4DBBA

The ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
150
Chain Sequence
EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRAINPEDLSQKEYSDLLNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family A member 1
publication title Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 36
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dbbA00
3QBVB 5FI1A 1WJ1A 1QC6A 5GOWB 1K5GB 5CLQB 1KZGA 1J0WA 4NY0A 4HAWB 2D10A 2YS5A 1TJ6A 4B6HA 2IYBA 4DXAB 1DDMA 2I1KA 1RRPB 2DHKA 2ELBA 3G9WA 4A6FB 2YS1A 3P7ZA 1WI1A 2I1JA 4K2PA 4Z2NA 2QKLA 2H7DA 2CY4A 4TKNA 2I5FA 5J3TA 3D8EA 4KHOA 3ODOA 3PZDA 5DHAB 5L81A 2LKOA 2LOZA 2D9WA 1OY2A 3BINA 5KCVA 2YT1A 2RUKB 2RGNB 1X1FA 4A6HA 2CODA 2V76A 1E5WA 2DKQA 2P0FA 5D3VA 3AU5A 3ULBA 3PP2A 4A6FA 4HB3B 4D0NB 1P6SA 2RSGA 1N3HA 1I2HA 1MKEA 1TXDA 3KRWA 2ROZB 3A98B 1ZSQA 5D3XA 5DHFB 2PZ1A 2KCJA 3U8ZA 1W1HA 3AJ4A 1SHCA 2OTXA 2Y7BA 5J3YA 4TYZA 3RCPA 1QQGA 5C5BA 4YL8A 2DN6A 4F7UP 1ISNA 2G35A 2ROVA 1IRSA 4CHJA 2FJLA 1OMWA 1UNRA 4MY6A 1GG3A 2LOXA 3ODWA 4GMVA 4KAXB 3PG7A 2RVBB 1OQNA 3FSSA 5JHGA 1BAKA 2XQNM 4XWXA 2M14A 2M38A 2GCJA 3SV1A 1WGUA 1Q67A 4EKUA 3TCAA 1XCGA 2ZPYA 1AQCA 4KVGB 5HE1A 2UVMA 4IFSA 1FGYA 2UZSA 2NMBA 1EF1A 1UEFA 2Z0QA 4GZUA 5D27A 1TQZA 1I7AA 4WJ7A 1XODA 5KQ4A 1NTVA 3DXDA 2COCA 4HAXB 3DXCA 4K81A 2EMSA 4GMXB 1U5DA 1WGQA 3GYPA 1M7EA 4NSWA 3GYOA 4BBKA 4L6EA 1DDWA 1FHXA 2MFQA 5D3WA 1V5PA 1V5MA 1KZ7A 3F5RA 1EAZA 2DYQA 2K00A 3AU4A 2Z0PA 1XX0A 2I5CA 2COFA 2DFKA 4A5KA 4ZRKA 4EJNA 1MK9B 5JP4A 4EMOA 5D3YA 3PVUA 2GJYA 2KGXB 2D2QA 4WVFB 2E2XA 3QIJA 2ADZA 2CAYA 2OQBA 1V5UA 1MAIA 3DXEA 1UPQA 5C16A 1Y19B 3N7CA 5C6RA 1ZC4B 2JP2A 3F0WA 5J3QA 1V88A 1FHOA 3M1IB 5LOPB 3LJUX 4WSFA 3SO6A 3T06A 2EMTA 3PSCA 5C5BB 3ODXA 3SUZA 3FEHA 2HE7A 1GC6A 2MWNB 5EFXA 1MIXA 3D8DA 3TW1A 5HE2A 4MT7A 1DBHA 1UNQA 3WA0A 3TO1A 1UNPA 4Z2MB 2DX5A 1U29A 1WG7A 2VSZA 2D9XA 3UZTA 4IAPA 4PQ0A 2VRWB 3KY9A 2P0DA 1M7RA 2QKMA 5LONB 4PNKA 4A6KA 2J0KA 1EVHA 4ZRJA 4F7HA 1NTYA 2ELAA 4DX90 4HDQA 2UZRA 2W2XC 4YONA 3ML4A 1GC7A 1P3RA 2YS3A 2P0HA 1PMSA 1K5DB 3TVVA 2Q13A 2K2UA 1V89A 2EC1A 1PFJA 5C79A 3KSYA 4KHBB 1W1DA 1BTKA 2YF0A 2VKIA 2H7EA 3KRXA 5JHHA 1ZM0A 1LW3A 2RNRB 5JLJB 1BWNA 2D11A 1FAOA 3ZVRA 5HE0A 2EJ8A 3HK0A 2P8VA 1U5EA 1FOEA 2LG1A 1J19A 3HQCA 3PVLA 1MK7B 2BCJA 1SGHA 2LYDA 2R09A 4HATB 2YT0A 3U7DA 2L2IA 1B55A 3CIKA 3A8QA 2L1CA 1MPHA 1RJ2A 1DYNA 1XD4A 5DI9B 1DROA 4HAZB 1XKEA 2MDXA 2YRYA 4DX8A 1EGXA 1H10A 4C0AA 4GXBA 5CLLB 4CHMA 1DDVA 2D4QA 4K17A 3OANA 4ZRIA 1MIZB 4MK0A 4GN1A 1W1GA 2YVCA 3QWMA 5HE3A 2Y8FA 3PVWA 1U2BA 5DIFB 1U27A 2DKPA 3IVFA 2D9ZA 2X18A 1FGZA 3SYXA 3V5WA 3VIAA 4K2OA 1V61A 1X1GA 1KI1B 3PEGA 1H4RA 2N23A 5KQ1A 1WVHA 4KHAA 2DTCA 3D8FA 4HB0B 5FI0A 2D9YA 3A8PA 2Z0OA 4HAVB 2DHIA 2DYNA 2DHJA 3TFMA 1X11A 1UPRA 2IFSA 3NSUA 5DH9B 1Y5OA 1U5GA 2RLOA 2MKRA 3WYFB 2GCLA 1X05A 3MDBC 3HW2B 3BJIA 2HTHB 1X86A 3KZ1A 4F7GA 1FHWA 3VOQA 2J59M 3O96A 4IOYX 2CRFA 1PLSA 3MPXA 1P5TA 2K2JA 3X23A 1LB1A 2KUPA 4HAUB 2DX1A 2R0DA 2DA0A 3ZDTA 2J0JA 4DBBA 3CXBB 2AL6A 2LULA 2J0MA 4P7IA 4HB4B 1XR0B 1ZVRA 2D9VA 3FM8C 2W2XD 1NI2A 1BTNA 4H8SA 4HHVA 1ZC3B 2YSZA 2W2WA 1AWEA 1Z87A 4GPTB 2Y8GA 3P6AA 4HB2B 4HDOA 3SNHA 2CY5A 2GS0A 1NU2A 4CYEA 2NZ8B 2AEHA 4Y94A 4HAYB 2DLWA 1WJMA 2N0YA 1FB8A 2COAA 1U5FA 3ULCA
chains in the Genus database with same CATH superfamily
3QBVB 5FI1A 1WJ1A 1QC6A 5GOWB 1K5GB 4QJ3B 5CLQB 1KZGA 1J0WA 4NY0A 4HAWB 2D10A 2YS5A 3OHMB 2NBVA 1TJ6A 2Z13A 4B6HA 2IYBA 4DXAB 1DDMA 2I1KA 1RRPB 2DHKA 2ELBA 3G9WA 4D6WA 4A6FB 2YS1A 3P7ZA 1WI1A 2I1JA 4K2PA 4Z2NA 2QKLA 2H7DA 2GUMA 2CY4A 4TKNA 4OT1A 2I5FA 5J3TA 5IRSA 3D8EA 4KHOA 4GNKB 3ODOA 3PZDA 5DHAB 5L81A 2LKOA 2LOZA 2D9WA 1OY2A 3BINA 5KCVA 2KUQA 2YT1A 2RUKB 2RGNB 1X1FA 4A6HA 2CODA 2V76A 1E5WA 2DKQA 2P0FA 5D3VA 3AU5A 3ULBA 3PP2A 4A6FA 4HB3B 4D0NB 1P6SA 2RSGA 1N3HA 1I2HA 1MKEA 1TXDA 3KRWA 5LG4B 2ROZB 3A98B 4DIXA 1ZSQA 5D3XA 5DHFB 2PZ1A 2KCJA 3U8ZA 1W1HA 3AJ4A 5I2SA 1SHCA 2OTXA 2Y7BA 2KIGA 2KIEA 5J3YA 4TYZA 3RCPA 1QQGA 5C5BA 4YL8A 2DN6A 4F7UP 1ISNA 2G35A 2ROVA 1IRSA 4CHJA 2FJLA 1OMWA 1UNRA 4MY6A 1GG3A 2LOXA 3ODWA 4GMVA 3HSAA 4KAXB 3PG7A 2RVBB 1OQNA 3FSSA 5JHGA 1BAKA 2XQNM 4XWXA 2M14A 2M38A 2GCJA 3SV1A 1WGUA 1Q67A 4EKUA 3TCAA 1XCGA 2ZPYA 1AQCA 4KVGB 5HE1A 2UVMA 4IFSA 1FGYA 2UZSA 2NMBA 1EF1A 1UEFA 2Z0QA 4GZUA 5D27A 1TQZA 1I7AA 4WJ7A 1XODA 5KQ4A 1NTVA 3DXDA 2COCA 4HAXB 3DXCA 4K81A 2EMSA 4GMXB 1U5DA 1WGQA 3GYPA 1M7EA 4NSWA 3GYOA 4BBKA 1MI1A 4L6EA 1DDWA 1FHXA 2MFQA 5D3WA 1V5PA 1V5MA 3HIEA 1KZ7A 3F5RA 1EAZA 2DYQA 2K00A 3AU4A 2Z0PA 1XX0A 2I5CA 2COFA 2DFKA 4A5KA 4ZRKA 4EJNA 1MK9B 5JP4A 4EMOA 5D3YA 3PVUA 2GJYA 2KGXB 2D2QA 4WVFB 2E2XA 4QXAB 3QIJA 4CSQA 2ADZA 2CAYA 2OQBA 1V5UA 1MAIA 3DXEA 1UPQA 5C16A 1Y19B 3N7CA 5C6RA 1ZC4B 2JP2A 3F0WA 5J3QA 1V88A 1FHOA 3M1IB 5LOPB 3LJUX 4WSFA 3SO6A 3T06A 2EMTA 3PSCA 5C5BB 3ODXA 3SUZA 3FEHA 2HE7A 1GC6A 2MWNB 4OSNA 5EFXA 1MIXA 2RRFA 3D8DA 3TW1A 2Z59A 5HE2A 4MT7A 1DBHA 1UNQA 3WA0A 3TO1A 1UNPA 4Z2MB 2DX5A 4QJ4B 1U29A 1WG7A 2VSZA 2D9XA 3UZTA 4IAPA 4PQ0A 2VRWB 3KY9A 3FVCA 2P0DA 1M7RA 2QKMA 5LONB 4PNKA 4QJ5B 4A6KA 2J0KA 1EVHA 4ZRJA 4F7HA 1NTYA 2ELAA 4DX90 4HDQA 2UZRA 2W2XC 4YONA 3ML4A 1GC7A 1P3RA 3NW8A 2YS3A 2P0HA 1PMSA 1K5DB 3TVVA 2Q13A 2K2UA 1V89A 2EC1A 1PFJA 5C79A 3KSYA 4KHBB 1W1DA 1BTKA 2YF0A 2VKIA 2H7EA 3KRXA 5JHHA 1ZM0A 1LW3A 2RNRB 3U12A 1T77A 5JLJB 1BWNA 2D11A 1FAOA 3ZVRA 5HE0A 2EJ8A 3HK0A 2P8VA 1U5EA 1FOEA 2LG1A 1J19A 3HQCA 3PVLA 1MK7B 2BCJA 1SGHA 2LYDA 2R09A 4HATB 2YT0A 3U7DA 2L2IA 1B55A 3CIKA 3A8QA 2L1CA 4KHBA 1MPHA 2Z14A 1RJ2A 1DYNA 1XD4A 5DI9B 1DROA 4HAZB 1XKEA 2MDXA 2YRYA 4DX8A 1EGXA 1H10A 4C0AA 4GXBA 5CLLB 4CHMA 2FJUB 1DDVA 2D4QA 4K17A 5M4YB 3OANA 4ZRIA 3NWDA 1MIZB 4MK0A 4GN1A 3B77A 1W1GA 2YVCA 3QWMA 5HE3A 2Y8FA 3PVWA 1U2BA 5DIFB 1U27A 2DKPA 3NWFA 5I2MA 3IVFA 2D9ZA 2X18A 1FGZA 4L1RA 3SYXA 2K8EA 3V5WA 3VIAA 4K2OA 3NWAA 1V61A 2Z4DA 1X1GA 1KI1B 3PEGA 1H4RA 2N23A 5KQ1A 1WVHA 4KHAA 2DTCA 3D8FA 4HB0B 5FI0A 2D9YA 3A8PA 2Z0OA 4HAVB 2DHIA 2DYNA 2ZKMX 2DHJA 3TFMA 3DCXA 1X11A 1UPRA 2IFSA 3NSUA 5DH9B 1Y5OA 1U5GA 2RLOA 2MKRA 3WYFB 2GCLA 1X05A 3MDBC 4GOUA 3HW2B 3BJIA 2HTHB 1X86A 3KZ1A 2KR0A 4F7GA 1FHWA 3VOQA 2J59M 3O96A 4IOYX 2CRFA 1PLSA 3MPXA 1P5TA 2K2JA 3X23A 1LB1A 2KUPA 4HAUB 2DX1A 2R0DA 2DA0A 2K49A 3ZDTA 2J0JA 4DBBA 3CXBB 1ZYIA 2AL6A 2J0MA 2LULA 4P7IA 4HB4B 1XR0B 1ZVRA 2D9VA 3FM8C 4HSIA 2W2XD 1NI2A 1BTNA 4H8SA 4HHVA 1ZC3B 2YSZA 2W2WA 1AWEA 3A58A 1Z87A 2YT2A 4GPTB 2Y8GA 3P6AA 4HB2B 4HDOA 3SNHA 2CY5A 2GS0A 1NU2A 4CYEA 2NZ8B 2AEHA 4Y94A 4HAYB 2DLWA 2R2YA 1WJMA 2N0YA 1FB8A 2COAA 1U5FA 3ULCA
chains in the Genus database with same CATH topology
3QBVB 5FI1A 1WJ1A 1QC6A 5GOWB 1K5GB 5CLQB 1KZGA 1J0WA 4NY0A 4HAWB 2D10A 2YS5A 1TJ6A 4B6HA 2IYBA 4DXAB 1DDMA 2I1KA 1RRPB 2DHKA 2ELBA 3G9WA 4A6FB 2YS1A 3P7ZA 1WI1A 2I1JA 4K2PA 4Z2NA 2QKLA 2H7DA 2CY4A 4TKNA 2I5FA 5J3TA 3D8EA 4KHOA 3ODOA 3PZDA 5DHAB 5L81A 2LKOA 2LOZA 2D9WA 1OY2A 3BINA 5KCVA 2YT1A 2RUKB 2RGNB 1X1FA 4A6HA 2CODA 2V76A 1E5WA 2DKQA 2P0FA 5D3VA 3AU5A 3ULBA 3PP2A 4A6FA 4HB3B 4D0NB 1P6SA 2RSGA 1N3HA 1I2HA 1MKEA 1TXDA 3KRWA 2ROZB 3A98B 1ZSQA 5D3XA 5DHFB 2PZ1A 2KCJA 3U8ZA 1W1HA 3AJ4A 1SHCA 2OTXA 2Y7BA 5J3YA 4TYZA 3RCPA 1QQGA 5C5BA 4YL8A 2DN6A 4F7UP 1ISNA 2G35A 2ROVA 1IRSA 4CHJA 2FJLA 1OMWA 1UNRA 4MY6A 1GG3A 2LOXA 3ODWA 4GMVA 4KAXB 3PG7A 2RVBB 1OQNA 3FSSA 5JHGA 1BAKA 2XQNM 4XWXA 2M14A 2M38A 2GCJA 3SV1A 1WGUA 1Q67A 4EKUA 3TCAA 1XCGA 2ZPYA 1AQCA 4KVGB 5HE1A 2UVMA 4IFSA 1FGYA 2UZSA 2NMBA 1EF1A 1UEFA 2Z0QA 4GZUA 5D27A 1TQZA 1I7AA 4WJ7A 1XODA 5KQ4A 1NTVA 3DXDA 2COCA 4HAXB 3DXCA 4K81A 2EMSA 4GMXB 1U5DA 1WGQA 3GYPA 1M7EA 4NSWA 3GYOA 4BBKA 4L6EA 1DDWA 1FHXA 2MFQA 5D3WA 1V5PA 1V5MA 1KZ7A 3F5RA 1EAZA 2DYQA 2K00A 3AU4A 2Z0PA 1XX0A 2I5CA 2COFA 2DFKA 4A5KA 4ZRKA 4EJNA 1MK9B 5JP4A 4EMOA 5D3YA 3PVUA 2GJYA 2KGXB 2D2QA 4WVFB 2E2XA 3QIJA 2ADZA 2CAYA 2OQBA 1V5UA 1MAIA 3DXEA 1UPQA 5C16A 1Y19B 3N7CA 5C6RA 1ZC4B 2JP2A 3F0WA 5J3QA 1V88A 1FHOA 3M1IB 5LOPB 3LJUX 4WSFA 3SO6A 3T06A 2EMTA 3PSCA 5C5BB 3ODXA 3SUZA 3FEHA 2HE7A 1GC6A 2MWNB 5EFXA 1MIXA 3D8DA 3TW1A 5HE2A 4MT7A 1DBHA 1UNQA 3WA0A 3TO1A 1UNPA 4Z2MB 2DX5A 1U29A 1WG7A 2VSZA 2D9XA 3UZTA 4IAPA 4PQ0A 2VRWB 3KY9A 2P0DA 1M7RA 2QKMA 5LONB 4PNKA 4A6KA 2J0KA 1EVHA 4ZRJA 4F7HA 1NTYA 2ELAA 4DX90 4HDQA 2UZRA 2W2XC 4YONA 3ML4A 1GC7A 1P3RA 2YS3A 2P0HA 1PMSA 1K5DB 3TVVA 2Q13A 2K2UA 1V89A 2EC1A 1PFJA 5C79A 3KSYA 4KHBB 1W1DA 1BTKA 2YF0A 2VKIA 2H7EA 3KRXA 5JHHA 1ZM0A 1LW3A 2RNRB 5JLJB 1BWNA 2D11A 1FAOA 3ZVRA 5HE0A 2EJ8A 3HK0A 2P8VA 1U5EA 1FOEA 2LG1A 1J19A 3HQCA 3PVLA 1MK7B 2BCJA 1SGHA 2LYDA 2R09A 4HATB 2YT0A 3U7DA 2L2IA 1B55A 3CIKA 3A8QA 2L1CA 1MPHA 1RJ2A 1DYNA 1XD4A 5DI9B 1DROA 4HAZB 1XKEA 2MDXA 2YRYA 4DX8A 1EGXA 1H10A 4C0AA 4GXBA 5CLLB 4CHMA 1DDVA 2D4QA 4K17A 3OANA 4ZRIA 1MIZB 4MK0A 4GN1A 1W1GA 2YVCA 3QWMA 5HE3A 2Y8FA 3PVWA 1U2BA 5DIFB 1U27A 2DKPA 3IVFA 2D9ZA 2X18A 1FGZA 3SYXA 3V5WA 3VIAA 4K2OA 1V61A 1X1GA 1KI1B 3PEGA 1H4RA 2N23A 5KQ1A 1WVHA 4KHAA 2DTCA 3D8FA 4HB0B 5FI0A 2D9YA 3A8PA 2Z0OA 4HAVB 2DHIA 2DYNA 2DHJA 3TFMA 1X11A 1UPRA 2IFSA 3NSUA 5DH9B 1Y5OA 1U5GA 2RLOA 2MKRA 3WYFB 2GCLA 1X05A 3MDBC 3HW2B 3BJIA 2HTHB 1X86A 3KZ1A 4F7GA 1FHWA 3VOQA 2J59M 3O96A 4IOYX 2CRFA 1PLSA 3MPXA 1P5TA 2K2JA 3X23A 1LB1A 2KUPA 4HAUB 2DX1A 2R0DA 2DA0A 3ZDTA 2J0JA 4DBBA 3CXBB 2AL6A 2LULA 2J0MA 4P7IA 4HB4B 1XR0B 1ZVRA 2D9VA 3FM8C 2W2XD 1NI2A 1BTNA 4H8SA 4HHVA 1ZC3B 2YSZA 2W2WA 1AWEA 1Z87A 4GPTB 2Y8GA 3P6AA 4HB2B 4HDOA 3SNHA 2CY5A 2GS0A 1NU2A 4CYEA 2NZ8B 2AEHA 4Y94A 4HAYB 2DLWA 1WJMA 2N0YA 1FB8A 2COAA 1U5FA 3ULCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBV B;  5FI1 A;  1WJ1 A;  1QC6 A;  5GOW B;  1K5G B;  5CLQ B;  1KZG A;  1J0W A;  4NY0 A;  4HAW B;  2D10 A;  2YS5 A;  1TJ6 A;  4B6H A;  2IYB A;  4DXA B;  1DDM A;  2I1K A;  1RRP B;  2DHK A;  2ELB A;  3G9W A;  4A6F B;  2YS1 A;  3P7Z A;  1WI1 A;  2I1J A;  4K2P A;  4Z2N A;  2QKL A;  2H7D A;  2CY4 A;  4TKN A;  2I5F A;  5J3T A;  3D8E A;  4KHO A;  3ODO A;  3PZD A;  5DHA B;  5L81 A;  2LKO A;  2LOZ A;  2D9W A;  1OY2 A;  3BIN A;  5KCV A;  2YT1 A;  2RUK B;  2RGN B;  1X1F A;  4A6H A;  2COD A;  2V76 A;  1E5W A;  2DKQ A;  2P0F A;  5D3V A;  3AU5 A;  3ULB A;  3PP2 A;  4A6F A;  4HB3 B;  4D0N B;  1P6S A;  2RSG A;  1N3H A;  1I2H A;  1MKE A;  1TXD A;  3KRW A;  2ROZ B;  3A98 B;  1ZSQ A;  5D3X A;  5DHF B;  2PZ1 A;  2KCJ A;  3U8Z A;  1W1H A;  3AJ4 A;  1SHC A;  2OTX A;  2Y7B A;  5J3Y A;  4TYZ A;  3RCP A;  1QQG A;  5C5B A;  4YL8 A;  2DN6 A;  4F7U P;  1ISN A;  2G35 A;  2ROV A;  1IRS A;  4CHJ A;  2FJL A;  1OMW A;  1UNR A;  4MY6 A;  1GG3 A;  2LOX A;  3ODW A;  4GMV A;  4KAX B;  3PG7 A;  2RVB B;  1OQN A;  3FSS A;  5JHG A;  1BAK A;  2XQN M;  4XWX A;  2M14 A;  2M38 A;  2GCJ A;  3SV1 A;  1WGU A;  1Q67 A;  4EKU A;  3TCA A;  1XCG A;  2ZPY A;  1AQC A;  4KVG B;  5HE1 A;  2UVM A;  4IFS A;  1FGY A;  2UZS A;  2NMB A;  1EF1 A;  1UEF A;  2Z0Q A;  4GZU A;  5D27 A;  1TQZ A;  1I7A A;  4WJ7 A;  1XOD A;  5KQ4 A;  1NTV A;  3DXD A;  2COC A;  4HAX B;  3DXC A;  4K81 A;  2EMS A;  4GMX B;  1U5D A;  1WGQ A;  3GYP A;  1M7E A;  4NSW A;  3GYO A;  4BBK A;  4L6E A;  1DDW A;  1FHX A;  2MFQ A;  5D3W A;  1V5P A;  1V5M A;  1KZ7 A;  3F5R A;  1EAZ A;  2DYQ A;  2K00 A;  3AU4 A;  2Z0P A;  1XX0 A;  2I5C A;  2COF A;  2DFK A;  4A5K A;  4ZRK A;  4EJN A;  1MK9 B;  5JP4 A;  4EMO A;  5D3Y A;  3PVU A;  2GJY A;  2KGX B;  2D2Q A;  4WVF B;  2E2X A;  3QIJ A;  2ADZ A;  2CAY A;  2OQB A;  1V5U A;  1MAI A;  3DXE A;  1UPQ A;  5C16 A;  1Y19 B;  3N7C A;  5C6R A;  1ZC4 B;  2JP2 A;  3F0W A;  5J3Q A;  1V88 A;  1FHO A;  3M1I B;  5LOP B;  3LJU X;  4WSF A;  3SO6 A;  3T06 A;  2EMT A;  3PSC A;  5C5B B;  3ODX A;  3SUZ A;  3FEH A;  2HE7 A;  1GC6 A;  2MWN B;  5EFX A;  1MIX A;  3D8D A;  3TW1 A;  5HE2 A;  4MT7 A;  1DBH A;  1UNQ A;  3WA0 A;  3TO1 A;  1UNP A;  4Z2M B;  2DX5 A;  1U29 A;  1WG7 A;  2VSZ A;  2D9X A;  3UZT A;  4IAP A;  4PQ0 A;  2VRW B;  3KY9 A;  2P0D A;  1M7R A;  2QKM A;  5LON B;  4PNK A;  4A6K A;  2J0K A;  1EVH A;  4ZRJ A;  4F7H A;  1NTY A;  2ELA A;  4DX9 0;  4HDQ A;  2UZR A;  2W2X C;  4YON A;  3ML4 A;  1GC7 A;  1P3R A;  2YS3 A;  2P0H A;  1PMS A;  1K5D B;  3TVV A;  2Q13 A;  2K2U A;  1V89 A;  2EC1 A;  1PFJ A;  5C79 A;  3KSY A;  4KHB B;  1W1D A;  1BTK A;  2YF0 A;  2VKI A;  2H7E A;  3KRX A;  5JHH A;  1ZM0 A;  1LW3 A;  2RNR B;  5JLJ B;  1BWN A;  2D11 A;  1FAO A;  3ZVR A;  5HE0 A;  2EJ8 A;  3HK0 A;  2P8V A;  1U5E A;  1FOE A;  2LG1 A;  1J19 A;  3HQC A;  3PVL A;  1MK7 B;  2BCJ A;  1SGH A;  2LYD A;  2R09 A;  4HAT B;  2YT0 A;  3U7D A;  2L2I A;  1B55 A;  3CIK A;  3A8Q A;  2L1C A;  1MPH A;  1RJ2 A;  1DYN A;  1XD4 A;  5DI9 B;  1DRO A;  4HAZ B;  1XKE A;  2MDX A;  2YRY A;  4DX8 A;  1EGX A;  1H10 A;  4C0A A;  4GXB A;  5CLL B;  4CHM A;  1DDV A;  2D4Q A;  4K17 A;  3OAN A;  4ZRI A;  1MIZ B;  4MK0 A;  4GN1 A;  1W1G A;  2YVC A;  3QWM A;  5HE3 A;  2Y8F A;  3PVW A;  1U2B A;  5DIF B;  1U27 A;  2DKP A;  3IVF A;  2D9Z A;  2X18 A;  1FGZ A;  3SYX A;  3V5W A;  3VIA A;  4K2O A;  1V61 A;  1X1G A;  1KI1 B;  3PEG A;  1H4R A;  2N23 A;  5KQ1 A;  1WVH A;  4KHA A;  2DTC A;  3D8F A;  4HB0 B;  5FI0 A;  2D9Y A;  3A8P A;  2Z0O A;  4HAV B;  2DHI A;  2DYN A;  2DHJ A;  3TFM A;  1X11 A;  1UPR A;  2IFS A;  3NSU A;  5DH9 B;  1Y5O A;  1U5G A;  2RLO A;  2MKR A;  3WYF B;  2GCL A;  1X05 A;  3MDB C;  3HW2 B;  3BJI A;  2HTH B;  1X86 A;  3KZ1 A;  4F7G A;  1FHW A;  3VOQ A;  2J59 M;  3O96 A;  4IOY X;  2CRF A;  1PLS A;  3MPX A;  1P5T A;  2K2J A;  3X23 A;  1LB1 A;  2KUP A;  4HAU B;  2DX1 A;  2R0D A;  2DA0 A;  3ZDT A;  2J0J A;  4DBB A;  3CXB B;  2AL6 A;  2LUL A;  2J0M A;  4P7I A;  4HB4 B;  1XR0 B;  1ZVR A;  2D9V A;  3FM8 C;  2W2X D;  1NI2 A;  1BTN A;  4H8S A;  4HHV A;  1ZC3 B;  2YSZ A;  2W2W A;  1AWE A;  1Z87 A;  4GPT B;  2Y8G A;  3P6A A;  4HB2 B;  4HDO A;  3SNH A;  2CY5 A;  2GS0 A;  1NU2 A;  4CYE A;  2NZ8 B;  2AEH A;  4Y94 A;  4HAY B;  2DLW A;  1WJM A;  2N0Y A;  1FB8 A;  2COA A;  1U5F A;  3ULC A; 
#chains in the Genus database with same CATH topology
 3QBV B;  5FI1 A;  1WJ1 A;  1QC6 A;  5GOW B;  1K5G B;  4QJ3 B;  5CLQ B;  1KZG A;  1J0W A;  4NY0 A;  4HAW B;  2D10 A;  2YS5 A;  3OHM B;  2NBV A;  1TJ6 A;  2Z13 A;  4B6H A;  2IYB A;  4DXA B;  1DDM A;  2I1K A;  1RRP B;  2DHK A;  2ELB A;  3G9W A;  4D6W A;  4A6F B;  2YS1 A;  3P7Z A;  1WI1 A;  2I1J A;  4K2P A;  4Z2N A;  2QKL A;  2H7D A;  2GUM A;  2CY4 A;  4TKN A;  4OT1 A;  2I5F A;  5J3T A;  5IRS A;  3D8E A;  4KHO A;  4GNK B;  3ODO A;  3PZD A;  5DHA B;  5L81 A;  2LKO A;  2LOZ A;  2D9W A;  1OY2 A;  3BIN A;  5KCV A;  2KUQ A;  2YT1 A;  2RUK B;  2RGN B;  1X1F A;  4A6H A;  2COD A;  2V76 A;  1E5W A;  2DKQ A;  2P0F A;  5D3V A;  3AU5 A;  3ULB A;  3PP2 A;  4A6F A;  4HB3 B;  4D0N B;  1P6S A;  2RSG A;  1N3H A;  1I2H A;  1MKE A;  1TXD A;  3KRW A;  5LG4 B;  2ROZ B;  3A98 B;  4DIX A;  1ZSQ A;  5D3X A;  5DHF B;  2PZ1 A;  2KCJ A;  3U8Z A;  1W1H A;  3AJ4 A;  5I2S A;  1SHC A;  2OTX A;  2Y7B A;  2KIG A;  2KIE A;  5J3Y A;  4TYZ A;  3RCP A;  1QQG A;  5C5B A;  4YL8 A;  2DN6 A;  4F7U P;  1ISN A;  2G35 A;  2ROV A;  1IRS A;  4CHJ A;  2FJL A;  1OMW A;  1UNR A;  4MY6 A;  1GG3 A;  2LOX A;  3ODW A;  4GMV A;  3HSA A;  4KAX B;  3PG7 A;  2RVB B;  1OQN A;  3FSS A;  5JHG A;  1BAK A;  2XQN M;  4XWX A;  2M14 A;  2M38 A;  2GCJ A;  3SV1 A;  1WGU A;  1Q67 A;  4EKU A;  3TCA A;  1XCG A;  2ZPY A;  1AQC A;  4KVG B;  5HE1 A;  2UVM A;  4IFS A;  1FGY A;  2UZS A;  2NMB A;  1EF1 A;  1UEF A;  2Z0Q A;  4GZU A;  5D27 A;  1TQZ A;  1I7A A;  4WJ7 A;  1XOD A;  5KQ4 A;  1NTV A;  3DXD A;  2COC A;  4HAX B;  3DXC A;  4K81 A;  2EMS A;  4GMX B;  1U5D A;  1WGQ A;  3GYP A;  1M7E A;  4NSW A;  3GYO A;  4BBK A;  1MI1 A;  4L6E A;  1DDW A;  1FHX A;  2MFQ A;  5D3W A;  1V5P A;  1V5M A;  3HIE A;  1KZ7 A;  3F5R A;  1EAZ A;  2DYQ A;  2K00 A;  3AU4 A;  2Z0P A;  1XX0 A;  2I5C A;  2COF A;  2DFK A;  4A5K A;  4ZRK A;  4EJN A;  1MK9 B;  5JP4 A;  4EMO A;  5D3Y A;  3PVU A;  2GJY A;  2KGX B;  2D2Q A;  4WVF B;  2E2X A;  4QXA B;  3QIJ A;  4CSQ A;  2ADZ A;  2CAY A;  2OQB A;  1V5U A;  1MAI A;  3DXE A;  1UPQ A;  5C16 A;  1Y19 B;  3N7C A;  5C6R A;  1ZC4 B;  2JP2 A;  3F0W A;  5J3Q A;  1V88 A;  1FHO A;  3M1I B;  5LOP B;  3LJU X;  4WSF A;  3SO6 A;  3T06 A;  2EMT A;  3PSC A;  5C5B B;  3ODX A;  3SUZ A;  3FEH A;  2HE7 A;  1GC6 A;  2MWN B;  4OSN A;  5EFX A;  1MIX A;  2RRF A;  3D8D A;  3TW1 A;  2Z59 A;  5HE2 A;  4MT7 A;  1DBH A;  1UNQ A;  3WA0 A;  3TO1 A;  1UNP A;  4Z2M B;  2DX5 A;  4QJ4 B;  1U29 A;  1WG7 A;  2VSZ A;  2D9X A;  3UZT A;  4IAP A;  4PQ0 A;  2VRW B;  3KY9 A;  3FVC A;  2P0D A;  1M7R A;  2QKM A;  5LON B;  4PNK A;  4QJ5 B;  4A6K A;  2J0K A;  1EVH A;  4ZRJ A;  4F7H A;  1NTY A;  2ELA A;  4DX9 0;  4HDQ A;  2UZR A;  2W2X C;  4YON A;  3ML4 A;  1GC7 A;  1P3R A;  3NW8 A;  2YS3 A;  2P0H A;  1PMS A;  1K5D B;  3TVV A;  2Q13 A;  2K2U A;  1V89 A;  2EC1 A;  1PFJ A;  5C79 A;  3KSY A;  4KHB B;  1W1D A;  1BTK A;  2YF0 A;  2VKI A;  2H7E A;  3KRX A;  5JHH A;  1ZM0 A;  1LW3 A;  2RNR B;  3U12 A;  1T77 A;  5JLJ B;  1BWN A;  2D11 A;  1FAO A;  3ZVR A;  5HE0 A;  2EJ8 A;  3HK0 A;  2P8V A;  1U5E A;  1FOE A;  2LG1 A;  1J19 A;  3HQC A;  3PVL A;  1MK7 B;  2BCJ A;  1SGH A;  2LYD A;  2R09 A;  4HAT B;  2YT0 A;  3U7D A;  2L2I A;  1B55 A;  3CIK A;  3A8Q A;  2L1C A;  4KHB A;  1MPH A;  2Z14 A;  1RJ2 A;  1DYN A;  1XD4 A;  5DI9 B;  1DRO A;  4HAZ B;  1XKE A;  2MDX A;  2YRY A;  4DX8 A;  1EGX A;  1H10 A;  4C0A A;  4GXB A;  5CLL B;  4CHM A;  2FJU B;  1DDV A;  2D4Q A;  4K17 A;  5M4Y B;  3OAN A;  4ZRI A;  3NWD A;  1MIZ B;  4MK0 A;  4GN1 A;  3B77 A;  1W1G A;  2YVC A;  3QWM A;  5HE3 A;  2Y8F A;  3PVW A;  1U2B A;  5DIF B;  1U27 A;  2DKP A;  3NWF A;  5I2M A;  3IVF A;  2D9Z A;  2X18 A;  1FGZ A;  4L1R A;  3SYX A;  2K8E A;  3V5W A;  3VIA A;  4K2O A;  3NWA A;  1V61 A;  2Z4D A;  1X1G A;  1KI1 B;  3PEG A;  1H4R A;  2N23 A;  5KQ1 A;  1WVH A;  4KHA A;  2DTC A;  3D8F A;  4HB0 B;  5FI0 A;  2D9Y A;  3A8P A;  2Z0O A;  4HAV B;  2DHI A;  2DYN A;  2ZKM X;  2DHJ A;  3TFM A;  3DCX A;  1X11 A;  1UPR A;  2IFS A;  3NSU A;  5DH9 B;  1Y5O A;  1U5G A;  2RLO A;  2MKR A;  3WYF B;  2GCL A;  1X05 A;  3MDB C;  4GOU A;  3HW2 B;  3BJI A;  2HTH B;  1X86 A;  3KZ1 A;  2KR0 A;  4F7G A;  1FHW A;  3VOQ A;  2J59 M;  3O96 A;  4IOY X;  2CRF A;  1PLS A;  3MPX A;  1P5T A;  2K2J A;  3X23 A;  1LB1 A;  2KUP A;  4HAU B;  2DX1 A;  2R0D A;  2DA0 A;  2K49 A;  3ZDT A;  2J0J A;  4DBB A;  3CXB B;  1ZYI A;  2AL6 A;  2J0M A;  2LUL A;  4P7I A;  4HB4 B;  1XR0 B;  1ZVR A;  2D9V A;  3FM8 C;  4HSI A;  2W2X D;  1NI2 A;  1BTN A;  4H8S A;  4HHV A;  1ZC3 B;  2YSZ A;  2W2W A;  1AWE A;  3A58 A;  1Z87 A;  2YT2 A;  4GPT B;  2Y8G A;  3P6A A;  4HB2 B;  4HDO A;  3SNH A;  2CY5 A;  2GS0 A;  1NU2 A;  4CYE A;  2NZ8 B;  2AEH A;  4Y94 A;  4HAY B;  2DLW A;  2R2Y A;  1WJM A;  2N0Y A;  1FB8 A;  2COA A;  1U5F A;  3ULC A; 
#chains in the Genus database with same CATH homology
 3QBV B;  5FI1 A;  1WJ1 A;  1QC6 A;  5GOW B;  1K5G B;  5CLQ B;  1KZG A;  1J0W A;  4NY0 A;  4HAW B;  2D10 A;  2YS5 A;  1TJ6 A;  4B6H A;  2IYB A;  4DXA B;  1DDM A;  2I1K A;  1RRP B;  2DHK A;  2ELB A;  3G9W A;  4A6F B;  2YS1 A;  3P7Z A;  1WI1 A;  2I1J A;  4K2P A;  4Z2N A;  2QKL A;  2H7D A;  2CY4 A;  4TKN A;  2I5F A;  5J3T A;  3D8E A;  4KHO A;  3ODO A;  3PZD A;  5DHA B;  5L81 A;  2LKO A;  2LOZ A;  2D9W A;  1OY2 A;  3BIN A;  5KCV A;  2YT1 A;  2RUK B;  2RGN B;  1X1F A;  4A6H A;  2COD A;  2V76 A;  1E5W A;  2DKQ A;  2P0F A;  5D3V A;  3AU5 A;  3ULB A;  3PP2 A;  4A6F A;  4HB3 B;  4D0N B;  1P6S A;  2RSG A;  1N3H A;  1I2H A;  1MKE A;  1TXD A;  3KRW A;  2ROZ B;  3A98 B;  1ZSQ A;  5D3X A;  5DHF B;  2PZ1 A;  2KCJ A;  3U8Z A;  1W1H A;  3AJ4 A;  1SHC A;  2OTX A;  2Y7B A;  5J3Y A;  4TYZ A;  3RCP A;  1QQG A;  5C5B A;  4YL8 A;  2DN6 A;  4F7U P;  1ISN A;  2G35 A;  2ROV A;  1IRS A;  4CHJ A;  2FJL A;  1OMW A;  1UNR A;  4MY6 A;  1GG3 A;  2LOX A;  3ODW A;  4GMV A;  4KAX B;  3PG7 A;  2RVB B;  1OQN A;  3FSS A;  5JHG A;  1BAK A;  2XQN M;  4XWX A;  2M14 A;  2M38 A;  2GCJ A;  3SV1 A;  1WGU A;  1Q67 A;  4EKU A;  3TCA A;  1XCG A;  2ZPY A;  1AQC A;  4KVG B;  5HE1 A;  2UVM A;  4IFS A;  1FGY A;  2UZS A;  2NMB A;  1EF1 A;  1UEF A;  2Z0Q A;  4GZU A;  5D27 A;  1TQZ A;  1I7A A;  4WJ7 A;  1XOD A;  5KQ4 A;  1NTV A;  3DXD A;  2COC A;  4HAX B;  3DXC A;  4K81 A;  2EMS A;  4GMX B;  1U5D A;  1WGQ A;  3GYP A;  1M7E A;  4NSW A;  3GYO A;  4BBK A;  4L6E A;  1DDW A;  1FHX A;  2MFQ A;  5D3W A;  1V5P A;  1V5M A;  1KZ7 A;  3F5R A;  1EAZ A;  2DYQ A;  2K00 A;  3AU4 A;  2Z0P A;  1XX0 A;  2I5C A;  2COF A;  2DFK A;  4A5K A;  4ZRK A;  4EJN A;  1MK9 B;  5JP4 A;  4EMO A;  5D3Y A;  3PVU A;  2GJY A;  2KGX B;  2D2Q A;  4WVF B;  2E2X A;  3QIJ A;  2ADZ A;  2CAY A;  2OQB A;  1V5U A;  1MAI A;  3DXE A;  1UPQ A;  5C16 A;  1Y19 B;  3N7C A;  5C6R A;  1ZC4 B;  2JP2 A;  3F0W A;  5J3Q A;  1V88 A;  1FHO A;  3M1I B;  5LOP B;  3LJU X;  4WSF A;  3SO6 A;  3T06 A;  2EMT A;  3PSC A;  5C5B B;  3ODX A;  3SUZ A;  3FEH A;  2HE7 A;  1GC6 A;  2MWN B;  5EFX A;  1MIX A;  3D8D A;  3TW1 A;  5HE2 A;  4MT7 A;  1DBH A;  1UNQ A;  3WA0 A;  3TO1 A;  1UNP A;  4Z2M B;  2DX5 A;  1U29 A;  1WG7 A;  2VSZ A;  2D9X A;  3UZT A;  4IAP A;  4PQ0 A;  2VRW B;  3KY9 A;  2P0D A;  1M7R A;  2QKM A;  5LON B;  4PNK A;  4A6K A;  2J0K A;  1EVH A;  4ZRJ A;  4F7H A;  1NTY A;  2ELA A;  4DX9 0;  4HDQ A;  2UZR A;  2W2X C;  4YON A;  3ML4 A;  1GC7 A;  1P3R A;  2YS3 A;  2P0H A;  1PMS A;  1K5D B;  3TVV A;  2Q13 A;  2K2U A;  1V89 A;  2EC1 A;  1PFJ A;  5C79 A;  3KSY A;  4KHB B;  1W1D A;  1BTK A;  2YF0 A;  2VKI A;  2H7E A;  3KRX A;  5JHH A;  1ZM0 A;  1LW3 A;  2RNR B;  5JLJ B;  1BWN A;  2D11 A;  1FAO A;  3ZVR A;  5HE0 A;  2EJ8 A;  3HK0 A;  2P8V A;  1U5E A;  1FOE A;  2LG1 A;  1J19 A;  3HQC A;  3PVL A;  1MK7 B;  2BCJ A;  1SGH A;  2LYD A;  2R09 A;  4HAT B;  2YT0 A;  3U7D A;  2L2I A;  1B55 A;  3CIK A;  3A8Q A;  2L1C A;  1MPH A;  1RJ2 A;  1DYN A;  1XD4 A;  5DI9 B;  1DRO A;  4HAZ B;  1XKE A;  2MDX A;  2YRY A;  4DX8 A;  1EGX A;  1H10 A;  4C0A A;  4GXB A;  5CLL B;  4CHM A;  1DDV A;  2D4Q A;  4K17 A;  3OAN A;  4ZRI A;  1MIZ B;  4MK0 A;  4GN1 A;  1W1G A;  2YVC A;  3QWM A;  5HE3 A;  2Y8F A;  3PVW A;  1U2B A;  5DIF B;  1U27 A;  2DKP A;  3IVF A;  2D9Z A;  2X18 A;  1FGZ A;  3SYX A;  3V5W A;  3VIA A;  4K2O A;  1V61 A;  1X1G A;  1KI1 B;  3PEG A;  1H4R A;  2N23 A;  5KQ1 A;  1WVH A;  4KHA A;  2DTC A;  3D8F A;  4HB0 B;  5FI0 A;  2D9Y A;  3A8P A;  2Z0O A;  4HAV B;  2DHI A;  2DYN A;  2DHJ A;  3TFM A;  1X11 A;  1UPR A;  2IFS A;  3NSU A;  5DH9 B;  1Y5O A;  1U5G A;  2RLO A;  2MKR A;  3WYF B;  2GCL A;  1X05 A;  3MDB C;  3HW2 B;  3BJI A;  2HTH B;  1X86 A;  3KZ1 A;  4F7G A;  1FHW A;  3VOQ A;  2J59 M;  3O96 A;  4IOY X;  2CRF A;  1PLS A;  3MPX A;  1P5T A;  2K2J A;  3X23 A;  1LB1 A;  2KUP A;  4HAU B;  2DX1 A;  2R0D A;  2DA0 A;  3ZDT A;  2J0J A;  4DBB A;  3CXB B;  2AL6 A;  2LUL A;  2J0M A;  4P7I A;  4HB4 B;  1XR0 B;  1ZVR A;  2D9V A;  3FM8 C;  2W2X D;  1NI2 A;  1BTN A;  4H8S A;  4HHV A;  1ZC3 B;  2YSZ A;  2W2W A;  1AWE A;  1Z87 A;  4GPT B;  2Y8G A;  3P6A A;  4HB2 B;  4HDO A;  3SNH A;  2CY5 A;  2GS0 A;  1NU2 A;  4CYE A;  2NZ8 B;  2AEH A;  4Y94 A;  4HAY B;  2DLW A;  1WJM A;  2N0Y A;  1FB8 A;  2COA A;  1U5F A;  3ULC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...