4DBBA

The ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
150
Chain Sequence
EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRAINPEDLSQKEYSDLLNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords Amyloid beta A4 precursor protein-binding family A member 1
total genus 36
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dbbA00
3HW2B 5D3VA 3ZVRA 2KGXB 2MDXA 2JP2A 4TYZA 2K2UA 1DBHA 3WA0A 3LJUX 2D4QA 1Z87A 2MKRA 5KCVA 4DX8A 3QBVB 3P6AA 2RUKB 4HB4B 2GCJA 5KQ1A 2ZPYA 2DLWA 2UZSA 3TFMA 2DYQA 3F0WA 1J0WA 1UEFA 1N3HA 1NI2A 3U7DA 3SO6A 2EMSA 1PLSA 1V5UA 3PG7A 5C79A 1FGYA 1V5MA 1TXDA 1BWNA 3AU4A 3G9WA 1TJ6A 1QQGA 1P6SA 2MWNB 2Z0PA 1FAOA 1FHWA 4HATB 1IRSA 2X18A 2CY4A 4YL8A 2DKQA 1RJ2A 3ULBA 3DXEA 3ML4A 1MIZB 4A6FA 2ROZB 1LW3A 3QWMA 2D9WA 1RRPB 1GG3A 5C6RA 2LG1A 4A6HA 1X1GA 5DH9B 2VKIA 4HB0B 1XX0A 2DTCA 1X11A 2R09A 4NSWA 5LOPB 1SHCA 2D9ZA 1WI1A 4KHAA 3WYFB 3D8FA 5GOWB 3ODWA 2I5FA 1KZ7A 1GC7A 3PVWA 2YS5A 1V61A 3SNHA 5JLJB 2KUPA 1U29A 3DXDA 2UZRA 2DA0A 2FJLA 2IFSA 1Y5OA 2Y8FA 5FI1A 2M14A 5D27A 3TCAA 3MDBC 3AU5A 3U8ZA 5CLQB 1XODA 3MPXA 1DROA 1FOEA 4CYEA 2W2WA 1UNRA 5LONB 3HQCA 1MK9B 4IFSA 1ZM0A 2RSGA 2YS3A 2E2XA 3KZ1A 1MPHA 4Z2NA 2ELAA 4KHBB 1FHXA 4TKNA 1B55A 5C16A 2Q13A 2W2XD 4F7UP 5DI9B 2ELBA 1UNQA 2D10A 2NZ8B 4MK0A 3D8DA 2DX1A 4KVGB 4GMXB 4K81A 3TO1A 1UPQA 2DKPA 1XCGA 3ODXA 2AL6A 3QIJA 1V88A 2K00A 1UPRA 4IOYX 1ZC4B 1WGUA 1V89A 3DXCA 2Y7BA 3ODOA 4HDQA 2BCJA 2D9YA 2LOXA 3PSCA 1U5GA 1U2BA 3V5WA 4L6EA 4Z2MB 5D3YA 4XWXA 3KRWA 3FEHA 4IAPA 3T06A 1ZVRA 3PVUA 2I5CA 1PFJA 1DYNA 1X1FA 3KSYA 3TW1A 2J0KA 3TVVA 4C0AA 3SV1A 4GPTB 2YRYA 2D11A 5DIFB 3SUZA 2EMTA 2DHIA 1U5FA 3FSSA 1XKEA 1K5DB 1QC6A 1SGHA 3A8PA 4A5KA 2CODA 5HE2A 1AWEA 1DDMA 4Y94A 3GYPA 5JHHA 3PVLA 2AEHA 4EKUA 4BBKA 4K2OA 4EMOA 2R0DA 3NSUA 2H7DA 4H8SA 3UZTA 2W2XC 2CAYA 1NTYA 2DFKA 2D9XA 3N7CA 2ADZA 3BJIA 1GC6A 4HAXB 1MIXA 1M7RA 3O96A 2RVBB 1XD4A 1DDWA 3D8EA 3PEGA 2YF0A 2UVMA 1KI1B 2DX5A 5HE1A 2LYDA 2OTXA 2DHKA 4F7GA 2ROVA 3X23A 3ULCA 1U27A 4GZUA 2YT1A 1P5TA 2OQBA 1E5WA 4K17A 2J0MA 1K5GB 5J3QA 2Z0QA 1FGZA 5FI0A 1ZSQA 1U5EA 4HAZB 1BTKA 5J3YA 4MT7A 5DHFB 2GJYA 2V76A 1BAKA 2LKOA 4A6KA 5J3TA 4HAUB 5D3WA 5L81A 1Q67A 2I1KA 2D9VA 4ZRIA 1I2HA 2GCLA 3IVFA 4WVFB 4D0NB 1I7AA 1EVHA 1Y19B 3M1IB 4GMVA 2KCJA 1TQZA 3VOQA 4MY6A 1ISNA 1UNPA 1V5PA 5EFXA 2Y8GA 2J0JA 4WJ7A 2COAA 3BINA 4K2PA 1KZGA 1X05A 5HE0A 3P7ZA 1DDVA 1OMWA 3HK0A 1X86A 4KAXB 2M38A 2CY5A 4HAVB 2CRFA 4WSFA 4DX90 3CXBB 2H7EA 2DYNA 4F7HA 2P8VA 1WG7A 2COFA 3AJ4A 1U5DA 2I1JA 2EC1A 1OQNA 5DHAB 1EGXA 2HE7A 2DN6A 2VRWB 3KY9A 4PQ0A 1AQCA 3A98B 3OANA 1XR0B 4HB3B 5CLLB 1OY2A 3KRXA 2GS0A 5JHGA 1WVHA 4GN1A 2K2JA 1PMSA 1EF1A 4HAWB 2L1CA 4A6FB 1P3RA 4P7IA 4HAYB 2YVCA 4CHJA 3SYXA 2P0HA 1MKEA 1NU2A 2RNRB 4KHOA 2L2IA 2D2QA 3CIKA 4HB2B 2RGNB 1LB1A 4YONA 4EJNA 1BTNA 2MFQA 2YSZA 3GYOA 1EAZA 2N23A 4DXAB 2COCA 4CHMA 3VIAA 5JP4A 1M7EA 4HDOA 1WJ1A 1FB8A 3PZDA 3ZDTA 4HHVA 2EJ8A 2P0DA 3F5RA 2QKMA 3A8QA 3FM8C 3RCPA 5KQ4A 1MAIA 5C5BB 1W1DA 5C5BA 4NY0A 2QKLA 2YT0A 1W1GA 4GXBA 2YS1A 1ZC3B 1W1HA 2LOZA 2IYBA 4B6HA 2PZ1A 4PNKA 1FHOA 1MK7B 4DBBA 1J19A 5D3XA 1WGQA 2VSZA 1H10A 1H4RA 2DHJA 1WJMA 2LULA 2N0YA 2G35A 2NMBA 2P0FA 4ZRJA 5HE3A 2XQNM 3PP2A 2HTHB 2Z0OA 2J59M 2RLOA 4ZRKA 1NTVA
chains in the Genus database with same CATH superfamily
3HW2B 5D3VA 3ZVRA 2KGXB 2MDXA 2JP2A 4TYZA 2K2UA 4CSQA 1DBHA 3NWFA 3WA0A 3LJUX 2D4QA 1Z87A 2MKRA 5KCVA 4DX8A 3QBVB 4QJ3B 3P6AA 2RUKB 4HB4B 2GCJA 5KQ1A 2KIEA 2ZPYA 2DLWA 2UZSA 3TFMA 2DYQA 3F0WA 1J0WA 1UEFA 5IRSA 1N3HA 1NI2A 3U7DA 3SO6A 2EMSA 1PLSA 1V5UA 3PG7A 5C79A 1FGYA 1V5MA 1TXDA 1BWNA 3AU4A 3G9WA 1TJ6A 1QQGA 1P6SA 2MWNB 2Z0PA 1FAOA 1FHWA 4HATB 1IRSA 2X18A 2CY4A 4YL8A 2DKQA 1RJ2A 3ULBA 2YT2A 2KR0A 3DXEA 3ML4A 1MIZB 1ZYIA 4A6FA 2ROZB 1LW3A 3QWMA 2D9WA 1RRPB 1GG3A 5C6RA 3NWAA 2LG1A 4A6HA 1X1GA 5DH9B 2VKIA 4HB0B 1XX0A 2DTCA 1X11A 3B77A 2R09A 4NSWA 5LOPB 1SHCA 2D9ZA 1WI1A 4KHAA 3WYFB 3D8FA 5GOWB 3ODWA 2I5FA 1KZ7A 1GC7A 3PVWA 2R2YA 2YS5A 1V61A 3SNHA 5JLJB 2KUPA 1U29A 3DXDA 2UZRA 2DA0A 2FJLA 2IFSA 1Y5OA 2Y8FA 5FI1A 2M14A 5D27A 3TCAA 3MDBC 3AU5A 3U8ZA 5CLQB 1XODA 3MPXA 1DROA 1FOEA 4CYEA 2W2WA 1UNRA 5LONB 3HQCA 1MK9B 4IFSA 1ZM0A 2RSGA 2YS3A 2E2XA 3KZ1A 1MPHA 4Z2NA 2ELAA 5LG4B 2FJUB 4KHBB 1FHXA 4TKNA 1B55A 5C16A 2Q13A 2W2XD 4F7UP 5DI9B 2ELBA 1UNQA 2D10A 2NZ8B 4MK0A 3D8DA 2DX1A 4KVGB 4GMXB 4K81A 3TO1A 1UPQA 2DKPA 1XCGA 3ODXA 2AL6A 3QIJA 1V88A 2K00A 1UPRA 4IOYX 1ZC4B 4GNKB 1WGUA 1V89A 3DXCA 2Y7BA 3ODOA 4HDQA 2BCJA 2D9YA 2LOXA 3PSCA 1U5GA 1U2BA 2GUMA 3V5WA 4L6EA 4Z2MB 5D3YA 4XWXA 3KRWA 3FEHA 3T06A 4IAPA 1ZVRA 3PVUA 2I5CA 1PFJA 1DYNA 1X1FA 3KSYA 3TW1A 2J0KA 3TVVA 4C0AA 3HIEA 3SV1A 4GPTB 2YRYA 2D11A 3OHMB 5DIFB 3SUZA 2EMTA 2DHIA 1U5FA 3FSSA 1XKEA 2Z13A 1K5DB 1QC6A 4HSIA 1SGHA 3A8PA 4A5KA 2CODA 5HE2A 1AWEA 3FVCA 1DDMA 4Y94A 3GYPA 5JHHA 3PVLA 2AEHA 4EKUA 4BBKA 4K2OA 4EMOA 2R0DA 3NSUA 2H7DA 4H8SA 3UZTA 2NBVA 2W2XC 2CAYA 1NTYA 2DFKA 2D9XA 3N7CA 2ADZA 3A58A 3BJIA 1GC6A 4HAXB 1MIXA 1M7RA 3O96A 2RVBB 1XD4A 1DDWA 3D8EA 3PEGA 2YF0A 2UVMA 1KI1B 2DX5A 2KIGA 5HE1A 2LYDA 2OTXA 2ZKMX 2DHKA 4F7GA 2ROVA 3X23A 3ULCA 1U27A 4OT1A 4GZUA 2YT1A 1P5TA 2OQBA 1E5WA 4K17A 2J0MA 1K5GB 5J3QA 2Z0QA 1FGZA 5M4YB 5FI0A 1ZSQA 1U5EA 4HAZB 1BTKA 5J3YA 4MT7A 5DHFB 2GJYA 2V76A 1BAKA 2LKOA 4A6KA 5J3TA 4HAUB 5D3WA 5L81A 4DIXA 1Q67A 2I1KA 2D9VA 4ZRIA 1I2HA 2GCLA 3IVFA 2RRFA 4WVFB 4D0NB 1I7AA 1EVHA 1Y19B 5I2SA 3M1IB 4GMVA 2KCJA 1T77A 1TQZA 3VOQA 4OSNA 4MY6A 1ISNA 1UNPA 1V5PA 5EFXA 4KHBA 2Y8GA 2J0JA 4WJ7A 2COAA 3BINA 4K2PA 1KZGA 1X05A 3NW8A 5HE0A 3P7ZA 1DDVA 1OMWA 3HK0A 1X86A 4KAXB 4QXAB 2M38A 2CY5A 4HAVB 2CRFA 4WSFA 4DX90 3CXBB 2H7EA 2DYNA 2Z14A 4F7HA 2P8VA 1WG7A 2COFA 3AJ4A 1U5DA 2I1JA 2EC1A 1OQNA 5DHAB 1EGXA 2HE7A 1MI1A 2DN6A 2VRWB 3KY9A 4GOUA 4PQ0A 1AQCA 3A98B 3OANA 3NWDA 1XR0B 4HB3B 5CLLB 1OY2A 3KRXA 2GS0A 5JHGA 1WVHA 4GN1A 2K2JA 3U12A 1PMSA 1EF1A 4HAWB 2L1CA 4A6FB 1P3RA 2K49A 4P7IA 4HAYB 4QJ5B 2YVCA 4CHJA 3SYXA 2P0HA 1MKEA 2KUQA 1NU2A 2RNRB 4KHOA 2K8EA 2L2IA 2D2QA 3CIKA 4HB2B 2RGNB 1LB1A 2Z4DA 4YONA 4EJNA 4L1RA 4D6WA 1BTNA 2MFQA 2YSZA 3GYOA 1EAZA 2N23A 4DXAB 2COCA 4CHMA 3VIAA 5JP4A 1M7EA 4HDOA 5I2MA 1WJ1A 1FB8A 3PZDA 3ZDTA 4HHVA 2EJ8A 2P0DA 3F5RA 2QKMA 3A8QA 3FM8C 3RCPA 5KQ4A 1MAIA 5C5BB 1W1DA 5C5BA 4NY0A 2QKLA 3DCXA 2YT0A 1W1GA 4GXBA 2YS1A 1ZC3B 3HSAA 1W1HA 2LOZA 2IYBA 4QJ4B 4B6HA 2PZ1A 4PNKA 1FHOA 1MK7B 4DBBA 1J19A 2Z59A 1WGQA 5D3XA 2VSZA 1H10A 1H4RA 2DHJA 1WJMA 2LULA 2N0YA 2G35A 2NMBA 2P0FA 4ZRJA 5HE3A 2XQNM 3PP2A 2HTHB 2Z0OA 2J59M 2RLOA 4ZRKA 1NTVA
chains in the Genus database with same CATH topology
3HW2B 5D3VA 3ZVRA 2KGXB 2MDXA 2JP2A 4TYZA 2K2UA 1DBHA 3WA0A 3LJUX 2D4QA 1Z87A 2MKRA 5KCVA 4DX8A 3QBVB 3P6AA 2RUKB 4HB4B 2GCJA 5KQ1A 2ZPYA 2DLWA 2UZSA 3TFMA 2DYQA 3F0WA 1J0WA 1UEFA 1N3HA 1NI2A 3U7DA 3SO6A 2EMSA 1PLSA 1V5UA 3PG7A 5C79A 1FGYA 1V5MA 1TXDA 1BWNA 3AU4A 3G9WA 1TJ6A 1QQGA 1P6SA 2MWNB 2Z0PA 1FAOA 1FHWA 4HATB 1IRSA 2X18A 2CY4A 4YL8A 2DKQA 1RJ2A 3ULBA 3DXEA 3ML4A 1MIZB 4A6FA 2ROZB 1LW3A 3QWMA 2D9WA 1RRPB 1GG3A 5C6RA 2LG1A 4A6HA 1X1GA 5DH9B 2VKIA 4HB0B 1XX0A 2DTCA 1X11A 2R09A 4NSWA 5LOPB 1SHCA 2D9ZA 1WI1A 4KHAA 3WYFB 3D8FA 5GOWB 3ODWA 2I5FA 1KZ7A 1GC7A 3PVWA 2YS5A 1V61A 3SNHA 5JLJB 2KUPA 1U29A 3DXDA 2UZRA 2DA0A 2FJLA 2IFSA 1Y5OA 2Y8FA 5FI1A 2M14A 5D27A 3TCAA 3MDBC 3AU5A 3U8ZA 5CLQB 1XODA 3MPXA 1DROA 1FOEA 4CYEA 2W2WA 1UNRA 5LONB 3HQCA 1MK9B 4IFSA 1ZM0A 2RSGA 2YS3A 2E2XA 3KZ1A 1MPHA 4Z2NA 2ELAA 4KHBB 1FHXA 4TKNA 1B55A 5C16A 2Q13A 2W2XD 4F7UP 5DI9B 2ELBA 1UNQA 2D10A 2NZ8B 4MK0A 3D8DA 2DX1A 4KVGB 4GMXB 4K81A 3TO1A 1UPQA 2DKPA 1XCGA 3ODXA 2AL6A 3QIJA 1V88A 2K00A 1UPRA 4IOYX 1ZC4B 1WGUA 1V89A 3DXCA 2Y7BA 3ODOA 4HDQA 2BCJA 2D9YA 2LOXA 3PSCA 1U5GA 1U2BA 3V5WA 4L6EA 4Z2MB 5D3YA 4XWXA 3KRWA 3FEHA 4IAPA 3T06A 1ZVRA 3PVUA 2I5CA 1PFJA 1DYNA 1X1FA 3KSYA 3TW1A 2J0KA 3TVVA 4C0AA 3SV1A 4GPTB 2YRYA 2D11A 5DIFB 3SUZA 2EMTA 2DHIA 1U5FA 3FSSA 1XKEA 1K5DB 1QC6A 1SGHA 3A8PA 4A5KA 2CODA 5HE2A 1AWEA 1DDMA 4Y94A 3GYPA 5JHHA 3PVLA 2AEHA 4EKUA 4BBKA 4K2OA 4EMOA 2R0DA 3NSUA 2H7DA 4H8SA 3UZTA 2W2XC 2CAYA 1NTYA 2DFKA 2D9XA 3N7CA 2ADZA 3BJIA 1GC6A 4HAXB 1MIXA 1M7RA 3O96A 2RVBB 1XD4A 1DDWA 3D8EA 3PEGA 2YF0A 2UVMA 1KI1B 2DX5A 5HE1A 2LYDA 2OTXA 2DHKA 4F7GA 2ROVA 3X23A 3ULCA 1U27A 4GZUA 2YT1A 1P5TA 2OQBA 1E5WA 4K17A 2J0MA 1K5GB 5J3QA 2Z0QA 1FGZA 5FI0A 1ZSQA 1U5EA 4HAZB 1BTKA 5J3YA 4MT7A 5DHFB 2GJYA 2V76A 1BAKA 2LKOA 4A6KA 5J3TA 4HAUB 5D3WA 5L81A 1Q67A 2I1KA 2D9VA 4ZRIA 1I2HA 2GCLA 3IVFA 4WVFB 4D0NB 1I7AA 1EVHA 1Y19B 3M1IB 4GMVA 2KCJA 1TQZA 3VOQA 4MY6A 1ISNA 1UNPA 1V5PA 5EFXA 2Y8GA 2J0JA 4WJ7A 2COAA 3BINA 4K2PA 1KZGA 1X05A 5HE0A 3P7ZA 1DDVA 1OMWA 3HK0A 1X86A 4KAXB 2M38A 2CY5A 4HAVB 2CRFA 4WSFA 4DX90 3CXBB 2H7EA 2DYNA 4F7HA 2P8VA 1WG7A 2COFA 3AJ4A 1U5DA 2I1JA 2EC1A 1OQNA 5DHAB 1EGXA 2HE7A 2DN6A 2VRWB 3KY9A 4PQ0A 1AQCA 3A98B 3OANA 1XR0B 4HB3B 5CLLB 1OY2A 3KRXA 2GS0A 5JHGA 1WVHA 4GN1A 2K2JA 1PMSA 1EF1A 4HAWB 2L1CA 4A6FB 1P3RA 4P7IA 4HAYB 2YVCA 4CHJA 3SYXA 2P0HA 1MKEA 1NU2A 2RNRB 4KHOA 2L2IA 2D2QA 3CIKA 4HB2B 2RGNB 1LB1A 4YONA 4EJNA 1BTNA 2MFQA 2YSZA 3GYOA 1EAZA 2N23A 4DXAB 2COCA 4CHMA 3VIAA 5JP4A 1M7EA 4HDOA 1WJ1A 1FB8A 3PZDA 3ZDTA 4HHVA 2EJ8A 2P0DA 3F5RA 2QKMA 3A8QA 3FM8C 3RCPA 5KQ4A 1MAIA 5C5BB 1W1DA 5C5BA 4NY0A 2QKLA 2YT0A 1W1GA 4GXBA 2YS1A 1ZC3B 1W1HA 2LOZA 2IYBA 4B6HA 2PZ1A 4PNKA 1FHOA 1MK7B 4DBBA 1J19A 5D3XA 1WGQA 2VSZA 1H10A 1H4RA 2DHJA 1WJMA 2LULA 2N0YA 2G35A 2NMBA 2P0FA 4ZRJA 5HE3A 2XQNM 3PP2A 2HTHB 2Z0OA 2J59M 2RLOA 4ZRKA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW2 B;  5D3V A;  3ZVR A;  2KGX B;  2MDX A;  2JP2 A;  4TYZ A;  2K2U A;  1DBH A;  3WA0 A;  3LJU X;  2D4Q A;  1Z87 A;  2MKR A;  5KCV A;  4DX8 A;  3QBV B;  3P6A A;  2RUK B;  4HB4 B;  2GCJ A;  5KQ1 A;  2ZPY A;  2DLW A;  2UZS A;  3TFM A;  2DYQ A;  3F0W A;  1J0W A;  1UEF A;  1N3H A;  1NI2 A;  3U7D A;  3SO6 A;  2EMS A;  1PLS A;  1V5U A;  3PG7 A;  5C79 A;  1FGY A;  1V5M A;  1TXD A;  1BWN A;  3AU4 A;  3G9W A;  1TJ6 A;  1QQG A;  1P6S A;  2MWN B;  2Z0P A;  1FAO A;  1FHW A;  4HAT B;  1IRS A;  2X18 A;  2CY4 A;  4YL8 A;  2DKQ A;  1RJ2 A;  3ULB A;  3DXE A;  3ML4 A;  1MIZ B;  4A6F A;  2ROZ B;  1LW3 A;  3QWM A;  2D9W A;  1RRP B;  1GG3 A;  5C6R A;  2LG1 A;  4A6H A;  1X1G A;  5DH9 B;  2VKI A;  4HB0 B;  1XX0 A;  2DTC A;  1X11 A;  2R09 A;  4NSW A;  5LOP B;  1SHC A;  2D9Z A;  1WI1 A;  4KHA A;  3WYF B;  3D8F A;  5GOW B;  3ODW A;  2I5F A;  1KZ7 A;  1GC7 A;  3PVW A;  2YS5 A;  1V61 A;  3SNH A;  5JLJ B;  2KUP A;  1U29 A;  3DXD A;  2UZR A;  2DA0 A;  2FJL A;  2IFS A;  1Y5O A;  2Y8F A;  5FI1 A;  2M14 A;  5D27 A;  3TCA A;  3MDB C;  3AU5 A;  3U8Z A;  5CLQ B;  1XOD A;  3MPX A;  1DRO A;  1FOE A;  4CYE A;  2W2W A;  1UNR A;  5LON B;  3HQC A;  1MK9 B;  4IFS A;  1ZM0 A;  2RSG A;  2YS3 A;  2E2X A;  3KZ1 A;  1MPH A;  4Z2N A;  2ELA A;  4KHB B;  1FHX A;  4TKN A;  1B55 A;  5C16 A;  2Q13 A;  2W2X D;  4F7U P;  5DI9 B;  2ELB A;  1UNQ A;  2D10 A;  2NZ8 B;  4MK0 A;  3D8D A;  2DX1 A;  4KVG B;  4GMX B;  4K81 A;  3TO1 A;  1UPQ A;  2DKP A;  1XCG A;  3ODX A;  2AL6 A;  3QIJ A;  1V88 A;  2K00 A;  1UPR A;  4IOY X;  1ZC4 B;  1WGU A;  1V89 A;  3DXC A;  2Y7B A;  3ODO A;  4HDQ A;  2BCJ A;  2D9Y A;  2LOX A;  3PSC A;  1U5G A;  1U2B A;  3V5W A;  4L6E A;  4Z2M B;  5D3Y A;  4XWX A;  3KRW A;  3FEH A;  4IAP A;  3T06 A;  1ZVR A;  3PVU A;  2I5C A;  1PFJ A;  1DYN A;  1X1F A;  3KSY A;  3TW1 A;  2J0K A;  3TVV A;  4C0A A;  3SV1 A;  4GPT B;  2YRY A;  2D11 A;  5DIF B;  3SUZ A;  2EMT A;  2DHI A;  1U5F A;  3FSS A;  1XKE A;  1K5D B;  1QC6 A;  1SGH A;  3A8P A;  4A5K A;  2COD A;  5HE2 A;  1AWE A;  1DDM A;  4Y94 A;  3GYP A;  5JHH A;  3PVL A;  2AEH A;  4EKU A;  4BBK A;  4K2O A;  4EMO A;  2R0D A;  3NSU A;  2H7D A;  4H8S A;  3UZT A;  2W2X C;  2CAY A;  1NTY A;  2DFK A;  2D9X A;  3N7C A;  2ADZ A;  3BJI A;  1GC6 A;  4HAX B;  1MIX A;  1M7R A;  3O96 A;  2RVB B;  1XD4 A;  1DDW A;  3D8E A;  3PEG A;  2YF0 A;  2UVM A;  1KI1 B;  2DX5 A;  5HE1 A;  2LYD A;  2OTX A;  2DHK A;  4F7G A;  2ROV A;  3X23 A;  3ULC A;  1U27 A;  4GZU A;  2YT1 A;  1P5T A;  2OQB A;  1E5W A;  4K17 A;  2J0M A;  1K5G B;  5J3Q A;  2Z0Q A;  1FGZ A;  5FI0 A;  1ZSQ A;  1U5E A;  4HAZ B;  1BTK A;  5J3Y A;  4MT7 A;  5DHF B;  2GJY A;  2V76 A;  1BAK A;  2LKO A;  4A6K A;  5J3T A;  4HAU B;  5D3W A;  5L81 A;  1Q67 A;  2I1K A;  2D9V A;  4ZRI A;  1I2H A;  2GCL A;  3IVF A;  4WVF B;  4D0N B;  1I7A A;  1EVH A;  1Y19 B;  3M1I B;  4GMV A;  2KCJ A;  1TQZ A;  3VOQ A;  4MY6 A;  1ISN A;  1UNP A;  1V5P A;  5EFX A;  2Y8G A;  2J0J A;  4WJ7 A;  2COA A;  3BIN A;  4K2P A;  1KZG A;  1X05 A;  5HE0 A;  3P7Z A;  1DDV A;  1OMW A;  3HK0 A;  1X86 A;  4KAX B;  2M38 A;  2CY5 A;  4HAV B;  2CRF A;  4WSF A;  4DX9 0;  3CXB B;  2H7E A;  2DYN A;  4F7H A;  2P8V A;  1WG7 A;  2COF A;  3AJ4 A;  1U5D A;  2I1J A;  2EC1 A;  1OQN A;  5DHA B;  1EGX A;  2HE7 A;  2DN6 A;  2VRW B;  3KY9 A;  4PQ0 A;  1AQC A;  3A98 B;  3OAN A;  1XR0 B;  4HB3 B;  5CLL B;  1OY2 A;  3KRX A;  2GS0 A;  5JHG A;  1WVH A;  4GN1 A;  2K2J A;  1PMS A;  1EF1 A;  4HAW B;  2L1C A;  4A6F B;  1P3R A;  4P7I A;  4HAY B;  2YVC A;  4CHJ A;  3SYX A;  2P0H A;  1MKE A;  1NU2 A;  2RNR B;  4KHO A;  2L2I A;  2D2Q A;  3CIK A;  4HB2 B;  2RGN B;  1LB1 A;  4YON A;  4EJN A;  1BTN A;  2MFQ A;  2YSZ A;  3GYO A;  1EAZ A;  2N23 A;  4DXA B;  2COC A;  4CHM A;  3VIA A;  5JP4 A;  1M7E A;  4HDO A;  1WJ1 A;  1FB8 A;  3PZD A;  3ZDT A;  4HHV A;  2EJ8 A;  2P0D A;  3F5R A;  2QKM A;  3A8Q A;  3FM8 C;  3RCP A;  5KQ4 A;  1MAI A;  5C5B B;  1W1D A;  5C5B A;  4NY0 A;  2QKL A;  2YT0 A;  1W1G A;  4GXB A;  2YS1 A;  1ZC3 B;  1W1H A;  2LOZ A;  2IYB A;  4B6H A;  2PZ1 A;  4PNK A;  1FHO A;  1MK7 B;  4DBB A;  1J19 A;  5D3X A;  1WGQ A;  2VSZ A;  1H10 A;  1H4R A;  2DHJ A;  1WJM A;  2LUL A;  2N0Y A;  2G35 A;  2NMB A;  2P0F A;  4ZRJ A;  5HE3 A;  2XQN M;  3PP2 A;  2HTH B;  2Z0O A;  2J59 M;  2RLO A;  4ZRK A;  1NTV A; 
#chains in the Genus database with same CATH topology
 3HW2 B;  5D3V A;  3ZVR A;  2KGX B;  2MDX A;  2JP2 A;  4TYZ A;  2K2U A;  4CSQ A;  1DBH A;  3NWF A;  3WA0 A;  3LJU X;  2D4Q A;  1Z87 A;  2MKR A;  5KCV A;  4DX8 A;  3QBV B;  4QJ3 B;  3P6A A;  2RUK B;  4HB4 B;  2GCJ A;  5KQ1 A;  2KIE A;  2ZPY A;  2DLW A;  2UZS A;  3TFM A;  2DYQ A;  3F0W A;  1J0W A;  1UEF A;  5IRS A;  1N3H A;  1NI2 A;  3U7D A;  3SO6 A;  2EMS A;  1PLS A;  1V5U A;  3PG7 A;  5C79 A;  1FGY A;  1V5M A;  1TXD A;  1BWN A;  3AU4 A;  3G9W A;  1TJ6 A;  1QQG A;  1P6S A;  2MWN B;  2Z0P A;  1FAO A;  1FHW A;  4HAT B;  1IRS A;  2X18 A;  2CY4 A;  4YL8 A;  2DKQ A;  1RJ2 A;  3ULB A;  2YT2 A;  2KR0 A;  3DXE A;  3ML4 A;  1MIZ B;  1ZYI A;  4A6F A;  2ROZ B;  1LW3 A;  3QWM A;  2D9W A;  1RRP B;  1GG3 A;  5C6R A;  3NWA A;  2LG1 A;  4A6H A;  1X1G A;  5DH9 B;  2VKI A;  4HB0 B;  1XX0 A;  2DTC A;  1X11 A;  3B77 A;  2R09 A;  4NSW A;  5LOP B;  1SHC A;  2D9Z A;  1WI1 A;  4KHA A;  3WYF B;  3D8F A;  5GOW B;  3ODW A;  2I5F A;  1KZ7 A;  1GC7 A;  3PVW A;  2R2Y A;  2YS5 A;  1V61 A;  3SNH A;  5JLJ B;  2KUP A;  1U29 A;  3DXD A;  2UZR A;  2DA0 A;  2FJL A;  2IFS A;  1Y5O A;  2Y8F A;  5FI1 A;  2M14 A;  5D27 A;  3TCA A;  3MDB C;  3AU5 A;  3U8Z A;  5CLQ B;  1XOD A;  3MPX A;  1DRO A;  1FOE A;  4CYE A;  2W2W A;  1UNR A;  5LON B;  3HQC A;  1MK9 B;  4IFS A;  1ZM0 A;  2RSG A;  2YS3 A;  2E2X A;  3KZ1 A;  1MPH A;  4Z2N A;  2ELA A;  5LG4 B;  2FJU B;  4KHB B;  1FHX A;  4TKN A;  1B55 A;  5C16 A;  2Q13 A;  2W2X D;  4F7U P;  5DI9 B;  2ELB A;  1UNQ A;  2D10 A;  2NZ8 B;  4MK0 A;  3D8D A;  2DX1 A;  4KVG B;  4GMX B;  4K81 A;  3TO1 A;  1UPQ A;  2DKP A;  1XCG A;  3ODX A;  2AL6 A;  3QIJ A;  1V88 A;  2K00 A;  1UPR A;  4IOY X;  1ZC4 B;  4GNK B;  1WGU A;  1V89 A;  3DXC A;  2Y7B A;  3ODO A;  4HDQ A;  2BCJ A;  2D9Y A;  2LOX A;  3PSC A;  1U5G A;  1U2B A;  2GUM A;  3V5W A;  4L6E A;  4Z2M B;  5D3Y A;  4XWX A;  3KRW A;  3FEH A;  3T06 A;  4IAP A;  1ZVR A;  3PVU A;  2I5C A;  1PFJ A;  1DYN A;  1X1F A;  3KSY A;  3TW1 A;  2J0K A;  3TVV A;  4C0A A;  3HIE A;  3SV1 A;  4GPT B;  2YRY A;  2D11 A;  3OHM B;  5DIF B;  3SUZ A;  2EMT A;  2DHI A;  1U5F A;  3FSS A;  1XKE A;  2Z13 A;  1K5D B;  1QC6 A;  4HSI A;  1SGH A;  3A8P A;  4A5K A;  2COD A;  5HE2 A;  1AWE A;  3FVC A;  1DDM A;  4Y94 A;  3GYP A;  5JHH A;  3PVL A;  2AEH A;  4EKU A;  4BBK A;  4K2O A;  4EMO A;  2R0D A;  3NSU A;  2H7D A;  4H8S A;  3UZT A;  2NBV A;  2W2X C;  2CAY A;  1NTY A;  2DFK A;  2D9X A;  3N7C A;  2ADZ A;  3A58 A;  3BJI A;  1GC6 A;  4HAX B;  1MIX A;  1M7R A;  3O96 A;  2RVB B;  1XD4 A;  1DDW A;  3D8E A;  3PEG A;  2YF0 A;  2UVM A;  1KI1 B;  2DX5 A;  2KIG A;  5HE1 A;  2LYD A;  2OTX A;  2ZKM X;  2DHK A;  4F7G A;  2ROV A;  3X23 A;  3ULC A;  1U27 A;  4OT1 A;  4GZU A;  2YT1 A;  1P5T A;  2OQB A;  1E5W A;  4K17 A;  2J0M A;  1K5G B;  5J3Q A;  2Z0Q A;  1FGZ A;  5M4Y B;  5FI0 A;  1ZSQ A;  1U5E A;  4HAZ B;  1BTK A;  5J3Y A;  4MT7 A;  5DHF B;  2GJY A;  2V76 A;  1BAK A;  2LKO A;  4A6K A;  5J3T A;  4HAU B;  5D3W A;  5L81 A;  4DIX A;  1Q67 A;  2I1K A;  2D9V A;  4ZRI A;  1I2H A;  2GCL A;  3IVF A;  2RRF A;  4WVF B;  4D0N B;  1I7A A;  1EVH A;  1Y19 B;  5I2S A;  3M1I B;  4GMV A;  2KCJ A;  1T77 A;  1TQZ A;  3VOQ A;  4OSN A;  4MY6 A;  1ISN A;  1UNP A;  1V5P A;  5EFX A;  4KHB A;  2Y8G A;  2J0J A;  4WJ7 A;  2COA A;  3BIN A;  4K2P A;  1KZG A;  1X05 A;  3NW8 A;  5HE0 A;  3P7Z A;  1DDV A;  1OMW A;  3HK0 A;  1X86 A;  4KAX B;  4QXA B;  2M38 A;  2CY5 A;  4HAV B;  2CRF A;  4WSF A;  4DX9 0;  3CXB B;  2H7E A;  2DYN A;  2Z14 A;  4F7H A;  2P8V A;  1WG7 A;  2COF A;  3AJ4 A;  1U5D A;  2I1J A;  2EC1 A;  1OQN A;  5DHA B;  1EGX A;  2HE7 A;  1MI1 A;  2DN6 A;  2VRW B;  3KY9 A;  4GOU A;  4PQ0 A;  1AQC A;  3A98 B;  3OAN A;  3NWD A;  1XR0 B;  4HB3 B;  5CLL B;  1OY2 A;  3KRX A;  2GS0 A;  5JHG A;  1WVH A;  4GN1 A;  2K2J A;  3U12 A;  1PMS A;  1EF1 A;  4HAW B;  2L1C A;  4A6F B;  1P3R A;  2K49 A;  4P7I A;  4HAY B;  4QJ5 B;  2YVC A;  4CHJ A;  3SYX A;  2P0H A;  1MKE A;  2KUQ A;  1NU2 A;  2RNR B;  4KHO A;  2K8E A;  2L2I A;  2D2Q A;  3CIK A;  4HB2 B;  2RGN B;  1LB1 A;  2Z4D A;  4YON A;  4EJN A;  4L1R A;  4D6W A;  1BTN A;  2MFQ A;  2YSZ A;  3GYO A;  1EAZ A;  2N23 A;  4DXA B;  2COC A;  4CHM A;  3VIA A;  5JP4 A;  1M7E A;  4HDO A;  5I2M A;  1WJ1 A;  1FB8 A;  3PZD A;  3ZDT A;  4HHV A;  2EJ8 A;  2P0D A;  3F5R A;  2QKM A;  3A8Q A;  3FM8 C;  3RCP A;  5KQ4 A;  1MAI A;  5C5B B;  1W1D A;  5C5B A;  4NY0 A;  2QKL A;  3DCX A;  2YT0 A;  1W1G A;  4GXB A;  2YS1 A;  1ZC3 B;  3HSA A;  1W1H A;  2LOZ A;  2IYB A;  4QJ4 B;  4B6H A;  2PZ1 A;  4PNK A;  1FHO A;  1MK7 B;  4DBB A;  1J19 A;  2Z59 A;  1WGQ A;  5D3X A;  2VSZ A;  1H10 A;  1H4R A;  2DHJ A;  1WJM A;  2LUL A;  2N0Y A;  2G35 A;  2NMB A;  2P0F A;  4ZRJ A;  5HE3 A;  2XQN M;  3PP2 A;  2HTH B;  2Z0O A;  2J59 M;  2RLO A;  4ZRK A;  1NTV A; 
#chains in the Genus database with same CATH homology
 3HW2 B;  5D3V A;  3ZVR A;  2KGX B;  2MDX A;  2JP2 A;  4TYZ A;  2K2U A;  1DBH A;  3WA0 A;  3LJU X;  2D4Q A;  1Z87 A;  2MKR A;  5KCV A;  4DX8 A;  3QBV B;  3P6A A;  2RUK B;  4HB4 B;  2GCJ A;  5KQ1 A;  2ZPY A;  2DLW A;  2UZS A;  3TFM A;  2DYQ A;  3F0W A;  1J0W A;  1UEF A;  1N3H A;  1NI2 A;  3U7D A;  3SO6 A;  2EMS A;  1PLS A;  1V5U A;  3PG7 A;  5C79 A;  1FGY A;  1V5M A;  1TXD A;  1BWN A;  3AU4 A;  3G9W A;  1TJ6 A;  1QQG A;  1P6S A;  2MWN B;  2Z0P A;  1FAO A;  1FHW A;  4HAT B;  1IRS A;  2X18 A;  2CY4 A;  4YL8 A;  2DKQ A;  1RJ2 A;  3ULB A;  3DXE A;  3ML4 A;  1MIZ B;  4A6F A;  2ROZ B;  1LW3 A;  3QWM A;  2D9W A;  1RRP B;  1GG3 A;  5C6R A;  2LG1 A;  4A6H A;  1X1G A;  5DH9 B;  2VKI A;  4HB0 B;  1XX0 A;  2DTC A;  1X11 A;  2R09 A;  4NSW A;  5LOP B;  1SHC A;  2D9Z A;  1WI1 A;  4KHA A;  3WYF B;  3D8F A;  5GOW B;  3ODW A;  2I5F A;  1KZ7 A;  1GC7 A;  3PVW A;  2YS5 A;  1V61 A;  3SNH A;  5JLJ B;  2KUP A;  1U29 A;  3DXD A;  2UZR A;  2DA0 A;  2FJL A;  2IFS A;  1Y5O A;  2Y8F A;  5FI1 A;  2M14 A;  5D27 A;  3TCA A;  3MDB C;  3AU5 A;  3U8Z A;  5CLQ B;  1XOD A;  3MPX A;  1DRO A;  1FOE A;  4CYE A;  2W2W A;  1UNR A;  5LON B;  3HQC A;  1MK9 B;  4IFS A;  1ZM0 A;  2RSG A;  2YS3 A;  2E2X A;  3KZ1 A;  1MPH A;  4Z2N A;  2ELA A;  4KHB B;  1FHX A;  4TKN A;  1B55 A;  5C16 A;  2Q13 A;  2W2X D;  4F7U P;  5DI9 B;  2ELB A;  1UNQ A;  2D10 A;  2NZ8 B;  4MK0 A;  3D8D A;  2DX1 A;  4KVG B;  4GMX B;  4K81 A;  3TO1 A;  1UPQ A;  2DKP A;  1XCG A;  3ODX A;  2AL6 A;  3QIJ A;  1V88 A;  2K00 A;  1UPR A;  4IOY X;  1ZC4 B;  1WGU A;  1V89 A;  3DXC A;  2Y7B A;  3ODO A;  4HDQ A;  2BCJ A;  2D9Y A;  2LOX A;  3PSC A;  1U5G A;  1U2B A;  3V5W A;  4L6E A;  4Z2M B;  5D3Y A;  4XWX A;  3KRW A;  3FEH A;  4IAP A;  3T06 A;  1ZVR A;  3PVU A;  2I5C A;  1PFJ A;  1DYN A;  1X1F A;  3KSY A;  3TW1 A;  2J0K A;  3TVV A;  4C0A A;  3SV1 A;  4GPT B;  2YRY A;  2D11 A;  5DIF B;  3SUZ A;  2EMT A;  2DHI A;  1U5F A;  3FSS A;  1XKE A;  1K5D B;  1QC6 A;  1SGH A;  3A8P A;  4A5K A;  2COD A;  5HE2 A;  1AWE A;  1DDM A;  4Y94 A;  3GYP A;  5JHH A;  3PVL A;  2AEH A;  4EKU A;  4BBK A;  4K2O A;  4EMO A;  2R0D A;  3NSU A;  2H7D A;  4H8S A;  3UZT A;  2W2X C;  2CAY A;  1NTY A;  2DFK A;  2D9X A;  3N7C A;  2ADZ A;  3BJI A;  1GC6 A;  4HAX B;  1MIX A;  1M7R A;  3O96 A;  2RVB B;  1XD4 A;  1DDW A;  3D8E A;  3PEG A;  2YF0 A;  2UVM A;  1KI1 B;  2DX5 A;  5HE1 A;  2LYD A;  2OTX A;  2DHK A;  4F7G A;  2ROV A;  3X23 A;  3ULC A;  1U27 A;  4GZU A;  2YT1 A;  1P5T A;  2OQB A;  1E5W A;  4K17 A;  2J0M A;  1K5G B;  5J3Q A;  2Z0Q A;  1FGZ A;  5FI0 A;  1ZSQ A;  1U5E A;  4HAZ B;  1BTK A;  5J3Y A;  4MT7 A;  5DHF B;  2GJY A;  2V76 A;  1BAK A;  2LKO A;  4A6K A;  5J3T A;  4HAU B;  5D3W A;  5L81 A;  1Q67 A;  2I1K A;  2D9V A;  4ZRI A;  1I2H A;  2GCL A;  3IVF A;  4WVF B;  4D0N B;  1I7A A;  1EVH A;  1Y19 B;  3M1I B;  4GMV A;  2KCJ A;  1TQZ A;  3VOQ A;  4MY6 A;  1ISN A;  1UNP A;  1V5P A;  5EFX A;  2Y8G A;  2J0J A;  4WJ7 A;  2COA A;  3BIN A;  4K2P A;  1KZG A;  1X05 A;  5HE0 A;  3P7Z A;  1DDV A;  1OMW A;  3HK0 A;  1X86 A;  4KAX B;  2M38 A;  2CY5 A;  4HAV B;  2CRF A;  4WSF A;  4DX9 0;  3CXB B;  2H7E A;  2DYN A;  4F7H A;  2P8V A;  1WG7 A;  2COF A;  3AJ4 A;  1U5D A;  2I1J A;  2EC1 A;  1OQN A;  5DHA B;  1EGX A;  2HE7 A;  2DN6 A;  2VRW B;  3KY9 A;  4PQ0 A;  1AQC A;  3A98 B;  3OAN A;  1XR0 B;  4HB3 B;  5CLL B;  1OY2 A;  3KRX A;  2GS0 A;  5JHG A;  1WVH A;  4GN1 A;  2K2J A;  1PMS A;  1EF1 A;  4HAW B;  2L1C A;  4A6F B;  1P3R A;  4P7I A;  4HAY B;  2YVC A;  4CHJ A;  3SYX A;  2P0H A;  1MKE A;  1NU2 A;  2RNR B;  4KHO A;  2L2I A;  2D2Q A;  3CIK A;  4HB2 B;  2RGN B;  1LB1 A;  4YON A;  4EJN A;  1BTN A;  2MFQ A;  2YSZ A;  3GYO A;  1EAZ A;  2N23 A;  4DXA B;  2COC A;  4CHM A;  3VIA A;  5JP4 A;  1M7E A;  4HDO A;  1WJ1 A;  1FB8 A;  3PZD A;  3ZDT A;  4HHV A;  2EJ8 A;  2P0D A;  3F5R A;  2QKM A;  3A8Q A;  3FM8 C;  3RCP A;  5KQ4 A;  1MAI A;  5C5B B;  1W1D A;  5C5B A;  4NY0 A;  2QKL A;  2YT0 A;  1W1G A;  4GXB A;  2YS1 A;  1ZC3 B;  1W1H A;  2LOZ A;  2IYB A;  4B6H A;  2PZ1 A;  4PNK A;  1FHO A;  1MK7 B;  4DBB A;  1J19 A;  5D3X A;  1WGQ A;  2VSZ A;  1H10 A;  1H4R A;  2DHJ A;  1WJM A;  2LUL A;  2N0Y A;  2G35 A;  2NMB A;  2P0F A;  4ZRJ A;  5HE3 A;  2XQN M;  3PP2 A;  2HTH B;  2Z0O A;  2J59 M;  2RLO A;  4ZRK A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...