2DHIA

Solution structure of the ph domain of evectin-2 from mouse
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GSSGSSGFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Solution structure of the PH domain of Evectin-2 from mouse
rcsb
source organism Mus musculus
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhiA00
5KQ1A 1WGUA 1UNPA 1UEFA 1FGZA 2EMTA 2D9VA 3KZ1A 1IRSA 3PSCA 1W1DA 4YONA 4D0NB 2P0DA 1WI1A 4PNKA 1MK7B 4DXAB 5C6RA 2M14A 1W1GA 3QBVB 5CLQB 1PMSA 1ZM0A 5L81A 4A6FB 2GJYA 1UNRA 2LKOA 1DDVA 3NSUA 2NMBA 2OTXA 2DYQA 4A6KA 2L2IA 3FSSA 2R09A 4HDOA 4Z2NA 2FJLA 2J0KA 3LJUX 4A6FA 4GN1A 1Q67A 2YF0A 3BINA 2Y8GA 1FGYA 4ZRJA 1XCGA 3D8EA 2COCA 2PZ1A 1OMWA 2COFA 3TVVA 2EC1A 2W2XC 2DLWA 4GXBA 2Q13A 2DKQA 2Z0QA 2Y7BA 3ODOA 1XX0A 2HE7A 3VIAA 4EKUA 2LULA 1ZC4B 2DHKA 2CRFA 4F7HA 1GG3A 2CAYA 3P6AA 5HE2A 2YVCA 1NU2A 4EMOA 2ELAA 5JLJB 5D3VA 2D11A 2YS3A 3A8PA 2KGXB 4K17A 1ZSQA 1BTKA 4CHJA 2UZRA 2CY5A 2P0HA 2J59M 1X86A 4ZRKA 1EF1A 3SV1A 2MKRA 4IFSA 1N3HA 5DIFB 2DN6A 2H7DA 1U5EA 2D2QA 1X1FA 2LYDA 3FEHA 1V88A 1B55A 1SGHA 4HAVB 2KCJA 4XWXA 1MKEA 4K2PA 5GOWB 4KVGB 1P5TA 1FB8A 5JHHA 2RLOA 1AQCA 1X05A 3QWMA 2W2WA 1LW3A 1DYNA 2DTCA 4C0AA 1FAOA 5FI0A 1GC7A 1U27A 3MDBC 4A5KA 2BCJA 3ODXA 3IVFA 3D8DA 2RNRB 2GCLA 3PP2A 3F5RA 2L1CA 2MFQA 2I1JA 1J19A 1X11A 4TKNA 1UNQA 2K00A 3ODWA 1DDMA 2DYNA 1V5UA 1V5PA 2X18A 4F7GA 3FM8C 5FI1A 2DA0A 2ZPYA 4MK0A 1NTVA 1V89A 3U7DA 4B6HA 2Z0PA 2CY4A 3PVLA 1FHXA 2QKLA 4CHMA 2VSZA 1GC6A 2YSZA 1MIXA 4KHAA 2ROZB 1XKEA 2I1KA 5HE3A 2IFSA 5KQ4A 4KHBB 2MDXA 5HE1A 3ULCA 3AJ4A 5DH9B 2I5FA 4GMVA 4HB2B 4GMXB 3SYXA 1LB1A 3V5WA 1FHWA 1Y5OA 4IOYX 4HAWB 2N0YA 1OQNA 4MY6A 5DI9B 3G9WA 1MPHA 3M1IB 1M7RA 5C16A 3GYOA 5KCVA 2R0DA 1ZC3B 2GCJA 2M38A 3ULBA 5DHFB 2LOZA 3PVUA 4A6HA 1SHCA 2UVMA 1BAKA 2P0FA 1TQZA 1H10A 1E5WA 1EGXA 3TFMA 1I7AA 5D3XA 2GS0A 3OANA 2ADZA 2DX5A 3D8FA 1NTYA 2DX1A 1V61A 2DKPA 4Y94A 2K2JA 4TYZA 4CYEA 2I5CA 4HAYB 4PQ0A 3T06A 3SNHA 1QC6A 1W1HA 1U2BA 2ELBA 2ROVA 4H8SA 1P6SA 3WA0A 3WYFB 2HTHB 2JP2A 5LOPB 2D9XA 4WVFB 1U5FA 3DXCA 4IAPA 1FHOA 2AL6A 1RRPB 4F7UP 1MK9B 1KI1B 4HAUB 3HQCA 1K5DB 2VKIA 1EAZA 4NSWA 5LONB 1OY2A 2N23A 4HHVA 3KRWA 4MT7A 2D9YA 5EFXA 3CIKA 3ZDTA 3SUZA 5D3YA 5C79A 1DBHA 1K5GB 3PVWA 2RGNB 3AU5A 1FOEA 2G35A 4GPTB 1XD4A 1ISNA 1TJ6A 1U5GA 4HAZB 1J0WA 2RUKB 3TO1A 1WVHA 3PZDA 1Z87A 2VRWB 1RJ2A 1DROA 2YS1A 1EVHA 3A98B 4WSFA 2RVBB 2V76A 2DFKA 4P7IA 4KHOA 1I2HA 4KAXB 1X1GA 1KZ7A 2NZ8B 5DHAB 2DHJA 1P3RA 3MPXA 5C5BB 1U29A 5J3TA 3HW2B 2EJ8A 4WJ7A 4EJNA 2CODA 2EMSA 2H7EA 2MWNB 3KSYA 3GYPA 3N7CA 4DX90 1PFJA 2DHIA 2J0JA 4HB4B 4K2OA 2UZSA 3KRXA 3PEGA 5HE0A 2LG1A 5D3WA 4ZRIA 3CXBB 5C5BA 3P7ZA 3TW1A 3ZVRA 4HDQA 5J3QA 3AU4A 1WJ1A 5JHGA 2COAA 2W2XD 4L6EA 2KUPA 3UZTA 2IYBA 1UPQA 3VOQA 1AWEA 1Y19B 2YT0A 3X23A 2AEHA 2YT1A 3BJIA 3A8QA 1KZGA 4GZUA 5D27A 1M7EA 2Y8FA 2D10A 5J3YA 4YL8A 2YRYA 3QIJA 1XODA 1UPRA 3HK0A 1MIZB 2E2XA 1H4RA 4BBKA 1TXDA 2LOXA 1MAIA 2J0MA 3PG7A 4NY0A 4Z2MB 1NI2A 1PLSA 5JP4A 4HB0B 2XQNM 1WGQA 2K2UA 3KY9A 3RCPA 3F0WA 2Z0OA 3SO6A 4HAXB 3U8ZA 3TCAA 1U5DA 2OQBA 1XR0B 2P8VA 3DXDA 4HB3B 2D9WA 2YS5A 1BWNA 2QKMA 4HATB 3ML4A 1WJMA 3DXEA 1WG7A 3O96A 2D4QA 4K81A 1ZVRA 4DBBA 1V5MA 5CLLB 1QQGA 1DDWA 2RSGA 1BTNA 4DX8A 2D9ZA
chains in the Genus database with same CATH superfamily
5KQ1A 1WGUA 1UNPA 1UEFA 1FGZA 2EMTA 2D9VA 3KZ1A 1IRSA 3PSCA 1W1DA 4YONA 4D0NB 2P0DA 1WI1A 4PNKA 1MK7B 2KIEA 4DXAB 5C6RA 2M14A 1W1GA 2FJUB 3QBVB 5CLQB 3A58A 1PMSA 2RRFA 1ZM0A 5L81A 4A6FB 2GJYA 1UNRA 2LKOA 1DDVA 3NSUA 2NMBA 2OTXA 2DYQA 4A6KA 2L2IA 3OHMB 3FSSA 2R09A 4HDOA 4Z2NA 2GUMA 2FJLA 2J0KA 3LJUX 4A6FA 4GN1A 1Q67A 2YF0A 3B77A 3BINA 2Y8GA 1FGYA 4ZRJA 1XCGA 3D8EA 2COCA 2PZ1A 1OMWA 2COFA 2ZKMX 3TVVA 2EC1A 2W2XC 2DLWA 4GXBA 2Q13A 2DKQA 2Z0QA 2Y7BA 3ODOA 1XX0A 2HE7A 3VIAA 4EKUA 2LULA 1ZC4B 2DHKA 2CRFA 4F7HA 1GG3A 2CAYA 3P6AA 5HE2A 2YVCA 1NU2A 4EMOA 2ELAA 5JLJB 5D3VA 1ZYIA 2D11A 2YS3A 3A8PA 2KGXB 4K17A 1ZSQA 1BTKA 4CHJA 2UZRA 4L1RA 2CY5A 2P0HA 2J59M 2KR0A 1X86A 4ZRKA 1EF1A 3SV1A 2MKRA 4IFSA 1N3HA 4OT1A 2Z13A 2DN6A 5DIFB 2H7DA 1U5EA 2D2QA 1X1FA 2LYDA 3FEHA 1V88A 1B55A 1SGHA 4HAVB 2KCJA 4XWXA 1MKEA 4K2PA 5GOWB 4KVGB 1P5TA 1FB8A 5JHHA 2RLOA 1AQCA 1X05A 3QWMA 2W2WA 1LW3A 1DYNA 2DTCA 4C0AA 1FAOA 5FI0A 5I2SA 1GC7A 1U27A 2Z59A 3MDBC 2BCJA 3ODXA 4A5KA 3IVFA 3D8DA 2RNRB 2GCLA 3PP2A 3F5RA 2L1CA 2MFQA 2I1JA 1J19A 1X11A 4TKNA 1UNQA 2K00A 3ODWA 1DDMA 2DYNA 1V5UA 1V5PA 4D6WA 2X18A 4F7GA 3FM8C 2K8EA 3HIEA 5FI1A 2DA0A 2ZPYA 4MK0A 1NTVA 1V89A 3U7DA 4B6HA 2Z0PA 2CY4A 3PVLA 1FHXA 2QKLA 4CHMA 2VSZA 1GC6A 2YSZA 1MIXA 4KHAA 2ROZB 1XKEA 2K49A 2I1KA 5HE3A 2IFSA 5KQ4A 4KHBB 2MDXA 5HE1A 3ULCA 3AJ4A 5DH9B 2I5FA 4GMVA 4HB2B 5IRSA 4GMXB 3SYXA 1LB1A 3V5WA 1FHWA 1Y5OA 4IOYX 4HAWB 2N0YA 1OQNA 4MY6A 5DI9B 3G9WA 1MPHA 4KHBA 3M1IB 1M7RA 5C16A 3GYOA 5KCVA 2R0DA 1ZC3B 2GCJA 2M38A 3ULBA 5DHFB 2LOZA 3PVUA 4A6HA 1SHCA 2UVMA 4CSQA 1BAKA 2P0FA 1TQZA 1H10A 3DCXA 1E5WA 1EGXA 3TFMA 1I7AA 5D3XA 2GS0A 3OANA 2ADZA 2DX5A 3D8FA 1NTYA 2DX1A 1V61A 2DKPA 4Y94A 5M4YB 3HSAA 2K2JA 4TYZA 4GOUA 4CYEA 2I5CA 4HAYB 4PQ0A 3T06A 3SNHA 1QC6A 1W1HA 1U2BA 2ELBA 2ROVA 4H8SA 1P6SA 3WA0A 3WYFB 2HTHB 2JP2A 2R2YA 5LOPB 2D9XA 4WVFB 1U5FA 3DXCA 4IAPA 1FHOA 2AL6A 1RRPB 4F7UP 1MK9B 1KI1B 4HSIA 4HAUB 3HQCA 1K5DB 2VKIA 1EAZA 4NSWA 5LONB 1OY2A 2N23A 4HHVA 3KRWA 4MT7A 2D9YA 5EFXA 4QXAB 3CIKA 3ZDTA 3SUZA 5D3YA 5C79A 1DBHA 1K5GB 3NWAA 3PVWA 2RGNB 3AU5A 1FOEA 2G35A 4GPTB 1XD4A 1ISNA 1TJ6A 4QJ4B 1U5GA 4HAZB 1J0WA 2RUKB 3TO1A 4GNKB 2YT2A 1WVHA 3PZDA 1Z87A 4DIXA 2VRWB 1RJ2A 1DROA 2YS1A 1EVHA 3A98B 4WSFA 1MI1A 2RVBB 2V76A 2DFKA 4P7IA 4KHOA 1I2HA 4KAXB 1X1GA 3NWFA 1KZ7A 2NZ8B 5DHAB 2DHJA 1P3RA 3MPXA 5C5BB 1U29A 5J3TA 3HW2B 2EJ8A 2NBVA 4WJ7A 4EJNA 2KUQA 2CODA 2EMSA 2H7EA 2MWNB 3KSYA 3GYPA 3N7CA 4DX90 1PFJA 2DHIA 2J0JA 4HB4B 4K2OA 2UZSA 3KRXA 3PEGA 5HE0A 2LG1A 5D3WA 4ZRIA 3CXBB 5C5BA 3P7ZA 3TW1A 3ZVRA 4HDQA 5J3QA 3AU4A 1WJ1A 5JHGA 2COAA 2W2XD 4L6EA 2KIGA 2KUPA 3UZTA 2IYBA 5LG4B 1UPQA 3VOQA 1AWEA 1Y19B 2YT0A 3X23A 2AEHA 2Z4DA 2YT1A 3BJIA 3A8QA 1KZGA 4GZUA 5D27A 1M7EA 2Y8FA 2D10A 5J3YA 4YL8A 2YRYA 3QIJA 1XODA 1UPRA 3U12A 3HK0A 1MIZB 2E2XA 1H4RA 5I2MA 4BBKA 1TXDA 3NWDA 2LOXA 1MAIA 2J0MA 3PG7A 4NY0A 4Z2MB 1NI2A 1PLSA 5JP4A 3FVCA 4HB0B 2XQNM 1WGQA 2K2UA 3KY9A 3RCPA 4QJ5B 3F0WA 2Z0OA 3SO6A 3NW8A 4HAXB 3U8ZA 3TCAA 1U5DA 2OQBA 1XR0B 2P8VA 3DXDA 4HB3B 2D9WA 2Z14A 1T77A 4QJ3B 2YS5A 1BWNA 2QKMA 4HATB 3ML4A 1WJMA 3DXEA 1WG7A 3O96A 2D4QA 4K81A 1ZVRA 4DBBA 4OSNA 1V5MA 5CLLB 1QQGA 1DDWA 2RSGA 1BTNA 4DX8A 2D9ZA
chains in the Genus database with same CATH topology
5KQ1A 1WGUA 1UNPA 1UEFA 1FGZA 2EMTA 2D9VA 3KZ1A 1IRSA 3PSCA 1W1DA 4YONA 4D0NB 2P0DA 1WI1A 4PNKA 1MK7B 4DXAB 5C6RA 2M14A 1W1GA 3QBVB 5CLQB 1PMSA 1ZM0A 5L81A 4A6FB 2GJYA 1UNRA 2LKOA 1DDVA 3NSUA 2NMBA 2OTXA 2DYQA 4A6KA 2L2IA 3FSSA 2R09A 4HDOA 4Z2NA 2FJLA 2J0KA 3LJUX 4A6FA 4GN1A 1Q67A 2YF0A 3BINA 2Y8GA 1FGYA 4ZRJA 1XCGA 3D8EA 2COCA 2PZ1A 1OMWA 2COFA 3TVVA 2EC1A 2W2XC 2DLWA 4GXBA 2Q13A 2DKQA 2Z0QA 2Y7BA 3ODOA 1XX0A 2HE7A 3VIAA 4EKUA 2LULA 1ZC4B 2DHKA 2CRFA 4F7HA 1GG3A 2CAYA 3P6AA 5HE2A 2YVCA 1NU2A 4EMOA 2ELAA 5JLJB 5D3VA 2D11A 2YS3A 3A8PA 2KGXB 4K17A 1ZSQA 1BTKA 4CHJA 2UZRA 2CY5A 2P0HA 2J59M 1X86A 4ZRKA 1EF1A 3SV1A 2MKRA 4IFSA 1N3HA 5DIFB 2DN6A 2H7DA 1U5EA 2D2QA 1X1FA 2LYDA 3FEHA 1V88A 1B55A 1SGHA 4HAVB 2KCJA 4XWXA 1MKEA 4K2PA 5GOWB 4KVGB 1P5TA 1FB8A 5JHHA 2RLOA 1AQCA 1X05A 3QWMA 2W2WA 1LW3A 1DYNA 2DTCA 4C0AA 1FAOA 5FI0A 1GC7A 1U27A 3MDBC 4A5KA 2BCJA 3ODXA 3IVFA 3D8DA 2RNRB 2GCLA 3PP2A 3F5RA 2L1CA 2MFQA 2I1JA 1J19A 1X11A 4TKNA 1UNQA 2K00A 3ODWA 1DDMA 2DYNA 1V5UA 1V5PA 2X18A 4F7GA 3FM8C 5FI1A 2DA0A 2ZPYA 4MK0A 1NTVA 1V89A 3U7DA 4B6HA 2Z0PA 2CY4A 3PVLA 1FHXA 2QKLA 4CHMA 2VSZA 1GC6A 2YSZA 1MIXA 4KHAA 2ROZB 1XKEA 2I1KA 5HE3A 2IFSA 5KQ4A 4KHBB 2MDXA 5HE1A 3ULCA 3AJ4A 5DH9B 2I5FA 4GMVA 4HB2B 4GMXB 3SYXA 1LB1A 3V5WA 1FHWA 1Y5OA 4IOYX 4HAWB 2N0YA 1OQNA 4MY6A 5DI9B 3G9WA 1MPHA 3M1IB 1M7RA 5C16A 3GYOA 5KCVA 2R0DA 1ZC3B 2GCJA 2M38A 3ULBA 5DHFB 2LOZA 3PVUA 4A6HA 1SHCA 2UVMA 1BAKA 2P0FA 1TQZA 1H10A 1E5WA 1EGXA 3TFMA 1I7AA 5D3XA 2GS0A 3OANA 2ADZA 2DX5A 3D8FA 1NTYA 2DX1A 1V61A 2DKPA 4Y94A 2K2JA 4TYZA 4CYEA 2I5CA 4HAYB 4PQ0A 3T06A 3SNHA 1QC6A 1W1HA 1U2BA 2ELBA 2ROVA 4H8SA 1P6SA 3WA0A 3WYFB 2HTHB 2JP2A 5LOPB 2D9XA 4WVFB 1U5FA 3DXCA 4IAPA 1FHOA 2AL6A 1RRPB 4F7UP 1MK9B 1KI1B 4HAUB 3HQCA 1K5DB 2VKIA 1EAZA 4NSWA 5LONB 1OY2A 2N23A 4HHVA 3KRWA 4MT7A 2D9YA 5EFXA 3CIKA 3ZDTA 3SUZA 5D3YA 5C79A 1DBHA 1K5GB 3PVWA 2RGNB 3AU5A 1FOEA 2G35A 4GPTB 1XD4A 1ISNA 1TJ6A 1U5GA 4HAZB 1J0WA 2RUKB 3TO1A 1WVHA 3PZDA 1Z87A 2VRWB 1RJ2A 1DROA 2YS1A 1EVHA 3A98B 4WSFA 2RVBB 2V76A 2DFKA 4P7IA 4KHOA 1I2HA 4KAXB 1X1GA 1KZ7A 2NZ8B 5DHAB 2DHJA 1P3RA 3MPXA 5C5BB 1U29A 5J3TA 3HW2B 2EJ8A 4WJ7A 4EJNA 2CODA 2EMSA 2H7EA 2MWNB 3KSYA 3GYPA 3N7CA 4DX90 1PFJA 2DHIA 2J0JA 4HB4B 4K2OA 2UZSA 3KRXA 3PEGA 5HE0A 2LG1A 5D3WA 4ZRIA 3CXBB 5C5BA 3P7ZA 3TW1A 3ZVRA 4HDQA 5J3QA 3AU4A 1WJ1A 5JHGA 2COAA 2W2XD 4L6EA 2KUPA 3UZTA 2IYBA 1UPQA 3VOQA 1AWEA 1Y19B 2YT0A 3X23A 2AEHA 2YT1A 3BJIA 3A8QA 1KZGA 4GZUA 5D27A 1M7EA 2Y8FA 2D10A 5J3YA 4YL8A 2YRYA 3QIJA 1XODA 1UPRA 3HK0A 1MIZB 2E2XA 1H4RA 4BBKA 1TXDA 2LOXA 1MAIA 2J0MA 3PG7A 4NY0A 4Z2MB 1NI2A 1PLSA 5JP4A 4HB0B 2XQNM 1WGQA 2K2UA 3KY9A 3RCPA 3F0WA 2Z0OA 3SO6A 4HAXB 3U8ZA 3TCAA 1U5DA 2OQBA 1XR0B 2P8VA 3DXDA 4HB3B 2D9WA 2YS5A 1BWNA 2QKMA 4HATB 3ML4A 1WJMA 3DXEA 1WG7A 3O96A 2D4QA 4K81A 1ZVRA 4DBBA 1V5MA 5CLLB 1QQGA 1DDWA 2RSGA 1BTNA 4DX8A 2D9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KQ1 A;  1WGU A;  1UNP A;  1UEF A;  1FGZ A;  2EMT A;  2D9V A;  3KZ1 A;  1IRS A;  3PSC A;  1W1D A;  4YON A;  4D0N B;  2P0D A;  1WI1 A;  4PNK A;  1MK7 B;  4DXA B;  5C6R A;  2M14 A;  1W1G A;  3QBV B;  5CLQ B;  1PMS A;  1ZM0 A;  5L81 A;  4A6F B;  2GJY A;  1UNR A;  2LKO A;  1DDV A;  3NSU A;  2NMB A;  2OTX A;  2DYQ A;  4A6K A;  2L2I A;  3FSS A;  2R09 A;  4HDO A;  4Z2N A;  2FJL A;  2J0K A;  3LJU X;  4A6F A;  4GN1 A;  1Q67 A;  2YF0 A;  3BIN A;  2Y8G A;  1FGY A;  4ZRJ A;  1XCG A;  3D8E A;  2COC A;  2PZ1 A;  1OMW A;  2COF A;  3TVV A;  2EC1 A;  2W2X C;  2DLW A;  4GXB A;  2Q13 A;  2DKQ A;  2Z0Q A;  2Y7B A;  3ODO A;  1XX0 A;  2HE7 A;  3VIA A;  4EKU A;  2LUL A;  1ZC4 B;  2DHK A;  2CRF A;  4F7H A;  1GG3 A;  2CAY A;  3P6A A;  5HE2 A;  2YVC A;  1NU2 A;  4EMO A;  2ELA A;  5JLJ B;  5D3V A;  2D11 A;  2YS3 A;  3A8P A;  2KGX B;  4K17 A;  1ZSQ A;  1BTK A;  4CHJ A;  2UZR A;  2CY5 A;  2P0H A;  2J59 M;  1X86 A;  4ZRK A;  1EF1 A;  3SV1 A;  2MKR A;  4IFS A;  1N3H A;  5DIF B;  2DN6 A;  2H7D A;  1U5E A;  2D2Q A;  1X1F A;  2LYD A;  3FEH A;  1V88 A;  1B55 A;  1SGH A;  4HAV B;  2KCJ A;  4XWX A;  1MKE A;  4K2P A;  5GOW B;  4KVG B;  1P5T A;  1FB8 A;  5JHH A;  2RLO A;  1AQC A;  1X05 A;  3QWM A;  2W2W A;  1LW3 A;  1DYN A;  2DTC A;  4C0A A;  1FAO A;  5FI0 A;  1GC7 A;  1U27 A;  3MDB C;  4A5K A;  2BCJ A;  3ODX A;  3IVF A;  3D8D A;  2RNR B;  2GCL A;  3PP2 A;  3F5R A;  2L1C A;  2MFQ A;  2I1J A;  1J19 A;  1X11 A;  4TKN A;  1UNQ A;  2K00 A;  3ODW A;  1DDM A;  2DYN A;  1V5U A;  1V5P A;  2X18 A;  4F7G A;  3FM8 C;  5FI1 A;  2DA0 A;  2ZPY A;  4MK0 A;  1NTV A;  1V89 A;  3U7D A;  4B6H A;  2Z0P A;  2CY4 A;  3PVL A;  1FHX A;  2QKL A;  4CHM A;  2VSZ A;  1GC6 A;  2YSZ A;  1MIX A;  4KHA A;  2ROZ B;  1XKE A;  2I1K A;  5HE3 A;  2IFS A;  5KQ4 A;  4KHB B;  2MDX A;  5HE1 A;  3ULC A;  3AJ4 A;  5DH9 B;  2I5F A;  4GMV A;  4HB2 B;  4GMX B;  3SYX A;  1LB1 A;  3V5W A;  1FHW A;  1Y5O A;  4IOY X;  4HAW B;  2N0Y A;  1OQN A;  4MY6 A;  5DI9 B;  3G9W A;  1MPH A;  3M1I B;  1M7R A;  5C16 A;  3GYO A;  5KCV A;  2R0D A;  1ZC3 B;  2GCJ A;  2M38 A;  3ULB A;  5DHF B;  2LOZ A;  3PVU A;  4A6H A;  1SHC A;  2UVM A;  1BAK A;  2P0F A;  1TQZ A;  1H10 A;  1E5W A;  1EGX A;  3TFM A;  1I7A A;  5D3X A;  2GS0 A;  3OAN A;  2ADZ A;  2DX5 A;  3D8F A;  1NTY A;  2DX1 A;  1V61 A;  2DKP A;  4Y94 A;  2K2J A;  4TYZ A;  4CYE A;  2I5C A;  4HAY B;  4PQ0 A;  3T06 A;  3SNH A;  1QC6 A;  1W1H A;  1U2B A;  2ELB A;  2ROV A;  4H8S A;  1P6S A;  3WA0 A;  3WYF B;  2HTH B;  2JP2 A;  5LOP B;  2D9X A;  4WVF B;  1U5F A;  3DXC A;  4IAP A;  1FHO A;  2AL6 A;  1RRP B;  4F7U P;  1MK9 B;  1KI1 B;  4HAU B;  3HQC A;  1K5D B;  2VKI A;  1EAZ A;  4NSW A;  5LON B;  1OY2 A;  2N23 A;  4HHV A;  3KRW A;  4MT7 A;  2D9Y A;  5EFX A;  3CIK A;  3ZDT A;  3SUZ A;  5D3Y A;  5C79 A;  1DBH A;  1K5G B;  3PVW A;  2RGN B;  3AU5 A;  1FOE A;  2G35 A;  4GPT B;  1XD4 A;  1ISN A;  1TJ6 A;  1U5G A;  4HAZ B;  1J0W A;  2RUK B;  3TO1 A;  1WVH A;  3PZD A;  1Z87 A;  2VRW B;  1RJ2 A;  1DRO A;  2YS1 A;  1EVH A;  3A98 B;  4WSF A;  2RVB B;  2V76 A;  2DFK A;  4P7I A;  4KHO A;  1I2H A;  4KAX B;  1X1G A;  1KZ7 A;  2NZ8 B;  5DHA B;  2DHJ A;  1P3R A;  3MPX A;  5C5B B;  1U29 A;  5J3T A;  3HW2 B;  2EJ8 A;  4WJ7 A;  4EJN A;  2COD A;  2EMS A;  2H7E A;  2MWN B;  3KSY A;  3GYP A;  3N7C A;  4DX9 0;  1PFJ A;  2DHI A;  2J0J A;  4HB4 B;  4K2O A;  2UZS A;  3KRX A;  3PEG A;  5HE0 A;  2LG1 A;  5D3W A;  4ZRI A;  3CXB B;  5C5B A;  3P7Z A;  3TW1 A;  3ZVR A;  4HDQ A;  5J3Q A;  3AU4 A;  1WJ1 A;  5JHG A;  2COA A;  2W2X D;  4L6E A;  2KUP A;  3UZT A;  2IYB A;  1UPQ A;  3VOQ A;  1AWE A;  1Y19 B;  2YT0 A;  3X23 A;  2AEH A;  2YT1 A;  3BJI A;  3A8Q A;  1KZG A;  4GZU A;  5D27 A;  1M7E A;  2Y8F A;  2D10 A;  5J3Y A;  4YL8 A;  2YRY A;  3QIJ A;  1XOD A;  1UPR A;  3HK0 A;  1MIZ B;  2E2X A;  1H4R A;  4BBK A;  1TXD A;  2LOX A;  1MAI A;  2J0M A;  3PG7 A;  4NY0 A;  4Z2M B;  1NI2 A;  1PLS A;  5JP4 A;  4HB0 B;  2XQN M;  1WGQ A;  2K2U A;  3KY9 A;  3RCP A;  3F0W A;  2Z0O A;  3SO6 A;  4HAX B;  3U8Z A;  3TCA A;  1U5D A;  2OQB A;  1XR0 B;  2P8V A;  3DXD A;  4HB3 B;  2D9W A;  2YS5 A;  1BWN A;  2QKM A;  4HAT B;  3ML4 A;  1WJM A;  3DXE A;  1WG7 A;  3O96 A;  2D4Q A;  4K81 A;  1ZVR A;  4DBB A;  1V5M A;  5CLL B;  1QQG A;  1DDW A;  2RSG A;  1BTN A;  4DX8 A;  2D9Z A; 
#chains in the Genus database with same CATH topology
 5KQ1 A;  1WGU A;  1UNP A;  1UEF A;  1FGZ A;  2EMT A;  2D9V A;  3KZ1 A;  1IRS A;  3PSC A;  1W1D A;  4YON A;  4D0N B;  2P0D A;  1WI1 A;  4PNK A;  1MK7 B;  2KIE A;  4DXA B;  5C6R A;  2M14 A;  1W1G A;  2FJU B;  3QBV B;  5CLQ B;  3A58 A;  1PMS A;  2RRF A;  1ZM0 A;  5L81 A;  4A6F B;  2GJY A;  1UNR A;  2LKO A;  1DDV A;  3NSU A;  2NMB A;  2OTX A;  2DYQ A;  4A6K A;  2L2I A;  3OHM B;  3FSS A;  2R09 A;  4HDO A;  4Z2N A;  2GUM A;  2FJL A;  2J0K A;  3LJU X;  4A6F A;  4GN1 A;  1Q67 A;  2YF0 A;  3B77 A;  3BIN A;  2Y8G A;  1FGY A;  4ZRJ A;  1XCG A;  3D8E A;  2COC A;  2PZ1 A;  1OMW A;  2COF A;  2ZKM X;  3TVV A;  2EC1 A;  2W2X C;  2DLW A;  4GXB A;  2Q13 A;  2DKQ A;  2Z0Q A;  2Y7B A;  3ODO A;  1XX0 A;  2HE7 A;  3VIA A;  4EKU A;  2LUL A;  1ZC4 B;  2DHK A;  2CRF A;  4F7H A;  1GG3 A;  2CAY A;  3P6A A;  5HE2 A;  2YVC A;  1NU2 A;  4EMO A;  2ELA A;  5JLJ B;  5D3V A;  1ZYI A;  2D11 A;  2YS3 A;  3A8P A;  2KGX B;  4K17 A;  1ZSQ A;  1BTK A;  4CHJ A;  2UZR A;  4L1R A;  2CY5 A;  2P0H A;  2J59 M;  2KR0 A;  1X86 A;  4ZRK A;  1EF1 A;  3SV1 A;  2MKR A;  4IFS A;  1N3H A;  4OT1 A;  2Z13 A;  2DN6 A;  5DIF B;  2H7D A;  1U5E A;  2D2Q A;  1X1F A;  2LYD A;  3FEH A;  1V88 A;  1B55 A;  1SGH A;  4HAV B;  2KCJ A;  4XWX A;  1MKE A;  4K2P A;  5GOW B;  4KVG B;  1P5T A;  1FB8 A;  5JHH A;  2RLO A;  1AQC A;  1X05 A;  3QWM A;  2W2W A;  1LW3 A;  1DYN A;  2DTC A;  4C0A A;  1FAO A;  5FI0 A;  5I2S A;  1GC7 A;  1U27 A;  2Z59 A;  3MDB C;  2BCJ A;  3ODX A;  4A5K A;  3IVF A;  3D8D A;  2RNR B;  2GCL A;  3PP2 A;  3F5R A;  2L1C A;  2MFQ A;  2I1J A;  1J19 A;  1X11 A;  4TKN A;  1UNQ A;  2K00 A;  3ODW A;  1DDM A;  2DYN A;  1V5U A;  1V5P A;  4D6W A;  2X18 A;  4F7G A;  3FM8 C;  2K8E A;  3HIE A;  5FI1 A;  2DA0 A;  2ZPY A;  4MK0 A;  1NTV A;  1V89 A;  3U7D A;  4B6H A;  2Z0P A;  2CY4 A;  3PVL A;  1FHX A;  2QKL A;  4CHM A;  2VSZ A;  1GC6 A;  2YSZ A;  1MIX A;  4KHA A;  2ROZ B;  1XKE A;  2K49 A;  2I1K A;  5HE3 A;  2IFS A;  5KQ4 A;  4KHB B;  2MDX A;  5HE1 A;  3ULC A;  3AJ4 A;  5DH9 B;  2I5F A;  4GMV A;  4HB2 B;  5IRS A;  4GMX B;  3SYX A;  1LB1 A;  3V5W A;  1FHW A;  1Y5O A;  4IOY X;  4HAW B;  2N0Y A;  1OQN A;  4MY6 A;  5DI9 B;  3G9W A;  1MPH A;  4KHB A;  3M1I B;  1M7R A;  5C16 A;  3GYO A;  5KCV A;  2R0D A;  1ZC3 B;  2GCJ A;  2M38 A;  3ULB A;  5DHF B;  2LOZ A;  3PVU A;  4A6H A;  1SHC A;  2UVM A;  4CSQ A;  1BAK A;  2P0F A;  1TQZ A;  1H10 A;  3DCX A;  1E5W A;  1EGX A;  3TFM A;  1I7A A;  5D3X A;  2GS0 A;  3OAN A;  2ADZ A;  2DX5 A;  3D8F A;  1NTY A;  2DX1 A;  1V61 A;  2DKP A;  4Y94 A;  5M4Y B;  3HSA A;  2K2J A;  4TYZ A;  4GOU A;  4CYE A;  2I5C A;  4HAY B;  4PQ0 A;  3T06 A;  3SNH A;  1QC6 A;  1W1H A;  1U2B A;  2ELB A;  2ROV A;  4H8S A;  1P6S A;  3WA0 A;  3WYF B;  2HTH B;  2JP2 A;  2R2Y A;  5LOP B;  2D9X A;  4WVF B;  1U5F A;  3DXC A;  4IAP A;  1FHO A;  2AL6 A;  1RRP B;  4F7U P;  1MK9 B;  1KI1 B;  4HSI A;  4HAU B;  3HQC A;  1K5D B;  2VKI A;  1EAZ A;  4NSW A;  5LON B;  1OY2 A;  2N23 A;  4HHV A;  3KRW A;  4MT7 A;  2D9Y A;  5EFX A;  4QXA B;  3CIK A;  3ZDT A;  3SUZ A;  5D3Y A;  5C79 A;  1DBH A;  1K5G B;  3NWA A;  3PVW A;  2RGN B;  3AU5 A;  1FOE A;  2G35 A;  4GPT B;  1XD4 A;  1ISN A;  1TJ6 A;  4QJ4 B;  1U5G A;  4HAZ B;  1J0W A;  2RUK B;  3TO1 A;  4GNK B;  2YT2 A;  1WVH A;  3PZD A;  1Z87 A;  4DIX A;  2VRW B;  1RJ2 A;  1DRO A;  2YS1 A;  1EVH A;  3A98 B;  4WSF A;  1MI1 A;  2RVB B;  2V76 A;  2DFK A;  4P7I A;  4KHO A;  1I2H A;  4KAX B;  1X1G A;  3NWF A;  1KZ7 A;  2NZ8 B;  5DHA B;  2DHJ A;  1P3R A;  3MPX A;  5C5B B;  1U29 A;  5J3T A;  3HW2 B;  2EJ8 A;  2NBV A;  4WJ7 A;  4EJN A;  2KUQ A;  2COD A;  2EMS A;  2H7E A;  2MWN B;  3KSY A;  3GYP A;  3N7C A;  4DX9 0;  1PFJ A;  2DHI A;  2J0J A;  4HB4 B;  4K2O A;  2UZS A;  3KRX A;  3PEG A;  5HE0 A;  2LG1 A;  5D3W A;  4ZRI A;  3CXB B;  5C5B A;  3P7Z A;  3TW1 A;  3ZVR A;  4HDQ A;  5J3Q A;  3AU4 A;  1WJ1 A;  5JHG A;  2COA A;  2W2X D;  4L6E A;  2KIG A;  2KUP A;  3UZT A;  2IYB A;  5LG4 B;  1UPQ A;  3VOQ A;  1AWE A;  1Y19 B;  2YT0 A;  3X23 A;  2AEH A;  2Z4D A;  2YT1 A;  3BJI A;  3A8Q A;  1KZG A;  4GZU A;  5D27 A;  1M7E A;  2Y8F A;  2D10 A;  5J3Y A;  4YL8 A;  2YRY A;  3QIJ A;  1XOD A;  1UPR A;  3U12 A;  3HK0 A;  1MIZ B;  2E2X A;  1H4R A;  5I2M A;  4BBK A;  1TXD A;  3NWD A;  2LOX A;  1MAI A;  2J0M A;  3PG7 A;  4NY0 A;  4Z2M B;  1NI2 A;  1PLS A;  5JP4 A;  3FVC A;  4HB0 B;  2XQN M;  1WGQ A;  2K2U A;  3KY9 A;  3RCP A;  4QJ5 B;  3F0W A;  2Z0O A;  3SO6 A;  3NW8 A;  4HAX B;  3U8Z A;  3TCA A;  1U5D A;  2OQB A;  1XR0 B;  2P8V A;  3DXD A;  4HB3 B;  2D9W A;  2Z14 A;  1T77 A;  4QJ3 B;  2YS5 A;  1BWN A;  2QKM A;  4HAT B;  3ML4 A;  1WJM A;  3DXE A;  1WG7 A;  3O96 A;  2D4Q A;  4K81 A;  1ZVR A;  4DBB A;  4OSN A;  1V5M A;  5CLL B;  1QQG A;  1DDW A;  2RSG A;  1BTN A;  4DX8 A;  2D9Z A; 
#chains in the Genus database with same CATH homology
 5KQ1 A;  1WGU A;  1UNP A;  1UEF A;  1FGZ A;  2EMT A;  2D9V A;  3KZ1 A;  1IRS A;  3PSC A;  1W1D A;  4YON A;  4D0N B;  2P0D A;  1WI1 A;  4PNK A;  1MK7 B;  4DXA B;  5C6R A;  2M14 A;  1W1G A;  3QBV B;  5CLQ B;  1PMS A;  1ZM0 A;  5L81 A;  4A6F B;  2GJY A;  1UNR A;  2LKO A;  1DDV A;  3NSU A;  2NMB A;  2OTX A;  2DYQ A;  4A6K A;  2L2I A;  3FSS A;  2R09 A;  4HDO A;  4Z2N A;  2FJL A;  2J0K A;  3LJU X;  4A6F A;  4GN1 A;  1Q67 A;  2YF0 A;  3BIN A;  2Y8G A;  1FGY A;  4ZRJ A;  1XCG A;  3D8E A;  2COC A;  2PZ1 A;  1OMW A;  2COF A;  3TVV A;  2EC1 A;  2W2X C;  2DLW A;  4GXB A;  2Q13 A;  2DKQ A;  2Z0Q A;  2Y7B A;  3ODO A;  1XX0 A;  2HE7 A;  3VIA A;  4EKU A;  2LUL A;  1ZC4 B;  2DHK A;  2CRF A;  4F7H A;  1GG3 A;  2CAY A;  3P6A A;  5HE2 A;  2YVC A;  1NU2 A;  4EMO A;  2ELA A;  5JLJ B;  5D3V A;  2D11 A;  2YS3 A;  3A8P A;  2KGX B;  4K17 A;  1ZSQ A;  1BTK A;  4CHJ A;  2UZR A;  2CY5 A;  2P0H A;  2J59 M;  1X86 A;  4ZRK A;  1EF1 A;  3SV1 A;  2MKR A;  4IFS A;  1N3H A;  5DIF B;  2DN6 A;  2H7D A;  1U5E A;  2D2Q A;  1X1F A;  2LYD A;  3FEH A;  1V88 A;  1B55 A;  1SGH A;  4HAV B;  2KCJ A;  4XWX A;  1MKE A;  4K2P A;  5GOW B;  4KVG B;  1P5T A;  1FB8 A;  5JHH A;  2RLO A;  1AQC A;  1X05 A;  3QWM A;  2W2W A;  1LW3 A;  1DYN A;  2DTC A;  4C0A A;  1FAO A;  5FI0 A;  1GC7 A;  1U27 A;  3MDB C;  4A5K A;  2BCJ A;  3ODX A;  3IVF A;  3D8D A;  2RNR B;  2GCL A;  3PP2 A;  3F5R A;  2L1C A;  2MFQ A;  2I1J A;  1J19 A;  1X11 A;  4TKN A;  1UNQ A;  2K00 A;  3ODW A;  1DDM A;  2DYN A;  1V5U A;  1V5P A;  2X18 A;  4F7G A;  3FM8 C;  5FI1 A;  2DA0 A;  2ZPY A;  4MK0 A;  1NTV A;  1V89 A;  3U7D A;  4B6H A;  2Z0P A;  2CY4 A;  3PVL A;  1FHX A;  2QKL A;  4CHM A;  2VSZ A;  1GC6 A;  2YSZ A;  1MIX A;  4KHA A;  2ROZ B;  1XKE A;  2I1K A;  5HE3 A;  2IFS A;  5KQ4 A;  4KHB B;  2MDX A;  5HE1 A;  3ULC A;  3AJ4 A;  5DH9 B;  2I5F A;  4GMV A;  4HB2 B;  4GMX B;  3SYX A;  1LB1 A;  3V5W A;  1FHW A;  1Y5O A;  4IOY X;  4HAW B;  2N0Y A;  1OQN A;  4MY6 A;  5DI9 B;  3G9W A;  1MPH A;  3M1I B;  1M7R A;  5C16 A;  3GYO A;  5KCV A;  2R0D A;  1ZC3 B;  2GCJ A;  2M38 A;  3ULB A;  5DHF B;  2LOZ A;  3PVU A;  4A6H A;  1SHC A;  2UVM A;  1BAK A;  2P0F A;  1TQZ A;  1H10 A;  1E5W A;  1EGX A;  3TFM A;  1I7A A;  5D3X A;  2GS0 A;  3OAN A;  2ADZ A;  2DX5 A;  3D8F A;  1NTY A;  2DX1 A;  1V61 A;  2DKP A;  4Y94 A;  2K2J A;  4TYZ A;  4CYE A;  2I5C A;  4HAY B;  4PQ0 A;  3T06 A;  3SNH A;  1QC6 A;  1W1H A;  1U2B A;  2ELB A;  2ROV A;  4H8S A;  1P6S A;  3WA0 A;  3WYF B;  2HTH B;  2JP2 A;  5LOP B;  2D9X A;  4WVF B;  1U5F A;  3DXC A;  4IAP A;  1FHO A;  2AL6 A;  1RRP B;  4F7U P;  1MK9 B;  1KI1 B;  4HAU B;  3HQC A;  1K5D B;  2VKI A;  1EAZ A;  4NSW A;  5LON B;  1OY2 A;  2N23 A;  4HHV A;  3KRW A;  4MT7 A;  2D9Y A;  5EFX A;  3CIK A;  3ZDT A;  3SUZ A;  5D3Y A;  5C79 A;  1DBH A;  1K5G B;  3PVW A;  2RGN B;  3AU5 A;  1FOE A;  2G35 A;  4GPT B;  1XD4 A;  1ISN A;  1TJ6 A;  1U5G A;  4HAZ B;  1J0W A;  2RUK B;  3TO1 A;  1WVH A;  3PZD A;  1Z87 A;  2VRW B;  1RJ2 A;  1DRO A;  2YS1 A;  1EVH A;  3A98 B;  4WSF A;  2RVB B;  2V76 A;  2DFK A;  4P7I A;  4KHO A;  1I2H A;  4KAX B;  1X1G A;  1KZ7 A;  2NZ8 B;  5DHA B;  2DHJ A;  1P3R A;  3MPX A;  5C5B B;  1U29 A;  5J3T A;  3HW2 B;  2EJ8 A;  4WJ7 A;  4EJN A;  2COD A;  2EMS A;  2H7E A;  2MWN B;  3KSY A;  3GYP A;  3N7C A;  4DX9 0;  1PFJ A;  2DHI A;  2J0J A;  4HB4 B;  4K2O A;  2UZS A;  3KRX A;  3PEG A;  5HE0 A;  2LG1 A;  5D3W A;  4ZRI A;  3CXB B;  5C5B A;  3P7Z A;  3TW1 A;  3ZVR A;  4HDQ A;  5J3Q A;  3AU4 A;  1WJ1 A;  5JHG A;  2COA A;  2W2X D;  4L6E A;  2KUP A;  3UZT A;  2IYB A;  1UPQ A;  3VOQ A;  1AWE A;  1Y19 B;  2YT0 A;  3X23 A;  2AEH A;  2YT1 A;  3BJI A;  3A8Q A;  1KZG A;  4GZU A;  5D27 A;  1M7E A;  2Y8F A;  2D10 A;  5J3Y A;  4YL8 A;  2YRY A;  3QIJ A;  1XOD A;  1UPR A;  3HK0 A;  1MIZ B;  2E2X A;  1H4R A;  4BBK A;  1TXD A;  2LOX A;  1MAI A;  2J0M A;  3PG7 A;  4NY0 A;  4Z2M B;  1NI2 A;  1PLS A;  5JP4 A;  4HB0 B;  2XQN M;  1WGQ A;  2K2U A;  3KY9 A;  3RCP A;  3F0W A;  2Z0O A;  3SO6 A;  4HAX B;  3U8Z A;  3TCA A;  1U5D A;  2OQB A;  1XR0 B;  2P8V A;  3DXD A;  4HB3 B;  2D9W A;  2YS5 A;  1BWN A;  2QKM A;  4HAT B;  3ML4 A;  1WJM A;  3DXE A;  1WG7 A;  3O96 A;  2D4Q A;  4K81 A;  1ZVR A;  4DBB A;  1V5M A;  5CLL B;  1QQG A;  1DDW A;  2RSG A;  1BTN A;  4DX8 A;  2D9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...