2DHIA

Solution structure of the ph domain of evectin-2 from mouse
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GSSGSSGFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Evectin-2 from mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family B member 2
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhiA00
1EVHA 2GCJA 1U5GA 1WJ1A 3A8QA 3F0WA 2CODA 4PNKA 2YS1A 2I1KA 2QKLA 2MDXA 1M7EA 2Q13A 3O96A 3OANA 1MIZB 2E2XA 4HATB 2Z0QA 5DH9B 1MK7B 1QQGA 3ULBA 2KCJA 4A6KA 1DDWA 1MIXA 2MWNB 2N23A 3TO1A 2DLWA 3PVLA 2I1JA 3MDBC 2X18A 3FEHA 1EF1A 1ZM0A 5LOPB 2K2UA 4DXAB 4K2PA 5C5BB 2G35A 2DYNA 1WGUA 2HTHB 3AU5A 3PVUA 1UNRA 1V5UA 5D3XA 3X23A 2EMSA 2N0YA 3N7CA 2OTXA 4MY6A 3P7ZA 2K00A 2RVBB 2DTCA 1FGZA 1E5WA 3SNHA 1BTNA 3ODXA 1UPQA 1KI1B 5LONB 2GS0A 2IYBA 1MAIA 1PLSA 1IRSA 2J59M 1I2HA 1SGHA 2VKIA 2Y8FA 4MK0A 1QC6A 1Y19B 1EAZA 4HHVA 4IAPA 3KY9A 4KHOA 4IOYX 3KRWA 4PQ0A 4A6FA 3WYFB 2DYQA 4ZRIA 5HE2A 2ZPYA 2QKMA 3PEGA 1XODA 2D10A 3HQCA 1P6SA 2RLOA 2Z0OA 2YS3A 2AEHA 2MFQA 3TW1A 2ELAA 4GZUA 5DI9B 1DBHA 3TCAA 1K5GB 1EGXA 1P5TA 2CY5A 1X1FA 4HAUB 1MK9B 4WSFA 3PG7A 3U8ZA 1XCGA 2YSZA 4GXBA 1ZVRA 1BWNA 2MKRA 3AJ4A 3BINA 5JHHA 1V61A 1GG3A 3AU4A 1U5DA 1LB1A 3F5RA 1U27A 3UZTA 1MPHA 2W2WA 1XX0A 2XQNM 2D9ZA 1J0WA 1OY2A 3SV1A 2M14A 4WJ7A 1ISNA 4TYZA 1WVHA 2DX1A 3ODWA 3QIJA 2LKOA 2VRWB 1DDVA 2YT0A 1TXDA 3PP2A 1XD4A 4TKNA 3A98B 2ADZA 4HB3B 4YONA 2VSZA 1UPRA 3WA0A 2D11A 1X11A 2Y7BA 2KUPA 5D3YA 4CYEA 5C16A 1M7RA 5D3VA 4B6HA 2IFSA 4HDOA 1H4RA 4BBKA 5J3TA 3DXEA 2P0FA 2ROVA 3M1IB 3TFMA 2PZ1A 1UNPA 2DKQA 3GYPA 1SHCA 2R09A 1WI1A 1TJ6A 4EJNA 4D0NB 2DKPA 1OMWA 1FOEA 1P3RA 2W2XD 5HE3A 1FB8A 2H7DA 1K5DB 3ML4A 3HK0A 3V5WA 2YS5A 2GCLA 4NY0A 5FI0A 4F7UP 4H8SA 4EMOA 4HDQA 3PSCA 1J19A 2J0JA 3HW2B 2M38A 4HAWB 1LW3A 1OQNA 3DXDA 1W1DA 1MKEA 2COFA 2UVMA 1UNQA 1N3HA 2LOXA 2LG1A 2RSGA 2CAYA 2CRFA 3KRXA 4F7HA 4ZRKA 2LOZA 3VIAA 2OQBA 4ZRJA 3QBVB 2D9YA 2RGNB 5KCVA 4A6FB 2I5CA 5J3YA 1NI2A 2J0KA 4L6EA 1X1GA 4K17A 2YVCA 5L81A 1NTYA 2UZSA 1BAKA 3CXBB 1GC6A 4NSWA 3GYOA 1PFJA 1RJ2A 1W1HA 5FI1A 2DN6A 1V5MA 3MPXA 3A8PA 2GJYA 2D9XA 1Q67A 4HAVB 4DX8A 1PMSA 5C6RA 2YT1A 5D27A 3KZ1A 2DHKA 1RRPB 1U2BA 3NSUA 2J0MA 4EKUA 2JP2A 4DBBA 2L1CA 3RCPA 2EC1A 3VOQA 4HB0B 1WJMA 2D2QA 2W2XC 2LYDA 2BCJA 5CLQB 5DHAB 4HB4B 3G9WA 1U5EA 5HE0A 5C5BA 1I7AA 1V5PA 2CY4A 2P8VA 4K81A 4CHJA 3SO6A 2YRYA 1BTKA 3TVVA 1AWEA 2V76A 2FJLA 2RNRB 1V89A 1FHXA 2H7EA 1FAOA 4Z2NA 5KQ1A 5EFXA 1U5FA 1Y5OA 2EMTA 2P0DA 3SYXA 2D9WA 2K2JA 4XWXA 3BJIA 4CHMA 4K2OA 5HE1A 1XR0B 2DX5A 1TQZA 4IFSA 1B55A 1AQCA 4Z2MB 2EJ8A 1GC7A 5J3QA 3PZDA 1ZC3B 2RUKB 4KHAA 4YL8A 1FHWA 1KZGA 3QWMA 1NTVA 5JP4A 2UZRA 2DHJA 4HAZB 4A6HA 4MT7A 5KQ4A 2KGXB 4HAXB 1U29A 1WGQA 1DROA 1H10A 3D8FA 2DA0A 1UEFA 1KZ7A 2DHIA 1WG7A 3ULCA 2I5FA 4HB2B 2COCA 3FSSA 5D3WA 5C79A 4GMVA 2L2IA 1FHOA 3CIKA 3P6AA 5JHGA 4KHBB 5GOWB 5DIFB 2LULA 4Y94A 4C0AA 4WVFB 2D9VA 2AL6A 2NMBA 2ROZB 4DX90 4GMXB 1DDMA 1DYNA 3ODOA 3T06A 4GN1A 3IVFA 4GPTB 1X05A 2COAA 2DFKA 1ZC4B 2HE7A 2NZ8B 2YF0A 4F7GA 2R0DA 4KAXB 3DXCA 3KSYA 4HAYB 3LJUX 3ZVRA 1NU2A 3D8EA 3PVWA 1X86A 1V88A 1ZSQA 2P0HA 3FM8C 2ELBA 5JLJB 2Z0PA 1Z87A 4A5KA 4KVGB 2Y8GA 5CLLB 3ZDTA 1FGYA 2D4QA 1XKEA 1W1GA 4P7IA 3D8DA 5DHFB 3SUZA 3U7DA
chains in the Genus database with same CATH superfamily
1EVHA 3B77A 2GCJA 1U5GA 1WJ1A 3A8QA 3F0WA 2CODA 4PNKA 2YS1A 2I1KA 2Z13A 2QKLA 2MDXA 1M7EA 2Q13A 3O96A 3OANA 2FJUB 1MIZB 2E2XA 4QJ5B 4HATB 2Z0QA 5DH9B 1MK7B 1QQGA 3ULBA 4D6WA 2KCJA 4A6KA 1DDWA 1MIXA 2MWNB 1T77A 2N23A 3TO1A 2DLWA 3PVLA 2I1JA 3MDBC 2X18A 3FEHA 1EF1A 1ZM0A 5LOPB 2K2UA 4OT1A 4DXAB 4K2PA 5C5BB 2G35A 2DYNA 1WGUA 2HTHB 3AU5A 3PVUA 1UNRA 1V5UA 5D3XA 3X23A 2EMSA 2N0YA 3N7CA 2OTXA 4MY6A 3P7ZA 2K00A 2RVBB 2DTCA 1FGZA 1E5WA 3SNHA 1BTNA 3ODXA 1UPQA 1KI1B 5LONB 2GS0A 2IYBA 1MAIA 1PLSA 1IRSA 2J59M 1I2HA 3NWAA 1SGHA 2VKIA 2Y8FA 3A58A 4MK0A 3NW8A 1QC6A 1Y19B 1EAZA 2KUQA 4HHVA 4IAPA 3KY9A 4KHOA 4IOYX 3KRWA 4PQ0A 4A6FA 3WYFB 2DYQA 4ZRIA 5HE2A 2ZPYA 2QKMA 3PEGA 1XODA 2YT2A 2D10A 3HQCA 1P6SA 2RLOA 2Z0OA 2YS3A 2AEHA 2MFQA 3TW1A 2ELAA 4GZUA 5DI9B 4CSQA 1DBHA 2K8EA 3TCAA 1K5GB 1EGXA 1P5TA 2CY5A 1X1FA 4HAUB 5M4YB 1MK9B 4WSFA 3PG7A 3U8ZA 1XCGA 2YSZA 4GXBA 1ZVRA 1BWNA 2MKRA 3AJ4A 3BINA 5JHHA 1V61A 1GG3A 3AU4A 1U5DA 4L1RA 1LB1A 3F5RA 1U27A 3UZTA 1MPHA 2W2WA 1XX0A 2XQNM 2D9ZA 1J0WA 1OY2A 3SV1A 2M14A 4WJ7A 2GUMA 1ISNA 4TYZA 1WVHA 2DX1A 3ODWA 3QIJA 2RRFA 2LKOA 2VRWB 1DDVA 2YT0A 1TXDA 3PP2A 1XD4A 4TKNA 3A98B 2ADZA 4HB3B 4YONA 2VSZA 1UPRA 3WA0A 2D11A 1X11A 2Y7BA 2KUPA 5D3YA 4CYEA 5C16A 1M7RA 2K49A 5D3VA 4B6HA 2IFSA 4HDOA 1H4RA 4BBKA 5J3TA 3DXEA 2P0FA 2ROVA 3M1IB 3TFMA 2PZ1A 1UNPA 2DKQA 2KR0A 3GYPA 1SHCA 2R09A 1WI1A 1TJ6A 4EJNA 3HSAA 4D0NB 2DKPA 1OMWA 1FOEA 1P3RA 2KIEA 2W2XD 5HE3A 1FB8A 2H7DA 1K5DB 3ML4A 3HK0A 3V5WA 2YS5A 2GCLA 4NY0A 5FI0A 4F7UP 4H8SA 4EMOA 4HDQA 3PSCA 3HIEA 1J19A 2J0JA 3HW2B 2M38A 4HAWB 1LW3A 1OQNA 3DXDA 1W1DA 1MKEA 2COFA 2UVMA 1UNQA 1N3HA 2LOXA 2Z4DA 2LG1A 2RSGA 2CAYA 2CRFA 2KIGA 3KRXA 4F7HA 4ZRKA 2LOZA 3VIAA 2OQBA 4ZRJA 3QBVB 2D9YA 2RGNB 5KCVA 4QJ3B 4A6FB 2I5CA 5J3YA 1NI2A 2J0KA 3NWDA 4L6EA 1X1GA 3U12A 2NBVA 4K17A 2YVCA 3OHMB 5L81A 1NTYA 2UZSA 1BAKA 3CXBB 1GC6A 4NSWA 3GYOA 1PFJA 1RJ2A 1W1HA 5FI1A 2DN6A 1V5MA 3MPXA 3A8PA 2GJYA 2D9XA 1Q67A 4HAVB 4DX8A 1PMSA 5C6RA 2YT1A 5D27A 3KZ1A 2DHKA 1RRPB 2Z59A 1U2BA 3NSUA 2J0MA 3DCXA 4EKUA 2JP2A 4DBBA 2L1CA 3RCPA 2EC1A 4KHBA 3VOQA 4HB0B 1WJMA 2D2QA 2W2XC 2LYDA 2BCJA 5CLQB 5DHAB 4HB4B 3G9WA 4GNKB 1U5EA 5HE0A 5C5BA 5LG4B 1I7AA 1V5PA 2CY4A 2P8VA 4K81A 4CHJA 3SO6A 4GOUA 2YRYA 1BTKA 3TVVA 1AWEA 2V76A 2FJLA 2RNRB 5IRSA 1V89A 1FHXA 2H7EA 1FAOA 4Z2NA 5KQ1A 5EFXA 1U5FA 1Y5OA 2EMTA 2P0DA 1MI1A 3SYXA 2D9WA 2K2JA 4XWXA 3BJIA 4CHMA 4K2OA 5HE1A 4QJ4B 1XR0B 2DX5A 1TQZA 4IFSA 1B55A 5I2SA 1AQCA 4Z2MB 2EJ8A 1GC7A 5J3QA 3PZDA 1ZC3B 2RUKB 4KHAA 4YL8A 1FHWA 1KZGA 3QWMA 1NTVA 5JP4A 2UZRA 2DHJA 4HAZB 4A6HA 4MT7A 5KQ4A 2KGXB 4HAXB 1U29A 1WGQA 1DROA 1H10A 3D8FA 2DA0A 1UEFA 5I2MA 1KZ7A 2DHIA 1WG7A 3ULCA 1ZYIA 2I5FA 4HB2B 2COCA 3FSSA 5D3WA 5C79A 4GMVA 2L2IA 1FHOA 3CIKA 3P6AA 5JHGA 2ZKMX 4KHBB 5GOWB 5DIFB 2LULA 4Y94A 4C0AA 4WVFB 2D9VA 2AL6A 2NMBA 3NWFA 2ROZB 4QXAB 4DX90 4GMXB 1DDMA 1DYNA 4DIXA 3ODOA 3T06A 4GN1A 3IVFA 4GPTB 1X05A 2COAA 2DFKA 1ZC4B 2HE7A 2NZ8B 2YF0A 4F7GA 2R0DA 4KAXB 3DXCA 3KSYA 4HAYB 3LJUX 3ZVRA 1NU2A 3D8EA 3PVWA 3FVCA 1X86A 1V88A 1ZSQA 2P0HA 2R2YA 3FM8C 2ELBA 5JLJB 2Z0PA 1Z87A 4A5KA 4KVGB 2Y8GA 5CLLB 4HSIA 4OSNA 3ZDTA 1FGYA 2D4QA 1XKEA 1W1GA 4P7IA 3D8DA 5DHFB 3SUZA 3U7DA 2Z14A
chains in the Genus database with same CATH topology
1EVHA 2GCJA 1U5GA 1WJ1A 3A8QA 3F0WA 2CODA 4PNKA 2YS1A 2I1KA 2QKLA 2MDXA 1M7EA 2Q13A 3O96A 3OANA 1MIZB 2E2XA 4HATB 2Z0QA 5DH9B 1MK7B 1QQGA 3ULBA 2KCJA 4A6KA 1DDWA 1MIXA 2MWNB 2N23A 3TO1A 2DLWA 3PVLA 2I1JA 3MDBC 2X18A 3FEHA 1EF1A 1ZM0A 5LOPB 2K2UA 4DXAB 4K2PA 5C5BB 2G35A 2DYNA 1WGUA 2HTHB 3AU5A 3PVUA 1UNRA 1V5UA 5D3XA 3X23A 2EMSA 2N0YA 3N7CA 2OTXA 4MY6A 3P7ZA 2K00A 2RVBB 2DTCA 1FGZA 1E5WA 3SNHA 1BTNA 3ODXA 1UPQA 1KI1B 5LONB 2GS0A 2IYBA 1MAIA 1PLSA 1IRSA 2J59M 1I2HA 1SGHA 2VKIA 2Y8FA 4MK0A 1QC6A 1Y19B 1EAZA 4HHVA 4IAPA 3KY9A 4KHOA 4IOYX 3KRWA 4PQ0A 4A6FA 3WYFB 2DYQA 4ZRIA 5HE2A 2ZPYA 2QKMA 3PEGA 1XODA 2D10A 3HQCA 1P6SA 2RLOA 2Z0OA 2YS3A 2AEHA 2MFQA 3TW1A 2ELAA 4GZUA 5DI9B 1DBHA 3TCAA 1K5GB 1EGXA 1P5TA 2CY5A 1X1FA 4HAUB 1MK9B 4WSFA 3PG7A 3U8ZA 1XCGA 2YSZA 4GXBA 1ZVRA 1BWNA 2MKRA 3AJ4A 3BINA 5JHHA 1V61A 1GG3A 3AU4A 1U5DA 1LB1A 3F5RA 1U27A 3UZTA 1MPHA 2W2WA 1XX0A 2XQNM 2D9ZA 1J0WA 1OY2A 3SV1A 2M14A 4WJ7A 1ISNA 4TYZA 1WVHA 2DX1A 3ODWA 3QIJA 2LKOA 2VRWB 1DDVA 2YT0A 1TXDA 3PP2A 1XD4A 4TKNA 3A98B 2ADZA 4HB3B 4YONA 2VSZA 1UPRA 3WA0A 2D11A 1X11A 2Y7BA 2KUPA 5D3YA 4CYEA 5C16A 1M7RA 5D3VA 4B6HA 2IFSA 4HDOA 1H4RA 4BBKA 5J3TA 3DXEA 2P0FA 2ROVA 3M1IB 3TFMA 2PZ1A 1UNPA 2DKQA 3GYPA 1SHCA 2R09A 1WI1A 1TJ6A 4EJNA 4D0NB 2DKPA 1OMWA 1FOEA 1P3RA 2W2XD 5HE3A 1FB8A 2H7DA 1K5DB 3ML4A 3HK0A 3V5WA 2YS5A 2GCLA 4NY0A 5FI0A 4F7UP 4H8SA 4EMOA 4HDQA 3PSCA 1J19A 2J0JA 3HW2B 2M38A 4HAWB 1LW3A 1OQNA 3DXDA 1W1DA 1MKEA 2COFA 2UVMA 1UNQA 1N3HA 2LOXA 2LG1A 2RSGA 2CAYA 2CRFA 3KRXA 4F7HA 4ZRKA 2LOZA 3VIAA 2OQBA 4ZRJA 3QBVB 2D9YA 2RGNB 5KCVA 4A6FB 2I5CA 5J3YA 1NI2A 2J0KA 4L6EA 1X1GA 4K17A 2YVCA 5L81A 1NTYA 2UZSA 1BAKA 3CXBB 1GC6A 4NSWA 3GYOA 1PFJA 1RJ2A 1W1HA 5FI1A 2DN6A 1V5MA 3MPXA 3A8PA 2GJYA 2D9XA 1Q67A 4HAVB 4DX8A 1PMSA 5C6RA 2YT1A 5D27A 3KZ1A 2DHKA 1RRPB 1U2BA 3NSUA 2J0MA 4EKUA 2JP2A 4DBBA 2L1CA 3RCPA 2EC1A 3VOQA 4HB0B 1WJMA 2D2QA 2W2XC 2LYDA 2BCJA 5CLQB 5DHAB 4HB4B 3G9WA 1U5EA 5HE0A 5C5BA 1I7AA 1V5PA 2CY4A 2P8VA 4K81A 4CHJA 3SO6A 2YRYA 1BTKA 3TVVA 1AWEA 2V76A 2FJLA 2RNRB 1V89A 1FHXA 2H7EA 1FAOA 4Z2NA 5KQ1A 5EFXA 1U5FA 1Y5OA 2EMTA 2P0DA 3SYXA 2D9WA 2K2JA 4XWXA 3BJIA 4CHMA 4K2OA 5HE1A 1XR0B 2DX5A 1TQZA 4IFSA 1B55A 1AQCA 4Z2MB 2EJ8A 1GC7A 5J3QA 3PZDA 1ZC3B 2RUKB 4KHAA 4YL8A 1FHWA 1KZGA 3QWMA 1NTVA 5JP4A 2UZRA 2DHJA 4HAZB 4A6HA 4MT7A 5KQ4A 2KGXB 4HAXB 1U29A 1WGQA 1DROA 1H10A 3D8FA 2DA0A 1UEFA 1KZ7A 2DHIA 1WG7A 3ULCA 2I5FA 4HB2B 2COCA 3FSSA 5D3WA 5C79A 4GMVA 2L2IA 1FHOA 3CIKA 3P6AA 5JHGA 4KHBB 5GOWB 5DIFB 2LULA 4Y94A 4C0AA 4WVFB 2D9VA 2AL6A 2NMBA 2ROZB 4DX90 4GMXB 1DDMA 1DYNA 3ODOA 3T06A 4GN1A 3IVFA 4GPTB 1X05A 2COAA 2DFKA 1ZC4B 2HE7A 2NZ8B 2YF0A 4F7GA 2R0DA 4KAXB 3DXCA 3KSYA 4HAYB 3LJUX 3ZVRA 1NU2A 3D8EA 3PVWA 1X86A 1V88A 1ZSQA 2P0HA 3FM8C 2ELBA 5JLJB 2Z0PA 1Z87A 4A5KA 4KVGB 2Y8GA 5CLLB 3ZDTA 1FGYA 2D4QA 1XKEA 1W1GA 4P7IA 3D8DA 5DHFB 3SUZA 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVH A;  2GCJ A;  1U5G A;  1WJ1 A;  3A8Q A;  3F0W A;  2COD A;  4PNK A;  2YS1 A;  2I1K A;  2QKL A;  2MDX A;  1M7E A;  2Q13 A;  3O96 A;  3OAN A;  1MIZ B;  2E2X A;  4HAT B;  2Z0Q A;  5DH9 B;  1MK7 B;  1QQG A;  3ULB A;  2KCJ A;  4A6K A;  1DDW A;  1MIX A;  2MWN B;  2N23 A;  3TO1 A;  2DLW A;  3PVL A;  2I1J A;  3MDB C;  2X18 A;  3FEH A;  1EF1 A;  1ZM0 A;  5LOP B;  2K2U A;  4DXA B;  4K2P A;  5C5B B;  2G35 A;  2DYN A;  1WGU A;  2HTH B;  3AU5 A;  3PVU A;  1UNR A;  1V5U A;  5D3X A;  3X23 A;  2EMS A;  2N0Y A;  3N7C A;  2OTX A;  4MY6 A;  3P7Z A;  2K00 A;  2RVB B;  2DTC A;  1FGZ A;  1E5W A;  3SNH A;  1BTN A;  3ODX A;  1UPQ A;  1KI1 B;  5LON B;  2GS0 A;  2IYB A;  1MAI A;  1PLS A;  1IRS A;  2J59 M;  1I2H A;  1SGH A;  2VKI A;  2Y8F A;  4MK0 A;  1QC6 A;  1Y19 B;  1EAZ A;  4HHV A;  4IAP A;  3KY9 A;  4KHO A;  4IOY X;  3KRW A;  4PQ0 A;  4A6F A;  3WYF B;  2DYQ A;  4ZRI A;  5HE2 A;  2ZPY A;  2QKM A;  3PEG A;  1XOD A;  2D10 A;  3HQC A;  1P6S A;  2RLO A;  2Z0O A;  2YS3 A;  2AEH A;  2MFQ A;  3TW1 A;  2ELA A;  4GZU A;  5DI9 B;  1DBH A;  3TCA A;  1K5G B;  1EGX A;  1P5T A;  2CY5 A;  1X1F A;  4HAU B;  1MK9 B;  4WSF A;  3PG7 A;  3U8Z A;  1XCG A;  2YSZ A;  4GXB A;  1ZVR A;  1BWN A;  2MKR A;  3AJ4 A;  3BIN A;  5JHH A;  1V61 A;  1GG3 A;  3AU4 A;  1U5D A;  1LB1 A;  3F5R A;  1U27 A;  3UZT A;  1MPH A;  2W2W A;  1XX0 A;  2XQN M;  2D9Z A;  1J0W A;  1OY2 A;  3SV1 A;  2M14 A;  4WJ7 A;  1ISN A;  4TYZ A;  1WVH A;  2DX1 A;  3ODW A;  3QIJ A;  2LKO A;  2VRW B;  1DDV A;  2YT0 A;  1TXD A;  3PP2 A;  1XD4 A;  4TKN A;  3A98 B;  2ADZ A;  4HB3 B;  4YON A;  2VSZ A;  1UPR A;  3WA0 A;  2D11 A;  1X11 A;  2Y7B A;  2KUP A;  5D3Y A;  4CYE A;  5C16 A;  1M7R A;  5D3V A;  4B6H A;  2IFS A;  4HDO A;  1H4R A;  4BBK A;  5J3T A;  3DXE A;  2P0F A;  2ROV A;  3M1I B;  3TFM A;  2PZ1 A;  1UNP A;  2DKQ A;  3GYP A;  1SHC A;  2R09 A;  1WI1 A;  1TJ6 A;  4EJN A;  4D0N B;  2DKP A;  1OMW A;  1FOE A;  1P3R A;  2W2X D;  5HE3 A;  1FB8 A;  2H7D A;  1K5D B;  3ML4 A;  3HK0 A;  3V5W A;  2YS5 A;  2GCL A;  4NY0 A;  5FI0 A;  4F7U P;  4H8S A;  4EMO A;  4HDQ A;  3PSC A;  1J19 A;  2J0J A;  3HW2 B;  2M38 A;  4HAW B;  1LW3 A;  1OQN A;  3DXD A;  1W1D A;  1MKE A;  2COF A;  2UVM A;  1UNQ A;  1N3H A;  2LOX A;  2LG1 A;  2RSG A;  2CAY A;  2CRF A;  3KRX A;  4F7H A;  4ZRK A;  2LOZ A;  3VIA A;  2OQB A;  4ZRJ A;  3QBV B;  2D9Y A;  2RGN B;  5KCV A;  4A6F B;  2I5C A;  5J3Y A;  1NI2 A;  2J0K A;  4L6E A;  1X1G A;  4K17 A;  2YVC A;  5L81 A;  1NTY A;  2UZS A;  1BAK A;  3CXB B;  1GC6 A;  4NSW A;  3GYO A;  1PFJ A;  1RJ2 A;  1W1H A;  5FI1 A;  2DN6 A;  1V5M A;  3MPX A;  3A8P A;  2GJY A;  2D9X A;  1Q67 A;  4HAV B;  4DX8 A;  1PMS A;  5C6R A;  2YT1 A;  5D27 A;  3KZ1 A;  2DHK A;  1RRP B;  1U2B A;  3NSU A;  2J0M A;  4EKU A;  2JP2 A;  4DBB A;  2L1C A;  3RCP A;  2EC1 A;  3VOQ A;  4HB0 B;  1WJM A;  2D2Q A;  2W2X C;  2LYD A;  2BCJ A;  5CLQ B;  5DHA B;  4HB4 B;  3G9W A;  1U5E A;  5HE0 A;  5C5B A;  1I7A A;  1V5P A;  2CY4 A;  2P8V A;  4K81 A;  4CHJ A;  3SO6 A;  2YRY A;  1BTK A;  3TVV A;  1AWE A;  2V76 A;  2FJL A;  2RNR B;  1V89 A;  1FHX A;  2H7E A;  1FAO A;  4Z2N A;  5KQ1 A;  5EFX A;  1U5F A;  1Y5O A;  2EMT A;  2P0D A;  3SYX A;  2D9W A;  2K2J A;  4XWX A;  3BJI A;  4CHM A;  4K2O A;  5HE1 A;  1XR0 B;  2DX5 A;  1TQZ A;  4IFS A;  1B55 A;  1AQC A;  4Z2M B;  2EJ8 A;  1GC7 A;  5J3Q A;  3PZD A;  1ZC3 B;  2RUK B;  4KHA A;  4YL8 A;  1FHW A;  1KZG A;  3QWM A;  1NTV A;  5JP4 A;  2UZR A;  2DHJ A;  4HAZ B;  4A6H A;  4MT7 A;  5KQ4 A;  2KGX B;  4HAX B;  1U29 A;  1WGQ A;  1DRO A;  1H10 A;  3D8F A;  2DA0 A;  1UEF A;  1KZ7 A;  2DHI A;  1WG7 A;  3ULC A;  2I5F A;  4HB2 B;  2COC A;  3FSS A;  5D3W A;  5C79 A;  4GMV A;  2L2I A;  1FHO A;  3CIK A;  3P6A A;  5JHG A;  4KHB B;  5GOW B;  5DIF B;  2LUL A;  4Y94 A;  4C0A A;  4WVF B;  2D9V A;  2AL6 A;  2NMB A;  2ROZ B;  4DX9 0;  4GMX B;  1DDM A;  1DYN A;  3ODO A;  3T06 A;  4GN1 A;  3IVF A;  4GPT B;  1X05 A;  2COA A;  2DFK A;  1ZC4 B;  2HE7 A;  2NZ8 B;  2YF0 A;  4F7G A;  2R0D A;  4KAX B;  3DXC A;  3KSY A;  4HAY B;  3LJU X;  3ZVR A;  1NU2 A;  3D8E A;  3PVW A;  1X86 A;  1V88 A;  1ZSQ A;  2P0H A;  3FM8 C;  2ELB A;  5JLJ B;  2Z0P A;  1Z87 A;  4A5K A;  4KVG B;  2Y8G A;  5CLL B;  3ZDT A;  1FGY A;  2D4Q A;  1XKE A;  1W1G A;  4P7I A;  3D8D A;  5DHF B;  3SUZ A;  3U7D A; 
#chains in the Genus database with same CATH topology
 1EVH A;  3B77 A;  2GCJ A;  1U5G A;  1WJ1 A;  3A8Q A;  3F0W A;  2COD A;  4PNK A;  2YS1 A;  2I1K A;  2Z13 A;  2QKL A;  2MDX A;  1M7E A;  2Q13 A;  3O96 A;  3OAN A;  2FJU B;  1MIZ B;  2E2X A;  4QJ5 B;  4HAT B;  2Z0Q A;  5DH9 B;  1MK7 B;  1QQG A;  3ULB A;  4D6W A;  2KCJ A;  4A6K A;  1DDW A;  1MIX A;  2MWN B;  1T77 A;  2N23 A;  3TO1 A;  2DLW A;  3PVL A;  2I1J A;  3MDB C;  2X18 A;  3FEH A;  1EF1 A;  1ZM0 A;  5LOP B;  2K2U A;  4OT1 A;  4DXA B;  4K2P A;  5C5B B;  2G35 A;  2DYN A;  1WGU A;  2HTH B;  3AU5 A;  3PVU A;  1UNR A;  1V5U A;  5D3X A;  3X23 A;  2EMS A;  2N0Y A;  3N7C A;  2OTX A;  4MY6 A;  3P7Z A;  2K00 A;  2RVB B;  2DTC A;  1FGZ A;  1E5W A;  3SNH A;  1BTN A;  3ODX A;  1UPQ A;  1KI1 B;  5LON B;  2GS0 A;  2IYB A;  1MAI A;  1PLS A;  1IRS A;  2J59 M;  1I2H A;  3NWA A;  1SGH A;  2VKI A;  2Y8F A;  3A58 A;  4MK0 A;  3NW8 A;  1QC6 A;  1Y19 B;  1EAZ A;  2KUQ A;  4HHV A;  4IAP A;  3KY9 A;  4KHO A;  4IOY X;  3KRW A;  4PQ0 A;  4A6F A;  3WYF B;  2DYQ A;  4ZRI A;  5HE2 A;  2ZPY A;  2QKM A;  3PEG A;  1XOD A;  2YT2 A;  2D10 A;  3HQC A;  1P6S A;  2RLO A;  2Z0O A;  2YS3 A;  2AEH A;  2MFQ A;  3TW1 A;  2ELA A;  4GZU A;  5DI9 B;  4CSQ A;  1DBH A;  2K8E A;  3TCA A;  1K5G B;  1EGX A;  1P5T A;  2CY5 A;  1X1F A;  4HAU B;  5M4Y B;  1MK9 B;  4WSF A;  3PG7 A;  3U8Z A;  1XCG A;  2YSZ A;  4GXB A;  1ZVR A;  1BWN A;  2MKR A;  3AJ4 A;  3BIN A;  5JHH A;  1V61 A;  1GG3 A;  3AU4 A;  1U5D A;  4L1R A;  1LB1 A;  3F5R A;  1U27 A;  3UZT A;  1MPH A;  2W2W A;  1XX0 A;  2XQN M;  2D9Z A;  1J0W A;  1OY2 A;  3SV1 A;  2M14 A;  4WJ7 A;  2GUM A;  1ISN A;  4TYZ A;  1WVH A;  2DX1 A;  3ODW A;  3QIJ A;  2RRF A;  2LKO A;  2VRW B;  1DDV A;  2YT0 A;  1TXD A;  3PP2 A;  1XD4 A;  4TKN A;  3A98 B;  2ADZ A;  4HB3 B;  4YON A;  2VSZ A;  1UPR A;  3WA0 A;  2D11 A;  1X11 A;  2Y7B A;  2KUP A;  5D3Y A;  4CYE A;  5C16 A;  1M7R A;  2K49 A;  5D3V A;  4B6H A;  2IFS A;  4HDO A;  1H4R A;  4BBK A;  5J3T A;  3DXE A;  2P0F A;  2ROV A;  3M1I B;  3TFM A;  2PZ1 A;  1UNP A;  2DKQ A;  2KR0 A;  3GYP A;  1SHC A;  2R09 A;  1WI1 A;  1TJ6 A;  4EJN A;  3HSA A;  4D0N B;  2DKP A;  1OMW A;  1FOE A;  1P3R A;  2KIE A;  2W2X D;  5HE3 A;  1FB8 A;  2H7D A;  1K5D B;  3ML4 A;  3HK0 A;  3V5W A;  2YS5 A;  2GCL A;  4NY0 A;  5FI0 A;  4F7U P;  4H8S A;  4EMO A;  4HDQ A;  3PSC A;  3HIE A;  1J19 A;  2J0J A;  3HW2 B;  2M38 A;  4HAW B;  1LW3 A;  1OQN A;  3DXD A;  1W1D A;  1MKE A;  2COF A;  2UVM A;  1UNQ A;  1N3H A;  2LOX A;  2Z4D A;  2LG1 A;  2RSG A;  2CAY A;  2CRF A;  2KIG A;  3KRX A;  4F7H A;  4ZRK A;  2LOZ A;  3VIA A;  2OQB A;  4ZRJ A;  3QBV B;  2D9Y A;  2RGN B;  5KCV A;  4QJ3 B;  4A6F B;  2I5C A;  5J3Y A;  1NI2 A;  2J0K A;  3NWD A;  4L6E A;  1X1G A;  3U12 A;  2NBV A;  4K17 A;  2YVC A;  3OHM B;  5L81 A;  1NTY A;  2UZS A;  1BAK A;  3CXB B;  1GC6 A;  4NSW A;  3GYO A;  1PFJ A;  1RJ2 A;  1W1H A;  5FI1 A;  2DN6 A;  1V5M A;  3MPX A;  3A8P A;  2GJY A;  2D9X A;  1Q67 A;  4HAV B;  4DX8 A;  1PMS A;  5C6R A;  2YT1 A;  5D27 A;  3KZ1 A;  2DHK A;  1RRP B;  2Z59 A;  1U2B A;  3NSU A;  2J0M A;  3DCX A;  4EKU A;  2JP2 A;  4DBB A;  2L1C A;  3RCP A;  2EC1 A;  4KHB A;  3VOQ A;  4HB0 B;  1WJM A;  2D2Q A;  2W2X C;  2LYD A;  2BCJ A;  5CLQ B;  5DHA B;  4HB4 B;  3G9W A;  4GNK B;  1U5E A;  5HE0 A;  5C5B A;  5LG4 B;  1I7A A;  1V5P A;  2CY4 A;  2P8V A;  4K81 A;  4CHJ A;  3SO6 A;  4GOU A;  2YRY A;  1BTK A;  3TVV A;  1AWE A;  2V76 A;  2FJL A;  2RNR B;  5IRS A;  1V89 A;  1FHX A;  2H7E A;  1FAO A;  4Z2N A;  5KQ1 A;  5EFX A;  1U5F A;  1Y5O A;  2EMT A;  2P0D A;  1MI1 A;  3SYX A;  2D9W A;  2K2J A;  4XWX A;  3BJI A;  4CHM A;  4K2O A;  5HE1 A;  4QJ4 B;  1XR0 B;  2DX5 A;  1TQZ A;  4IFS A;  1B55 A;  5I2S A;  1AQC A;  4Z2M B;  2EJ8 A;  1GC7 A;  5J3Q A;  3PZD A;  1ZC3 B;  2RUK B;  4KHA A;  4YL8 A;  1FHW A;  1KZG A;  3QWM A;  1NTV A;  5JP4 A;  2UZR A;  2DHJ A;  4HAZ B;  4A6H A;  4MT7 A;  5KQ4 A;  2KGX B;  4HAX B;  1U29 A;  1WGQ A;  1DRO A;  1H10 A;  3D8F A;  2DA0 A;  1UEF A;  5I2M A;  1KZ7 A;  2DHI A;  1WG7 A;  3ULC A;  1ZYI A;  2I5F A;  4HB2 B;  2COC A;  3FSS A;  5D3W A;  5C79 A;  4GMV A;  2L2I A;  1FHO A;  3CIK A;  3P6A A;  5JHG A;  2ZKM X;  4KHB B;  5GOW B;  5DIF B;  2LUL A;  4Y94 A;  4C0A A;  4WVF B;  2D9V A;  2AL6 A;  2NMB A;  3NWF A;  2ROZ B;  4QXA B;  4DX9 0;  4GMX B;  1DDM A;  1DYN A;  4DIX A;  3ODO A;  3T06 A;  4GN1 A;  3IVF A;  4GPT B;  1X05 A;  2COA A;  2DFK A;  1ZC4 B;  2HE7 A;  2NZ8 B;  2YF0 A;  4F7G A;  2R0D A;  4KAX B;  3DXC A;  3KSY A;  4HAY B;  3LJU X;  3ZVR A;  1NU2 A;  3D8E A;  3PVW A;  3FVC A;  1X86 A;  1V88 A;  1ZSQ A;  2P0H A;  2R2Y A;  3FM8 C;  2ELB A;  5JLJ B;  2Z0P A;  1Z87 A;  4A5K A;  4KVG B;  2Y8G A;  5CLL B;  4HSI A;  4OSN A;  3ZDT A;  1FGY A;  2D4Q A;  1XKE A;  1W1G A;  4P7I A;  3D8D A;  5DHF B;  3SUZ A;  3U7D A;  2Z14 A; 
#chains in the Genus database with same CATH homology
 1EVH A;  2GCJ A;  1U5G A;  1WJ1 A;  3A8Q A;  3F0W A;  2COD A;  4PNK A;  2YS1 A;  2I1K A;  2QKL A;  2MDX A;  1M7E A;  2Q13 A;  3O96 A;  3OAN A;  1MIZ B;  2E2X A;  4HAT B;  2Z0Q A;  5DH9 B;  1MK7 B;  1QQG A;  3ULB A;  2KCJ A;  4A6K A;  1DDW A;  1MIX A;  2MWN B;  2N23 A;  3TO1 A;  2DLW A;  3PVL A;  2I1J A;  3MDB C;  2X18 A;  3FEH A;  1EF1 A;  1ZM0 A;  5LOP B;  2K2U A;  4DXA B;  4K2P A;  5C5B B;  2G35 A;  2DYN A;  1WGU A;  2HTH B;  3AU5 A;  3PVU A;  1UNR A;  1V5U A;  5D3X A;  3X23 A;  2EMS A;  2N0Y A;  3N7C A;  2OTX A;  4MY6 A;  3P7Z A;  2K00 A;  2RVB B;  2DTC A;  1FGZ A;  1E5W A;  3SNH A;  1BTN A;  3ODX A;  1UPQ A;  1KI1 B;  5LON B;  2GS0 A;  2IYB A;  1MAI A;  1PLS A;  1IRS A;  2J59 M;  1I2H A;  1SGH A;  2VKI A;  2Y8F A;  4MK0 A;  1QC6 A;  1Y19 B;  1EAZ A;  4HHV A;  4IAP A;  3KY9 A;  4KHO A;  4IOY X;  3KRW A;  4PQ0 A;  4A6F A;  3WYF B;  2DYQ A;  4ZRI A;  5HE2 A;  2ZPY A;  2QKM A;  3PEG A;  1XOD A;  2D10 A;  3HQC A;  1P6S A;  2RLO A;  2Z0O A;  2YS3 A;  2AEH A;  2MFQ A;  3TW1 A;  2ELA A;  4GZU A;  5DI9 B;  1DBH A;  3TCA A;  1K5G B;  1EGX A;  1P5T A;  2CY5 A;  1X1F A;  4HAU B;  1MK9 B;  4WSF A;  3PG7 A;  3U8Z A;  1XCG A;  2YSZ A;  4GXB A;  1ZVR A;  1BWN A;  2MKR A;  3AJ4 A;  3BIN A;  5JHH A;  1V61 A;  1GG3 A;  3AU4 A;  1U5D A;  1LB1 A;  3F5R A;  1U27 A;  3UZT A;  1MPH A;  2W2W A;  1XX0 A;  2XQN M;  2D9Z A;  1J0W A;  1OY2 A;  3SV1 A;  2M14 A;  4WJ7 A;  1ISN A;  4TYZ A;  1WVH A;  2DX1 A;  3ODW A;  3QIJ A;  2LKO A;  2VRW B;  1DDV A;  2YT0 A;  1TXD A;  3PP2 A;  1XD4 A;  4TKN A;  3A98 B;  2ADZ A;  4HB3 B;  4YON A;  2VSZ A;  1UPR A;  3WA0 A;  2D11 A;  1X11 A;  2Y7B A;  2KUP A;  5D3Y A;  4CYE A;  5C16 A;  1M7R A;  5D3V A;  4B6H A;  2IFS A;  4HDO A;  1H4R A;  4BBK A;  5J3T A;  3DXE A;  2P0F A;  2ROV A;  3M1I B;  3TFM A;  2PZ1 A;  1UNP A;  2DKQ A;  3GYP A;  1SHC A;  2R09 A;  1WI1 A;  1TJ6 A;  4EJN A;  4D0N B;  2DKP A;  1OMW A;  1FOE A;  1P3R A;  2W2X D;  5HE3 A;  1FB8 A;  2H7D A;  1K5D B;  3ML4 A;  3HK0 A;  3V5W A;  2YS5 A;  2GCL A;  4NY0 A;  5FI0 A;  4F7U P;  4H8S A;  4EMO A;  4HDQ A;  3PSC A;  1J19 A;  2J0J A;  3HW2 B;  2M38 A;  4HAW B;  1LW3 A;  1OQN A;  3DXD A;  1W1D A;  1MKE A;  2COF A;  2UVM A;  1UNQ A;  1N3H A;  2LOX A;  2LG1 A;  2RSG A;  2CAY A;  2CRF A;  3KRX A;  4F7H A;  4ZRK A;  2LOZ A;  3VIA A;  2OQB A;  4ZRJ A;  3QBV B;  2D9Y A;  2RGN B;  5KCV A;  4A6F B;  2I5C A;  5J3Y A;  1NI2 A;  2J0K A;  4L6E A;  1X1G A;  4K17 A;  2YVC A;  5L81 A;  1NTY A;  2UZS A;  1BAK A;  3CXB B;  1GC6 A;  4NSW A;  3GYO A;  1PFJ A;  1RJ2 A;  1W1H A;  5FI1 A;  2DN6 A;  1V5M A;  3MPX A;  3A8P A;  2GJY A;  2D9X A;  1Q67 A;  4HAV B;  4DX8 A;  1PMS A;  5C6R A;  2YT1 A;  5D27 A;  3KZ1 A;  2DHK A;  1RRP B;  1U2B A;  3NSU A;  2J0M A;  4EKU A;  2JP2 A;  4DBB A;  2L1C A;  3RCP A;  2EC1 A;  3VOQ A;  4HB0 B;  1WJM A;  2D2Q A;  2W2X C;  2LYD A;  2BCJ A;  5CLQ B;  5DHA B;  4HB4 B;  3G9W A;  1U5E A;  5HE0 A;  5C5B A;  1I7A A;  1V5P A;  2CY4 A;  2P8V A;  4K81 A;  4CHJ A;  3SO6 A;  2YRY A;  1BTK A;  3TVV A;  1AWE A;  2V76 A;  2FJL A;  2RNR B;  1V89 A;  1FHX A;  2H7E A;  1FAO A;  4Z2N A;  5KQ1 A;  5EFX A;  1U5F A;  1Y5O A;  2EMT A;  2P0D A;  3SYX A;  2D9W A;  2K2J A;  4XWX A;  3BJI A;  4CHM A;  4K2O A;  5HE1 A;  1XR0 B;  2DX5 A;  1TQZ A;  4IFS A;  1B55 A;  1AQC A;  4Z2M B;  2EJ8 A;  1GC7 A;  5J3Q A;  3PZD A;  1ZC3 B;  2RUK B;  4KHA A;  4YL8 A;  1FHW A;  1KZG A;  3QWM A;  1NTV A;  5JP4 A;  2UZR A;  2DHJ A;  4HAZ B;  4A6H A;  4MT7 A;  5KQ4 A;  2KGX B;  4HAX B;  1U29 A;  1WGQ A;  1DRO A;  1H10 A;  3D8F A;  2DA0 A;  1UEF A;  1KZ7 A;  2DHI A;  1WG7 A;  3ULC A;  2I5F A;  4HB2 B;  2COC A;  3FSS A;  5D3W A;  5C79 A;  4GMV A;  2L2I A;  1FHO A;  3CIK A;  3P6A A;  5JHG A;  4KHB B;  5GOW B;  5DIF B;  2LUL A;  4Y94 A;  4C0A A;  4WVF B;  2D9V A;  2AL6 A;  2NMB A;  2ROZ B;  4DX9 0;  4GMX B;  1DDM A;  1DYN A;  3ODO A;  3T06 A;  4GN1 A;  3IVF A;  4GPT B;  1X05 A;  2COA A;  2DFK A;  1ZC4 B;  2HE7 A;  2NZ8 B;  2YF0 A;  4F7G A;  2R0D A;  4KAX B;  3DXC A;  3KSY A;  4HAY B;  3LJU X;  3ZVR A;  1NU2 A;  3D8E A;  3PVW A;  1X86 A;  1V88 A;  1ZSQ A;  2P0H A;  3FM8 C;  2ELB A;  5JLJ B;  2Z0P A;  1Z87 A;  4A5K A;  4KVG B;  2Y8G A;  5CLL B;  3ZDT A;  1FGY A;  2D4Q A;  1XKE A;  1W1G A;  4P7I A;  3D8D A;  5DHF B;  3SUZ A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...