K2JA 2Q13A 2MWNB 3QIJA 1PMSA 2RGNB 2EC1A 4KHOA 2R0DA 4HAVB 2COCA 4HDOA 2W2XD 2H7DA 3A8PA 2G35A 1IRSA 3KRWA 1V5PA 3OANA 3QWMA 2LULA 2DHJA 2D4QA 4HAZB 1BTNA 2QKLA 4A6KA 3QBVB 1X1FA 2M14A 2I5FA 3TO1A 1GG3A 5DHFB 4GMVA 2P0FA 3KSYA 2XQNM 1SHCA 1QQGA 3FSSA 2DX5A 2OTXA 4HB0B 3U7DA 3MDBC 3KRXA 2ROZB 1FOEA 2LOZA 1XR0B 1WJ1A 1V5UA 5CLLB 1GC6A 2N0YA 4CYEA 4MY6A 1OMWA 4DXAB 5JHGA 1I7AA 3CXBB 1MIXA 2ELBA 1WGQA 4C0AA 4EMOA 3SV1A 5C79A 1EGXA 2YS5A 2N23A 2VRWB 3PG7A 1U5GA 1DDMA 2DHIA 2DTCA 2RVBB 1NTYA 1V88A 2MFQA 3NSUA 1AQCA 2I1KA 1Y19B 4NSWA 3TW1A 2YT0A 3PVWA 2K2UA 4YONA 5EFXA 2YS3A 1WI1A 3F0WA 3ODXA 4TKNA 1GC7A 1EVHA 2M38A 3GYPA 4WJ7A 2L1CA 4XWXA 1P5TA 1DDVA 5HE1A 3WA0A 3PSCA 1XODA 2DFKA 2ZPYA 2D9VA 5D27A 1TJ6A 1WVHA 2J0KA 2YF0A 4CHMA 1TXDA 1U27A 5J3YA 2L2IA 3KZ1A 1U5EA 2HE7A 1LB1A 4HAWB 5KQ1A 2CAYA 5JLJB 4DX90 3DXDA 5D3YA 1XKEA 3AU4A 1Q67A 3ODOA 2Z0QA 1X86A 1PFJA 4MK0A 1N3HA 2I5CA 1MK9B 2YSZA 2COAA 2Z0PA 2YRYA 3P7ZA 2P8VA 2J0JA 1XCGA 2LKOA 2VSZA 3ML4A 2D9YA 3LJUX 3SUZA 4HAYB 1FGYA 2W2XC 4HAUB 2DA0A 2ELAA 2YVCA 3MPXA 2D9ZA 2LYDA 3D8FA 5CLQB 2CY4A 4EKUA 1UNPA 4P7IA 3T06A 5KCVA 1WGUA 3A98B 3AU5A 1LW3A 1ZM0A 1W1DA 1DROA 1MPHA 1FHOA
chains in the Genus database with same CATH superfamily
3GYOA 4A6FA 2DKQA 2IYBA 3TFMA 3WYFB 1U5DA 1EAZA 4F7HA 2R09A 4KHBB 1KZGA 1DBHA 2JP2A 1FAOA 3N7CA 2HTHB 3G9WA 2KIEA 2P0DA 2DHKA 2CODA 2Z4DA 5L81A 2MDXA 2KR0A 2W2WA 2UZRA 4KHBA 2YS1A 1FHWA 5J3TA 4HSIA 4L6EA 2LOXA 2J59M 3SO6A 2RSGA 1WG7A 3NWAA 2KGXB 5C16A 5FI0A 1BWNA 1ZVRA 4IFSA 3U12A 4DX8A 3NWFA 2FJLA 1NI2A 3UZTA 5DIFB 4HATB 1PLSA 5DI9B 1MIZB 3IVFA 5LONB 4WVFB 3TVVA 2Z59A 2AEHA 4CHJA 2EMSA 4Z2NA 5LOPB 4F7UP 4KVGB 1K5GB 2FJUB 5HE3A 1Z87A 1H4RA 1B55A 1H10A 2UVMA 1X11A 2D9WA 2Y8FA 4GNKB 4GPTB 4ZRJA 2EMTA 2D10A 2BCJA 3HQCA 4NY0A 1OY2A 3ZDTA 2CY5A 2RLOA 2J0MA 4L1RA 3HSAA 3DXEA 5GOWB 1XD4A 2H7EA 1X1GA 4EJNA 2D2QA 1OQNA 3PVUA 4K81A 5C5BB 1RJ2A 3F5RA 1WJMA 3VIAA 4QXAB 2Y7BA 1UNRA 4KAXB 3TCAA 2GCLA 3BINA 2RNRB 4PQ0A 1P6SA 1E5WA 2AL6A 3BJIA 4H8SA 4D6WA 3ULBA 2OQBA 1V5MA 1ISNA 5KQ4A 4A6FB 5J3QA 3M1IB 5C5BA 2Z0OA 4HHVA 1J19A 1SGHA 1EF1A 3B77A 4F7GA 2VKIA 2D11A 1MK7B 3O96A 3V5WA 3ZVRA 3VOQA 4GZUA 3D8DA 3HK0A 4D0NB 4IAPA 5JHHA 1FB8A 2ADZA 1RRPB 2NMBA 1NU2A 3SNHA 4PNKA 1V61A 1ZC3B 4MT7A 2I1JA 4OT1A 3A8QA 4GN1A 4KHAA 2RUKB 2DKPA 4A5KA 4ZRIA 3PZDA 3PP2A 4K2OA 1M7EA 2ROVA 5D3WA 3HIEA 4Z2MB 3FM8C 4BBKA 3NW8A 1BAKA 1K5DB 4HDQA 2DYNA 1Y5OA 4HB3B 4TYZA 1P3RA 3RCPA 2LG1A 1U29A 3DXCA 1W1HA 4GXBA 5JP4A 1X05A 1UEFA 4YL8A 5IRSA 4HB2B 1MKEA 3FEHA 1U2BA 4K17A 2QKMA 2K00A 1FGZA 4A6HA 4B6HA 4IOYX 1ZC4B 2E2XA 2PZ1A 3U8ZA 3A58A 2KCJA 3AJ4A 1AWEA 3HW2B 5DH9B 1UPQA 2YT1A 2DYQA 1MAIA 1V89A 1DYNA 2GS0A 1KI1B 2NBVA 3ULCA 4DBBA 3DCXA 2P0HA 4HB4B 1XX0A 2DX1A 3X23A 1M7RA 5M4YB 1I2HA 2NZ8B 2COFA 2GJYA 2CRFA 2Y8GA 3ODWA 4Y94A 4HAXB 1QC6A 1W1GA 2MKRA 5FI1A 1U5FA 3PVLA 1UPRA 2KIGA 5HE2A 1J0WA 1ZSQA 3KY9A 2X18A 5DHAB 2D9XA 2R2YA 1T77A 1BTKA 4K2PA 3SYXA 2UZSA 2DLWA 2IFSA 3PEGA 2RRFA 2GCJA 3CIKA 4WSFA 2KUPA 5D3VA 1FHXA 1KZ7A 1NTVA 2V76A 1TQZA 2EJ8A 3D8EA 5D3XA 3P6AA 5HE0A 5C6RA 4ZRKA 2DN6A 4GMXB 1DDWA 1UNQA 2K2JA 2Q13A 3FVCA 2MWNB 3QIJA 1PMSA 2RGNB 3NWDA 2EC1A 4KHOA 2R0DA 4HAVB 2COCA 4HDOA 2YT2A 2W2XD 2H7DA 4DIXA 3A8PA 2G35A 1IRSA 3KRWA 1V5PA 3OANA 3QWMA 4CSQA 2LULA 2DHJA 2D4QA 4HAZB 1BTNA 2QKLA 4A6KA 1ZYIA 3QBVB 1X1FA 2M14A 2I5FA 3TO1A 1GG3A 2K8EA 5DHFB 4GMVA 4OSNA 2P0FA 3KSYA 2XQNM 1SHCA 1QQGA 3FSSA 2DX5A 2OTXA 4HB0B 2Z14A 3U7DA 3MDBC 3KRXA 2ROZB 1FOEA 3OHMB 2LOZA 1XR0B 1WJ1A 1V5UA 5CLLB 1GC6A 2N0YA 4CYEA 4MY6A 1OMWA 4DXAB 5JHGA 1I7AA 3CXBB 1MIXA 2ELBA 1WGQA 4C0AA 4EMOA 3SV1A 5C79A 1EGXA 2YS5A 5LG4B 2N23A 2VRWB 1U5GA 3PG7A 1DDMA 2DHIA 2DTCA 2RVBB 1NTYA 1V88A 2MFQA 5I2SA 3NSUA 1AQCA 2I1KA 1Y19B 4NSWA 3TW1A 2YT0A 4QJ5B 3PVWA 2K2UA 4YONA 5EFXA 2YS3A 1WI1A 2GUMA 5I2MA 4QJ3B 3F0WA 3ODXA 4TKNA 1GC7A 1EVHA 2M38A 3GYPA 2Z13A 4WJ7A 2L1CA 4XWXA 1P5TA 1DDVA 5HE1A 3WA0A 3PSCA 1XODA 2DFKA 4GOUA 4QJ4B 2ZPYA 2D9VA 5D27A 1TJ6A 1WVHA 2J0KA 2YF0A 1MI1A 4CHMA 2K49A 1TXDA 1U27A 5J3YA 2L2IA 1U5EA 2HE7A 3KZ1A 1LB1A 4HAWB 5KQ1A 2CAYA 5JLJB 4DX90 3DXDA 5D3YA 1XKEA 3AU4A 1Q67A 3ODOA 2Z0QA 1X86A 1PFJA 4MK0A 1N3HA 2I5CA 1MK9B 2YSZA 2COAA 2Z0PA 2KUQA 2YRYA 3P7ZA 2P8VA 2J0JA 1XCGA 2LKOA 2VSZA 3ML4A 2D9YA 3LJUX 3SUZA 4HAYB 1FGYA 2W2XC 4HAUB 2DA0A 2ELAA 2YVCA 3MPXA 2D9ZA 2LYDA 3D8FA 5CLQB 2CY4A 4EKUA 2ZKMX 1UNPA 4P7IA 3T06A 5KCVA 1WGUA 3A98B 3AU5A 1LW3A 1ZM0A 1W1DA 1DROA 1MPHA 1FHOA
chains in the Genus database with same CATH topology
3GYOA 4A6FA 2DKQA 2IYBA 3TFMA 3WYFB 1U5DA 1EAZA 4F7HA 2R09A 4KHBB 1KZGA 1DBHA 2JP2A 1FAOA 3N7CA 2HTHB 3G9WA 2P0DA 2DHKA 2CODA 5L81A 2MDXA 2W2WA 2UZRA 2YS1A 1FHWA 5J3TA 4L6EA 2LOXA 2J59M 3SO6A 2RSGA 1WG7A 2KGXB 5C16A 5FI0A 1BWNA 1ZVRA 4IFSA 4DX8A 2FJLA 1NI2A 3UZTA 5DIFB 4HATB 1PLSA 5DI9B 1MIZB 3IVFA 5LONB 4WVFB 3TVVA 2AEHA 4CHJA 2EMSA 4Z2NA 5LOPB 4F7UP 4KVGB 1K5GB 5HE3A 1Z87A 1H4RA 1B55A 1H10A 2UVMA 1X11A 2D9WA 2Y8FA 4ZRJA 4GPTB 2EMTA 2D10A 2BCJA 3HQCA 4NY0A 1OY2A 3ZDTA 2CY5A 2RLOA 2J0MA 3DXEA 5GOWB 1XD4A 2H7EA 1X1GA 4EJNA 2D2QA 1OQNA 3PVUA 4K81A 5C5BB 1RJ2A 3F5RA 1WJMA 3VIAA 2Y7BA 1UNRA 4KAXB 3TCAA 2GCLA 3BINA 2RNRB 4PQ0A 1P6SA 1E5WA 2AL6A 3BJIA 4H8SA 3ULBA 2OQBA 1V5MA 1ISNA 5KQ4A 4A6FB 5J3QA 3M1IB 5C5BA 2Z0OA 4HHVA 1J19A 1SGHA 1EF1A 4F7GA 2VKIA 2D11A 1MK7B 3O96A 3V5WA 3ZVRA 3VOQA 4GZUA 3D8DA 3HK0A 4D0NB 4IAPA 5JHHA 1FB8A 2ADZA 1RRPB 2NMBA 1NU2A 3SNHA 4PNKA 1V61A 1ZC3B 4MT7A 2I1JA 3A8QA 4GN1A 4KHAA 2RUKB 2DKPA 4A5KA 4ZRIA 3PZDA 3PP2A 4K2OA 1M7EA 2ROVA 5D3WA 4Z2MB 3FM8C 4BBKA 1BAKA 1K5DB 4HDQA 2DYNA 1Y5OA 4HB3B 4TYZA 1P3RA 3RCPA 2LG1A 1U29A 3DXCA 1W1HA 4GXBA 5JP4A 1X05A 1UEFA 4YL8A 4HB2B 1MKEA 3FEHA 1U2BA 4K17A 2QKMA 2K00A 1FGZA 4A6HA 4B6HA 4IOYX 1ZC4B 2E2XA 2PZ1A 3U8ZA 1AWEA 2KCJA 3AJ4A 3HW2B 5DH9B 1UPQA 2YT1A 2DYQA 1MAIA 1V89A 1DYNA 2GS0A 1KI1B 3ULCA 4DBBA 2P0HA 4HB4B 1XX0A 2DX1A 3X23A 1M7RA 1I2HA 2NZ8B 2COFA 2GJYA 2CRFA 2Y8GA 3ODWA 4Y94A 4HAXB 1QC6A 1W1GA 2MKRA 5FI1A 1U5FA 3PVLA 1UPRA 5HE2A 1J0WA 3KY9A 1ZSQA 2X18A 5DHAB 2D9XA 4K2PA 1BTKA 3SYXA 2UZSA 2DLWA 2IFSA 3PEGA 2GCJA 3CIKA 4WSFA 2KUPA 5D3VA 1FHXA 1KZ7A 1NTVA 2V76A 1TQZA 2EJ8A 3D8EA 5D3XA 3P6AA 5HE0A 5C6RA 4ZRKA 2DN6A 4GMXB 1DDWA 1UNQA 2K2JA 2Q13A 2MWNB 3QIJA 1PMSA 2RGNB 2EC1A 4KHOA 2R0DA 4HAVB 2COCA 4HDOA 2W2XD 2H7DA 3A8PA 2G35A 1IRSA 3KRWA 1V5PA 3OANA 3QWMA 2LULA 2DHJA 2D4QA 4HAZB 1BTNA 2QKLA 4A6KA 3QBVB 1X1FA 2M14A 2I5FA 3TO1A 1GG3A 5DHFB 4GMVA 2P0FA 3KSYA 2XQNM 1SHCA 1QQGA 3FSSA 2DX5A 2OTXA 4HB0B 3U7DA 3MDBC 3KRXA 2ROZB 1FOEA 2LOZA 1XR0B 1WJ1A 1V5UA 5CLLB 1GC6A 2N0YA 4CYEA 4MY6A 1OMWA 4DXAB 5JHGA 1I7AA 3CXBB 1MIXA 2ELBA 1WGQA 4C0AA 4EMOA 3SV1A 5C79A 1EGXA 2YS5A 2N23A 2VRWB 3PG7A 1U5GA 1DDMA 2DHIA 2DTCA 2RVBB 1NTYA 1V88A 2MFQA 3NSUA 1AQCA 2I1KA 1Y19B 4NSWA 3TW1A 2YT0A 3PVWA 2K2UA 4YONA 5EFXA 2YS3A 1WI1A 3F0WA 3ODXA 4TKNA 1GC7A 1EVHA 2M38A 3GYPA 4WJ7A 2L1CA 4XWXA 1P5TA 1DDVA 5HE1A 3WA0A 3PSCA 1XODA 2DFKA 2ZPYA 2D9VA 5D27A 1TJ6A 1WVHA 2J0KA 2YF0A 4CHMA 1TXDA 1U27A 5J3YA 2L2IA 3KZ1A 1U5EA 2HE7A 1LB1A 4HAWB 5KQ1A 2CAYA 5JLJB 4DX90 3DXDA 5D3YA 1XKEA 3AU4A 1Q67A 3ODOA 2Z0QA 1X86A 1PFJA 4MK0A 1N3HA 2I5CA 1MK9B 2YSZA 2COAA 2Z0PA 2YRYA 3P7ZA 2P8VA 2J0JA 1XCGA 2LKOA 2VSZA 3ML4A 2D9YA 3LJUX 3SUZA 4HAYB 1FGYA 2W2XC 4HAUB 2DA0A 2ELAA 2YVCA 3MPXA 2D9ZA 2LYDA 3D8FA 5CLQB 2CY4A 4EKUA 1UNPA 4P7IA 3T06A 5KCVA 1WGUA 3A98B 3AU5A 1LW3A 1ZM0A 1W1DA 1DROA 1MPHA 1FHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYO A;  4A6F A;  2DKQ A;  2IYB A;  3TFM A;  3WYF B;  1U5D A;  1EAZ A;  4F7H A;  2R09 A;  4KHB B;  1KZG A;  1DBH A;  2JP2 A;  1FAO A;  3N7C A;  2HTH B;  3G9W A;  2P0D A;  2DHK A;  2COD A;  5L81 A;  2MDX A;  2W2W A;  2UZR A;  2YS1 A;  1FHW A;  5J3T A;  4L6E A;  2LOX A;  2J59 M;  3SO6 A;  2RSG A;  1WG7 A;  2KGX B;  5C16 A;  5FI0 A;  1BWN A;  1ZVR A;  4IFS A;  4DX8 A;  2FJL A;  1NI2 A;  3UZT A;  5DIF B;  4HAT B;  1PLS A;  5DI9 B;  1MIZ B;  3IVF A;  5LON B;  4WVF B;  3TVV A;  2AEH A;  4CHJ A;  2EMS A;  4Z2N A;  5LOP B;  4F7U P;  4KVG B;  1K5G B;  5HE3 A;  1Z87 A;  1H4R A;  1B55 A;  1H10 A;  2UVM A;  1X11 A;  2D9W A;  2Y8F A;  4ZRJ A;  4GPT B;  2EMT A;  2D10 A;  2BCJ A;  3HQC A;  4NY0 A;  1OY2 A;  3ZDT A;  2CY5 A;  2RLO A;  2J0M A;  3DXE A;  5GOW B;  1XD4 A;  2H7E A;  1X1G A;  4EJN A;  2D2Q A;  1OQN A;  3PVU A;  4K81 A;  5C5B B;  1RJ2 A;  3F5R A;  1WJM A;  3VIA A;  2Y7B A;  1UNR A;  4KAX B;  3TCA A;  2GCL A;  3BIN A;  2RNR B;  4PQ0 A;  1P6S A;  1E5W A;  2AL6 A;  3BJI A;  4H8S A;  3ULB A;  2OQB A;  1V5M A;  1ISN A;  5KQ4 A;  4A6F B;  5J3Q A;  3M1I B;  5C5B A;  2Z0O A;  4HHV A;  1J19 A;  1SGH A;  1EF1 A;  4F7G A;  2VKI A;  2D11 A;  1MK7 B;  3O96 A;  3V5W A;  3ZVR A;  3VOQ A;  4GZU A;  3D8D A;  3HK0 A;  4D0N B;  4IAP A;  5JHH A;  1FB8 A;  2ADZ A;  1RRP B;  2NMB A;  1NU2 A;  3SNH A;  4PNK A;  1V61 A;  1ZC3 B;  4MT7 A;  2I1J A;  3A8Q A;  4GN1 A;  4KHA A;  2RUK B;  2DKP A;  4A5K A;  4ZRI A;  3PZD A;  3PP2 A;  4K2O A;  1M7E A;  2ROV A;  5D3W A;  4Z2M B;  3FM8 C;  4BBK A;  1BAK A;  1K5D B;  4HDQ A;  2DYN A;  1Y5O A;  4HB3 B;  4TYZ A;  1P3R A;  3RCP A;  2LG1 A;  1U29 A;  3DXC A;  1W1H A;  4GXB A;  5JP4 A;  1X05 A;  1UEF A;  4YL8 A;  4HB2 B;  1MKE A;  3FEH A;  1U2B A;  4K17 A;  2QKM A;  2K00 A;  1FGZ A;  4A6H A;  4B6H A;  4IOY X;  1ZC4 B;  2E2X A;  2PZ1 A;  3U8Z A;  1AWE A;  2KCJ A;  3AJ4 A;  3HW2 B;  5DH9 B;  1UPQ A;  2YT1 A;  2DYQ A;  1MAI A;  1V89 A;  1DYN A;  2GS0 A;  1KI1 B;  3ULC A;  4DBB A;  2P0H A;  4HB4 B;  1XX0 A;  2DX1 A;  3X23 A;  1M7R A;  1I2H A;  2NZ8 B;  2COF A;  2GJY A;  2CRF A;  2Y8G A;  3ODW A;  4Y94 A;  4HAX B;  1QC6 A;  1W1G A;  2MKR A;  5FI1 A;  1U5F A;  3PVL A;  1UPR A;  5HE2 A;  1J0W A;  3KY9 A;  1ZSQ A;  2X18 A;  5DHA B;  2D9X A;  4K2P A;  1BTK A;  3SYX A;  2UZS A;  2DLW A;  2IFS A;  3PEG A;  2GCJ A;  3CIK A;  4WSF A;  2KUP A;  5D3V A;  1FHX A;  1KZ7 A;  1NTV A;  2V76 A;  1TQZ A;  2EJ8 A;  3D8E A;  5D3X A;  3P6A A;  5HE0 A;  5C6R A;  4ZRK A;  2DN6 A;  4GMX B;  1DDW A;  1UNQ A;  2K2J A;  2Q13 A;  2MWN B;  3QIJ A;  1PMS A;  2RGN B;  2EC1 A;  4KHO A;  2R0D A;  4HAV B;  2COC A;  4HDO A;  2W2X D;  2H7D A;  3A8P A;  2G35 A;  1IRS A;  3KRW A;  1V5P A;  3OAN A;  3QWM A;  2LUL A;  2DHJ A;  2D4Q A;  4HAZ B;  1BTN A;  2QKL A;  4A6K A;  3QBV B;  1X1F A;  2M14 A;  2I5F A;  3TO1 A;  1GG3 A;  5DHF B;  4GMV A;  2P0F A;  3KSY A;  2XQN M;  1SHC A;  1QQG A;  3FSS A;  2DX5 A;  2OTX A;  4HB0 B;  3U7D A;  3MDB C;  3KRX A;  2ROZ B;  1FOE A;  2LOZ A;  1XR0 B;  1WJ1 A;  1V5U A;  5CLL B;  1GC6 A;  2N0Y A;  4CYE A;  4MY6 A;  1OMW A;  4DXA B;  5JHG A;  1I7A A;  3CXB B;  1MIX A;  2ELB A;  1WGQ A;  4C0A A;  4EMO A;  3SV1 A;  5C79 A;  1EGX A;  2YS5 A;  2N23 A;  2VRW B;  3PG7 A;  1U5G A;  1DDM A;  2DHI A;  2DTC A;  2RVB B;  1NTY A;  1V88 A;  2MFQ A;  3NSU A;  1AQC A;  2I1K A;  1Y19 B;  4NSW A;  3TW1 A;  2YT0 A;  3PVW A;  2K2U A;  4YON A;  5EFX A;  2YS3 A;  1WI1 A;  3F0W A;  3ODX A;  4TKN A;  1GC7 A;  1EVH A;  2M38 A;  3GYP A;  4WJ7 A;  2L1C A;  4XWX A;  1P5T A;  1DDV A;  5HE1 A;  3WA0 A;  3PSC A;  1XOD A;  2DFK A;  2ZPY A;  2D9V A;  5D27 A;  1TJ6 A;  1WVH A;  2J0K A;  2YF0 A;  4CHM A;  1TXD A;  1U27 A;  5J3Y A;  2L2I A;  3KZ1 A;  1U5E A;  2HE7 A;  1LB1 A;  4HAW B;  5KQ1 A;  2CAY A;  5JLJ B;  4DX9 0;  3DXD A;  5D3Y A;  1XKE A;  3AU4 A;  1Q67 A;  3ODO A;  2Z0Q A;  1X86 A;  1PFJ A;  4MK0 A;  1N3H A;  2I5C A;  1MK9 B;  2YSZ A;  2COA A;  2Z0P A;  2YRY A;  3P7Z A;  2P8V A;  2J0J A;  1XCG A;  2LKO A;  2VSZ A;  3ML4 A;  2D9Y A;  3LJU X;  3SUZ A;  4HAY B;  1FGY A;  2W2X C;  4HAU B;  2DA0 A;  2ELA A;  2YVC A;  3MPX A;  2D9Z A;  2LYD A;  3D8F A;  5CLQ B;  2CY4 A;  4EKU A;  1UNP A;  4P7I A;  3T06 A;  5KCV A;  1WGU A;  3A98 B;  3AU5 A;  1LW3 A;  1ZM0 A;  1W1D A;  1DRO A;  1MPH A;  1FHO A; 
#chains in the Genus database with same CATH topology
 3GYO A;  4A6F A;  2DKQ A;  2IYB A;  3TFM A;  3WYF B;  1U5D A;  1EAZ A;  4F7H A;  2R09 A;  4KHB B;  1KZG A;  1DBH A;  2JP2 A;  1FAO A;  3N7C A;  2HTH B;  3G9W A;  2KIE A;  2P0D A;  2DHK A;  2COD A;  2Z4D A;  5L81 A;  2MDX A;  2KR0 A;  2W2W A;  2UZR A;  4KHB A;  2YS1 A;  1FHW A;  5J3T A;  4HSI A;  4L6E A;  2LOX A;  2J59 M;  3SO6 A;  2RSG A;  1WG7 A;  3NWA A;  2KGX B;  5C16 A;  5FI0 A;  1BWN A;  1ZVR A;  4IFS A;  3U12 A;  4DX8 A;  3NWF A;  2FJL A;  1NI2 A;  3UZT A;  5DIF B;  4HAT B;  1PLS A;  5DI9 B;  1MIZ B;  3IVF A;  5LON B;  4WVF B;  3TVV A;  2Z59 A;  2AEH A;  4CHJ A;  2EMS A;  4Z2N A;  5LOP B;  4F7U P;  4KVG B;  1K5G B;  2FJU B;  5HE3 A;  1Z87 A;  1H4R A;  1B55 A;  1H10 A;  2UVM A;  1X11 A;  2D9W A;  2Y8F A;  4GNK B;  4GPT B;  4ZRJ A;  2EMT A;  2D10 A;  2BCJ A;  3HQC A;  4NY0 A;  1OY2 A;  3ZDT A;  2CY5 A;  2RLO A;  2J0M A;  4L1R A;  3HSA A;  3DXE A;  5GOW B;  1XD4 A;  2H7E A;  1X1G A;  4EJN A;  2D2Q A;  1OQN A;  3PVU A;  4K81 A;  5C5B B;  1RJ2 A;  3F5R A;  1WJM A;  3VIA A;  4QXA B;  2Y7B A;  1UNR A;  4KAX B;  3TCA A;  2GCL A;  3BIN A;  2RNR B;  4PQ0 A;  1P6S A;  1E5W A;  2AL6 A;  3BJI A;  4H8S A;  4D6W A;  3ULB A;  2OQB A;  1V5M A;  1ISN A;  5KQ4 A;  4A6F B;  5J3Q A;  3M1I B;  5C5B A;  2Z0O A;  4HHV A;  1J19 A;  1SGH A;  1EF1 A;  3B77 A;  4F7G A;  2VKI A;  2D11 A;  1MK7 B;  3O96 A;  3V5W A;  3ZVR A;  3VOQ A;  4GZU A;  3D8D A;  3HK0 A;  4D0N B;  4IAP A;  5JHH A;  1FB8 A;  2ADZ A;  1RRP B;  2NMB A;  1NU2 A;  3SNH A;  4PNK A;  1V61 A;  1ZC3 B;  4MT7 A;  2I1J A;  4OT1 A;  3A8Q A;  4GN1 A;  4KHA A;  2RUK B;  2DKP A;  4A5K A;  4ZRI A;  3PZD A;  3PP2 A;  4K2O A;  1M7E A;  2ROV A;  5D3W A;  3HIE A;  4Z2M B;  3FM8 C;  4BBK A;  3NW8 A;  1BAK A;  1K5D B;  4HDQ A;  2DYN A;  1Y5O A;  4HB3 B;  4TYZ A;  1P3R A;  3RCP A;  2LG1 A;  1U29 A;  3DXC A;  1W1H A;  4GXB A;  5JP4 A;  1X05 A;  1UEF A;  4YL8 A;  5IRS A;  4HB2 B;  1MKE A;  3FEH A;  1U2B A;  4K17 A;  2QKM A;  2K00 A;  1FGZ A;  4A6H A;  4B6H A;  4IOY X;  1ZC4 B;  2E2X A;  2PZ1 A;  3U8Z A;  3A58 A;  2KCJ A;  3AJ4 A;  1AWE A;  3HW2 B;  5DH9 B;  1UPQ A;  2YT1 A;  2DYQ A;  1MAI A;  1V89 A;  1DYN A;  2GS0 A;  1KI1 B;  2NBV A;  3ULC A;  4DBB A;  3DCX A;  2P0H A;  4HB4 B;  1XX0 A;  2DX1 A;  3X23 A;  1M7R A;  5M4Y B;  1I2H A;  2NZ8 B;  2COF A;  2GJY A;  2CRF A;  2Y8G A;  3ODW A;  4Y94 A;  4HAX B;  1QC6 A;  1W1G A;  2MKR A;  5FI1 A;  1U5F A;  3PVL A;  1UPR A;  2KIG A;  5HE2 A;  1J0W A;  1ZSQ A;  3KY9 A;  2X18 A;  5DHA B;  2D9X A;  2R2Y A;  1T77 A;  1BTK A;  4K2P A;  3SYX A;  2UZS A;  2DLW A;  2IFS A;  3PEG A;  2RRF A;  2GCJ A;  3CIK A;  4WSF A;  2KUP A;  5D3V A;  1FHX A;  1KZ7 A;  1NTV A;  2V76 A;  1TQZ A;  2EJ8 A;  3D8E A;  5D3X A;  3P6A A;  5HE0 A;  5C6R A;  4ZRK A;  2DN6 A;  4GMX B;  1DDW A;  1UNQ A;  2K2J A;  2Q13 A;  3FVC A;  2MWN B;  3QIJ A;  1PMS A;  2RGN B;  3NWD A;  2EC1 A;  4KHO A;  2R0D A;  4HAV B;  2COC A;  4HDO A;  2YT2 A;  2W2X D;  2H7D A;  4DIX A;  3A8P A;  2G35 A;  1IRS A;  3KRW A;  1V5P A;  3OAN A;  3QWM A;  4CSQ A;  2LUL A;  2DHJ A;  2D4Q A;  4HAZ B;  1BTN A;  2QKL A;  4A6K A;  1ZYI A;  3QBV B;  1X1F A;  2M14 A;  2I5F A;  3TO1 A;  1GG3 A;  2K8E A;  5DHF B;  4GMV A;  4OSN A;  2P0F A;  3KSY A;  2XQN M;  1SHC A;  1QQG A;  3FSS A;  2DX5 A;  2OTX A;  4HB0 B;  2Z14 A;  3U7D A;  3MDB C;  3KRX A;  2ROZ B;  1FOE A;  3OHM B;  2LOZ A;  1XR0 B;  1WJ1 A;  1V5U A;  5CLL B;  1GC6 A;  2N0Y A;  4CYE A;  4MY6 A;  1OMW A;  4DXA B;  5JHG A;  1I7A A;  3CXB B;  1MIX A;  2ELB A;  1WGQ A;  4C0A A;  4EMO A;  3SV1 A;  5C79 A;  1EGX A;  2YS5 A;  5LG4 B;  2N23 A;  2VRW B;  1U5G A;  3PG7 A;  1DDM A;  2DHI A;  2DTC A;  2RVB B;  1NTY A;  1V88 A;  2MFQ A;  5I2S A;  3NSU A;  1AQC A;  2I1K A;  1Y19 B;  4NSW A;  3TW1 A;  2YT0 A;  4QJ5 B;  3PVW A;  2K2U A;  4YON A;  5EFX A;  2YS3 A;  1WI1 A;  2GUM A;  5I2M A;  4QJ3 B;  3F0W A;  3ODX A;  4TKN A;  1GC7 A;  1EVH A;  2M38 A;  3GYP A;  2Z13 A;  4WJ7 A;  2L1C A;  4XWX A;  1P5T A;  1DDV A;  5HE1 A;  3WA0 A;  3PSC A;  1XOD A;  2DFK A;  4GOU A;  4QJ4 B;  2ZPY A;  2D9V A;  5D27 A;  1TJ6 A;  1WVH A;  2J0K A;  2YF0 A;  1MI1 A;  4CHM A;  2K49 A;  1TXD A;  1U27 A;  5J3Y A;  2L2I A;  1U5E A;  2HE7 A;  3KZ1 A;  1LB1 A;  4HAW B;  5KQ1 A;  2CAY A;  5JLJ B;  4DX9 0;  3DXD A;  5D3Y A;  1XKE A;  3AU4 A;  1Q67 A;  3ODO A;  2Z0Q A;  1X86 A;  1PFJ A;  4MK0 A;  1N3H A;  2I5C A;  1MK9 B;  2YSZ A;  2COA A;  2Z0P A;  2KUQ A;  2YRY A;  3P7Z A;  2P8V A;  2J0J A;  1XCG A;  2LKO A;  2VSZ A;  3ML4 A;  2D9Y A;  3LJU X;  3SUZ A;  4HAY B;  1FGY A;  2W2X C;  4HAU B;  2DA0 A;  2ELA A;  2YVC A;  3MPX A;  2D9Z A;  2LYD A;  3D8F A;  5CLQ B;  2CY4 A;  4EKU A;  2ZKM X;  1UNP A;  4P7I A;  3T06 A;  5KCV A;  1WGU A;  3A98 B;  3AU5 A;  1LW3 A;  1ZM0 A;  1W1D A;  1DRO A;  1MPH A;  1FHO A; 
#chains in the Genus database with same CATH homology
 3GYO A;  4A6F A;  2DKQ A;  2IYB A;  3TFM A;  3WYF B;  1U5D A;  1EAZ A;  4F7H A;  2R09 A;  4KHB B;  1KZG A;  1DBH A;  2JP2 A;  1FAO A;  3N7C A;  2HTH B;  3G9W A;  2P0D A;  2DHK A;  2COD A;  5L81 A;  2MDX A;  2W2W A;  2UZR A;  2YS1 A;  1FHW A;  5J3T A;  4L6E A;  2LOX A;  2J59 M;  3SO6 A;  2RSG A;  1WG7 A;  2KGX B;  5C16 A;  5FI0 A;  1BWN A;  1ZVR A;  4IFS A;  4DX8 A;  2FJL A;  1NI2 A;  3UZT A;  5DIF B;  4HAT B;  1PLS A;  5DI9 B;  1MIZ B;  3IVF A;  5LON B;  4WVF B;  3TVV A;  2AEH A;  4CHJ A;  2EMS A;  4Z2N A;  5LOP B;  4F7U P;  4KVG B;  1K5G B;  5HE3 A;  1Z87 A;  1H4R A;  1B55 A;  1H10 A;  2UVM A;  1X11 A;  2D9W A;  2Y8F A;  4ZRJ A;  4GPT B;  2EMT A;  2D10 A;  2BCJ A;  3HQC A;  4NY0 A;  1OY2 A;  3ZDT A;  2CY5 A;  2RLO A;  2J0M A;  3DXE A;  5GOW B;  1XD4 A;  2H7E A;  1X1G A;  4EJN A;  2D2Q A;  1OQN A;  3PVU A;  4K81 A;  5C5B B;  1RJ2 A;  3F5R A;  1WJM A;  3VIA A;  2Y7B A;  1UNR A;  4KAX B;  3TCA A;  2GCL A;  3BIN A;  2RNR B;  4PQ0 A;  1P6S A;  1E5W A;  2AL6 A;  3BJI A;  4H8S A;  3ULB A;  2OQB A;  1V5M A;  1ISN A;  5KQ4 A;  4A6F B;  5J3Q A;  3M1I B;  5C5B A;  2Z0O A;  4HHV A;  1J19 A;  1SGH A;  1EF1 A;  4F7G A;  2VKI A;  2D11 A;  1MK7 B;  3O96 A;  3V5W A;  3ZVR A;  3VOQ A;  4GZU A;  3D8D A;  3HK0 A;  4D0N B;  4IAP A;  5JHH A;  1FB8 A;  2ADZ A;  1RRP B;  2NMB A;  1NU2 A;  3SNH A;  4PNK A;  1V61 A;  1ZC3 B;  4MT7 A;  2I1J A;  3A8Q A;  4GN1 A;  4KHA A;  2RUK B;  2DKP A;  4A5K A;  4ZRI A;  3PZD A;  3PP2 A;  4K2O A;  1M7E A;  2ROV A;  5D3W A;  4Z2M B;  3FM8 C;  4BBK A;  1BAK A;  1K5D B;  4HDQ A;  2DYN A;  1Y5O A;  4HB3 B;  4TYZ A;  1P3R A;  3RCP A;  2LG1 A;  1U29 A;  3DXC A;  1W1H A;  4GXB A;  5JP4 A;  1X05 A;  1UEF A;  4YL8 A;  4HB2 B;  1MKE A;  3FEH A;  1U2B A;  4K17 A;  2QKM A;  2K00 A;  1FGZ A;  4A6H A;  4B6H A;  4IOY X;  1ZC4 B;  2E2X A;  2PZ1 A;  3U8Z A;  1AWE A;  2KCJ A;  3AJ4 A;  3HW2 B;  5DH9 B;  1UPQ A;  2YT1 A;  2DYQ A;  1MAI A;  1V89 A;  1DYN A;  2GS0 A;  1KI1 B;  3ULC A;  4DBB A;  2P0H A;  4HB4 B;  1XX0 A;  2DX1 A;  3X23 A;  1M7R A;  1I2H A;  2NZ8 B;  2COF A;  2GJY A;  2CRF A;  2Y8G A;  3ODW A;  4Y94 A;  4HAX B;  1QC6 A;  1W1G A;  2MKR A;  5FI1 A;  1U5F A;  3PVL A;  1UPR A;  5HE2 A;  1J0W A;  3KY9 A;  1ZSQ A;  2X18 A;  5DHA B;  2D9X A;  4K2P A;  1BTK A;  3SYX A;  2UZS A;  2DLW A;  2IFS A;  3PEG A;  2GCJ A;  3CIK A;  4WSF A;  2KUP A;  5D3V A;  1FHX A;  1KZ7 A;  1NTV A;  2V76 A;  1TQZ A;  2EJ8 A;  3D8E A;  5D3X A;  3P6A A;  5HE0 A;  5C6R A;  4ZRK A;  2DN6 A;  4GMX B;  1DDW A;  1UNQ A;  2K2J A;  2Q13 A;  2MWN B;  3QIJ A;  1PMS A;  2RGN B;  2EC1 A;  4KHO A;  2R0D A;  4HAV B;  2COC A;  4HDO A;  2W2X D;  2H7D A;  3A8P A;  2G35 A;  1IRS A;  3KRW A;  1V5P A;  3OAN A;  3QWM A;  2LUL A;  2DHJ A;  2D4Q A;  4HAZ B;  1BTN A;  2QKL A;  4A6K A;  3QBV B;  1X1F A;  2M14 A;  2I5F A;  3TO1 A;  1GG3 A;  5DHF B;  4GMV A;  2P0F A;  3KSY A;  2XQN M;  1SHC A;  1QQG A;  3FSS A;  2DX5 A;  2OTX A;  4HB0 B;  3U7D A;  3MDB C;  3KRX A;  2ROZ B;  1FOE A;  2LOZ A;  1XR0 B;  1WJ1 A;  1V5U A;  5CLL B;  1GC6 A;  2N0Y A;  4CYE A;  4MY6 A;  1OMW A;  4DXA B;  5JHG A;  1I7A A;  3CXB B;  1MIX A;  2ELB A;  1WGQ A;  4C0A A;  4EMO A;  3SV1 A;  5C79 A;  1EGX A;  2YS5 A;  2N23 A;  2VRW B;  3PG7 A;  1U5G A;  1DDM A;  2DHI A;  2DTC A;  2RVB B;  1NTY A;  1V88 A;  2MFQ A;  3NSU A;  1AQC A;  2I1K A;  1Y19 B;  4NSW A;  3TW1 A;  2YT0 A;  3PVW A;  2K2U A;  4YON A;  5EFX A;  2YS3 A;  1WI1 A;  3F0W A;  3ODX A;  4TKN A;  1GC7 A;  1EVH A;  2M38 A;  3GYP A;  4WJ7 A;  2L1C A;  4XWX A;  1P5T A;  1DDV A;  5HE1 A;  3WA0 A;  3PSC A;  1XOD A;  2DFK A;  2ZPY A;  2D9V A;  5D27 A;  1TJ6 A;  1WVH A;  2J0K A;  2YF0 A;  4CHM A;  1TXD A;  1U27 A;  5J3Y A;  2L2I A;  3KZ1 A;  1U5E A;  2HE7 A;  1LB1 A;  4HAW B;  5KQ1 A;  2CAY A;  5JLJ B;  4DX9 0;  3DXD A;  5D3Y A;  1XKE A;  3AU4 A;  1Q67 A;  3ODO A;  2Z0Q A;  1X86 A;  1PFJ A;  4MK0 A;  1N3H A;  2I5C A;  1MK9 B;  2YSZ A;  2COA A;  2Z0P A;  2YRY A;  3P7Z A;  2P8V A;  2J0J A;  1XCG A;  2LKO A;  2VSZ A;  3ML4 A;  2D9Y A;  3LJU X;  3SUZ A;  4HAY B;  1FGY A;  2W2X C;  4HAU B;  2DA0 A;  2ELA A;  2YVC A;  3MPX A;  2D9Z A;  2LYD A;  3D8F A;  5CLQ B;  2CY4 A;  4EKU A;  1UNP A;  4P7I A;  3T06 A;  5KCV A;  1WGU A;  3A98 B;  3AU5 A;  1LW3 A;  1ZM0 A;  1W1D A;  1DRO A;  1MPH A;  1FHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...