2DHIA

Solution structure of the ph domain of evectin-2 from mouse
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GSSGSSGFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Solution structure of the PH domain of Evectin-2 from mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhiA00
1E5WA 2QKMA 1ZSQA 4L6EA 2QKLA 2AL6A 3PG7A 1XD4A 3ODOA 4GMXB 2E2XA 3P6AA 4P7IA 2J0MA 2COAA 2JP2A 1W1GA 1TJ6A 3CXBB 2HE7A 4GXBA 5J3YA 2BCJA 3TVVA 4CHMA 5CLLB 2D9ZA 3ULBA 2D4QA 3HK0A 1FGZA 2D9YA 3ML4A 3HW2B 1MPHA 3D8FA 4F7UP 1KZGA 2LKOA 1W1HA 1K5DB 2DHKA 2J0KA 4YONA 2Y8GA 1V89A 4A6HA 2K2UA 3ZVRA 2EMSA 2GCLA 2D10A 3T06A 1X86A 3D8EA 4KVGB 2HTHB 3KSYA 5J3QA 4WSFA 1P6SA 2DKQA 4HATB 1MAIA 2DX5A 1J19A 2DX1A 1PMSA 2VKIA 4Z2MB 5L81A 4DXAB 4HAYB 1SHCA 3PEGA 3TW1A 1UPRA 3MDBC 5C16A 1Y19B 1B55A 5JP4A 3KRWA 3SV1A 2CODA 5DHAB 4K2PA 1FHOA 2EJ8A 1NTYA 2I1KA 3BJIA 3QIJA 4ZRKA 1WG7A 1QQGA 1GC6A 4KAXB 2P0DA 2UZRA 3TFMA 4NY0A 4EKUA 2R09A 3QBVB 4K81A 2ELBA 2Y8FA 1RJ2A 4WJ7A 2Z0QA 1BAKA 3FEHA 3HQCA 2ADZA 3LJUX 2KGXB 2ZPYA 3TO1A 1UNRA 4TKNA 4MT7A 1DDVA 3F5RA 1X11A 1V88A 5FI1A 2COCA 4HHVA 2MWNB 2J59M 1ZC3B 3N7CA 1FOEA 1Q67A 1QC6A 1XR0B 1EGXA 1LW3A 2RUKB 1M7EA 2EMTA 5HE3A 1DROA 2IYBA 2N23A 2D9VA 2MKRA 4HAZB 1M7RA 2ELAA 3PVLA 1FHWA 1PFJA 1J0WA 2GJYA 1H10A 1OY2A 3MPXA 4BBKA 4CYEA 1U5EA 1GG3A 2FJLA 1SGHA 5JHGA 1LB1A 2VRWB 1MKEA 2DA0A 1MIZB 2PZ1A 2LULA 4D0NB 3AU4A 1FGYA 2R0DA 3TCAA 3ZDTA 2CY5A 2DHIA 1UPQA 4IAPA 1MIXA 1FAOA 1WGUA 1BTNA 1WI1A 3DXDA 2W2XC 2D11A 3OANA 1ISNA 2UVMA 2DN6A 4IFSA 3IVFA 2GS0A 1DYNA 3AU5A 4NSWA 4EMOA 2GCJA 1XCGA 3O96A 4GPTB 2DKPA 5D3VA 1Z87A 4TYZA 4YL8A 5LONB 2LG1A 3PSCA 2DHJA 3A8PA 1BWNA 3U8ZA 1UNQA 3G9WA 2K00A 3PVWA 1BTKA 5GOWB 2NZ8B 1WVHA 2DTCA 2X18A 1TQZA 4DX90 3CIKA 3V5WA 5C5BA 3BINA 2XQNM 1ZC4B 3UZTA 3SNHA 3SUZA 2I1JA 1V5MA 4K17A 1WJ1A 1NTVA 1EVHA 1FHXA 1PLSA 5CLQB 2N0YA 2CAYA 2IFSA 5D3XA 2MFQA 4XWXA 2Z0PA 4WVFB 1DDWA 2ROZB 4A6KA 3PP2A 5JLJB 2NMBA 2OQBA 2YSZA 2Q13A 2RVBB 4PQ0A 2H7DA 2D9WA 4KHBB 5C5BB 3ULCA 3WYFB 2YF0A 2LYDA 1XX0A 2CRFA 2W2XD 1N3HA 1U2BA 5FI0A 3FSSA 4HAVB 1UNPA 3VOQA 1P5TA 4HDQA 4A5KA 5KQ4A 4HB0B 1GC7A 2UZSA 4HB3B 4KHOA 1KI1B 3FM8C 4HB2B 3A98B 3U7DA 2Y7BA 3DXCA 5KCVA 1I7AA 3M1IB 2P0HA 3SYXA 4Z2NA 5JHHA 1DBHA 3PVUA 3GYPA 5DI9B 5LOPB 1NU2A 4HAWB 2V76A 1IRSA 4MK0A 1MK7B 1MK9B 2CY4A 4A6FA 1X05A 3ODWA 2YS5A 3GYOA 2EC1A 3DXEA 5HE0A 1X1GA 2DFKA 5D3YA 2H7EA 3PZDA 2I5FA 2RNRB 5EFXA 4MY6A 1AQCA 3KY9A 3WA0A 3SO6A 4HAXB 4F7GA 1K5GB 2MDXA 5C6RA 1AWEA 3A8QA 4C0AA 2J0JA 2OTXA 2G35A 2K2JA 2RGNB 4HAUB 4A6FB 4DBBA 3D8DA 1U5FA 4PNKA 2D9XA 3F0WA 4ZRIA 4ZRJA 4DX8A 4EJNA 1XKEA 1I2HA 2KUPA 1U5GA 1KZ7A 5DH9B 2LOZA 4CHJA 3QWMA 4K2OA 1TXDA 2YRYA 1FB8A 5KQ1A 4HDOA 4GN1A 5J3TA 1V61A 1U27A 2LOXA 1U5DA 2YS1A 1WJMA 1XODA 2W2WA 4KHAA 1H4RA 1OMWA 4B6HA 3VIAA 1ZVRA 2DYNA 4GZUA 2M14A 2Z0OA 1DDMA 1V5PA 5DIFB 2VSZA 3ODXA 2AEHA 3KRXA 2RSGA 5C79A 2L2IA 3NSUA 1UEFA 3AJ4A 5HE2A 1EF1A 2D2QA 4H8SA 2I5CA 2YS3A 1X1FA 1RRPB 1WGQA 2ROVA 1U29A 1EAZA 1W1DA 3X23A 2RLOA 4GMVA 2DYQA 2P0FA 1V5UA 4Y94A 3P7ZA 1OQNA 1NI2A 3RCPA 4F7HA 1Y5OA 2P8VA 5D27A 5D3WA 4IOYX 2M38A 3KZ1A 2YT1A 2DLWA 2KCJA 4HB4B 2YVCA 2L1CA 2COFA 1ZM0A 5HE1A 5DHFB 1P3RA 2YT0A
chains in the Genus database with same CATH superfamily
1E5WA 2QKMA 1ZSQA 4L6EA 2YT2A 2QKLA 5LG4B 2AL6A 3PG7A 1XD4A 3ODOA 4GMXB 2E2XA 3P6AA 4P7IA 4CSQA 2J0MA 2COAA 2JP2A 1W1GA 3OHMB 1TJ6A 3CXBB 5IRSA 2HE7A 4GXBA 5J3YA 2BCJA 3TVVA 4CHMA 5CLLB 2D9ZA 3A58A 3ULBA 2D4QA 3HK0A 1FGZA 2D9YA 3ML4A 3HW2B 1MPHA 3D8FA 4F7UP 1KZGA 2LKOA 1W1HA 1K5DB 2DHKA 2J0KA 4YONA 2Y8GA 4HSIA 1V89A 4A6HA 2K2UA 3ZVRA 2EMSA 2GCLA 2D10A 3T06A 1X86A 3D8EA 4KVGB 2HTHB 3KSYA 5J3QA 5I2SA 4WSFA 1P6SA 2DKQA 4HATB 1MAIA 2DX5A 1J19A 2DX1A 1PMSA 2VKIA 4Z2MB 5L81A 4DXAB 4HAYB 1SHCA 3PEGA 3TW1A 1UPRA 3MDBC 5C16A 1Y19B 1B55A 2K8EA 5JP4A 3KRWA 3SV1A 2CODA 5DHAB 4K2PA 1FHOA 2EJ8A 1NTYA 2I1KA 3BJIA 3QIJA 4ZRKA 1WG7A 1QQGA 1GC6A 4KAXB 2P0DA 2UZRA 3TFMA 4NY0A 4EKUA 1ZYIA 2R09A 3QBVB 4K81A 2ELBA 2Y8FA 4OSNA 1RJ2A 4WJ7A 2Z0QA 1BAKA 3FEHA 3HQCA 2ADZA 3LJUX 2KGXB 2ZPYA 3TO1A 1UNRA 4TKNA 2KIGA 1DDVA 4MT7A 3F5RA 1X11A 3B77A 1V88A 5FI1A 2COCA 4HHVA 2KIEA 2MWNB 2J59M 1ZC3B 3N7CA 1FOEA 1Q67A 1QC6A 1XR0B 2Z59A 1EGXA 1LW3A 2RUKB 1M7EA 2EMTA 5HE3A 2Z4DA 1DROA 2K49A 2IYBA 2N23A 5M4YB 2D9VA 2MKRA 4OT1A 4HAZB 1M7RA 2ELAA 3PVLA 1FHWA 1PFJA 1J0WA 2GJYA 1H10A 1OY2A 3MPXA 4BBKA 2FJUB 3NW8A 4CYEA 1MI1A 1U5EA 1GG3A 2FJLA 1SGHA 5JHGA 2KUQA 1LB1A 2VRWB 1MKEA 2DA0A 4DIXA 1MIZB 2PZ1A 2LULA 4D0NB 3AU4A 1FGYA 2R0DA 3TCAA 2RRFA 3ZDTA 2CY5A 2DHIA 1UPQA 4IAPA 1MIXA 1FAOA 1WGUA 1BTNA 1WI1A 3DXDA 2W2XC 2D11A 3OANA 1ISNA 2UVMA 2DN6A 4IFSA 3IVFA 2GS0A 1DYNA 3AU5A 4NSWA 4EMOA 2GCJA 4QJ4B 4GOUA 1XCGA 3O96A 4GPTB 2DKPA 5D3VA 1Z87A 2GUMA 4TYZA 4YL8A 5LONB 2LG1A 3PSCA 2DHJA 3A8PA 1BWNA 3U8ZA 1UNQA 3G9WA 2K00A 3PVWA 1BTKA 5GOWB 2NZ8B 1WVHA 2DTCA 2X18A 1TQZA 4DX90 3CIKA 3V5WA 4KHBA 5C5BA 3BINA 2XQNM 1ZC4B 3UZTA 3SNHA 3SUZA 2I1JA 2R2YA 1V5MA 4K17A 1WJ1A 1NTVA 1EVHA 1FHXA 1PLSA 5CLQB 2N0YA 2CAYA 2IFSA 5D3XA 2MFQA 4XWXA 2Z0PA 4WVFB 1DDWA 2ROZB 4A6KA 3PP2A 5JLJB 2NMBA 2OQBA 2YSZA 2Q13A 2RVBB 4PQ0A 2H7DA 2D9WA 4KHBB 5C5BB 3ULCA 3WYFB 2YF0A 2LYDA 1XX0A 2CRFA 4QJ5B 2W2XD 1N3HA 1U2BA 5FI0A 3FSSA 4HAVB 1UNPA 3VOQA 4D6WA 1P5TA 4HDQA 4A5KA 5KQ4A 4HB0B 1GC7A 2UZSA 4HB3B 4KHOA 1KI1B 2NBVA 4L1RA 3FM8C 4HB2B 3A98B 3U7DA 2Y7BA 3DXCA 5KCVA 1I7AA 3M1IB 2P0HA 3SYXA 4Z2NA 5JHHA 1DBHA 3PVUA 3GYPA 5DI9B 5LOPB 1NU2A 4HAWB 2V76A 1IRSA 4MK0A 1MK7B 1MK9B 2CY4A 4A6FA 1X05A 3ODWA 2YS5A 3GYOA 2EC1A 3DXEA 5HE0A 1X1GA 2DFKA 5D3YA 2H7EA 3PZDA 2I5FA 2RNRB 5EFXA 4MY6A 2KR0A 1AQCA 3KY9A 3WA0A 3SO6A 4HAXB 3HIEA 4F7GA 2Z14A 1K5GB 2MDXA 5C6RA 4QJ3B 1AWEA 3A8QA 4C0AA 2J0JA 2OTXA 2G35A 2K2JA 2RGNB 4HAUB 4A6FB 4DBBA 3D8DA 1U5FA 4PNKA 2D9XA 3F0WA 3NWAA 3U12A 4ZRIA 4ZRJA 4DX8A 3NWFA 4EJNA 1XKEA 1I2HA 2KUPA 1U5GA 1KZ7A 5DH9B 2LOZA 4CHJA 3QWMA 4K2OA 1TXDA 2YRYA 1FB8A 5KQ1A 4HDOA 4GN1A 5J3TA 3HSAA 1V61A 4QXAB 1U27A 2LOXA 1U5DA 1T77A 2YS1A 1WJMA 1XODA 2W2WA 4KHAA 1H4RA 1OMWA 4B6HA 3VIAA 1ZVRA 2DYNA 4GZUA 2M14A 2Z0OA 1DDMA 1V5PA 5DIFB 2Z13A 3DCXA 2VSZA 3ODXA 2AEHA 3KRXA 3FVCA 2RSGA 5C79A 2L2IA 3NSUA 1UEFA 3AJ4A 5HE2A 1EF1A 2D2QA 4H8SA 2I5CA 2YS3A 1X1FA 1RRPB 1WGQA 2ROVA 1U29A 1EAZA 1W1DA 2ZKMX 2RLOA 3X23A 4GMVA 2DYQA 2P0FA 1V5UA 4Y94A 3P7ZA 1OQNA 3NWDA 5I2MA 1NI2A 3RCPA 4F7HA 1Y5OA 2P8VA 5D27A 5D3WA 4IOYX 2M38A 3KZ1A 4GNKB 2YT1A 2DLWA 2KCJA 4HB4B 2YVCA 2L1CA 2COFA 1ZM0A 5HE1A 5DHFB 1P3RA 2YT0A
chains in the Genus database with same CATH topology
1E5WA 2QKMA 1ZSQA 4L6EA 2QKLA 2AL6A 3PG7A 1XD4A 3ODOA 4GMXB 2E2XA 3P6AA 4P7IA 2J0MA 2COAA 2JP2A 1W1GA 1TJ6A 3CXBB 2HE7A 4GXBA 5J3YA 2BCJA 3TVVA 4CHMA 5CLLB 2D9ZA 3ULBA 2D4QA 3HK0A 1FGZA 2D9YA 3ML4A 3HW2B 1MPHA 3D8FA 4F7UP 1KZGA 2LKOA 1W1HA 1K5DB 2DHKA 2J0KA 4YONA 2Y8GA 1V89A 4A6HA 2K2UA 3ZVRA 2EMSA 2GCLA 2D10A 3T06A 1X86A 3D8EA 4KVGB 2HTHB 3KSYA 5J3QA 4WSFA 1P6SA 2DKQA 4HATB 1MAIA 2DX5A 1J19A 2DX1A 1PMSA 2VKIA 4Z2MB 5L81A 4DXAB 4HAYB 1SHCA 3PEGA 3TW1A 1UPRA 3MDBC 5C16A 1Y19B 1B55A 5JP4A 3KRWA 3SV1A 2CODA 5DHAB 4K2PA 1FHOA 2EJ8A 1NTYA 2I1KA 3BJIA 3QIJA 4ZRKA 1WG7A 1QQGA 1GC6A 4KAXB 2P0DA 2UZRA 3TFMA 4NY0A 4EKUA 2R09A 3QBVB 4K81A 2ELBA 2Y8FA 1RJ2A 4WJ7A 2Z0QA 1BAKA 3FEHA 3HQCA 2ADZA 3LJUX 2KGXB 2ZPYA 3TO1A 1UNRA 4TKNA 4MT7A 1DDVA 3F5RA 1X11A 1V88A 5FI1A 2COCA 4HHVA 2MWNB 2J59M 1ZC3B 3N7CA 1FOEA 1Q67A 1QC6A 1XR0B 1EGXA 1LW3A 2RUKB 1M7EA 2EMTA 5HE3A 1DROA 2IYBA 2N23A 2D9VA 2MKRA 4HAZB 1M7RA 2ELAA 3PVLA 1FHWA 1PFJA 1J0WA 2GJYA 1H10A 1OY2A 3MPXA 4BBKA 4CYEA 1U5EA 1GG3A 2FJLA 1SGHA 5JHGA 1LB1A 2VRWB 1MKEA 2DA0A 1MIZB 2PZ1A 2LULA 4D0NB 3AU4A 1FGYA 2R0DA 3TCAA 3ZDTA 2CY5A 2DHIA 1UPQA 4IAPA 1MIXA 1FAOA 1WGUA 1BTNA 1WI1A 3DXDA 2W2XC 2D11A 3OANA 1ISNA 2UVMA 2DN6A 4IFSA 3IVFA 2GS0A 1DYNA 3AU5A 4NSWA 4EMOA 2GCJA 1XCGA 3O96A 4GPTB 2DKPA 5D3VA 1Z87A 4TYZA 4YL8A 5LONB 2LG1A 3PSCA 2DHJA 3A8PA 1BWNA 3U8ZA 1UNQA 3G9WA 2K00A 3PVWA 1BTKA 5GOWB 2NZ8B 1WVHA 2DTCA 2X18A 1TQZA 4DX90 3CIKA 3V5WA 5C5BA 3BINA 2XQNM 1ZC4B 3UZTA 3SNHA 3SUZA 2I1JA 1V5MA 4K17A 1WJ1A 1NTVA 1EVHA 1FHXA 1PLSA 5CLQB 2N0YA 2CAYA 2IFSA 5D3XA 2MFQA 4XWXA 2Z0PA 4WVFB 1DDWA 2ROZB 4A6KA 3PP2A 5JLJB 2NMBA 2OQBA 2YSZA 2Q13A 2RVBB 4PQ0A 2H7DA 2D9WA 4KHBB 5C5BB 3ULCA 3WYFB 2YF0A 2LYDA 1XX0A 2CRFA 2W2XD 1N3HA 1U2BA 5FI0A 3FSSA 4HAVB 1UNPA 3VOQA 1P5TA 4HDQA 4A5KA 5KQ4A 4HB0B 1GC7A 2UZSA 4HB3B 4KHOA 1KI1B 3FM8C 4HB2B 3A98B 3U7DA 2Y7BA 3DXCA 5KCVA 1I7AA 3M1IB 2P0HA 3SYXA 4Z2NA 5JHHA 1DBHA 3PVUA 3GYPA 5DI9B 5LOPB 1NU2A 4HAWB 2V76A 1IRSA 4MK0A 1MK7B 1MK9B 2CY4A 4A6FA 1X05A 3ODWA 2YS5A 3GYOA 2EC1A 3DXEA 5HE0A 1X1GA 2DFKA 5D3YA 2H7EA 3PZDA 2I5FA 2RNRB 5EFXA 4MY6A 1AQCA 3KY9A 3WA0A 3SO6A 4HAXB 4F7GA 1K5GB 2MDXA 5C6RA 1AWEA 3A8QA 4C0AA 2J0JA 2OTXA 2G35A 2K2JA 2RGNB 4HAUB 4A6FB 4DBBA 3D8DA 1U5FA 4PNKA 2D9XA 3F0WA 4ZRIA 4ZRJA 4DX8A 4EJNA 1XKEA 1I2HA 2KUPA 1U5GA 1KZ7A 5DH9B 2LOZA 4CHJA 3QWMA 4K2OA 1TXDA 2YRYA 1FB8A 5KQ1A 4HDOA 4GN1A 5J3TA 1V61A 1U27A 2LOXA 1U5DA 2YS1A 1WJMA 1XODA 2W2WA 4KHAA 1H4RA 1OMWA 4B6HA 3VIAA 1ZVRA 2DYNA 4GZUA 2M14A 2Z0OA 1DDMA 1V5PA 5DIFB 2VSZA 3ODXA 2AEHA 3KRXA 2RSGA 5C79A 2L2IA 3NSUA 1UEFA 3AJ4A 5HE2A 1EF1A 2D2QA 4H8SA 2I5CA 2YS3A 1X1FA 1RRPB 1WGQA 2ROVA 1U29A 1EAZA 1W1DA 3X23A 2RLOA 4GMVA 2DYQA 2P0FA 1V5UA 4Y94A 3P7ZA 1OQNA 1NI2A 3RCPA 4F7HA 1Y5OA 2P8VA 5D27A 5D3WA 4IOYX 2M38A 3KZ1A 2YT1A 2DLWA 2KCJA 4HB4B 2YVCA 2L1CA 2COFA 1ZM0A 5HE1A 5DHFB 1P3RA 2YT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5W A;  2QKM A;  1ZSQ A;  4L6E A;  2QKL A;  2AL6 A;  3PG7 A;  1XD4 A;  3ODO A;  4GMX B;  2E2X A;  3P6A A;  4P7I A;  2J0M A;  2COA A;  2JP2 A;  1W1G A;  1TJ6 A;  3CXB B;  2HE7 A;  4GXB A;  5J3Y A;  2BCJ A;  3TVV A;  4CHM A;  5CLL B;  2D9Z A;  3ULB A;  2D4Q A;  3HK0 A;  1FGZ A;  2D9Y A;  3ML4 A;  3HW2 B;  1MPH A;  3D8F A;  4F7U P;  1KZG A;  2LKO A;  1W1H A;  1K5D B;  2DHK A;  2J0K A;  4YON A;  2Y8G A;  1V89 A;  4A6H A;  2K2U A;  3ZVR A;  2EMS A;  2GCL A;  2D10 A;  3T06 A;  1X86 A;  3D8E A;  4KVG B;  2HTH B;  3KSY A;  5J3Q A;  4WSF A;  1P6S A;  2DKQ A;  4HAT B;  1MAI A;  2DX5 A;  1J19 A;  2DX1 A;  1PMS A;  2VKI A;  4Z2M B;  5L81 A;  4DXA B;  4HAY B;  1SHC A;  3PEG A;  3TW1 A;  1UPR A;  3MDB C;  5C16 A;  1Y19 B;  1B55 A;  5JP4 A;  3KRW A;  3SV1 A;  2COD A;  5DHA B;  4K2P A;  1FHO A;  2EJ8 A;  1NTY A;  2I1K A;  3BJI A;  3QIJ A;  4ZRK A;  1WG7 A;  1QQG A;  1GC6 A;  4KAX B;  2P0D A;  2UZR A;  3TFM A;  4NY0 A;  4EKU A;  2R09 A;  3QBV B;  4K81 A;  2ELB A;  2Y8F A;  1RJ2 A;  4WJ7 A;  2Z0Q A;  1BAK A;  3FEH A;  3HQC A;  2ADZ A;  3LJU X;  2KGX B;  2ZPY A;  3TO1 A;  1UNR A;  4TKN A;  4MT7 A;  1DDV A;  3F5R A;  1X11 A;  1V88 A;  5FI1 A;  2COC A;  4HHV A;  2MWN B;  2J59 M;  1ZC3 B;  3N7C A;  1FOE A;  1Q67 A;  1QC6 A;  1XR0 B;  1EGX A;  1LW3 A;  2RUK B;  1M7E A;  2EMT A;  5HE3 A;  1DRO A;  2IYB A;  2N23 A;  2D9V A;  2MKR A;  4HAZ B;  1M7R A;  2ELA A;  3PVL A;  1FHW A;  1PFJ A;  1J0W A;  2GJY A;  1H10 A;  1OY2 A;  3MPX A;  4BBK A;  4CYE A;  1U5E A;  1GG3 A;  2FJL A;  1SGH A;  5JHG A;  1LB1 A;  2VRW B;  1MKE A;  2DA0 A;  1MIZ B;  2PZ1 A;  2LUL A;  4D0N B;  3AU4 A;  1FGY A;  2R0D A;  3TCA A;  3ZDT A;  2CY5 A;  2DHI A;  1UPQ A;  4IAP A;  1MIX A;  1FAO A;  1WGU A;  1BTN A;  1WI1 A;  3DXD A;  2W2X C;  2D11 A;  3OAN A;  1ISN A;  2UVM A;  2DN6 A;  4IFS A;  3IVF A;  2GS0 A;  1DYN A;  3AU5 A;  4NSW A;  4EMO A;  2GCJ A;  1XCG A;  3O96 A;  4GPT B;  2DKP A;  5D3V A;  1Z87 A;  4TYZ A;  4YL8 A;  5LON B;  2LG1 A;  3PSC A;  2DHJ A;  3A8P A;  1BWN A;  3U8Z A;  1UNQ A;  3G9W A;  2K00 A;  3PVW A;  1BTK A;  5GOW B;  2NZ8 B;  1WVH A;  2DTC A;  2X18 A;  1TQZ A;  4DX9 0;  3CIK A;  3V5W A;  5C5B A;  3BIN A;  2XQN M;  1ZC4 B;  3UZT A;  3SNH A;  3SUZ A;  2I1J A;  1V5M A;  4K17 A;  1WJ1 A;  1NTV A;  1EVH A;  1FHX A;  1PLS A;  5CLQ B;  2N0Y A;  2CAY A;  2IFS A;  5D3X A;  2MFQ A;  4XWX A;  2Z0P A;  4WVF B;  1DDW A;  2ROZ B;  4A6K A;  3PP2 A;  5JLJ B;  2NMB A;  2OQB A;  2YSZ A;  2Q13 A;  2RVB B;  4PQ0 A;  2H7D A;  2D9W A;  4KHB B;  5C5B B;  3ULC A;  3WYF B;  2YF0 A;  2LYD A;  1XX0 A;  2CRF A;  2W2X D;  1N3H A;  1U2B A;  5FI0 A;  3FSS A;  4HAV B;  1UNP A;  3VOQ A;  1P5T A;  4HDQ A;  4A5K A;  5KQ4 A;  4HB0 B;  1GC7 A;  2UZS A;  4HB3 B;  4KHO A;  1KI1 B;  3FM8 C;  4HB2 B;  3A98 B;  3U7D A;  2Y7B A;  3DXC A;  5KCV A;  1I7A A;  3M1I B;  2P0H A;  3SYX A;  4Z2N A;  5JHH A;  1DBH A;  3PVU A;  3GYP A;  5DI9 B;  5LOP B;  1NU2 A;  4HAW B;  2V76 A;  1IRS A;  4MK0 A;  1MK7 B;  1MK9 B;  2CY4 A;  4A6F A;  1X05 A;  3ODW A;  2YS5 A;  3GYO A;  2EC1 A;  3DXE A;  5HE0 A;  1X1G A;  2DFK A;  5D3Y A;  2H7E A;  3PZD A;  2I5F A;  2RNR B;  5EFX A;  4MY6 A;  1AQC A;  3KY9 A;  3WA0 A;  3SO6 A;  4HAX B;  4F7G A;  1K5G B;  2MDX A;  5C6R A;  1AWE A;  3A8Q A;  4C0A A;  2J0J A;  2OTX A;  2G35 A;  2K2J A;  2RGN B;  4HAU B;  4A6F B;  4DBB A;  3D8D A;  1U5F A;  4PNK A;  2D9X A;  3F0W A;  4ZRI A;  4ZRJ A;  4DX8 A;  4EJN A;  1XKE A;  1I2H A;  2KUP A;  1U5G A;  1KZ7 A;  5DH9 B;  2LOZ A;  4CHJ A;  3QWM A;  4K2O A;  1TXD A;  2YRY A;  1FB8 A;  5KQ1 A;  4HDO A;  4GN1 A;  5J3T A;  1V61 A;  1U27 A;  2LOX A;  1U5D A;  2YS1 A;  1WJM A;  1XOD A;  2W2W A;  4KHA A;  1H4R A;  1OMW A;  4B6H A;  3VIA A;  1ZVR A;  2DYN A;  4GZU A;  2M14 A;  2Z0O A;  1DDM A;  1V5P A;  5DIF B;  2VSZ A;  3ODX A;  2AEH A;  3KRX A;  2RSG A;  5C79 A;  2L2I A;  3NSU A;  1UEF A;  3AJ4 A;  5HE2 A;  1EF1 A;  2D2Q A;  4H8S A;  2I5C A;  2YS3 A;  1X1F A;  1RRP B;  1WGQ A;  2ROV A;  1U29 A;  1EAZ A;  1W1D A;  3X23 A;  2RLO A;  4GMV A;  2DYQ A;  2P0F A;  1V5U A;  4Y94 A;  3P7Z A;  1OQN A;  1NI2 A;  3RCP A;  4F7H A;  1Y5O A;  2P8V A;  5D27 A;  5D3W A;  4IOY X;  2M38 A;  3KZ1 A;  2YT1 A;  2DLW A;  2KCJ A;  4HB4 B;  2YVC A;  2L1C A;  2COF A;  1ZM0 A;  5HE1 A;  5DHF B;  1P3R A;  2YT0 A; 
#chains in the Genus database with same CATH topology
 1E5W A;  2QKM A;  1ZSQ A;  4L6E A;  2YT2 A;  2QKL A;  5LG4 B;  2AL6 A;  3PG7 A;  1XD4 A;  3ODO A;  4GMX B;  2E2X A;  3P6A A;  4P7I A;  4CSQ A;  2J0M A;  2COA A;  2JP2 A;  1W1G A;  3OHM B;  1TJ6 A;  3CXB B;  5IRS A;  2HE7 A;  4GXB A;  5J3Y A;  2BCJ A;  3TVV A;  4CHM A;  5CLL B;  2D9Z A;  3A58 A;  3ULB A;  2D4Q A;  3HK0 A;  1FGZ A;  2D9Y A;  3ML4 A;  3HW2 B;  1MPH A;  3D8F A;  4F7U P;  1KZG A;  2LKO A;  1W1H A;  1K5D B;  2DHK A;  2J0K A;  4YON A;  2Y8G A;  4HSI A;  1V89 A;  4A6H A;  2K2U A;  3ZVR A;  2EMS A;  2GCL A;  2D10 A;  3T06 A;  1X86 A;  3D8E A;  4KVG B;  2HTH B;  3KSY A;  5J3Q A;  5I2S A;  4WSF A;  1P6S A;  2DKQ A;  4HAT B;  1MAI A;  2DX5 A;  1J19 A;  2DX1 A;  1PMS A;  2VKI A;  4Z2M B;  5L81 A;  4DXA B;  4HAY B;  1SHC A;  3PEG A;  3TW1 A;  1UPR A;  3MDB C;  5C16 A;  1Y19 B;  1B55 A;  2K8E A;  5JP4 A;  3KRW A;  3SV1 A;  2COD A;  5DHA B;  4K2P A;  1FHO A;  2EJ8 A;  1NTY A;  2I1K A;  3BJI A;  3QIJ A;  4ZRK A;  1WG7 A;  1QQG A;  1GC6 A;  4KAX B;  2P0D A;  2UZR A;  3TFM A;  4NY0 A;  4EKU A;  1ZYI A;  2R09 A;  3QBV B;  4K81 A;  2ELB A;  2Y8F A;  4OSN A;  1RJ2 A;  4WJ7 A;  2Z0Q A;  1BAK A;  3FEH A;  3HQC A;  2ADZ A;  3LJU X;  2KGX B;  2ZPY A;  3TO1 A;  1UNR A;  4TKN A;  2KIG A;  1DDV A;  4MT7 A;  3F5R A;  1X11 A;  3B77 A;  1V88 A;  5FI1 A;  2COC A;  4HHV A;  2KIE A;  2MWN B;  2J59 M;  1ZC3 B;  3N7C A;  1FOE A;  1Q67 A;  1QC6 A;  1XR0 B;  2Z59 A;  1EGX A;  1LW3 A;  2RUK B;  1M7E A;  2EMT A;  5HE3 A;  2Z4D A;  1DRO A;  2K49 A;  2IYB A;  2N23 A;  5M4Y B;  2D9V A;  2MKR A;  4OT1 A;  4HAZ B;  1M7R A;  2ELA A;  3PVL A;  1FHW A;  1PFJ A;  1J0W A;  2GJY A;  1H10 A;  1OY2 A;  3MPX A;  4BBK A;  2FJU B;  3NW8 A;  4CYE A;  1MI1 A;  1U5E A;  1GG3 A;  2FJL A;  1SGH A;  5JHG A;  2KUQ A;  1LB1 A;  2VRW B;  1MKE A;  2DA0 A;  4DIX A;  1MIZ B;  2PZ1 A;  2LUL A;  4D0N B;  3AU4 A;  1FGY A;  2R0D A;  3TCA A;  2RRF A;  3ZDT A;  2CY5 A;  2DHI A;  1UPQ A;  4IAP A;  1MIX A;  1FAO A;  1WGU A;  1BTN A;  1WI1 A;  3DXD A;  2W2X C;  2D11 A;  3OAN A;  1ISN A;  2UVM A;  2DN6 A;  4IFS A;  3IVF A;  2GS0 A;  1DYN A;  3AU5 A;  4NSW A;  4EMO A;  2GCJ A;  4QJ4 B;  4GOU A;  1XCG A;  3O96 A;  4GPT B;  2DKP A;  5D3V A;  1Z87 A;  2GUM A;  4TYZ A;  4YL8 A;  5LON B;  2LG1 A;  3PSC A;  2DHJ A;  3A8P A;  1BWN A;  3U8Z A;  1UNQ A;  3G9W A;  2K00 A;  3PVW A;  1BTK A;  5GOW B;  2NZ8 B;  1WVH A;  2DTC A;  2X18 A;  1TQZ A;  4DX9 0;  3CIK A;  3V5W A;  4KHB A;  5C5B A;  3BIN A;  2XQN M;  1ZC4 B;  3UZT A;  3SNH A;  3SUZ A;  2I1J A;  2R2Y A;  1V5M A;  4K17 A;  1WJ1 A;  1NTV A;  1EVH A;  1FHX A;  1PLS A;  5CLQ B;  2N0Y A;  2CAY A;  2IFS A;  5D3X A;  2MFQ A;  4XWX A;  2Z0P A;  4WVF B;  1DDW A;  2ROZ B;  4A6K A;  3PP2 A;  5JLJ B;  2NMB A;  2OQB A;  2YSZ A;  2Q13 A;  2RVB B;  4PQ0 A;  2H7D A;  2D9W A;  4KHB B;  5C5B B;  3ULC A;  3WYF B;  2YF0 A;  2LYD A;  1XX0 A;  2CRF A;  4QJ5 B;  2W2X D;  1N3H A;  1U2B A;  5FI0 A;  3FSS A;  4HAV B;  1UNP A;  3VOQ A;  4D6W A;  1P5T A;  4HDQ A;  4A5K A;  5KQ4 A;  4HB0 B;  1GC7 A;  2UZS A;  4HB3 B;  4KHO A;  1KI1 B;  2NBV A;  4L1R A;  3FM8 C;  4HB2 B;  3A98 B;  3U7D A;  2Y7B A;  3DXC A;  5KCV A;  1I7A A;  3M1I B;  2P0H A;  3SYX A;  4Z2N A;  5JHH A;  1DBH A;  3PVU A;  3GYP A;  5DI9 B;  5LOP B;  1NU2 A;  4HAW B;  2V76 A;  1IRS A;  4MK0 A;  1MK7 B;  1MK9 B;  2CY4 A;  4A6F A;  1X05 A;  3ODW A;  2YS5 A;  3GYO A;  2EC1 A;  3DXE A;  5HE0 A;  1X1G A;  2DFK A;  5D3Y A;  2H7E A;  3PZD A;  2I5F A;  2RNR B;  5EFX A;  4MY6 A;  2KR0 A;  1AQC A;  3KY9 A;  3WA0 A;  3SO6 A;  4HAX B;  3HIE A;  4F7G A;  2Z14 A;  1K5G B;  2MDX A;  5C6R A;  4QJ3 B;  1AWE A;  3A8Q A;  4C0A A;  2J0J A;  2OTX A;  2G35 A;  2K2J A;  2RGN B;  4HAU B;  4A6F B;  4DBB A;  3D8D A;  1U5F A;  4PNK A;  2D9X A;  3F0W A;  3NWA A;  3U12 A;  4ZRI A;  4ZRJ A;  4DX8 A;  3NWF A;  4EJN A;  1XKE A;  1I2H A;  2KUP A;  1U5G A;  1KZ7 A;  5DH9 B;  2LOZ A;  4CHJ A;  3QWM A;  4K2O A;  1TXD A;  2YRY A;  1FB8 A;  5KQ1 A;  4HDO A;  4GN1 A;  5J3T A;  3HSA A;  1V61 A;  4QXA B;  1U27 A;  2LOX A;  1U5D A;  1T77 A;  2YS1 A;  1WJM A;  1XOD A;  2W2W A;  4KHA A;  1H4R A;  1OMW A;  4B6H A;  3VIA A;  1ZVR A;  2DYN A;  4GZU A;  2M14 A;  2Z0O A;  1DDM A;  1V5P A;  5DIF B;  2Z13 A;  3DCX A;  2VSZ A;  3ODX A;  2AEH A;  3KRX A;  3FVC A;  2RSG A;  5C79 A;  2L2I A;  3NSU A;  1UEF A;  3AJ4 A;  5HE2 A;  1EF1 A;  2D2Q A;  4H8S A;  2I5C A;  2YS3 A;  1X1F A;  1RRP B;  1WGQ A;  2ROV A;  1U29 A;  1EAZ A;  1W1D A;  2ZKM X;  2RLO A;  3X23 A;  4GMV A;  2DYQ A;  2P0F A;  1V5U A;  4Y94 A;  3P7Z A;  1OQN A;  3NWD A;  5I2M A;  1NI2 A;  3RCP A;  4F7H A;  1Y5O A;  2P8V A;  5D27 A;  5D3W A;  4IOY X;  2M38 A;  3KZ1 A;  4GNK B;  2YT1 A;  2DLW A;  2KCJ A;  4HB4 B;  2YVC A;  2L1C A;  2COF A;  1ZM0 A;  5HE1 A;  5DHF B;  1P3R A;  2YT0 A; 
#chains in the Genus database with same CATH homology
 1E5W A;  2QKM A;  1ZSQ A;  4L6E A;  2QKL A;  2AL6 A;  3PG7 A;  1XD4 A;  3ODO A;  4GMX B;  2E2X A;  3P6A A;  4P7I A;  2J0M A;  2COA A;  2JP2 A;  1W1G A;  1TJ6 A;  3CXB B;  2HE7 A;  4GXB A;  5J3Y A;  2BCJ A;  3TVV A;  4CHM A;  5CLL B;  2D9Z A;  3ULB A;  2D4Q A;  3HK0 A;  1FGZ A;  2D9Y A;  3ML4 A;  3HW2 B;  1MPH A;  3D8F A;  4F7U P;  1KZG A;  2LKO A;  1W1H A;  1K5D B;  2DHK A;  2J0K A;  4YON A;  2Y8G A;  1V89 A;  4A6H A;  2K2U A;  3ZVR A;  2EMS A;  2GCL A;  2D10 A;  3T06 A;  1X86 A;  3D8E A;  4KVG B;  2HTH B;  3KSY A;  5J3Q A;  4WSF A;  1P6S A;  2DKQ A;  4HAT B;  1MAI A;  2DX5 A;  1J19 A;  2DX1 A;  1PMS A;  2VKI A;  4Z2M B;  5L81 A;  4DXA B;  4HAY B;  1SHC A;  3PEG A;  3TW1 A;  1UPR A;  3MDB C;  5C16 A;  1Y19 B;  1B55 A;  5JP4 A;  3KRW A;  3SV1 A;  2COD A;  5DHA B;  4K2P A;  1FHO A;  2EJ8 A;  1NTY A;  2I1K A;  3BJI A;  3QIJ A;  4ZRK A;  1WG7 A;  1QQG A;  1GC6 A;  4KAX B;  2P0D A;  2UZR A;  3TFM A;  4NY0 A;  4EKU A;  2R09 A;  3QBV B;  4K81 A;  2ELB A;  2Y8F A;  1RJ2 A;  4WJ7 A;  2Z0Q A;  1BAK A;  3FEH A;  3HQC A;  2ADZ A;  3LJU X;  2KGX B;  2ZPY A;  3TO1 A;  1UNR A;  4TKN A;  4MT7 A;  1DDV A;  3F5R A;  1X11 A;  1V88 A;  5FI1 A;  2COC A;  4HHV A;  2MWN B;  2J59 M;  1ZC3 B;  3N7C A;  1FOE A;  1Q67 A;  1QC6 A;  1XR0 B;  1EGX A;  1LW3 A;  2RUK B;  1M7E A;  2EMT A;  5HE3 A;  1DRO A;  2IYB A;  2N23 A;  2D9V A;  2MKR A;  4HAZ B;  1M7R A;  2ELA A;  3PVL A;  1FHW A;  1PFJ A;  1J0W A;  2GJY A;  1H10 A;  1OY2 A;  3MPX A;  4BBK A;  4CYE A;  1U5E A;  1GG3 A;  2FJL A;  1SGH A;  5JHG A;  1LB1 A;  2VRW B;  1MKE A;  2DA0 A;  1MIZ B;  2PZ1 A;  2LUL A;  4D0N B;  3AU4 A;  1FGY A;  2R0D A;  3TCA A;  3ZDT A;  2CY5 A;  2DHI A;  1UPQ A;  4IAP A;  1MIX A;  1FAO A;  1WGU A;  1BTN A;  1WI1 A;  3DXD A;  2W2X C;  2D11 A;  3OAN A;  1ISN A;  2UVM A;  2DN6 A;  4IFS A;  3IVF A;  2GS0 A;  1DYN A;  3AU5 A;  4NSW A;  4EMO A;  2GCJ A;  1XCG A;  3O96 A;  4GPT B;  2DKP A;  5D3V A;  1Z87 A;  4TYZ A;  4YL8 A;  5LON B;  2LG1 A;  3PSC A;  2DHJ A;  3A8P A;  1BWN A;  3U8Z A;  1UNQ A;  3G9W A;  2K00 A;  3PVW A;  1BTK A;  5GOW B;  2NZ8 B;  1WVH A;  2DTC A;  2X18 A;  1TQZ A;  4DX9 0;  3CIK A;  3V5W A;  5C5B A;  3BIN A;  2XQN M;  1ZC4 B;  3UZT A;  3SNH A;  3SUZ A;  2I1J A;  1V5M A;  4K17 A;  1WJ1 A;  1NTV A;  1EVH A;  1FHX A;  1PLS A;  5CLQ B;  2N0Y A;  2CAY A;  2IFS A;  5D3X A;  2MFQ A;  4XWX A;  2Z0P A;  4WVF B;  1DDW A;  2ROZ B;  4A6K A;  3PP2 A;  5JLJ B;  2NMB A;  2OQB A;  2YSZ A;  2Q13 A;  2RVB B;  4PQ0 A;  2H7D A;  2D9W A;  4KHB B;  5C5B B;  3ULC A;  3WYF B;  2YF0 A;  2LYD A;  1XX0 A;  2CRF A;  2W2X D;  1N3H A;  1U2B A;  5FI0 A;  3FSS A;  4HAV B;  1UNP A;  3VOQ A;  1P5T A;  4HDQ A;  4A5K A;  5KQ4 A;  4HB0 B;  1GC7 A;  2UZS A;  4HB3 B;  4KHO A;  1KI1 B;  3FM8 C;  4HB2 B;  3A98 B;  3U7D A;  2Y7B A;  3DXC A;  5KCV A;  1I7A A;  3M1I B;  2P0H A;  3SYX A;  4Z2N A;  5JHH A;  1DBH A;  3PVU A;  3GYP A;  5DI9 B;  5LOP B;  1NU2 A;  4HAW B;  2V76 A;  1IRS A;  4MK0 A;  1MK7 B;  1MK9 B;  2CY4 A;  4A6F A;  1X05 A;  3ODW A;  2YS5 A;  3GYO A;  2EC1 A;  3DXE A;  5HE0 A;  1X1G A;  2DFK A;  5D3Y A;  2H7E A;  3PZD A;  2I5F A;  2RNR B;  5EFX A;  4MY6 A;  1AQC A;  3KY9 A;  3WA0 A;  3SO6 A;  4HAX B;  4F7G A;  1K5G B;  2MDX A;  5C6R A;  1AWE A;  3A8Q A;  4C0A A;  2J0J A;  2OTX A;  2G35 A;  2K2J A;  2RGN B;  4HAU B;  4A6F B;  4DBB A;  3D8D A;  1U5F A;  4PNK A;  2D9X A;  3F0W A;  4ZRI A;  4ZRJ A;  4DX8 A;  4EJN A;  1XKE A;  1I2H A;  2KUP A;  1U5G A;  1KZ7 A;  5DH9 B;  2LOZ A;  4CHJ A;  3QWM A;  4K2O A;  1TXD A;  2YRY A;  1FB8 A;  5KQ1 A;  4HDO A;  4GN1 A;  5J3T A;  1V61 A;  1U27 A;  2LOX A;  1U5D A;  2YS1 A;  1WJM A;  1XOD A;  2W2W A;  4KHA A;  1H4R A;  1OMW A;  4B6H A;  3VIA A;  1ZVR A;  2DYN A;  4GZU A;  2M14 A;  2Z0O A;  1DDM A;  1V5P A;  5DIF B;  2VSZ A;  3ODX A;  2AEH A;  3KRX A;  2RSG A;  5C79 A;  2L2I A;  3NSU A;  1UEF A;  3AJ4 A;  5HE2 A;  1EF1 A;  2D2Q A;  4H8S A;  2I5C A;  2YS3 A;  1X1F A;  1RRP B;  1WGQ A;  2ROV A;  1U29 A;  1EAZ A;  1W1D A;  3X23 A;  2RLO A;  4GMV A;  2DYQ A;  2P0F A;  1V5U A;  4Y94 A;  3P7Z A;  1OQN A;  1NI2 A;  3RCP A;  4F7H A;  1Y5O A;  2P8V A;  5D27 A;  5D3W A;  4IOY X;  2M38 A;  3KZ1 A;  2YT1 A;  2DLW A;  2KCJ A;  4HB4 B;  2YVC A;  2L1C A;  2COF A;  1ZM0 A;  5HE1 A;  5DHF B;  1P3R A;  2YT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...