2IFSA

Structure of the n-wasp evh1 domain in complex with an extended wip peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
169
Chain Sequence
b'GSESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRGGLVPRGSGGSLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wiskott-Aldrich Syndrome Protien interacting protein and Neu
publication title Multiple WASP-interacting protein recognition motifs are required for a functional interaction with N-WASP.
pubmed doi rcsb
source organism Homo sapiens, rattus norvegicus
molecule tags Signaling protein
total genus 36
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ifsA00
4F7UP 5C16A 2DN6A 4ZRIA 3DXCA 2CY5A 1BTKA 5C5BB 2KGXB 1P5TA 4CHMA 2DHJA 1MK7B 3KZ1A 3D8EA 3KSYA 2YVCA 2RVBB 2RLOA 5JHGA 1WG7A 4GMXB 1J0WA 5DI9B 2I5CA 1GC6A 5DIFB 1EVHA 3HQCA 3DXEA 3VOQA 2J0MA 5D3XA 2YT1A 1W1GA 4HAWB 2W2XD 3AJ4A 3P6AA 4HATB 4C0AA 4MY6A 2DYQA 4Z2MB 4HAVB 2P0HA 3TFMA 2V76A 3TVVA 3PZDA 3G9WA 2R0DA 4IOYX 3TO1A 2X18A 2ADZA 2YT0A 2KUPA 1N3HA 1EF1A 1PFJA 1IRSA 3BJIA 3A8QA 3MPXA 4HAZB 3VIAA 1K5DB 1Y5OA 4IAPA 2MDXA 3IVFA 1TJ6A 1OMWA 1U29A 5J3TA 2P8VA 1NI2A 2JP2A 4NSWA 1J19A 1KI1B 4F7HA 2DTCA 3ULBA 1K5GB 2H7DA 1XR0B 4BBKA 5KQ4A 4DX90 2YRYA 1MK9B 1ZM0A 1ZVRA 2J0KA 4IFSA 1XX0A 2J59M 3CIKA 3RCPA 2D10A 2EC1A 2VRWB 1E5WA 1FHWA 2R09A 4A6FA 1XKEA 5GOWB 1TQZA 4L6EA 1UNQA 5DHAB 5D27A 1V88A 2MFQA 3M1IB 5D3VA 1U5GA 2N23A 5KQ1A 5LOPB 2XQNM 4NY0A 1Y19B 3P7ZA 4GPTB 3N7CA 3AU5A 5KCVA 2HE7A 1DDVA 1I7AA 3GYOA 4EJNA 4K2OA 4PQ0A 5JHHA 1UNRA 2FJLA 2K2JA 2LYDA 4EMOA 2QKMA 4CHJA 5LONB 1MIXA 4MK0A 3ZDTA 3NSUA 3U8ZA 4HB0B 1UPQA 1UPRA 3CXBB 1DYNA 4YONA 2I5FA 1PMSA 1BAKA 3SUZA 2ELBA 1V5UA 4K17A 1UNPA 2M14A 1V5PA 2PZ1A 4HDOA 1RJ2A 4KAXB 2YS1A 2UZSA 1FHXA 1SHCA 1QQGA 5HE3A 3TCAA 1FGZA 3A98B 3ODXA 2ROZB 2Q13A 3ZVRA 1BWNA 2DFKA 3HW2B 1OY2A 2D9ZA 4CYEA 3ODWA 3FM8C 5D3WA 3ULCA 5CLLB 5J3YA 4DX8A 3ODOA 2D4QA 2K00A 1V89A 2P0DA 2RUKB 3PVWA 2DLWA 2Z0OA 4HAUB 2IYBA 1LB1A 1WJ1A 4MT7A 2LG1A 2VSZA 4GZUA 2DYNA 1Q67A 1PLSA 2D2QA 1NTVA 4ZRJA 1WVHA 2D9VA 2EJ8A 1SGHA 5DH9B 1U5DA 3U7DA 4A5KA 5C5BA 1ZC3B 2YF0A 2Z0PA 1U27A 2ROVA 1WGUA 1V61A 4HB2B 2YS3A 2I1JA 5D3YA 1MIZB 2RSGA 1BTNA 1GC7A 4ZRKA 3UZTA 2DHKA 1EGXA 4HAXB 1KZGA 4K81A 1FAOA 1U5FA 4HAYB 4Y94A 2DKQA 3SNHA 2Y8GA 4HDQA 2W2WA 2YSZA 1B55A 3KRWA 3FSSA 3X23A 4A6HA 2MWNB 1H4RA 2Z0QA 4GXBA 1WI1A 1ZC4B 2W2XC 4B6HA 3SV1A 2HTHB 2RNRB 5DHFB 3WA0A 2LOXA 2YS5A 2AL6A 5HE2A 5HE0A 2M38A 3TW1A 4A6KA 4P7IA 2MKRA 3MDBC 3PG7A 1H10A 5JP4A 2D9XA 2D11A 3QBVB 3DXDA 1M7RA 4HB3B 1MAIA 3GYPA 2H7EA 1WGQA 3A8PA 2RGNB 2N0YA 4F7GA 2E2XA 1X1FA 2NZ8B 2LOZA 4KHAA 1EAZA 1P6SA 2G35A 4HHVA 2L2IA 2CY4A 1MPHA 5L81A 4KHBB 2QKLA 5FI0A 2D9YA 2DX5A 4GN1A 3PSCA 2CAYA 3O96A 1W1DA 2GCLA 1X86A 2ZPYA 4DBBA 4YL8A 3D8FA 1W1HA 2Y7BA 1ISNA 4H8SA 2DHIA 3PVUA 2K2UA 3OANA 3V5WA 3ML4A 1NTYA 2COCA 3BINA 4TKNA 4TYZA 4HB4B 1Z87A 1M7EA 2CRFA 3AU4A 4A6FB 3KY9A 2COFA 4K2PA 3D8DA 3QIJA 1FB8A 2AEHA 4GMVA 4KHOA 1FOEA 1RRPB 1FHOA 2D9WA 3HK0A 5C79A 4WVFB 3F5RA 5EFXA 1XCGA 2UVMA 1WJMA 3QWMA 5FI1A 5J3QA 1AQCA 2NMBA 5HE1A 3WYFB 3FEHA 2LULA 2GS0A 5JLJB 2DKPA 2OTXA 1X1GA 3KRXA 2P0FA 4WJ7A 2EMTA 1U2BA 1TXDA 1U5EA 2L1CA 5C6RA 4KVGB 3PEGA 1DDWA 2DA0A 1I2HA 2BCJA 2IFSA 1ZSQA 1X11A 4WSFA 2Y8FA 2I1KA 1XD4A 1DDMA 2COAA 3LJUX 1AWEA 5CLQB 1XODA 2UZRA 3SO6A 3T06A 1V5MA 3SYXA 4DXAB 2CODA 2ELAA 1DBHA 1NU2A 2GJYA 1OQNA 1X05A 2KCJA 4XWXA 1FGYA 4PNKA 2EMSA 1KZ7A 4Z2NA 4D0NB 2DX1A 3F0WA 2GCJA 1MKEA 1P3RA 2J0JA 1QC6A 3PP2A 3PVLA 1GG3A 2VKIA 1UEFA 1LW3A 2OQBA 2LKOA 4EKUA 1DROA
chains in the Genus database with same CATH superfamily
4F7UP 5C16A 5LG4B 2DN6A 4ZRIA 3DXCA 2CY5A 1BTKA 5C5BB 2KGXB 1P5TA 4CHMA 2DHJA 1MK7B 3KZ1A 3D8EA 3KSYA 3U12A 2YVCA 2RVBB 4L1RA 2RLOA 5JHGA 1WG7A 4GMXB 1J0WA 3NWDA 5DI9B 2I5CA 1GC6A 2ZKMX 5DIFB 1EVHA 3HQCA 3DXEA 3VOQA 2J0MA 5D3XA 2YT1A 1W1GA 4HAWB 2W2XD 3AJ4A 3P6AA 4HATB 4C0AA 4MY6A 2DYQA 4Z2MB 4HAVB 2P0HA 3TFMA 2V76A 3TVVA 3PZDA 3G9WA 2R0DA 4IOYX 3TO1A 2X18A 2ADZA 2YT0A 2KUPA 1N3HA 1EF1A 1PFJA 1IRSA 3BJIA 3A8QA 5I2MA 3MPXA 4HAZB 3VIAA 1K5DB 1Y5OA 4IAPA 2MDXA 3IVFA 1TJ6A 1OMWA 1U29A 4GOUA 5J3TA 5I2SA 2NBVA 2P8VA 1NI2A 2JP2A 4NSWA 1J19A 1KI1B 4F7HA 2DTCA 3ULBA 1K5GB 2H7DA 1XR0B 4BBKA 5KQ4A 4D6WA 4DX90 2YRYA 1MK9B 5M4YB 1ZM0A 5IRSA 1ZVRA 2J0KA 4QXAB 4IFSA 1XX0A 2J59M 3CIKA 3RCPA 2D10A 2EC1A 3NW8A 2VRWB 1E5WA 3HSAA 2Z13A 1FHWA 2R09A 4A6FA 1XKEA 5GOWB 1TQZA 4L6EA 1UNQA 5DHAB 5D27A 1V88A 2Z14A 2MFQA 3M1IB 5D3VA 1U5GA 2N23A 5KQ1A 5LOPB 2XQNM 4NY0A 1Y19B 3P7ZA 3B77A 3DCXA 4GPTB 3N7CA 3AU5A 5KCVA 2HE7A 1DDVA 1I7AA 3GYOA 4EJNA 3OHMB 4K2OA 4PQ0A 3HIEA 5JHHA 1UNRA 2FJLA 2K2JA 2LYDA 4EMOA 2QKMA 4CHJA 5LONB 1MIXA 4MK0A 3ZDTA 3NSUA 2FJUB 3U8ZA 4HB0B 1UPQA 1T77A 1UPRA 3CXBB 1DYNA 4YONA 2I5FA 1PMSA 1BAKA 2KR0A 3SUZA 2ELBA 1V5UA 4K17A 1UNPA 2M14A 1V5PA 2PZ1A 4HDOA 1RJ2A 4KAXB 2YS1A 1ZYIA 2UZSA 2Z59A 1FHXA 1SHCA 1QQGA 2KIEA 5HE3A 3TCAA 2Z4DA 1FGZA 3A98B 4QJ5B 3ODXA 2ROZB 2Q13A 3ZVRA 1BWNA 2DFKA 3HW2B 1OY2A 2D9ZA 2KUQA 4CYEA 3ODWA 3FM8C 5D3WA 3ULCA 5CLLB 5J3YA 4DX8A 3ODOA 2D4QA 2K00A 1V89A 2P0DA 2RUKB 3PVWA 2DLWA 2Z0OA 4HAUB 2IYBA 1LB1A 1WJ1A 4MT7A 2LG1A 3A58A 2VSZA 2GUMA 4GZUA 2DYNA 4QJ4B 1Q67A 1PLSA 2D2QA 1NTVA 4ZRJA 1WVHA 2D9VA 2EJ8A 1SGHA 5DH9B 1U5DA 4OSNA 3U7DA 4A5KA 5C5BA 1ZC3B 2YF0A 2Z0PA 1U27A 2ROVA 1WGUA 2R2YA 1V61A 4HB2B 2YS3A 2I1JA 5D3YA 1MIZB 2RSGA 1BTNA 1GC7A 4ZRKA 3UZTA 2DHKA 1EGXA 4HAXB 1KZGA 4K81A 1FAOA 1U5FA 4HAYB 4Y94A 2DKQA 3SNHA 2Y8GA 4HDQA 2W2WA 2YSZA 4OT1A 1B55A 3KRWA 3FSSA 3X23A 4A6HA 2MWNB 1H4RA 2Z0QA 4GXBA 1WI1A 1ZC4B 2W2XC 4B6HA 3SV1A 4DIXA 2HTHB 2RNRB 5DHFB 3WA0A 2LOXA 2YS5A 2AL6A 5HE2A 5HE0A 2M38A 3TW1A 4A6KA 4P7IA 2MKRA 3MDBC 3PG7A 3NWAA 1H10A 5JP4A 2D9XA 2D11A 3QBVB 3DXDA 1M7RA 4HB3B 1MAIA 3GYPA 2H7EA 1WGQA 3A8PA 2RGNB 2N0YA 4F7GA 2E2XA 1X1FA 2NZ8B 2LOZA 2YT2A 4KHAA 1EAZA 4QJ3B 3NWFA 1P6SA 2G35A 4HHVA 2L2IA 2CY4A 1MPHA 5L81A 4KHBB 2QKLA 5FI0A 2D9YA 2DX5A 4GN1A 3PSCA 2CAYA 3O96A 1W1DA 2GCLA 1X86A 2ZPYA 4DBBA 4YL8A 3D8FA 1W1HA 2Y7BA 4GNKB 1ISNA 4H8SA 2DHIA 3PVUA 2K2UA 3FVCA 3OANA 3V5WA 3ML4A 1NTYA 2COCA 3BINA 4TKNA 4TYZA 4HB4B 1Z87A 1M7EA 2CRFA 3AU4A 4A6FB 3KY9A 2COFA 4K2PA 3D8DA 3QIJA 1FB8A 2AEHA 4GMVA 4KHOA 1FOEA 1RRPB 1FHOA 2D9WA 3HK0A 2KIGA 5C79A 4WVFB 3F5RA 5EFXA 2RRFA 1XCGA 2UVMA 1WJMA 3QWMA 5FI1A 5J3QA 1AQCA 2NMBA 5HE1A 3WYFB 3FEHA 2LULA 2GS0A 5JLJB 2DKPA 2OTXA 1X1GA 3KRXA 2P0FA 4KHBA 4WJ7A 2EMTA 1U2BA 1MI1A 1TXDA 1U5EA 2L1CA 5C6RA 4KVGB 3PEGA 1DDWA 2DA0A 1I2HA 2BCJA 2IFSA 1ZSQA 1X11A 4WSFA 2Y8FA 2K49A 2I1KA 1XD4A 1DDMA 2COAA 2K8EA 3LJUX 1AWEA 5CLQB 1XODA 2UZRA 3SO6A 3T06A 1V5MA 3SYXA 4DXAB 2CODA 2ELAA 1DBHA 1NU2A 2GJYA 4HSIA 1OQNA 1X05A 2KCJA 4XWXA 1FGYA 4PNKA 2EMSA 1KZ7A 4Z2NA 4D0NB 2DX1A 3F0WA 2GCJA 1MKEA 1P3RA 2J0JA 1QC6A 3PP2A 3PVLA 4CSQA 1GG3A 2VKIA 1UEFA 1LW3A 2OQBA 2LKOA 4EKUA 1DROA
chains in the Genus database with same CATH topology
4F7UP 5C16A 2DN6A 4ZRIA 3DXCA 2CY5A 1BTKA 5C5BB 2KGXB 1P5TA 4CHMA 2DHJA 1MK7B 3KZ1A 3D8EA 3KSYA 2YVCA 2RVBB 2RLOA 5JHGA 1WG7A 4GMXB 1J0WA 5DI9B 2I5CA 1GC6A 5DIFB 1EVHA 3HQCA 3DXEA 3VOQA 2J0MA 5D3XA 2YT1A 1W1GA 4HAWB 2W2XD 3AJ4A 3P6AA 4HATB 4C0AA 4MY6A 2DYQA 4Z2MB 4HAVB 2P0HA 3TFMA 2V76A 3TVVA 3PZDA 3G9WA 2R0DA 4IOYX 3TO1A 2X18A 2ADZA 2YT0A 2KUPA 1N3HA 1EF1A 1PFJA 1IRSA 3BJIA 3A8QA 3MPXA 4HAZB 3VIAA 1K5DB 1Y5OA 4IAPA 2MDXA 3IVFA 1TJ6A 1OMWA 1U29A 5J3TA 2P8VA 1NI2A 2JP2A 4NSWA 1J19A 1KI1B 4F7HA 2DTCA 3ULBA 1K5GB 2H7DA 1XR0B 4BBKA 5KQ4A 4DX90 2YRYA 1MK9B 1ZM0A 1ZVRA 2J0KA 4IFSA 1XX0A 2J59M 3CIKA 3RCPA 2D10A 2EC1A 2VRWB 1E5WA 1FHWA 2R09A 4A6FA 1XKEA 5GOWB 1TQZA 4L6EA 1UNQA 5DHAB 5D27A 1V88A 2MFQA 3M1IB 5D3VA 1U5GA 2N23A 5KQ1A 5LOPB 2XQNM 4NY0A 1Y19B 3P7ZA 4GPTB 3N7CA 3AU5A 5KCVA 2HE7A 1DDVA 1I7AA 3GYOA 4EJNA 4K2OA 4PQ0A 5JHHA 1UNRA 2FJLA 2K2JA 2LYDA 4EMOA 2QKMA 4CHJA 5LONB 1MIXA 4MK0A 3ZDTA 3NSUA 3U8ZA 4HB0B 1UPQA 1UPRA 3CXBB 1DYNA 4YONA 2I5FA 1PMSA 1BAKA 3SUZA 2ELBA 1V5UA 4K17A 1UNPA 2M14A 1V5PA 2PZ1A 4HDOA 1RJ2A 4KAXB 2YS1A 2UZSA 1FHXA 1SHCA 1QQGA 5HE3A 3TCAA 1FGZA 3A98B 3ODXA 2ROZB 2Q13A 3ZVRA 1BWNA 2DFKA 3HW2B 1OY2A 2D9ZA 4CYEA 3ODWA 3FM8C 5D3WA 3ULCA 5CLLB 5J3YA 4DX8A 3ODOA 2D4QA 2K00A 1V89A 2P0DA 2RUKB 3PVWA 2DLWA 2Z0OA 4HAUB 2IYBA 1LB1A 1WJ1A 4MT7A 2LG1A 2VSZA 4GZUA 2DYNA 1Q67A 1PLSA 2D2QA 1NTVA 4ZRJA 1WVHA 2D9VA 2EJ8A 1SGHA 5DH9B 1U5DA 3U7DA 4A5KA 5C5BA 1ZC3B 2YF0A 2Z0PA 1U27A 2ROVA 1WGUA 1V61A 4HB2B 2YS3A 2I1JA 5D3YA 1MIZB 2RSGA 1BTNA 1GC7A 4ZRKA 3UZTA 2DHKA 1EGXA 4HAXB 1KZGA 4K81A 1FAOA 1U5FA 4HAYB 4Y94A 2DKQA 3SNHA 2Y8GA 4HDQA 2W2WA 2YSZA 1B55A 3KRWA 3FSSA 3X23A 4A6HA 2MWNB 1H4RA 2Z0QA 4GXBA 1WI1A 1ZC4B 2W2XC 4B6HA 3SV1A 2HTHB 2RNRB 5DHFB 3WA0A 2LOXA 2YS5A 2AL6A 5HE2A 5HE0A 2M38A 3TW1A 4A6KA 4P7IA 2MKRA 3MDBC 3PG7A 1H10A 5JP4A 2D9XA 2D11A 3QBVB 3DXDA 1M7RA 4HB3B 1MAIA 3GYPA 2H7EA 1WGQA 3A8PA 2RGNB 2N0YA 4F7GA 2E2XA 1X1FA 2NZ8B 2LOZA 4KHAA 1EAZA 1P6SA 2G35A 4HHVA 2L2IA 2CY4A 1MPHA 5L81A 4KHBB 2QKLA 5FI0A 2D9YA 2DX5A 4GN1A 3PSCA 2CAYA 3O96A 1W1DA 2GCLA 1X86A 2ZPYA 4DBBA 4YL8A 3D8FA 1W1HA 2Y7BA 1ISNA 4H8SA 2DHIA 3PVUA 2K2UA 3OANA 3V5WA 3ML4A 1NTYA 2COCA 3BINA 4TKNA 4TYZA 4HB4B 1Z87A 1M7EA 2CRFA 3AU4A 4A6FB 3KY9A 2COFA 4K2PA 3D8DA 3QIJA 1FB8A 2AEHA 4GMVA 4KHOA 1FOEA 1RRPB 1FHOA 2D9WA 3HK0A 5C79A 4WVFB 3F5RA 5EFXA 1XCGA 2UVMA 1WJMA 3QWMA 5FI1A 5J3QA 1AQCA 2NMBA 5HE1A 3WYFB 3FEHA 2LULA 2GS0A 5JLJB 2DKPA 2OTXA 1X1GA 3KRXA 2P0FA 4WJ7A 2EMTA 1U2BA 1TXDA 1U5EA 2L1CA 5C6RA 4KVGB 3PEGA 1DDWA 2DA0A 1I2HA 2BCJA 2IFSA 1ZSQA 1X11A 4WSFA 2Y8FA 2I1KA 1XD4A 1DDMA 2COAA 3LJUX 1AWEA 5CLQB 1XODA 2UZRA 3SO6A 3T06A 1V5MA 3SYXA 4DXAB 2CODA 2ELAA 1DBHA 1NU2A 2GJYA 1OQNA 1X05A 2KCJA 4XWXA 1FGYA 4PNKA 2EMSA 1KZ7A 4Z2NA 4D0NB 2DX1A 3F0WA 2GCJA 1MKEA 1P3RA 2J0JA 1QC6A 3PP2A 3PVLA 1GG3A 2VKIA 1UEFA 1LW3A 2OQBA 2LKOA 4EKUA 1DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U P;  5C16 A;  2DN6 A;  4ZRI A;  3DXC A;  2CY5 A;  1BTK A;  5C5B B;  2KGX B;  1P5T A;  4CHM A;  2DHJ A;  1MK7 B;  3KZ1 A;  3D8E A;  3KSY A;  2YVC A;  2RVB B;  2RLO A;  5JHG A;  1WG7 A;  4GMX B;  1J0W A;  5DI9 B;  2I5C A;  1GC6 A;  5DIF B;  1EVH A;  3HQC A;  3DXE A;  3VOQ A;  2J0M A;  5D3X A;  2YT1 A;  1W1G A;  4HAW B;  2W2X D;  3AJ4 A;  3P6A A;  4HAT B;  4C0A A;  4MY6 A;  2DYQ A;  4Z2M B;  4HAV B;  2P0H A;  3TFM A;  2V76 A;  3TVV A;  3PZD A;  3G9W A;  2R0D A;  4IOY X;  3TO1 A;  2X18 A;  2ADZ A;  2YT0 A;  2KUP A;  1N3H A;  1EF1 A;  1PFJ A;  1IRS A;  3BJI A;  3A8Q A;  3MPX A;  4HAZ B;  3VIA A;  1K5D B;  1Y5O A;  4IAP A;  2MDX A;  3IVF A;  1TJ6 A;  1OMW A;  1U29 A;  5J3T A;  2P8V A;  1NI2 A;  2JP2 A;  4NSW A;  1J19 A;  1KI1 B;  4F7H A;  2DTC A;  3ULB A;  1K5G B;  2H7D A;  1XR0 B;  4BBK A;  5KQ4 A;  4DX9 0;  2YRY A;  1MK9 B;  1ZM0 A;  1ZVR A;  2J0K A;  4IFS A;  1XX0 A;  2J59 M;  3CIK A;  3RCP A;  2D10 A;  2EC1 A;  2VRW B;  1E5W A;  1FHW A;  2R09 A;  4A6F A;  1XKE A;  5GOW B;  1TQZ A;  4L6E A;  1UNQ A;  5DHA B;  5D27 A;  1V88 A;  2MFQ A;  3M1I B;  5D3V A;  1U5G A;  2N23 A;  5KQ1 A;  5LOP B;  2XQN M;  4NY0 A;  1Y19 B;  3P7Z A;  4GPT B;  3N7C A;  3AU5 A;  5KCV A;  2HE7 A;  1DDV A;  1I7A A;  3GYO A;  4EJN A;  4K2O A;  4PQ0 A;  5JHH A;  1UNR A;  2FJL A;  2K2J A;  2LYD A;  4EMO A;  2QKM A;  4CHJ A;  5LON B;  1MIX A;  4MK0 A;  3ZDT A;  3NSU A;  3U8Z A;  4HB0 B;  1UPQ A;  1UPR A;  3CXB B;  1DYN A;  4YON A;  2I5F A;  1PMS A;  1BAK A;  3SUZ A;  2ELB A;  1V5U A;  4K17 A;  1UNP A;  2M14 A;  1V5P A;  2PZ1 A;  4HDO A;  1RJ2 A;  4KAX B;  2YS1 A;  2UZS A;  1FHX A;  1SHC A;  1QQG A;  5HE3 A;  3TCA A;  1FGZ A;  3A98 B;  3ODX A;  2ROZ B;  2Q13 A;  3ZVR A;  1BWN A;  2DFK A;  3HW2 B;  1OY2 A;  2D9Z A;  4CYE A;  3ODW A;  3FM8 C;  5D3W A;  3ULC A;  5CLL B;  5J3Y A;  4DX8 A;  3ODO A;  2D4Q A;  2K00 A;  1V89 A;  2P0D A;  2RUK B;  3PVW A;  2DLW A;  2Z0O A;  4HAU B;  2IYB A;  1LB1 A;  1WJ1 A;  4MT7 A;  2LG1 A;  2VSZ A;  4GZU A;  2DYN A;  1Q67 A;  1PLS A;  2D2Q A;  1NTV A;  4ZRJ A;  1WVH A;  2D9V A;  2EJ8 A;  1SGH A;  5DH9 B;  1U5D A;  3U7D A;  4A5K A;  5C5B A;  1ZC3 B;  2YF0 A;  2Z0P A;  1U27 A;  2ROV A;  1WGU A;  1V61 A;  4HB2 B;  2YS3 A;  2I1J A;  5D3Y A;  1MIZ B;  2RSG A;  1BTN A;  1GC7 A;  4ZRK A;  3UZT A;  2DHK A;  1EGX A;  4HAX B;  1KZG A;  4K81 A;  1FAO A;  1U5F A;  4HAY B;  4Y94 A;  2DKQ A;  3SNH A;  2Y8G A;  4HDQ A;  2W2W A;  2YSZ A;  1B55 A;  3KRW A;  3FSS A;  3X23 A;  4A6H A;  2MWN B;  1H4R A;  2Z0Q A;  4GXB A;  1WI1 A;  1ZC4 B;  2W2X C;  4B6H A;  3SV1 A;  2HTH B;  2RNR B;  5DHF B;  3WA0 A;  2LOX A;  2YS5 A;  2AL6 A;  5HE2 A;  5HE0 A;  2M38 A;  3TW1 A;  4A6K A;  4P7I A;  2MKR A;  3MDB C;  3PG7 A;  1H10 A;  5JP4 A;  2D9X A;  2D11 A;  3QBV B;  3DXD A;  1M7R A;  4HB3 B;  1MAI A;  3GYP A;  2H7E A;  1WGQ A;  3A8P A;  2RGN B;  2N0Y A;  4F7G A;  2E2X A;  1X1F A;  2NZ8 B;  2LOZ A;  4KHA A;  1EAZ A;  1P6S A;  2G35 A;  4HHV A;  2L2I A;  2CY4 A;  1MPH A;  5L81 A;  4KHB B;  2QKL A;  5FI0 A;  2D9Y A;  2DX5 A;  4GN1 A;  3PSC A;  2CAY A;  3O96 A;  1W1D A;  2GCL A;  1X86 A;  2ZPY A;  4DBB A;  4YL8 A;  3D8F A;  1W1H A;  2Y7B A;  1ISN A;  4H8S A;  2DHI A;  3PVU A;  2K2U A;  3OAN A;  3V5W A;  3ML4 A;  1NTY A;  2COC A;  3BIN A;  4TKN A;  4TYZ A;  4HB4 B;  1Z87 A;  1M7E A;  2CRF A;  3AU4 A;  4A6F B;  3KY9 A;  2COF A;  4K2P A;  3D8D A;  3QIJ A;  1FB8 A;  2AEH A;  4GMV A;  4KHO A;  1FOE A;  1RRP B;  1FHO A;  2D9W A;  3HK0 A;  5C79 A;  4WVF B;  3F5R A;  5EFX A;  1XCG A;  2UVM A;  1WJM A;  3QWM A;  5FI1 A;  5J3Q A;  1AQC A;  2NMB A;  5HE1 A;  3WYF B;  3FEH A;  2LUL A;  2GS0 A;  5JLJ B;  2DKP A;  2OTX A;  1X1G A;  3KRX A;  2P0F A;  4WJ7 A;  2EMT A;  1U2B A;  1TXD A;  1U5E A;  2L1C A;  5C6R A;  4KVG B;  3PEG A;  1DDW A;  2DA0 A;  1I2H A;  2BCJ A;  2IFS A;  1ZSQ A;  1X11 A;  4WSF A;  2Y8F A;  2I1K A;  1XD4 A;  1DDM A;  2COA A;  3LJU X;  1AWE A;  5CLQ B;  1XOD A;  2UZR A;  3SO6 A;  3T06 A;  1V5M A;  3SYX A;  4DXA B;  2COD A;  2ELA A;  1DBH A;  1NU2 A;  2GJY A;  1OQN A;  1X05 A;  2KCJ A;  4XWX A;  1FGY A;  4PNK A;  2EMS A;  1KZ7 A;  4Z2N A;  4D0N B;  2DX1 A;  3F0W A;  2GCJ A;  1MKE A;  1P3R A;  2J0J A;  1QC6 A;  3PP2 A;  3PVL A;  1GG3 A;  2VKI A;  1UEF A;  1LW3 A;  2OQB A;  2LKO A;  4EKU A;  1DRO A; 
#chains in the Genus database with same CATH topology
 4F7U P;  5C16 A;  5LG4 B;  2DN6 A;  4ZRI A;  3DXC A;  2CY5 A;  1BTK A;  5C5B B;  2KGX B;  1P5T A;  4CHM A;  2DHJ A;  1MK7 B;  3KZ1 A;  3D8E A;  3KSY A;  3U12 A;  2YVC A;  2RVB B;  4L1R A;  2RLO A;  5JHG A;  1WG7 A;  4GMX B;  1J0W A;  3NWD A;  5DI9 B;  2I5C A;  1GC6 A;  2ZKM X;  5DIF B;  1EVH A;  3HQC A;  3DXE A;  3VOQ A;  2J0M A;  5D3X A;  2YT1 A;  1W1G A;  4HAW B;  2W2X D;  3AJ4 A;  3P6A A;  4HAT B;  4C0A A;  4MY6 A;  2DYQ A;  4Z2M B;  4HAV B;  2P0H A;  3TFM A;  2V76 A;  3TVV A;  3PZD A;  3G9W A;  2R0D A;  4IOY X;  3TO1 A;  2X18 A;  2ADZ A;  2YT0 A;  2KUP A;  1N3H A;  1EF1 A;  1PFJ A;  1IRS A;  3BJI A;  3A8Q A;  5I2M A;  3MPX A;  4HAZ B;  3VIA A;  1K5D B;  1Y5O A;  4IAP A;  2MDX A;  3IVF A;  1TJ6 A;  1OMW A;  1U29 A;  4GOU A;  5J3T A;  5I2S A;  2NBV A;  2P8V A;  1NI2 A;  2JP2 A;  4NSW A;  1J19 A;  1KI1 B;  4F7H A;  2DTC A;  3ULB A;  1K5G B;  2H7D A;  1XR0 B;  4BBK A;  5KQ4 A;  4D6W A;  4DX9 0;  2YRY A;  1MK9 B;  5M4Y B;  1ZM0 A;  5IRS A;  1ZVR A;  2J0K A;  4QXA B;  4IFS A;  1XX0 A;  2J59 M;  3CIK A;  3RCP A;  2D10 A;  2EC1 A;  3NW8 A;  2VRW B;  1E5W A;  3HSA A;  2Z13 A;  1FHW A;  2R09 A;  4A6F A;  1XKE A;  5GOW B;  1TQZ A;  4L6E A;  1UNQ A;  5DHA B;  5D27 A;  1V88 A;  2Z14 A;  2MFQ A;  3M1I B;  5D3V A;  1U5G A;  2N23 A;  5KQ1 A;  5LOP B;  2XQN M;  4NY0 A;  1Y19 B;  3P7Z A;  3B77 A;  3DCX A;  4GPT B;  3N7C A;  3AU5 A;  5KCV A;  2HE7 A;  1DDV A;  1I7A A;  3GYO A;  4EJN A;  3OHM B;  4K2O A;  4PQ0 A;  3HIE A;  5JHH A;  1UNR A;  2FJL A;  2K2J A;  2LYD A;  4EMO A;  2QKM A;  4CHJ A;  5LON B;  1MIX A;  4MK0 A;  3ZDT A;  3NSU A;  2FJU B;  3U8Z A;  4HB0 B;  1UPQ A;  1T77 A;  1UPR A;  3CXB B;  1DYN A;  4YON A;  2I5F A;  1PMS A;  1BAK A;  2KR0 A;  3SUZ A;  2ELB A;  1V5U A;  4K17 A;  1UNP A;  2M14 A;  1V5P A;  2PZ1 A;  4HDO A;  1RJ2 A;  4KAX B;  2YS1 A;  1ZYI A;  2UZS A;  2Z59 A;  1FHX A;  1SHC A;  1QQG A;  2KIE A;  5HE3 A;  3TCA A;  2Z4D A;  1FGZ A;  3A98 B;  4QJ5 B;  3ODX A;  2ROZ B;  2Q13 A;  3ZVR A;  1BWN A;  2DFK A;  3HW2 B;  1OY2 A;  2D9Z A;  2KUQ A;  4CYE A;  3ODW A;  3FM8 C;  5D3W A;  3ULC A;  5CLL B;  5J3Y A;  4DX8 A;  3ODO A;  2D4Q A;  2K00 A;  1V89 A;  2P0D A;  2RUK B;  3PVW A;  2DLW A;  2Z0O A;  4HAU B;  2IYB A;  1LB1 A;  1WJ1 A;  4MT7 A;  2LG1 A;  3A58 A;  2VSZ A;  2GUM A;  4GZU A;  2DYN A;  4QJ4 B;  1Q67 A;  1PLS A;  2D2Q A;  1NTV A;  4ZRJ A;  1WVH A;  2D9V A;  2EJ8 A;  1SGH A;  5DH9 B;  1U5D A;  4OSN A;  3U7D A;  4A5K A;  5C5B A;  1ZC3 B;  2YF0 A;  2Z0P A;  1U27 A;  2ROV A;  1WGU A;  2R2Y A;  1V61 A;  4HB2 B;  2YS3 A;  2I1J A;  5D3Y A;  1MIZ B;  2RSG A;  1BTN A;  1GC7 A;  4ZRK A;  3UZT A;  2DHK A;  1EGX A;  4HAX B;  1KZG A;  4K81 A;  1FAO A;  1U5F A;  4HAY B;  4Y94 A;  2DKQ A;  3SNH A;  2Y8G A;  4HDQ A;  2W2W A;  2YSZ A;  4OT1 A;  1B55 A;  3KRW A;  3FSS A;  3X23 A;  4A6H A;  2MWN B;  1H4R A;  2Z0Q A;  4GXB A;  1WI1 A;  1ZC4 B;  2W2X C;  4B6H A;  3SV1 A;  4DIX A;  2HTH B;  2RNR B;  5DHF B;  3WA0 A;  2LOX A;  2YS5 A;  2AL6 A;  5HE2 A;  5HE0 A;  2M38 A;  3TW1 A;  4A6K A;  4P7I A;  2MKR A;  3MDB C;  3PG7 A;  3NWA A;  1H10 A;  5JP4 A;  2D9X A;  2D11 A;  3QBV B;  3DXD A;  1M7R A;  4HB3 B;  1MAI A;  3GYP A;  2H7E A;  1WGQ A;  3A8P A;  2RGN B;  2N0Y A;  4F7G A;  2E2X A;  1X1F A;  2NZ8 B;  2LOZ A;  2YT2 A;  4KHA A;  1EAZ A;  4QJ3 B;  3NWF A;  1P6S A;  2G35 A;  4HHV A;  2L2I A;  2CY4 A;  1MPH A;  5L81 A;  4KHB B;  2QKL A;  5FI0 A;  2D9Y A;  2DX5 A;  4GN1 A;  3PSC A;  2CAY A;  3O96 A;  1W1D A;  2GCL A;  1X86 A;  2ZPY A;  4DBB A;  4YL8 A;  3D8F A;  1W1H A;  2Y7B A;  4GNK B;  1ISN A;  4H8S A;  2DHI A;  3PVU A;  2K2U A;  3FVC A;  3OAN A;  3V5W A;  3ML4 A;  1NTY A;  2COC A;  3BIN A;  4TKN A;  4TYZ A;  4HB4 B;  1Z87 A;  1M7E A;  2CRF A;  3AU4 A;  4A6F B;  3KY9 A;  2COF A;  4K2P A;  3D8D A;  3QIJ A;  1FB8 A;  2AEH A;  4GMV A;  4KHO A;  1FOE A;  1RRP B;  1FHO A;  2D9W A;  3HK0 A;  2KIG A;  5C79 A;  4WVF B;  3F5R A;  5EFX A;  2RRF A;  1XCG A;  2UVM A;  1WJM A;  3QWM A;  5FI1 A;  5J3Q A;  1AQC A;  2NMB A;  5HE1 A;  3WYF B;  3FEH A;  2LUL A;  2GS0 A;  5JLJ B;  2DKP A;  2OTX A;  1X1G A;  3KRX A;  2P0F A;  4KHB A;  4WJ7 A;  2EMT A;  1U2B A;  1MI1 A;  1TXD A;  1U5E A;  2L1C A;  5C6R A;  4KVG B;  3PEG A;  1DDW A;  2DA0 A;  1I2H A;  2BCJ A;  2IFS A;  1ZSQ A;  1X11 A;  4WSF A;  2Y8F A;  2K49 A;  2I1K A;  1XD4 A;  1DDM A;  2COA A;  2K8E A;  3LJU X;  1AWE A;  5CLQ B;  1XOD A;  2UZR A;  3SO6 A;  3T06 A;  1V5M A;  3SYX A;  4DXA B;  2COD A;  2ELA A;  1DBH A;  1NU2 A;  2GJY A;  4HSI A;  1OQN A;  1X05 A;  2KCJ A;  4XWX A;  1FGY A;  4PNK A;  2EMS A;  1KZ7 A;  4Z2N A;  4D0N B;  2DX1 A;  3F0W A;  2GCJ A;  1MKE A;  1P3R A;  2J0J A;  1QC6 A;  3PP2 A;  3PVL A;  4CSQ A;  1GG3 A;  2VKI A;  1UEF A;  1LW3 A;  2OQB A;  2LKO A;  4EKU A;  1DRO A; 
#chains in the Genus database with same CATH homology
 4F7U P;  5C16 A;  2DN6 A;  4ZRI A;  3DXC A;  2CY5 A;  1BTK A;  5C5B B;  2KGX B;  1P5T A;  4CHM A;  2DHJ A;  1MK7 B;  3KZ1 A;  3D8E A;  3KSY A;  2YVC A;  2RVB B;  2RLO A;  5JHG A;  1WG7 A;  4GMX B;  1J0W A;  5DI9 B;  2I5C A;  1GC6 A;  5DIF B;  1EVH A;  3HQC A;  3DXE A;  3VOQ A;  2J0M A;  5D3X A;  2YT1 A;  1W1G A;  4HAW B;  2W2X D;  3AJ4 A;  3P6A A;  4HAT B;  4C0A A;  4MY6 A;  2DYQ A;  4Z2M B;  4HAV B;  2P0H A;  3TFM A;  2V76 A;  3TVV A;  3PZD A;  3G9W A;  2R0D A;  4IOY X;  3TO1 A;  2X18 A;  2ADZ A;  2YT0 A;  2KUP A;  1N3H A;  1EF1 A;  1PFJ A;  1IRS A;  3BJI A;  3A8Q A;  3MPX A;  4HAZ B;  3VIA A;  1K5D B;  1Y5O A;  4IAP A;  2MDX A;  3IVF A;  1TJ6 A;  1OMW A;  1U29 A;  5J3T A;  2P8V A;  1NI2 A;  2JP2 A;  4NSW A;  1J19 A;  1KI1 B;  4F7H A;  2DTC A;  3ULB A;  1K5G B;  2H7D A;  1XR0 B;  4BBK A;  5KQ4 A;  4DX9 0;  2YRY A;  1MK9 B;  1ZM0 A;  1ZVR A;  2J0K A;  4IFS A;  1XX0 A;  2J59 M;  3CIK A;  3RCP A;  2D10 A;  2EC1 A;  2VRW B;  1E5W A;  1FHW A;  2R09 A;  4A6F A;  1XKE A;  5GOW B;  1TQZ A;  4L6E A;  1UNQ A;  5DHA B;  5D27 A;  1V88 A;  2MFQ A;  3M1I B;  5D3V A;  1U5G A;  2N23 A;  5KQ1 A;  5LOP B;  2XQN M;  4NY0 A;  1Y19 B;  3P7Z A;  4GPT B;  3N7C A;  3AU5 A;  5KCV A;  2HE7 A;  1DDV A;  1I7A A;  3GYO A;  4EJN A;  4K2O A;  4PQ0 A;  5JHH A;  1UNR A;  2FJL A;  2K2J A;  2LYD A;  4EMO A;  2QKM A;  4CHJ A;  5LON B;  1MIX A;  4MK0 A;  3ZDT A;  3NSU A;  3U8Z A;  4HB0 B;  1UPQ A;  1UPR A;  3CXB B;  1DYN A;  4YON A;  2I5F A;  1PMS A;  1BAK A;  3SUZ A;  2ELB A;  1V5U A;  4K17 A;  1UNP A;  2M14 A;  1V5P A;  2PZ1 A;  4HDO A;  1RJ2 A;  4KAX B;  2YS1 A;  2UZS A;  1FHX A;  1SHC A;  1QQG A;  5HE3 A;  3TCA A;  1FGZ A;  3A98 B;  3ODX A;  2ROZ B;  2Q13 A;  3ZVR A;  1BWN A;  2DFK A;  3HW2 B;  1OY2 A;  2D9Z A;  4CYE A;  3ODW A;  3FM8 C;  5D3W A;  3ULC A;  5CLL B;  5J3Y A;  4DX8 A;  3ODO A;  2D4Q A;  2K00 A;  1V89 A;  2P0D A;  2RUK B;  3PVW A;  2DLW A;  2Z0O A;  4HAU B;  2IYB A;  1LB1 A;  1WJ1 A;  4MT7 A;  2LG1 A;  2VSZ A;  4GZU A;  2DYN A;  1Q67 A;  1PLS A;  2D2Q A;  1NTV A;  4ZRJ A;  1WVH A;  2D9V A;  2EJ8 A;  1SGH A;  5DH9 B;  1U5D A;  3U7D A;  4A5K A;  5C5B A;  1ZC3 B;  2YF0 A;  2Z0P A;  1U27 A;  2ROV A;  1WGU A;  1V61 A;  4HB2 B;  2YS3 A;  2I1J A;  5D3Y A;  1MIZ B;  2RSG A;  1BTN A;  1GC7 A;  4ZRK A;  3UZT A;  2DHK A;  1EGX A;  4HAX B;  1KZG A;  4K81 A;  1FAO A;  1U5F A;  4HAY B;  4Y94 A;  2DKQ A;  3SNH A;  2Y8G A;  4HDQ A;  2W2W A;  2YSZ A;  1B55 A;  3KRW A;  3FSS A;  3X23 A;  4A6H A;  2MWN B;  1H4R A;  2Z0Q A;  4GXB A;  1WI1 A;  1ZC4 B;  2W2X C;  4B6H A;  3SV1 A;  2HTH B;  2RNR B;  5DHF B;  3WA0 A;  2LOX A;  2YS5 A;  2AL6 A;  5HE2 A;  5HE0 A;  2M38 A;  3TW1 A;  4A6K A;  4P7I A;  2MKR A;  3MDB C;  3PG7 A;  1H10 A;  5JP4 A;  2D9X A;  2D11 A;  3QBV B;  3DXD A;  1M7R A;  4HB3 B;  1MAI A;  3GYP A;  2H7E A;  1WGQ A;  3A8P A;  2RGN B;  2N0Y A;  4F7G A;  2E2X A;  1X1F A;  2NZ8 B;  2LOZ A;  4KHA A;  1EAZ A;  1P6S A;  2G35 A;  4HHV A;  2L2I A;  2CY4 A;  1MPH A;  5L81 A;  4KHB B;  2QKL A;  5FI0 A;  2D9Y A;  2DX5 A;  4GN1 A;  3PSC A;  2CAY A;  3O96 A;  1W1D A;  2GCL A;  1X86 A;  2ZPY A;  4DBB A;  4YL8 A;  3D8F A;  1W1H A;  2Y7B A;  1ISN A;  4H8S A;  2DHI A;  3PVU A;  2K2U A;  3OAN A;  3V5W A;  3ML4 A;  1NTY A;  2COC A;  3BIN A;  4TKN A;  4TYZ A;  4HB4 B;  1Z87 A;  1M7E A;  2CRF A;  3AU4 A;  4A6F B;  3KY9 A;  2COF A;  4K2P A;  3D8D A;  3QIJ A;  1FB8 A;  2AEH A;  4GMV A;  4KHO A;  1FOE A;  1RRP B;  1FHO A;  2D9W A;  3HK0 A;  5C79 A;  4WVF B;  3F5R A;  5EFX A;  1XCG A;  2UVM A;  1WJM A;  3QWM A;  5FI1 A;  5J3Q A;  1AQC A;  2NMB A;  5HE1 A;  3WYF B;  3FEH A;  2LUL A;  2GS0 A;  5JLJ B;  2DKP A;  2OTX A;  1X1G A;  3KRX A;  2P0F A;  4WJ7 A;  2EMT A;  1U2B A;  1TXD A;  1U5E A;  2L1C A;  5C6R A;  4KVG B;  3PEG A;  1DDW A;  2DA0 A;  1I2H A;  2BCJ A;  2IFS A;  1ZSQ A;  1X11 A;  4WSF A;  2Y8F A;  2I1K A;  1XD4 A;  1DDM A;  2COA A;  3LJU X;  1AWE A;  5CLQ B;  1XOD A;  2UZR A;  3SO6 A;  3T06 A;  1V5M A;  3SYX A;  4DXA B;  2COD A;  2ELA A;  1DBH A;  1NU2 A;  2GJY A;  1OQN A;  1X05 A;  2KCJ A;  4XWX A;  1FGY A;  4PNK A;  2EMS A;  1KZ7 A;  4Z2N A;  4D0N B;  2DX1 A;  3F0W A;  2GCJ A;  1MKE A;  1P3R A;  2J0J A;  1QC6 A;  3PP2 A;  3PVL A;  1GG3 A;  2VKI A;  1UEF A;  1LW3 A;  2OQB A;  2LKO A;  4EKU A;  1DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...