2DHIA

Solution structure of the ph domain of evectin-2 from mouse
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
b'GSSGSSGFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Solution structure of the PH domain of Evectin-2 from mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhiA00
4CYEA 4BBKA 1XCGA 2OQBA 1V61A 2OTXA 3SYXA 2DYNA 2COCA 1ISNA 1DROA 2UVMA 1J19A 1XODA 1B55A 1UPQA 2RGNB 3DXEA 2J0JA 4KHOA 4F7GA 5KCVA 1TQZA 1I2HA 1WG7A 3DXCA 2QKMA 3GYOA 2D11A 1FHWA 1DDWA 2VKIA 2D10A 2J0MA 4L6EA 3SO6A 2DYQA 2Z0QA 5DIFB 1MK7B 2H7EA 3F5RA 1BTKA 2Q13A 4HDQA 1ZSQA 4WVFB 1KZGA 1KI1B 4HAYB 5D27A 1U5EA 2YS3A 1V5UA 1WVHA 1Y5OA 5LOPB 5HE1A 1SHCA 2VSZA 4K2OA 5FI0A 1XD4A 3CXBB 4EKUA 4EJNA 1P5TA 1GC7A 2RNRB 4HDOA 4ZRIA 3T06A 2K00A 4YL8A 1UNRA 1V5MA 2D9ZA 5DHAB 5GOWB 2W2XD 2MDXA 1WGUA 3QWMA 1I7AA 2I1KA 2UZRA 3QIJA 2KUPA 4GZUA 2ROVA 2ZPYA 1NU2A 3O96A 2NMBA 2I5FA 1W1DA 4TKNA 1BTNA 3X23A 3ULBA 1V89A 3ODOA 3P7ZA 2G35A 1NTYA 4A6FA 3HW2B 2N0YA 3A8PA 4HB3B 3KZ1A 4DX90 3PZDA 1Q67A 3HQCA 2E2XA 3MDBC 4C0AA 5JHHA 1EF1A 2YT0A 1MIXA 1BAKA 3MPXA 4WSFA 2UZSA 5L81A 2N23A 2Y8GA 2IYBA 3BJIA 4NSWA 2LOZA 3AJ4A 2DFKA 3TVVA 3PEGA 2D4QA 2D9VA 1H10A 5EFXA 5HE0A 1Z87A 5D3XA 3F0WA 2RVBB 2BCJA 1ZC4B 2ELAA 1M7RA 3ODWA 3SNHA 5DI9B 5DH9B 5D3YA 2MWNB 3CIKA 3U7DA 2GCLA 1WGQA 1UEFA 3GYPA 2NZ8B 1IRSA 4K17A 2YS5A 3U8ZA 1H4RA 3OANA 4MY6A 1EVHA 1U5FA 1DDMA 2RLOA 4A5KA 2CODA 2J59M 1SGHA 2M38A 2LOXA 1PFJA 3HK0A 3NSUA 1PLSA 2DTCA 4PQ0A 3PSCA 1FAOA 2LG1A 2YVCA 1E5WA 2H7DA 2ADZA 2DA0A 1FOEA 1WI1A 2MKRA 3ZVRA 2CRFA 2L1CA 4A6FB 1P3RA 1P6SA 1UNQA 2DHJA 1LW3A 2EMTA 1V88A 2W2WA 1Y19B 4F7HA 3TCAA 1GG3A 1FHOA 2GS0A 1ZC3B 2GJYA 2D2QA 5HE2A 2KCJA 4EMOA 1V5PA 5FI1A 4MK0A 2W2XC 4KHAA 5LONB 1QQGA 1TJ6A 2YT1A 2PZ1A 2DX1A 1OY2A 2EMSA 4KHBB 5JP4A 2IFSA 1X1GA 2GCJA 2DN6A 2Y8FA 2V76A 1U5DA 3LJUX 4ZRKA 4K2PA 5C6RA 1X86A 4HB2B 2DX5A 2P0DA 5JLJB 1N3HA 4GMXB 3G9WA 4Y94A 3KRXA 4MT7A 2RUKB 4DBBA 2K2UA 1GC6A 2LYDA 3TW1A 1EAZA 1W1GA 1U2BA 4HAWB 2MFQA 4HAXB 3FSSA 3D8EA 2I5CA 2P0FA 3PVLA 3V5WA 5C5BA 4PNKA 1NI2A 1U29A 1X11A 3A8QA 4DXAB 2Z0PA 1RJ2A 2CY5A 3QBVB 5CLLB 2FJLA 2AEHA 1XX0A 4P7IA 1FHXA 5C79A 4F7UP 2EC1A 5JHGA 2LULA 3BINA 2JP2A 1XKEA 2DHIA 3P6AA 2KGXB 3ODXA 4KVGB 1NTVA 1PMSA 2D9YA 4ZRJA 3ML4A 4TYZA 4HAVB 4A6KA 2D9WA 5D3VA 4DX8A 2DHKA 1DBHA 3KRWA 1J0WA 4Z2MB 4A6HA 3SUZA 3TFMA 3FM8C 1UNPA 3IVFA 5J3TA 1MIZB 2R0DA 4NY0A 3D8FA 3SV1A 4GMVA 4D0NB 5D3WA 3UZTA 3M1IB 1MPHA 1FGZA 1DYNA 3D8DA 3N7CA 4IAPA 4HB0B 2P8VA 1U27A 1ZM0A 2HE7A 4KAXB 4Z2NA 2YRYA 2QKLA 1X1FA 1W1HA 1MAIA 2COFA 3FEHA 4B6HA 1OQNA 2YSZA 2L2IA 2P0HA 1KZ7A 4IFSA 2VRWB 5DHFB 1FB8A 5CLQB 3PVWA 2I1JA 1DDVA 1LB1A 1ZVRA 3ZDTA 2D9XA 2YF0A 4WJ7A 3KY9A 1XR0B 2DLWA 5C5BB 4HAZB 5J3QA 1EGXA 3WA0A 2EJ8A 1UPRA 2ROZB 1MK9B 2CAYA 2Z0OA 4IOYX 4K81A 5C16A 2K2JA 3PVUA 1M7EA 4CHJA 2DKPA 2R09A 4GPTB 1OMWA 3VOQA 4H8SA 3ULCA 5J3YA 1MKEA 3TO1A 1FGYA 4GXBA 2DKQA 1U5GA 3DXDA 4HAUB 1AWEA 1BWNA 4GN1A 1WJMA 1WJ1A 1X05A 3RCPA 2YS1A 2LKOA 3PG7A 3VIAA 2ELBA 2COAA 3AU4A 2XQNM 2AL6A 4HATB 3KSYA 4HB4B 1QC6A 1AQCA 5HE3A 5KQ1A 5KQ4A 1RRPB 3WYFB 2RSGA 1K5DB 2Y7BA 4XWXA 4CHMA 2X18A 2HTHB 2M14A 3AU5A 2CY4A 2J0KA 4HHVA 1TXDA 3PP2A 3A98B 4YONA 1K5GB
chains in the Genus database with same CATH superfamily
4CYEA 4BBKA 1XCGA 2OQBA 1V61A 2OTXA 3SYXA 2DYNA 2COCA 3A58A 1ISNA 5M4YB 1DROA 3NWDA 2UVMA 4QJ3B 1J19A 1XODA 1B55A 1UPQA 2RGNB 3DXEA 2J0JA 3NWFA 2RRFA 4KHOA 4F7GA 5KCVA 1TQZA 1I2HA 1WG7A 3DXCA 2QKMA 3GYOA 2D11A 1FHWA 1DDWA 2VKIA 2D10A 2J0MA 4L6EA 3SO6A 2DYQA 2Z0QA 5DIFB 1MK7B 2Z59A 2H7EA 3F5RA 1BTKA 2Q13A 4HDQA 1ZSQA 4WVFB 1KZGA 1KI1B 4HAYB 5D27A 1U5EA 2YS3A 1V5UA 1WVHA 1Y5OA 5LOPB 5HE1A 1SHCA 2VSZA 4K2OA 5FI0A 1XD4A 3CXBB 4EKUA 4EJNA 1P5TA 1GC7A 2RNRB 4HDOA 4ZRIA 3T06A 2K00A 4YL8A 1UNRA 1V5MA 2D9ZA 4GNKB 5DHAB 5GOWB 2W2XD 2MDXA 1WGUA 3QWMA 1I7AA 2I1KA 2UZRA 3QIJA 2KUPA 4GZUA 2ROVA 2ZPYA 1NU2A 3O96A 2K49A 2NMBA 2I5FA 1W1DA 4HSIA 4TKNA 1BTNA 3X23A 3ULBA 3NWAA 3HSAA 1V89A 3ODOA 3DCXA 3P7ZA 2G35A 1NTYA 4A6FA 3HW2B 2N0YA 4GOUA 3A8PA 4HB3B 3KZ1A 4CSQA 4DX90 2R2YA 1Q67A 3HQCA 3PZDA 2E2XA 3MDBC 4C0AA 5JHHA 1EF1A 2YT0A 1MIXA 1BAKA 3MPXA 4WSFA 2UZSA 5L81A 2N23A 2Y8GA 2IYBA 3BJIA 4NSWA 2LOZA 3AJ4A 4QJ4B 2DFKA 3TVVA 3PEGA 3FVCA 2D4QA 2D9VA 1H10A 5EFXA 5HE0A 1Z87A 5D3XA 5LG4B 3F0WA 2RVBB 2BCJA 4KHBA 1ZC4B 2ELAA 1M7RA 3ODWA 3SNHA 5DI9B 5DH9B 5D3YA 2MWNB 3CIKA 3U7DA 2GCLA 1WGQA 1UEFA 3GYPA 2NZ8B 1IRSA 5I2MA 4K17A 2YS5A 4QJ5B 3U8ZA 4OSNA 1H4RA 3OANA 4MY6A 1EVHA 1U5FA 1DDMA 2RLOA 4A5KA 2CODA 2J59M 2ZKMX 1SGHA 2M38A 2LOXA 4OT1A 1PFJA 3HK0A 3NSUA 1PLSA 2DTCA 2KIGA 4PQ0A 3PSCA 1FAOA 2LG1A 2YVCA 1E5WA 2H7DA 2ADZA 2DA0A 1FOEA 1WI1A 2MKRA 2GUMA 3ZVRA 2CRFA 2Z14A 2L1CA 4A6FB 1P3RA 1P6SA 1UNQA 2DHJA 1LW3A 2EMTA 1V88A 2W2WA 1Y19B 4F7HA 3TCAA 2KUQA 1GG3A 1FHOA 2GS0A 1ZC3B 2GJYA 2D2QA 5HE2A 2KCJA 4EMOA 1V5PA 2Z4DA 4D6WA 5FI1A 4MK0A 2W2XC 4KHAA 5LONB 1QQGA 1TJ6A 2YT1A 1T77A 2PZ1A 2DX1A 1OY2A 2EMSA 4KHBB 5JP4A 2IFSA 1X1GA 2GCJA 2DN6A 2Y8FA 2V76A 1U5DA 2FJUB 3LJUX 4ZRKA 4K2PA 5C6RA 3NW8A 1X86A 4HB2B 2DX5A 2P0DA 5JLJB 1N3HA 4GMXB 3G9WA 4Y94A 3KRXA 4MT7A 2RUKB 4DBBA 2K2UA 1GC6A 2LYDA 3TW1A 5IRSA 1EAZA 1W1GA 1U2BA 4HAWB 3OHMB 2MFQA 4HAXB 3FSSA 3D8EA 2I5CA 2P0FA 3PVLA 3V5WA 5C5BA 4PNKA 1NI2A 1U29A 1X11A 3A8QA 4DXAB 2Z0PA 1RJ2A 2CY5A 4L1RA 3QBVB 5CLLB 2FJLA 2AEHA 1XX0A 4P7IA 1FHXA 5C79A 4F7UP 2EC1A 5JHGA 2LULA 3BINA 2JP2A 1XKEA 2YT2A 2DHIA 3P6AA 2KGXB 3ODXA 4KVGB 4DIXA 1NTVA 1PMSA 2D9YA 4ZRJA 3ML4A 4TYZA 4HAVB 4A6KA 2D9WA 5D3VA 4DX8A 2DHKA 1DBHA 3KRWA 1J0WA 4Z2MB 4A6HA 3SUZA 3HIEA 3TFMA 3FM8C 1UNPA 3IVFA 5J3TA 1MIZB 2R0DA 4NY0A 3D8FA 2KR0A 3SV1A 4GMVA 4D0NB 5D3WA 3UZTA 3M1IB 1MPHA 1FGZA 1DYNA 3D8DA 3N7CA 4IAPA 4HB0B 5I2SA 2P8VA 1U27A 1ZM0A 2HE7A 4KAXB 4Z2NA 2YRYA 2QKLA 1X1FA 3U12A 1W1HA 1MAIA 2COFA 3FEHA 4B6HA 1OQNA 2YSZA 2L2IA 2P0HA 1KZ7A 4IFSA 2VRWB 5DHFB 1FB8A 5CLQB 3PVWA 2I1JA 1DDVA 1LB1A 1ZVRA 2Z13A 3ZDTA 2K8EA 2D9XA 2YF0A 4WJ7A 3KY9A 1XR0B 2DLWA 5C5BB 4HAZB 5J3QA 1EGXA 3WA0A 2EJ8A 4QXAB 1UPRA 2ROZB 1MK9B 1MI1A 2CAYA 2Z0OA 4IOYX 4K81A 5C16A 2K2JA 3PVUA 1M7EA 4CHJA 2DKPA 2R09A 4GPTB 1OMWA 3VOQA 4H8SA 3ULCA 5J3YA 1MKEA 3TO1A 1FGYA 4GXBA 2DKQA 1U5GA 3DXDA 4HAUB 1AWEA 1BWNA 4GN1A 1WJMA 2NBVA 1WJ1A 1X05A 3RCPA 2YS1A 2LKOA 3PG7A 3VIAA 2ELBA 2COAA 3B77A 3AU4A 2XQNM 2AL6A 4HATB 3KSYA 4HB4B 1QC6A 1AQCA 5HE3A 5KQ1A 5KQ4A 1RRPB 3WYFB 2RSGA 1K5DB 2Y7BA 4XWXA 4CHMA 2X18A 2HTHB 2M14A 3AU5A 2CY4A 2J0KA 4HHVA 1ZYIA 1TXDA 3PP2A 3A98B 4YONA 2KIEA 1K5GB
chains in the Genus database with same CATH topology
4CYEA 4BBKA 1XCGA 2OQBA 1V61A 2OTXA 3SYXA 2DYNA 2COCA 1ISNA 1DROA 2UVMA 1J19A 1XODA 1B55A 1UPQA 2RGNB 3DXEA 2J0JA 4KHOA 4F7GA 5KCVA 1TQZA 1I2HA 1WG7A 3DXCA 2QKMA 3GYOA 2D11A 1FHWA 1DDWA 2VKIA 2D10A 2J0MA 4L6EA 3SO6A 2DYQA 2Z0QA 5DIFB 1MK7B 2H7EA 3F5RA 1BTKA 2Q13A 4HDQA 1ZSQA 4WVFB 1KZGA 1KI1B 4HAYB 5D27A 1U5EA 2YS3A 1V5UA 1WVHA 1Y5OA 5LOPB 5HE1A 1SHCA 2VSZA 4K2OA 5FI0A 1XD4A 3CXBB 4EKUA 4EJNA 1P5TA 1GC7A 2RNRB 4HDOA 4ZRIA 3T06A 2K00A 4YL8A 1UNRA 1V5MA 2D9ZA 5DHAB 5GOWB 2W2XD 2MDXA 1WGUA 3QWMA 1I7AA 2I1KA 2UZRA 3QIJA 2KUPA 4GZUA 2ROVA 2ZPYA 1NU2A 3O96A 2NMBA 2I5FA 1W1DA 4TKNA 1BTNA 3X23A 3ULBA 1V89A 3ODOA 3P7ZA 2G35A 1NTYA 4A6FA 3HW2B 2N0YA 3A8PA 4HB3B 3KZ1A 4DX90 3PZDA 1Q67A 3HQCA 2E2XA 3MDBC 4C0AA 5JHHA 1EF1A 2YT0A 1MIXA 1BAKA 3MPXA 4WSFA 2UZSA 5L81A 2N23A 2Y8GA 2IYBA 3BJIA 4NSWA 2LOZA 3AJ4A 2DFKA 3TVVA 3PEGA 2D4QA 2D9VA 1H10A 5EFXA 5HE0A 1Z87A 5D3XA 3F0WA 2RVBB 2BCJA 1ZC4B 2ELAA 1M7RA 3ODWA 3SNHA 5DI9B 5DH9B 5D3YA 2MWNB 3CIKA 3U7DA 2GCLA 1WGQA 1UEFA 3GYPA 2NZ8B 1IRSA 4K17A 2YS5A 3U8ZA 1H4RA 3OANA 4MY6A 1EVHA 1U5FA 1DDMA 2RLOA 4A5KA 2CODA 2J59M 1SGHA 2M38A 2LOXA 1PFJA 3HK0A 3NSUA 1PLSA 2DTCA 4PQ0A 3PSCA 1FAOA 2LG1A 2YVCA 1E5WA 2H7DA 2ADZA 2DA0A 1FOEA 1WI1A 2MKRA 3ZVRA 2CRFA 2L1CA 4A6FB 1P3RA 1P6SA 1UNQA 2DHJA 1LW3A 2EMTA 1V88A 2W2WA 1Y19B 4F7HA 3TCAA 1GG3A 1FHOA 2GS0A 1ZC3B 2GJYA 2D2QA 5HE2A 2KCJA 4EMOA 1V5PA 5FI1A 4MK0A 2W2XC 4KHAA 5LONB 1QQGA 1TJ6A 2YT1A 2PZ1A 2DX1A 1OY2A 2EMSA 4KHBB 5JP4A 2IFSA 1X1GA 2GCJA 2DN6A 2Y8FA 2V76A 1U5DA 3LJUX 4ZRKA 4K2PA 5C6RA 1X86A 4HB2B 2DX5A 2P0DA 5JLJB 1N3HA 4GMXB 3G9WA 4Y94A 3KRXA 4MT7A 2RUKB 4DBBA 2K2UA 1GC6A 2LYDA 3TW1A 1EAZA 1W1GA 1U2BA 4HAWB 2MFQA 4HAXB 3FSSA 3D8EA 2I5CA 2P0FA 3PVLA 3V5WA 5C5BA 4PNKA 1NI2A 1U29A 1X11A 3A8QA 4DXAB 2Z0PA 1RJ2A 2CY5A 3QBVB 5CLLB 2FJLA 2AEHA 1XX0A 4P7IA 1FHXA 5C79A 4F7UP 2EC1A 5JHGA 2LULA 3BINA 2JP2A 1XKEA 2DHIA 3P6AA 2KGXB 3ODXA 4KVGB 1NTVA 1PMSA 2D9YA 4ZRJA 3ML4A 4TYZA 4HAVB 4A6KA 2D9WA 5D3VA 4DX8A 2DHKA 1DBHA 3KRWA 1J0WA 4Z2MB 4A6HA 3SUZA 3TFMA 3FM8C 1UNPA 3IVFA 5J3TA 1MIZB 2R0DA 4NY0A 3D8FA 3SV1A 4GMVA 4D0NB 5D3WA 3UZTA 3M1IB 1MPHA 1FGZA 1DYNA 3D8DA 3N7CA 4IAPA 4HB0B 2P8VA 1U27A 1ZM0A 2HE7A 4KAXB 4Z2NA 2YRYA 2QKLA 1X1FA 1W1HA 1MAIA 2COFA 3FEHA 4B6HA 1OQNA 2YSZA 2L2IA 2P0HA 1KZ7A 4IFSA 2VRWB 5DHFB 1FB8A 5CLQB 3PVWA 2I1JA 1DDVA 1LB1A 1ZVRA 3ZDTA 2D9XA 2YF0A 4WJ7A 3KY9A 1XR0B 2DLWA 5C5BB 4HAZB 5J3QA 1EGXA 3WA0A 2EJ8A 1UPRA 2ROZB 1MK9B 2CAYA 2Z0OA 4IOYX 4K81A 5C16A 2K2JA 3PVUA 1M7EA 4CHJA 2DKPA 2R09A 4GPTB 1OMWA 3VOQA 4H8SA 3ULCA 5J3YA 1MKEA 3TO1A 1FGYA 4GXBA 2DKQA 1U5GA 3DXDA 4HAUB 1AWEA 1BWNA 4GN1A 1WJMA 1WJ1A 1X05A 3RCPA 2YS1A 2LKOA 3PG7A 3VIAA 2ELBA 2COAA 3AU4A 2XQNM 2AL6A 4HATB 3KSYA 4HB4B 1QC6A 1AQCA 5HE3A 5KQ1A 5KQ4A 1RRPB 3WYFB 2RSGA 1K5DB 2Y7BA 4XWXA 4CHMA 2X18A 2HTHB 2M14A 3AU5A 2CY4A 2J0KA 4HHVA 1TXDA 3PP2A 3A98B 4YONA 1K5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  4BBK A;  1XCG A;  2OQB A;  1V61 A;  2OTX A;  3SYX A;  2DYN A;  2COC A;  1ISN A;  1DRO A;  2UVM A;  1J19 A;  1XOD A;  1B55 A;  1UPQ A;  2RGN B;  3DXE A;  2J0J A;  4KHO A;  4F7G A;  5KCV A;  1TQZ A;  1I2H A;  1WG7 A;  3DXC A;  2QKM A;  3GYO A;  2D11 A;  1FHW A;  1DDW A;  2VKI A;  2D10 A;  2J0M A;  4L6E A;  3SO6 A;  2DYQ A;  2Z0Q A;  5DIF B;  1MK7 B;  2H7E A;  3F5R A;  1BTK A;  2Q13 A;  4HDQ A;  1ZSQ A;  4WVF B;  1KZG A;  1KI1 B;  4HAY B;  5D27 A;  1U5E A;  2YS3 A;  1V5U A;  1WVH A;  1Y5O A;  5LOP B;  5HE1 A;  1SHC A;  2VSZ A;  4K2O A;  5FI0 A;  1XD4 A;  3CXB B;  4EKU A;  4EJN A;  1P5T A;  1GC7 A;  2RNR B;  4HDO A;  4ZRI A;  3T06 A;  2K00 A;  4YL8 A;  1UNR A;  1V5M A;  2D9Z A;  5DHA B;  5GOW B;  2W2X D;  2MDX A;  1WGU A;  3QWM A;  1I7A A;  2I1K A;  2UZR A;  3QIJ A;  2KUP A;  4GZU A;  2ROV A;  2ZPY A;  1NU2 A;  3O96 A;  2NMB A;  2I5F A;  1W1D A;  4TKN A;  1BTN A;  3X23 A;  3ULB A;  1V89 A;  3ODO A;  3P7Z A;  2G35 A;  1NTY A;  4A6F A;  3HW2 B;  2N0Y A;  3A8P A;  4HB3 B;  3KZ1 A;  4DX9 0;  3PZD A;  1Q67 A;  3HQC A;  2E2X A;  3MDB C;  4C0A A;  5JHH A;  1EF1 A;  2YT0 A;  1MIX A;  1BAK A;  3MPX A;  4WSF A;  2UZS A;  5L81 A;  2N23 A;  2Y8G A;  2IYB A;  3BJI A;  4NSW A;  2LOZ A;  3AJ4 A;  2DFK A;  3TVV A;  3PEG A;  2D4Q A;  2D9V A;  1H10 A;  5EFX A;  5HE0 A;  1Z87 A;  5D3X A;  3F0W A;  2RVB B;  2BCJ A;  1ZC4 B;  2ELA A;  1M7R A;  3ODW A;  3SNH A;  5DI9 B;  5DH9 B;  5D3Y A;  2MWN B;  3CIK A;  3U7D A;  2GCL A;  1WGQ A;  1UEF A;  3GYP A;  2NZ8 B;  1IRS A;  4K17 A;  2YS5 A;  3U8Z A;  1H4R A;  3OAN A;  4MY6 A;  1EVH A;  1U5F A;  1DDM A;  2RLO A;  4A5K A;  2COD A;  2J59 M;  1SGH A;  2M38 A;  2LOX A;  1PFJ A;  3HK0 A;  3NSU A;  1PLS A;  2DTC A;  4PQ0 A;  3PSC A;  1FAO A;  2LG1 A;  2YVC A;  1E5W A;  2H7D A;  2ADZ A;  2DA0 A;  1FOE A;  1WI1 A;  2MKR A;  3ZVR A;  2CRF A;  2L1C A;  4A6F B;  1P3R A;  1P6S A;  1UNQ A;  2DHJ A;  1LW3 A;  2EMT A;  1V88 A;  2W2W A;  1Y19 B;  4F7H A;  3TCA A;  1GG3 A;  1FHO A;  2GS0 A;  1ZC3 B;  2GJY A;  2D2Q A;  5HE2 A;  2KCJ A;  4EMO A;  1V5P A;  5FI1 A;  4MK0 A;  2W2X C;  4KHA A;  5LON B;  1QQG A;  1TJ6 A;  2YT1 A;  2PZ1 A;  2DX1 A;  1OY2 A;  2EMS A;  4KHB B;  5JP4 A;  2IFS A;  1X1G A;  2GCJ A;  2DN6 A;  2Y8F A;  2V76 A;  1U5D A;  3LJU X;  4ZRK A;  4K2P A;  5C6R A;  1X86 A;  4HB2 B;  2DX5 A;  2P0D A;  5JLJ B;  1N3H A;  4GMX B;  3G9W A;  4Y94 A;  3KRX A;  4MT7 A;  2RUK B;  4DBB A;  2K2U A;  1GC6 A;  2LYD A;  3TW1 A;  1EAZ A;  1W1G A;  1U2B A;  4HAW B;  2MFQ A;  4HAX B;  3FSS A;  3D8E A;  2I5C A;  2P0F A;  3PVL A;  3V5W A;  5C5B A;  4PNK A;  1NI2 A;  1U29 A;  1X11 A;  3A8Q A;  4DXA B;  2Z0P A;  1RJ2 A;  2CY5 A;  3QBV B;  5CLL B;  2FJL A;  2AEH A;  1XX0 A;  4P7I A;  1FHX A;  5C79 A;  4F7U P;  2EC1 A;  5JHG A;  2LUL A;  3BIN A;  2JP2 A;  1XKE A;  2DHI A;  3P6A A;  2KGX B;  3ODX A;  4KVG B;  1NTV A;  1PMS A;  2D9Y A;  4ZRJ A;  3ML4 A;  4TYZ A;  4HAV B;  4A6K A;  2D9W A;  5D3V A;  4DX8 A;  2DHK A;  1DBH A;  3KRW A;  1J0W A;  4Z2M B;  4A6H A;  3SUZ A;  3TFM A;  3FM8 C;  1UNP A;  3IVF A;  5J3T A;  1MIZ B;  2R0D A;  4NY0 A;  3D8F A;  3SV1 A;  4GMV A;  4D0N B;  5D3W A;  3UZT A;  3M1I B;  1MPH A;  1FGZ A;  1DYN A;  3D8D A;  3N7C A;  4IAP A;  4HB0 B;  2P8V A;  1U27 A;  1ZM0 A;  2HE7 A;  4KAX B;  4Z2N A;  2YRY A;  2QKL A;  1X1F A;  1W1H A;  1MAI A;  2COF A;  3FEH A;  4B6H A;  1OQN A;  2YSZ A;  2L2I A;  2P0H A;  1KZ7 A;  4IFS A;  2VRW B;  5DHF B;  1FB8 A;  5CLQ B;  3PVW A;  2I1J A;  1DDV A;  1LB1 A;  1ZVR A;  3ZDT A;  2D9X A;  2YF0 A;  4WJ7 A;  3KY9 A;  1XR0 B;  2DLW A;  5C5B B;  4HAZ B;  5J3Q A;  1EGX A;  3WA0 A;  2EJ8 A;  1UPR A;  2ROZ B;  1MK9 B;  2CAY A;  2Z0O A;  4IOY X;  4K81 A;  5C16 A;  2K2J A;  3PVU A;  1M7E A;  4CHJ A;  2DKP A;  2R09 A;  4GPT B;  1OMW A;  3VOQ A;  4H8S A;  3ULC A;  5J3Y A;  1MKE A;  3TO1 A;  1FGY A;  4GXB A;  2DKQ A;  1U5G A;  3DXD A;  4HAU B;  1AWE A;  1BWN A;  4GN1 A;  1WJM A;  1WJ1 A;  1X05 A;  3RCP A;  2YS1 A;  2LKO A;  3PG7 A;  3VIA A;  2ELB A;  2COA A;  3AU4 A;  2XQN M;  2AL6 A;  4HAT B;  3KSY A;  4HB4 B;  1QC6 A;  1AQC A;  5HE3 A;  5KQ1 A;  5KQ4 A;  1RRP B;  3WYF B;  2RSG A;  1K5D B;  2Y7B A;  4XWX A;  4CHM A;  2X18 A;  2HTH B;  2M14 A;  3AU5 A;  2CY4 A;  2J0K A;  4HHV A;  1TXD A;  3PP2 A;  3A98 B;  4YON A;  1K5G B; 
#chains in the Genus database with same CATH topology
 4CYE A;  4BBK A;  1XCG A;  2OQB A;  1V61 A;  2OTX A;  3SYX A;  2DYN A;  2COC A;  3A58 A;  1ISN A;  5M4Y B;  1DRO A;  3NWD A;  2UVM A;  4QJ3 B;  1J19 A;  1XOD A;  1B55 A;  1UPQ A;  2RGN B;  3DXE A;  2J0J A;  3NWF A;  2RRF A;  4KHO A;  4F7G A;  5KCV A;  1TQZ A;  1I2H A;  1WG7 A;  3DXC A;  2QKM A;  3GYO A;  2D11 A;  1FHW A;  1DDW A;  2VKI A;  2D10 A;  2J0M A;  4L6E A;  3SO6 A;  2DYQ A;  2Z0Q A;  5DIF B;  1MK7 B;  2Z59 A;  2H7E A;  3F5R A;  1BTK A;  2Q13 A;  4HDQ A;  1ZSQ A;  4WVF B;  1KZG A;  1KI1 B;  4HAY B;  5D27 A;  1U5E A;  2YS3 A;  1V5U A;  1WVH A;  1Y5O A;  5LOP B;  5HE1 A;  1SHC A;  2VSZ A;  4K2O A;  5FI0 A;  1XD4 A;  3CXB B;  4EKU A;  4EJN A;  1P5T A;  1GC7 A;  2RNR B;  4HDO A;  4ZRI A;  3T06 A;  2K00 A;  4YL8 A;  1UNR A;  1V5M A;  2D9Z A;  4GNK B;  5DHA B;  5GOW B;  2W2X D;  2MDX A;  1WGU A;  3QWM A;  1I7A A;  2I1K A;  2UZR A;  3QIJ A;  2KUP A;  4GZU A;  2ROV A;  2ZPY A;  1NU2 A;  3O96 A;  2K49 A;  2NMB A;  2I5F A;  1W1D A;  4HSI A;  4TKN A;  1BTN A;  3X23 A;  3ULB A;  3NWA A;  3HSA A;  1V89 A;  3ODO A;  3DCX A;  3P7Z A;  2G35 A;  1NTY A;  4A6F A;  3HW2 B;  2N0Y A;  4GOU A;  3A8P A;  4HB3 B;  3KZ1 A;  4CSQ A;  4DX9 0;  2R2Y A;  1Q67 A;  3HQC A;  3PZD A;  2E2X A;  3MDB C;  4C0A A;  5JHH A;  1EF1 A;  2YT0 A;  1MIX A;  1BAK A;  3MPX A;  4WSF A;  2UZS A;  5L81 A;  2N23 A;  2Y8G A;  2IYB A;  3BJI A;  4NSW A;  2LOZ A;  3AJ4 A;  4QJ4 B;  2DFK A;  3TVV A;  3PEG A;  3FVC A;  2D4Q A;  2D9V A;  1H10 A;  5EFX A;  5HE0 A;  1Z87 A;  5D3X A;  5LG4 B;  3F0W A;  2RVB B;  2BCJ A;  4KHB A;  1ZC4 B;  2ELA A;  1M7R A;  3ODW A;  3SNH A;  5DI9 B;  5DH9 B;  5D3Y A;  2MWN B;  3CIK A;  3U7D A;  2GCL A;  1WGQ A;  1UEF A;  3GYP A;  2NZ8 B;  1IRS A;  5I2M A;  4K17 A;  2YS5 A;  4QJ5 B;  3U8Z A;  4OSN A;  1H4R A;  3OAN A;  4MY6 A;  1EVH A;  1U5F A;  1DDM A;  2RLO A;  4A5K A;  2COD A;  2J59 M;  2ZKM X;  1SGH A;  2M38 A;  2LOX A;  4OT1 A;  1PFJ A;  3HK0 A;  3NSU A;  1PLS A;  2DTC A;  2KIG A;  4PQ0 A;  3PSC A;  1FAO A;  2LG1 A;  2YVC A;  1E5W A;  2H7D A;  2ADZ A;  2DA0 A;  1FOE A;  1WI1 A;  2MKR A;  2GUM A;  3ZVR A;  2CRF A;  2Z14 A;  2L1C A;  4A6F B;  1P3R A;  1P6S A;  1UNQ A;  2DHJ A;  1LW3 A;  2EMT A;  1V88 A;  2W2W A;  1Y19 B;  4F7H A;  3TCA A;  2KUQ A;  1GG3 A;  1FHO A;  2GS0 A;  1ZC3 B;  2GJY A;  2D2Q A;  5HE2 A;  2KCJ A;  4EMO A;  1V5P A;  2Z4D A;  4D6W A;  5FI1 A;  4MK0 A;  2W2X C;  4KHA A;  5LON B;  1QQG A;  1TJ6 A;  2YT1 A;  1T77 A;  2PZ1 A;  2DX1 A;  1OY2 A;  2EMS A;  4KHB B;  5JP4 A;  2IFS A;  1X1G A;  2GCJ A;  2DN6 A;  2Y8F A;  2V76 A;  1U5D A;  2FJU B;  3LJU X;  4ZRK A;  4K2P A;  5C6R A;  3NW8 A;  1X86 A;  4HB2 B;  2DX5 A;  2P0D A;  5JLJ B;  1N3H A;  4GMX B;  3G9W A;  4Y94 A;  3KRX A;  4MT7 A;  2RUK B;  4DBB A;  2K2U A;  1GC6 A;  2LYD A;  3TW1 A;  5IRS A;  1EAZ A;  1W1G A;  1U2B A;  4HAW B;  3OHM B;  2MFQ A;  4HAX B;  3FSS A;  3D8E A;  2I5C A;  2P0F A;  3PVL A;  3V5W A;  5C5B A;  4PNK A;  1NI2 A;  1U29 A;  1X11 A;  3A8Q A;  4DXA B;  2Z0P A;  1RJ2 A;  2CY5 A;  4L1R A;  3QBV B;  5CLL B;  2FJL A;  2AEH A;  1XX0 A;  4P7I A;  1FHX A;  5C79 A;  4F7U P;  2EC1 A;  5JHG A;  2LUL A;  3BIN A;  2JP2 A;  1XKE A;  2YT2 A;  2DHI A;  3P6A A;  2KGX B;  3ODX A;  4KVG B;  4DIX A;  1NTV A;  1PMS A;  2D9Y A;  4ZRJ A;  3ML4 A;  4TYZ A;  4HAV B;  4A6K A;  2D9W A;  5D3V A;  4DX8 A;  2DHK A;  1DBH A;  3KRW A;  1J0W A;  4Z2M B;  4A6H A;  3SUZ A;  3HIE A;  3TFM A;  3FM8 C;  1UNP A;  3IVF A;  5J3T A;  1MIZ B;  2R0D A;  4NY0 A;  3D8F A;  2KR0 A;  3SV1 A;  4GMV A;  4D0N B;  5D3W A;  3UZT A;  3M1I B;  1MPH A;  1FGZ A;  1DYN A;  3D8D A;  3N7C A;  4IAP A;  4HB0 B;  5I2S A;  2P8V A;  1U27 A;  1ZM0 A;  2HE7 A;  4KAX B;  4Z2N A;  2YRY A;  2QKL A;  1X1F A;  3U12 A;  1W1H A;  1MAI A;  2COF A;  3FEH A;  4B6H A;  1OQN A;  2YSZ A;  2L2I A;  2P0H A;  1KZ7 A;  4IFS A;  2VRW B;  5DHF B;  1FB8 A;  5CLQ B;  3PVW A;  2I1J A;  1DDV A;  1LB1 A;  1ZVR A;  2Z13 A;  3ZDT A;  2K8E A;  2D9X A;  2YF0 A;  4WJ7 A;  3KY9 A;  1XR0 B;  2DLW A;  5C5B B;  4HAZ B;  5J3Q A;  1EGX A;  3WA0 A;  2EJ8 A;  4QXA B;  1UPR A;  2ROZ B;  1MK9 B;  1MI1 A;  2CAY A;  2Z0O A;  4IOY X;  4K81 A;  5C16 A;  2K2J A;  3PVU A;  1M7E A;  4CHJ A;  2DKP A;  2R09 A;  4GPT B;  1OMW A;  3VOQ A;  4H8S A;  3ULC A;  5J3Y A;  1MKE A;  3TO1 A;  1FGY A;  4GXB A;  2DKQ A;  1U5G A;  3DXD A;  4HAU B;  1AWE A;  1BWN A;  4GN1 A;  1WJM A;  2NBV A;  1WJ1 A;  1X05 A;  3RCP A;  2YS1 A;  2LKO A;  3PG7 A;  3VIA A;  2ELB A;  2COA A;  3B77 A;  3AU4 A;  2XQN M;  2AL6 A;  4HAT B;  3KSY A;  4HB4 B;  1QC6 A;  1AQC A;  5HE3 A;  5KQ1 A;  5KQ4 A;  1RRP B;  3WYF B;  2RSG A;  1K5D B;  2Y7B A;  4XWX A;  4CHM A;  2X18 A;  2HTH B;  2M14 A;  3AU5 A;  2CY4 A;  2J0K A;  4HHV A;  1ZYI A;  1TXD A;  3PP2 A;  3A98 B;  4YON A;  2KIE A;  1K5G B; 
#chains in the Genus database with same CATH homology
 4CYE A;  4BBK A;  1XCG A;  2OQB A;  1V61 A;  2OTX A;  3SYX A;  2DYN A;  2COC A;  1ISN A;  1DRO A;  2UVM A;  1J19 A;  1XOD A;  1B55 A;  1UPQ A;  2RGN B;  3DXE A;  2J0J A;  4KHO A;  4F7G A;  5KCV A;  1TQZ A;  1I2H A;  1WG7 A;  3DXC A;  2QKM A;  3GYO A;  2D11 A;  1FHW A;  1DDW A;  2VKI A;  2D10 A;  2J0M A;  4L6E A;  3SO6 A;  2DYQ A;  2Z0Q A;  5DIF B;  1MK7 B;  2H7E A;  3F5R A;  1BTK A;  2Q13 A;  4HDQ A;  1ZSQ A;  4WVF B;  1KZG A;  1KI1 B;  4HAY B;  5D27 A;  1U5E A;  2YS3 A;  1V5U A;  1WVH A;  1Y5O A;  5LOP B;  5HE1 A;  1SHC A;  2VSZ A;  4K2O A;  5FI0 A;  1XD4 A;  3CXB B;  4EKU A;  4EJN A;  1P5T A;  1GC7 A;  2RNR B;  4HDO A;  4ZRI A;  3T06 A;  2K00 A;  4YL8 A;  1UNR A;  1V5M A;  2D9Z A;  5DHA B;  5GOW B;  2W2X D;  2MDX A;  1WGU A;  3QWM A;  1I7A A;  2I1K A;  2UZR A;  3QIJ A;  2KUP A;  4GZU A;  2ROV A;  2ZPY A;  1NU2 A;  3O96 A;  2NMB A;  2I5F A;  1W1D A;  4TKN A;  1BTN A;  3X23 A;  3ULB A;  1V89 A;  3ODO A;  3P7Z A;  2G35 A;  1NTY A;  4A6F A;  3HW2 B;  2N0Y A;  3A8P A;  4HB3 B;  3KZ1 A;  4DX9 0;  3PZD A;  1Q67 A;  3HQC A;  2E2X A;  3MDB C;  4C0A A;  5JHH A;  1EF1 A;  2YT0 A;  1MIX A;  1BAK A;  3MPX A;  4WSF A;  2UZS A;  5L81 A;  2N23 A;  2Y8G A;  2IYB A;  3BJI A;  4NSW A;  2LOZ A;  3AJ4 A;  2DFK A;  3TVV A;  3PEG A;  2D4Q A;  2D9V A;  1H10 A;  5EFX A;  5HE0 A;  1Z87 A;  5D3X A;  3F0W A;  2RVB B;  2BCJ A;  1ZC4 B;  2ELA A;  1M7R A;  3ODW A;  3SNH A;  5DI9 B;  5DH9 B;  5D3Y A;  2MWN B;  3CIK A;  3U7D A;  2GCL A;  1WGQ A;  1UEF A;  3GYP A;  2NZ8 B;  1IRS A;  4K17 A;  2YS5 A;  3U8Z A;  1H4R A;  3OAN A;  4MY6 A;  1EVH A;  1U5F A;  1DDM A;  2RLO A;  4A5K A;  2COD A;  2J59 M;  1SGH A;  2M38 A;  2LOX A;  1PFJ A;  3HK0 A;  3NSU A;  1PLS A;  2DTC A;  4PQ0 A;  3PSC A;  1FAO A;  2LG1 A;  2YVC A;  1E5W A;  2H7D A;  2ADZ A;  2DA0 A;  1FOE A;  1WI1 A;  2MKR A;  3ZVR A;  2CRF A;  2L1C A;  4A6F B;  1P3R A;  1P6S A;  1UNQ A;  2DHJ A;  1LW3 A;  2EMT A;  1V88 A;  2W2W A;  1Y19 B;  4F7H A;  3TCA A;  1GG3 A;  1FHO A;  2GS0 A;  1ZC3 B;  2GJY A;  2D2Q A;  5HE2 A;  2KCJ A;  4EMO A;  1V5P A;  5FI1 A;  4MK0 A;  2W2X C;  4KHA A;  5LON B;  1QQG A;  1TJ6 A;  2YT1 A;  2PZ1 A;  2DX1 A;  1OY2 A;  2EMS A;  4KHB B;  5JP4 A;  2IFS A;  1X1G A;  2GCJ A;  2DN6 A;  2Y8F A;  2V76 A;  1U5D A;  3LJU X;  4ZRK A;  4K2P A;  5C6R A;  1X86 A;  4HB2 B;  2DX5 A;  2P0D A;  5JLJ B;  1N3H A;  4GMX B;  3G9W A;  4Y94 A;  3KRX A;  4MT7 A;  2RUK B;  4DBB A;  2K2U A;  1GC6 A;  2LYD A;  3TW1 A;  1EAZ A;  1W1G A;  1U2B A;  4HAW B;  2MFQ A;  4HAX B;  3FSS A;  3D8E A;  2I5C A;  2P0F A;  3PVL A;  3V5W A;  5C5B A;  4PNK A;  1NI2 A;  1U29 A;  1X11 A;  3A8Q A;  4DXA B;  2Z0P A;  1RJ2 A;  2CY5 A;  3QBV B;  5CLL B;  2FJL A;  2AEH A;  1XX0 A;  4P7I A;  1FHX A;  5C79 A;  4F7U P;  2EC1 A;  5JHG A;  2LUL A;  3BIN A;  2JP2 A;  1XKE A;  2DHI A;  3P6A A;  2KGX B;  3ODX A;  4KVG B;  1NTV A;  1PMS A;  2D9Y A;  4ZRJ A;  3ML4 A;  4TYZ A;  4HAV B;  4A6K A;  2D9W A;  5D3V A;  4DX8 A;  2DHK A;  1DBH A;  3KRW A;  1J0W A;  4Z2M B;  4A6H A;  3SUZ A;  3TFM A;  3FM8 C;  1UNP A;  3IVF A;  5J3T A;  1MIZ B;  2R0D A;  4NY0 A;  3D8F A;  3SV1 A;  4GMV A;  4D0N B;  5D3W A;  3UZT A;  3M1I B;  1MPH A;  1FGZ A;  1DYN A;  3D8D A;  3N7C A;  4IAP A;  4HB0 B;  2P8V A;  1U27 A;  1ZM0 A;  2HE7 A;  4KAX B;  4Z2N A;  2YRY A;  2QKL A;  1X1F A;  1W1H A;  1MAI A;  2COF A;  3FEH A;  4B6H A;  1OQN A;  2YSZ A;  2L2I A;  2P0H A;  1KZ7 A;  4IFS A;  2VRW B;  5DHF B;  1FB8 A;  5CLQ B;  3PVW A;  2I1J A;  1DDV A;  1LB1 A;  1ZVR A;  3ZDT A;  2D9X A;  2YF0 A;  4WJ7 A;  3KY9 A;  1XR0 B;  2DLW A;  5C5B B;  4HAZ B;  5J3Q A;  1EGX A;  3WA0 A;  2EJ8 A;  1UPR A;  2ROZ B;  1MK9 B;  2CAY A;  2Z0O A;  4IOY X;  4K81 A;  5C16 A;  2K2J A;  3PVU A;  1M7E A;  4CHJ A;  2DKP A;  2R09 A;  4GPT B;  1OMW A;  3VOQ A;  4H8S A;  3ULC A;  5J3Y A;  1MKE A;  3TO1 A;  1FGY A;  4GXB A;  2DKQ A;  1U5G A;  3DXD A;  4HAU B;  1AWE A;  1BWN A;  4GN1 A;  1WJM A;  1WJ1 A;  1X05 A;  3RCP A;  2YS1 A;  2LKO A;  3PG7 A;  3VIA A;  2ELB A;  2COA A;  3AU4 A;  2XQN M;  2AL6 A;  4HAT B;  3KSY A;  4HB4 B;  1QC6 A;  1AQC A;  5HE3 A;  5KQ1 A;  5KQ4 A;  1RRP B;  3WYF B;  2RSG A;  1K5D B;  2Y7B A;  4XWX A;  4CHM A;  2X18 A;  2HTH B;  2M14 A;  3AU5 A;  2CY4 A;  2J0K A;  4HHV A;  1TXD A;  3PP2 A;  3A98 B;  4YON A;  1K5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...