2IFSA

Structure of the n-wasp evh1 domain in complex with an extended wip peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
169
Chain Sequence
GSESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRGGLVPRGSGGSLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Wiskott-Aldrich Syndrome Protien interacting protein and Neu
publication title Multiple WASP-interacting protein recognition motifs are required for a functional interaction with N-WASP.
pubmed doi rcsb
source organism Homo sapiens, rattus norvegicus
total genus 36
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ifsA00
3F5RA 2ROVA 2I5FA 2I1JA 1WGQA 1FHOA 1ZVRA 3OANA 5GOWB 4C0AA 3KY9A 2LOXA 3KZ1A 1BWNA 1X11A 1WGUA 4HAUB 2N23A 2W2XC 5HE0A 3U7DA 1J19A 1X1GA 4HAXB 1KZ7A 4HAWB 4YONA 1QC6A 1EGXA 4WJ7A 3VOQA 4HB4B 1NTVA 4DX90 2VSZA 4A6HA 5L81A 4HB2B 2RVBB 2M14A 2CY5A 3X23A 2D9XA 1P5TA 3DXCA 4L6EA 1FAOA 3MPXA 1W1HA 2CAYA 1I7AA 2W2XD 2VKIA 1Y5OA 3T06A 2AEHA 3SYXA 1ZC3B 5HE3A 3QWMA 1H10A 1V89A 1FGYA 1U5FA 2DHKA 2AL6A 4H8SA 2MWNB 3PP2A 2GCJA 3VIAA 5DHAB 3SNHA 2I5CA 1U5DA 3ODOA 1UPRA 1U2BA 1KI1B 3P6AA 3PSCA 3U8ZA 1MKEA 3NSUA 2Y8FA 2E2XA 4MY6A 3ZVRA 5HE2A 5LONB 4CYEA 1DYNA 4EMOA 4KHOA 2MKRA 2W2WA 1AWEA 3KRXA 2KGXB 4F7HA 4P7IA 3FM8C 1X86A 2R0DA 4F7GA 1OMWA 2NMBA 5J3YA 4XWXA 3WA0A 3UZTA 4IFSA 1W1GA 2YS5A 1XD4A 2D11A 1Z87A 3G9WA 1IRSA 1E5WA 4EJNA 1TQZA 4KHBB 5EFXA 3KSYA 1UPQA 2EMSA 1EVHA 5D3XA 1H4RA 2GS0A 3IVFA 4B6HA 2DLWA 5J3TA 1XX0A 4BBKA 2RNRB 1U5GA 2Z0QA 4Z2NA 1SGHA 2N0YA 1PFJA 1P6SA 3SV1A 3QBVB 3TCAA 2P0DA 1NTYA 4MK0A 1OQNA 4D0NB 2J59M 3TVVA 5JHGA 4IAPA 3HW2B 3PZDA 2RSGA 4DX8A 1X1FA 1WVHA 3AU5A 2ADZA 5DH9B 4F7UP 4DXAB 5JHHA 1U27A 2CRFA 1PMSA 2I1KA 2K2JA 3PVLA 5C79A 3D8DA 2L2IA 5C6RA 2DKQA 1ZM0A 2DX5A 2DYNA 2EC1A 2R09A 2ELBA 1EAZA 5FI0A 2RGNB 4HB3B 4HDOA 3DXEA 1MK9B 3MDBC 5DIFB 3TW1A 5D27A 4A6FB 3WYFB 2EJ8A 4HDQA 2Z0OA 3ULCA 2JP2A 4GN1A 5C5BB 1QQGA 1ZC4B 3HK0A 1UNPA 4HHVA 3GYOA 1BTNA 3PVWA 1MIXA 3O96A 2PZ1A 3A8QA 2YT1A 4NY0A 4HATB 1MAIA 3SUZA 3ML4A 2DKPA 5KQ1A 2P8VA 2YS3A 3ODXA 2D9YA 4Z2MB 1M7EA 3GYPA 5FI1A 2IFSA 4GXBA 2YS1A 4CHMA 4WSFA 3A98B 4ZRIA 2D10A 2DX1A 2J0MA 2Q13A 2LULA 2UZSA 2DHJA 3PEGA 4CHJA 4KHAA 1GC7A 2D9VA 5HE1A 4KVGB 1XCGA 2X18A 4HAVB 1TJ6A 2COFA 1Q67A 3A8PA 2DHIA 2MFQA 5JP4A 1K5DB 3D8EA 3AU4A 2MDXA 3ULBA 2DA0A 3PG7A 3FSSA 5J3QA 1DROA 2YVCA 4PQ0A 1I2HA 3PVUA 1DBHA 1UEFA 1MK7B 2OQBA 3BJIA 1LB1A 5JLJB 2HE7A 4ZRJA 2CODA 2L1CA 1MIZB 1V61A 1RJ2A 2YT0A 1DDVA 3BINA 1LW3A 2KUPA 3DXDA 1DDWA 1WJ1A 4Y94A 3QIJA 4A6KA 4MT7A 5D3WA 3M1IB 5C16A 2LKOA 2LOZA 1J0WA 2DTCA 2LYDA 2P0HA 1GC6A 1MPHA 2M38A 4EKUA 3TFMA 2D4QA 3LJUX 2COCA 2KCJA 3FEHA 2DYQA 1BAKA 1M7RA 1WJMA 3V5WA 1PLSA 1V5PA 1FHXA 1V5MA 1X05A 3F0WA 2ZPYA 1GG3A 2K00A 5KQ4A 4A5KA 2BCJA 1DDMA 2XQNM 4WVFB 3SO6A 2H7EA 2K2UA 4GMVA 1B55A 2QKMA 2J0KA 4PNKA 4K2PA 2D9ZA 4DBBA 5DI9B 2NZ8B 1XR0B 1XKEA 2ROZB 3ZDTA 5LOPB 2LG1A 3P7ZA 4HB0B 3HQCA 3KRWA 2H7DA 2DFKA 2UZRA 1K5GB 4GZUA 1FGZA 2D2QA 4K17A 2YF0A 2J0JA 1Y19B 2Y7BA 5D3YA 2ELAA 1EF1A 2FJLA 1WG7A 2EMTA 1ZSQA 4HAYB 5D3VA 3AJ4A 2V76A 2G35A 2GCLA 2HTHB 1FHWA 2YRYA 2P0FA 4TYZA 1TXDA 4ZRKA 1FOEA 5DHFB 4GPTB 1OY2A 1AQCA 2Z0PA 2OTXA 1ISNA 2IYBA 2RUKB 1UNQA 4IOYX 5CLQB 4YL8A 1FB8A 2Y8GA 2UVMA 1NI2A 1U29A 1KZGA 3CIKA 4HAZB 2RLOA 4KAXB 1RRPB 1W1DA 1XODA 1N3HA 3N7CA 1BTKA 1UNRA 3RCPA 1U5EA 4A6FA 2COAA 1WI1A 5C5BA 5KCVA 4K81A 1P3RA 1SHCA 2QKLA 2VRWB 5CLLB 3CXBB 3D8FA 2CY4A 4GMXB 2GJYA 3ODWA 4TKNA 1V88A 2DN6A 4NSWA 2YSZA 2D9WA 3TO1A 1NU2A 1V5UA 4K2OA
chains in the Genus database with same CATH superfamily
3F5RA 2ROVA 2I5FA 2I1JA 1WGQA 1FHOA 3HIEA 1ZVRA 3OANA 5GOWB 4C0AA 3KY9A 2LOXA 3KZ1A 1BWNA 1X11A 1WGUA 4HAUB 2N23A 2W2XC 5HE0A 3U7DA 1J19A 1X1GA 4HAXB 1KZ7A 4HAWB 4YONA 1QC6A 1EGXA 3HSAA 4WJ7A 3NW8A 2Z59A 3VOQA 4HB4B 4OT1A 1NTVA 4DX90 2VSZA 4A6HA 5L81A 4GOUA 2NBVA 4HB2B 2RVBB 2M14A 2CY5A 3X23A 2D9XA 1P5TA 3DXCA 4L6EA 1FAOA 3FVCA 3MPXA 1W1HA 2CAYA 1I7AA 2W2XD 2VKIA 1Y5OA 3T06A 2AEHA 3SYXA 2YT2A 1ZC3B 2K49A 4QJ3B 3QWMA 5HE3A 1H10A 1V89A 1FGYA 1U5FA 2DHKA 2AL6A 4H8SA 2MWNB 3PP2A 2GCJA 3VIAA 5DHAB 3SNHA 2I5CA 1U5DA 3NWDA 3ODOA 2Z13A 1UPRA 1U2BA 1KI1B 3P6AA 3PSCA 3U8ZA 1MKEA 3NSUA 2Y8FA 2E2XA 4MY6A 3ZVRA 5HE2A 5LONB 4CYEA 1DYNA 3A58A 4EMOA 4KHOA 2MKRA 2W2WA 1AWEA 3KRXA 2KGXB 4F7HA 4P7IA 3FM8C 1X86A 2KIGA 2R0DA 4F7GA 1OMWA 2NMBA 5J3YA 4XWXA 3WA0A 3UZTA 4IFSA 1W1GA 2YS5A 2Z14A 1XD4A 2D11A 1Z87A 3G9WA 1IRSA 1E5WA 4EJNA 1TQZA 3DCXA 2K8EA 4KHBB 5EFXA 3KSYA 1UPQA 2EMSA 1EVHA 5D3XA 1H4RA 2GS0A 3IVFA 4B6HA 2DLWA 5J3TA 1XX0A 4BBKA 2RNRB 1U5GA 2Z0QA 4Z2NA 2Z4DA 1SGHA 2N0YA 1PFJA 1P6SA 3SV1A 3QBVB 1ZYIA 3TCAA 2P0DA 1NTYA 4MK0A 1OQNA 4D0NB 2J59M 3TVVA 2FJUB 5JHGA 4IAPA 3HW2B 3PZDA 2RSGA 4DX8A 1X1FA 1WVHA 3AU5A 2ADZA 5DH9B 4F7UP 4DXAB 5JHHA 1U27A 2CRFA 1PMSA 3NWFA 2I1KA 2K2JA 3PVLA 5I2SA 5C79A 4L1RA 3D8DA 2L2IA 5C6RA 2DKQA 1ZM0A 2DX5A 2DYNA 2EC1A 2R09A 2ELBA 1EAZA 5FI0A 2RGNB 4HB3B 4HDOA 3DXEA 1MK9B 3MDBC 5DIFB 3TW1A 5D27A 4A6FB 3WYFB 2EJ8A 4HDQA 2Z0OA 3ULCA 2JP2A 4GN1A 5C5BB 1QQGA 1ZC4B 3HK0A 1UNPA 4HHVA 3GYOA 2KUQA 1BTNA 3PVWA 5IRSA 1MIXA 3O96A 2PZ1A 3A8QA 2YT1A 4NY0A 4DIXA 4HATB 1MAIA 4GNKB 3SUZA 3ML4A 2DKPA 5KQ1A 2P8VA 2YS3A 3ODXA 2D9YA 4Z2MB 1M7EA 3GYPA 5FI1A 2IFSA 4GXBA 2YS1A 4CHMA 4WSFA 3A98B 4ZRIA 2D10A 2DX1A 2J0MA 2Q13A 2LULA 2UZSA 2DHJA 3PEGA 4CHJA 4KHAA 1GC7A 2D9VA 5HE1A 4KVGB 1XCGA 2GUMA 2X18A 4HAVB 1TJ6A 2COFA 1Q67A 3A8PA 2DHIA 2MFQA 5JP4A 1K5DB 3D8EA 3AU4A 2MDXA 3ULBA 2DA0A 1MI1A 3PG7A 3FSSA 5J3QA 1DROA 2YVCA 1T77A 4PQ0A 3OHMB 2KIEA 1I2HA 3PVUA 4QJ4B 1DBHA 1UEFA 1MK7B 2OQBA 2R2YA 3BJIA 1LB1A 5JLJB 3NWAA 2HE7A 4ZRJA 2CODA 2L1CA 5I2MA 1MIZB 1V61A 1RJ2A 2YT0A 1DDVA 3BINA 1LW3A 2KUPA 3DXDA 1DDWA 1WJ1A 4Y94A 3QIJA 4A6KA 4MT7A 5D3WA 3B77A 3M1IB 5C16A 5M4YB 2LKOA 2LOZA 2KR0A 1J0WA 2DTCA 2LYDA 2P0HA 1GC6A 1MPHA 2M38A 4EKUA 3TFMA 2D4QA 3LJUX 2COCA 2KCJA 3FEHA 2DYQA 1BAKA 1M7RA 1WJMA 3V5WA 1PLSA 1V5PA 3U12A 1FHXA 1V5MA 1X05A 3F0WA 2ZPYA 1GG3A 2K00A 5KQ4A 4A5KA 2BCJA 1DDMA 2XQNM 4WVFB 3SO6A 2H7EA 4QXAB 4KHBA 2K2UA 4GMVA 1B55A 2QKMA 2J0KA 4PNKA 4K2PA 4QJ5B 2D9ZA 4DBBA 2RRFA 5DI9B 2NZ8B 1XR0B 1XKEA 2ROZB 3ZDTA 5LOPB 2LG1A 3P7ZA 4HB0B 3HQCA 3KRWA 2H7DA 2DFKA 2UZRA 1K5GB 4GZUA 1FGZA 2D2QA 4K17A 2YF0A 2J0JA 1Y19B 2Y7BA 5D3YA 2ELAA 1EF1A 2FJLA 1WG7A 2EMTA 1ZSQA 4HAYB 5D3VA 3AJ4A 2V76A 2G35A 2GCLA 2HTHB 1FHWA 4OSNA 2YRYA 4D6WA 2P0FA 2ZKMX 4TYZA 1TXDA 4ZRKA 1FOEA 5DHFB 4GPTB 1OY2A 1AQCA 2Z0PA 2OTXA 1ISNA 2IYBA 2RUKB 1UNQA 4IOYX 5CLQB 4YL8A 1FB8A 2Y8GA 4CSQA 2UVMA 1NI2A 1U29A 1KZGA 3CIKA 4HAZB 2RLOA 4KAXB 4HSIA 1RRPB 1W1DA 1XODA 1N3HA 3N7CA 1BTKA 1UNRA 3RCPA 1U5EA 4A6FA 2COAA 1WI1A 5C5BA 5KCVA 4K81A 1P3RA 1SHCA 2QKLA 2VRWB 5CLLB 3CXBB 3D8FA 2CY4A 4GMXB 2GJYA 3ODWA 4TKNA 1V88A 2DN6A 4NSWA 5LG4B 2YSZA 2D9WA 3TO1A 1NU2A 1V5UA 4K2OA
chains in the Genus database with same CATH topology
3F5RA 2ROVA 2I5FA 2I1JA 1WGQA 1FHOA 1ZVRA 3OANA 5GOWB 4C0AA 3KY9A 2LOXA 3KZ1A 1BWNA 1X11A 1WGUA 4HAUB 2N23A 2W2XC 5HE0A 3U7DA 1J19A 1X1GA 4HAXB 1KZ7A 4HAWB 4YONA 1QC6A 1EGXA 4WJ7A 3VOQA 4HB4B 1NTVA 4DX90 2VSZA 4A6HA 5L81A 4HB2B 2RVBB 2M14A 2CY5A 3X23A 2D9XA 1P5TA 3DXCA 4L6EA 1FAOA 3MPXA 1W1HA 2CAYA 1I7AA 2W2XD 2VKIA 1Y5OA 3T06A 2AEHA 3SYXA 1ZC3B 5HE3A 3QWMA 1H10A 1V89A 1FGYA 1U5FA 2DHKA 2AL6A 4H8SA 2MWNB 3PP2A 2GCJA 3VIAA 5DHAB 3SNHA 2I5CA 1U5DA 3ODOA 1UPRA 1U2BA 1KI1B 3P6AA 3PSCA 3U8ZA 1MKEA 3NSUA 2Y8FA 2E2XA 4MY6A 3ZVRA 5HE2A 5LONB 4CYEA 1DYNA 4EMOA 4KHOA 2MKRA 2W2WA 1AWEA 3KRXA 2KGXB 4F7HA 4P7IA 3FM8C 1X86A 2R0DA 4F7GA 1OMWA 2NMBA 5J3YA 4XWXA 3WA0A 3UZTA 4IFSA 1W1GA 2YS5A 1XD4A 2D11A 1Z87A 3G9WA 1IRSA 1E5WA 4EJNA 1TQZA 4KHBB 5EFXA 3KSYA 1UPQA 2EMSA 1EVHA 5D3XA 1H4RA 2GS0A 3IVFA 4B6HA 2DLWA 5J3TA 1XX0A 4BBKA 2RNRB 1U5GA 2Z0QA 4Z2NA 1SGHA 2N0YA 1PFJA 1P6SA 3SV1A 3QBVB 3TCAA 2P0DA 1NTYA 4MK0A 1OQNA 4D0NB 2J59M 3TVVA 5JHGA 4IAPA 3HW2B 3PZDA 2RSGA 4DX8A 1X1FA 1WVHA 3AU5A 2ADZA 5DH9B 4F7UP 4DXAB 5JHHA 1U27A 2CRFA 1PMSA 2I1KA 2K2JA 3PVLA 5C79A 3D8DA 2L2IA 5C6RA 2DKQA 1ZM0A 2DX5A 2DYNA 2EC1A 2R09A 2ELBA 1EAZA 5FI0A 2RGNB 4HB3B 4HDOA 3DXEA 1MK9B 3MDBC 5DIFB 3TW1A 5D27A 4A6FB 3WYFB 2EJ8A 4HDQA 2Z0OA 3ULCA 2JP2A 4GN1A 5C5BB 1QQGA 1ZC4B 3HK0A 1UNPA 4HHVA 3GYOA 1BTNA 3PVWA 1MIXA 3O96A 2PZ1A 3A8QA 2YT1A 4NY0A 4HATB 1MAIA 3SUZA 3ML4A 2DKPA 5KQ1A 2P8VA 2YS3A 3ODXA 2D9YA 4Z2MB 1M7EA 3GYPA 5FI1A 2IFSA 4GXBA 2YS1A 4CHMA 4WSFA 3A98B 4ZRIA 2D10A 2DX1A 2J0MA 2Q13A 2LULA 2UZSA 2DHJA 3PEGA 4CHJA 4KHAA 1GC7A 2D9VA 5HE1A 4KVGB 1XCGA 2X18A 4HAVB 1TJ6A 2COFA 1Q67A 3A8PA 2DHIA 2MFQA 5JP4A 1K5DB 3D8EA 3AU4A 2MDXA 3ULBA 2DA0A 3PG7A 3FSSA 5J3QA 1DROA 2YVCA 4PQ0A 1I2HA 3PVUA 1DBHA 1UEFA 1MK7B 2OQBA 3BJIA 1LB1A 5JLJB 2HE7A 4ZRJA 2CODA 2L1CA 1MIZB 1V61A 1RJ2A 2YT0A 1DDVA 3BINA 1LW3A 2KUPA 3DXDA 1DDWA 1WJ1A 4Y94A 3QIJA 4A6KA 4MT7A 5D3WA 3M1IB 5C16A 2LKOA 2LOZA 1J0WA 2DTCA 2LYDA 2P0HA 1GC6A 1MPHA 2M38A 4EKUA 3TFMA 2D4QA 3LJUX 2COCA 2KCJA 3FEHA 2DYQA 1BAKA 1M7RA 1WJMA 3V5WA 1PLSA 1V5PA 1FHXA 1V5MA 1X05A 3F0WA 2ZPYA 1GG3A 2K00A 5KQ4A 4A5KA 2BCJA 1DDMA 2XQNM 4WVFB 3SO6A 2H7EA 2K2UA 4GMVA 1B55A 2QKMA 2J0KA 4PNKA 4K2PA 2D9ZA 4DBBA 5DI9B 2NZ8B 1XR0B 1XKEA 2ROZB 3ZDTA 5LOPB 2LG1A 3P7ZA 4HB0B 3HQCA 3KRWA 2H7DA 2DFKA 2UZRA 1K5GB 4GZUA 1FGZA 2D2QA 4K17A 2YF0A 2J0JA 1Y19B 2Y7BA 5D3YA 2ELAA 1EF1A 2FJLA 1WG7A 2EMTA 1ZSQA 4HAYB 5D3VA 3AJ4A 2V76A 2G35A 2GCLA 2HTHB 1FHWA 2YRYA 2P0FA 4TYZA 1TXDA 4ZRKA 1FOEA 5DHFB 4GPTB 1OY2A 1AQCA 2Z0PA 2OTXA 1ISNA 2IYBA 2RUKB 1UNQA 4IOYX 5CLQB 4YL8A 1FB8A 2Y8GA 2UVMA 1NI2A 1U29A 1KZGA 3CIKA 4HAZB 2RLOA 4KAXB 1RRPB 1W1DA 1XODA 1N3HA 3N7CA 1BTKA 1UNRA 3RCPA 1U5EA 4A6FA 2COAA 1WI1A 5C5BA 5KCVA 4K81A 1P3RA 1SHCA 2QKLA 2VRWB 5CLLB 3CXBB 3D8FA 2CY4A 4GMXB 2GJYA 3ODWA 4TKNA 1V88A 2DN6A 4NSWA 2YSZA 2D9WA 3TO1A 1NU2A 1V5UA 4K2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5R A;  2ROV A;  2I5F A;  2I1J A;  1WGQ A;  1FHO A;  1ZVR A;  3OAN A;  5GOW B;  4C0A A;  3KY9 A;  2LOX A;  3KZ1 A;  1BWN A;  1X11 A;  1WGU A;  4HAU B;  2N23 A;  2W2X C;  5HE0 A;  3U7D A;  1J19 A;  1X1G A;  4HAX B;  1KZ7 A;  4HAW B;  4YON A;  1QC6 A;  1EGX A;  4WJ7 A;  3VOQ A;  4HB4 B;  1NTV A;  4DX9 0;  2VSZ A;  4A6H A;  5L81 A;  4HB2 B;  2RVB B;  2M14 A;  2CY5 A;  3X23 A;  2D9X A;  1P5T A;  3DXC A;  4L6E A;  1FAO A;  3MPX A;  1W1H A;  2CAY A;  1I7A A;  2W2X D;  2VKI A;  1Y5O A;  3T06 A;  2AEH A;  3SYX A;  1ZC3 B;  5HE3 A;  3QWM A;  1H10 A;  1V89 A;  1FGY A;  1U5F A;  2DHK A;  2AL6 A;  4H8S A;  2MWN B;  3PP2 A;  2GCJ A;  3VIA A;  5DHA B;  3SNH A;  2I5C A;  1U5D A;  3ODO A;  1UPR A;  1U2B A;  1KI1 B;  3P6A A;  3PSC A;  3U8Z A;  1MKE A;  3NSU A;  2Y8F A;  2E2X A;  4MY6 A;  3ZVR A;  5HE2 A;  5LON B;  4CYE A;  1DYN A;  4EMO A;  4KHO A;  2MKR A;  2W2W A;  1AWE A;  3KRX A;  2KGX B;  4F7H A;  4P7I A;  3FM8 C;  1X86 A;  2R0D A;  4F7G A;  1OMW A;  2NMB A;  5J3Y A;  4XWX A;  3WA0 A;  3UZT A;  4IFS A;  1W1G A;  2YS5 A;  1XD4 A;  2D11 A;  1Z87 A;  3G9W A;  1IRS A;  1E5W A;  4EJN A;  1TQZ A;  4KHB B;  5EFX A;  3KSY A;  1UPQ A;  2EMS A;  1EVH A;  5D3X A;  1H4R A;  2GS0 A;  3IVF A;  4B6H A;  2DLW A;  5J3T A;  1XX0 A;  4BBK A;  2RNR B;  1U5G A;  2Z0Q A;  4Z2N A;  1SGH A;  2N0Y A;  1PFJ A;  1P6S A;  3SV1 A;  3QBV B;  3TCA A;  2P0D A;  1NTY A;  4MK0 A;  1OQN A;  4D0N B;  2J59 M;  3TVV A;  5JHG A;  4IAP A;  3HW2 B;  3PZD A;  2RSG A;  4DX8 A;  1X1F A;  1WVH A;  3AU5 A;  2ADZ A;  5DH9 B;  4F7U P;  4DXA B;  5JHH A;  1U27 A;  2CRF A;  1PMS A;  2I1K A;  2K2J A;  3PVL A;  5C79 A;  3D8D A;  2L2I A;  5C6R A;  2DKQ A;  1ZM0 A;  2DX5 A;  2DYN A;  2EC1 A;  2R09 A;  2ELB A;  1EAZ A;  5FI0 A;  2RGN B;  4HB3 B;  4HDO A;  3DXE A;  1MK9 B;  3MDB C;  5DIF B;  3TW1 A;  5D27 A;  4A6F B;  3WYF B;  2EJ8 A;  4HDQ A;  2Z0O A;  3ULC A;  2JP2 A;  4GN1 A;  5C5B B;  1QQG A;  1ZC4 B;  3HK0 A;  1UNP A;  4HHV A;  3GYO A;  1BTN A;  3PVW A;  1MIX A;  3O96 A;  2PZ1 A;  3A8Q A;  2YT1 A;  4NY0 A;  4HAT B;  1MAI A;  3SUZ A;  3ML4 A;  2DKP A;  5KQ1 A;  2P8V A;  2YS3 A;  3ODX A;  2D9Y A;  4Z2M B;  1M7E A;  3GYP A;  5FI1 A;  2IFS A;  4GXB A;  2YS1 A;  4CHM A;  4WSF A;  3A98 B;  4ZRI A;  2D10 A;  2DX1 A;  2J0M A;  2Q13 A;  2LUL A;  2UZS A;  2DHJ A;  3PEG A;  4CHJ A;  4KHA A;  1GC7 A;  2D9V A;  5HE1 A;  4KVG B;  1XCG A;  2X18 A;  4HAV B;  1TJ6 A;  2COF A;  1Q67 A;  3A8P A;  2DHI A;  2MFQ A;  5JP4 A;  1K5D B;  3D8E A;  3AU4 A;  2MDX A;  3ULB A;  2DA0 A;  3PG7 A;  3FSS A;  5J3Q A;  1DRO A;  2YVC A;  4PQ0 A;  1I2H A;  3PVU A;  1DBH A;  1UEF A;  1MK7 B;  2OQB A;  3BJI A;  1LB1 A;  5JLJ B;  2HE7 A;  4ZRJ A;  2COD A;  2L1C A;  1MIZ B;  1V61 A;  1RJ2 A;  2YT0 A;  1DDV A;  3BIN A;  1LW3 A;  2KUP A;  3DXD A;  1DDW A;  1WJ1 A;  4Y94 A;  3QIJ A;  4A6K A;  4MT7 A;  5D3W A;  3M1I B;  5C16 A;  2LKO A;  2LOZ A;  1J0W A;  2DTC A;  2LYD A;  2P0H A;  1GC6 A;  1MPH A;  2M38 A;  4EKU A;  3TFM A;  2D4Q A;  3LJU X;  2COC A;  2KCJ A;  3FEH A;  2DYQ A;  1BAK A;  1M7R A;  1WJM A;  3V5W A;  1PLS A;  1V5P A;  1FHX A;  1V5M A;  1X05 A;  3F0W A;  2ZPY A;  1GG3 A;  2K00 A;  5KQ4 A;  4A5K A;  2BCJ A;  1DDM A;  2XQN M;  4WVF B;  3SO6 A;  2H7E A;  2K2U A;  4GMV A;  1B55 A;  2QKM A;  2J0K A;  4PNK A;  4K2P A;  2D9Z A;  4DBB A;  5DI9 B;  2NZ8 B;  1XR0 B;  1XKE A;  2ROZ B;  3ZDT A;  5LOP B;  2LG1 A;  3P7Z A;  4HB0 B;  3HQC A;  3KRW A;  2H7D A;  2DFK A;  2UZR A;  1K5G B;  4GZU A;  1FGZ A;  2D2Q A;  4K17 A;  2YF0 A;  2J0J A;  1Y19 B;  2Y7B A;  5D3Y A;  2ELA A;  1EF1 A;  2FJL A;  1WG7 A;  2EMT A;  1ZSQ A;  4HAY B;  5D3V A;  3AJ4 A;  2V76 A;  2G35 A;  2GCL A;  2HTH B;  1FHW A;  2YRY A;  2P0F A;  4TYZ A;  1TXD A;  4ZRK A;  1FOE A;  5DHF B;  4GPT B;  1OY2 A;  1AQC A;  2Z0P A;  2OTX A;  1ISN A;  2IYB A;  2RUK B;  1UNQ A;  4IOY X;  5CLQ B;  4YL8 A;  1FB8 A;  2Y8G A;  2UVM A;  1NI2 A;  1U29 A;  1KZG A;  3CIK A;  4HAZ B;  2RLO A;  4KAX B;  1RRP B;  1W1D A;  1XOD A;  1N3H A;  3N7C A;  1BTK A;  1UNR A;  3RCP A;  1U5E A;  4A6F A;  2COA A;  1WI1 A;  5C5B A;  5KCV A;  4K81 A;  1P3R A;  1SHC A;  2QKL A;  2VRW B;  5CLL B;  3CXB B;  3D8F A;  2CY4 A;  4GMX B;  2GJY A;  3ODW A;  4TKN A;  1V88 A;  2DN6 A;  4NSW A;  2YSZ A;  2D9W A;  3TO1 A;  1NU2 A;  1V5U A;  4K2O A; 
#chains in the Genus database with same CATH topology
 3F5R A;  2ROV A;  2I5F A;  2I1J A;  1WGQ A;  1FHO A;  3HIE A;  1ZVR A;  3OAN A;  5GOW B;  4C0A A;  3KY9 A;  2LOX A;  3KZ1 A;  1BWN A;  1X11 A;  1WGU A;  4HAU B;  2N23 A;  2W2X C;  5HE0 A;  3U7D A;  1J19 A;  1X1G A;  4HAX B;  1KZ7 A;  4HAW B;  4YON A;  1QC6 A;  1EGX A;  3HSA A;  4WJ7 A;  3NW8 A;  2Z59 A;  3VOQ A;  4HB4 B;  4OT1 A;  1NTV A;  4DX9 0;  2VSZ A;  4A6H A;  5L81 A;  4GOU A;  2NBV A;  4HB2 B;  2RVB B;  2M14 A;  2CY5 A;  3X23 A;  2D9X A;  1P5T A;  3DXC A;  4L6E A;  1FAO A;  3FVC A;  3MPX A;  1W1H A;  2CAY A;  1I7A A;  2W2X D;  2VKI A;  1Y5O A;  3T06 A;  2AEH A;  3SYX A;  2YT2 A;  1ZC3 B;  2K49 A;  4QJ3 B;  3QWM A;  5HE3 A;  1H10 A;  1V89 A;  1FGY A;  1U5F A;  2DHK A;  2AL6 A;  4H8S A;  2MWN B;  3PP2 A;  2GCJ A;  3VIA A;  5DHA B;  3SNH A;  2I5C A;  1U5D A;  3NWD A;  3ODO A;  2Z13 A;  1UPR A;  1U2B A;  1KI1 B;  3P6A A;  3PSC A;  3U8Z A;  1MKE A;  3NSU A;  2Y8F A;  2E2X A;  4MY6 A;  3ZVR A;  5HE2 A;  5LON B;  4CYE A;  1DYN A;  3A58 A;  4EMO A;  4KHO A;  2MKR A;  2W2W A;  1AWE A;  3KRX A;  2KGX B;  4F7H A;  4P7I A;  3FM8 C;  1X86 A;  2KIG A;  2R0D A;  4F7G A;  1OMW A;  2NMB A;  5J3Y A;  4XWX A;  3WA0 A;  3UZT A;  4IFS A;  1W1G A;  2YS5 A;  2Z14 A;  1XD4 A;  2D11 A;  1Z87 A;  3G9W A;  1IRS A;  1E5W A;  4EJN A;  1TQZ A;  3DCX A;  2K8E A;  4KHB B;  5EFX A;  3KSY A;  1UPQ A;  2EMS A;  1EVH A;  5D3X A;  1H4R A;  2GS0 A;  3IVF A;  4B6H A;  2DLW A;  5J3T A;  1XX0 A;  4BBK A;  2RNR B;  1U5G A;  2Z0Q A;  4Z2N A;  2Z4D A;  1SGH A;  2N0Y A;  1PFJ A;  1P6S A;  3SV1 A;  3QBV B;  1ZYI A;  3TCA A;  2P0D A;  1NTY A;  4MK0 A;  1OQN A;  4D0N B;  2J59 M;  3TVV A;  2FJU B;  5JHG A;  4IAP A;  3HW2 B;  3PZD A;  2RSG A;  4DX8 A;  1X1F A;  1WVH A;  3AU5 A;  2ADZ A;  5DH9 B;  4F7U P;  4DXA B;  5JHH A;  1U27 A;  2CRF A;  1PMS A;  3NWF A;  2I1K A;  2K2J A;  3PVL A;  5I2S A;  5C79 A;  4L1R A;  3D8D A;  2L2I A;  5C6R A;  2DKQ A;  1ZM0 A;  2DX5 A;  2DYN A;  2EC1 A;  2R09 A;  2ELB A;  1EAZ A;  5FI0 A;  2RGN B;  4HB3 B;  4HDO A;  3DXE A;  1MK9 B;  3MDB C;  5DIF B;  3TW1 A;  5D27 A;  4A6F B;  3WYF B;  2EJ8 A;  4HDQ A;  2Z0O A;  3ULC A;  2JP2 A;  4GN1 A;  5C5B B;  1QQG A;  1ZC4 B;  3HK0 A;  1UNP A;  4HHV A;  3GYO A;  2KUQ A;  1BTN A;  3PVW A;  5IRS A;  1MIX A;  3O96 A;  2PZ1 A;  3A8Q A;  2YT1 A;  4NY0 A;  4DIX A;  4HAT B;  1MAI A;  4GNK B;  3SUZ A;  3ML4 A;  2DKP A;  5KQ1 A;  2P8V A;  2YS3 A;  3ODX A;  2D9Y A;  4Z2M B;  1M7E A;  3GYP A;  5FI1 A;  2IFS A;  4GXB A;  2YS1 A;  4CHM A;  4WSF A;  3A98 B;  4ZRI A;  2D10 A;  2DX1 A;  2J0M A;  2Q13 A;  2LUL A;  2UZS A;  2DHJ A;  3PEG A;  4CHJ A;  4KHA A;  1GC7 A;  2D9V A;  5HE1 A;  4KVG B;  1XCG A;  2GUM A;  2X18 A;  4HAV B;  1TJ6 A;  2COF A;  1Q67 A;  3A8P A;  2DHI A;  2MFQ A;  5JP4 A;  1K5D B;  3D8E A;  3AU4 A;  2MDX A;  3ULB A;  2DA0 A;  1MI1 A;  3PG7 A;  3FSS A;  5J3Q A;  1DRO A;  2YVC A;  1T77 A;  4PQ0 A;  3OHM B;  2KIE A;  1I2H A;  3PVU A;  4QJ4 B;  1DBH A;  1UEF A;  1MK7 B;  2OQB A;  2R2Y A;  3BJI A;  1LB1 A;  5JLJ B;  3NWA A;  2HE7 A;  4ZRJ A;  2COD A;  2L1C A;  5I2M A;  1MIZ B;  1V61 A;  1RJ2 A;  2YT0 A;  1DDV A;  3BIN A;  1LW3 A;  2KUP A;  3DXD A;  1DDW A;  1WJ1 A;  4Y94 A;  3QIJ A;  4A6K A;  4MT7 A;  5D3W A;  3B77 A;  3M1I B;  5C16 A;  5M4Y B;  2LKO A;  2LOZ A;  2KR0 A;  1J0W A;  2DTC A;  2LYD A;  2P0H A;  1GC6 A;  1MPH A;  2M38 A;  4EKU A;  3TFM A;  2D4Q A;  3LJU X;  2COC A;  2KCJ A;  3FEH A;  2DYQ A;  1BAK A;  1M7R A;  1WJM A;  3V5W A;  1PLS A;  1V5P A;  3U12 A;  1FHX A;  1V5M A;  1X05 A;  3F0W A;  2ZPY A;  1GG3 A;  2K00 A;  5KQ4 A;  4A5K A;  2BCJ A;  1DDM A;  2XQN M;  4WVF B;  3SO6 A;  2H7E A;  4QXA B;  4KHB A;  2K2U A;  4GMV A;  1B55 A;  2QKM A;  2J0K A;  4PNK A;  4K2P A;  4QJ5 B;  2D9Z A;  4DBB A;  2RRF A;  5DI9 B;  2NZ8 B;  1XR0 B;  1XKE A;  2ROZ B;  3ZDT A;  5LOP B;  2LG1 A;  3P7Z A;  4HB0 B;  3HQC A;  3KRW A;  2H7D A;  2DFK A;  2UZR A;  1K5G B;  4GZU A;  1FGZ A;  2D2Q A;  4K17 A;  2YF0 A;  2J0J A;  1Y19 B;  2Y7B A;  5D3Y A;  2ELA A;  1EF1 A;  2FJL A;  1WG7 A;  2EMT A;  1ZSQ A;  4HAY B;  5D3V A;  3AJ4 A;  2V76 A;  2G35 A;  2GCL A;  2HTH B;  1FHW A;  4OSN A;  2YRY A;  4D6W A;  2P0F A;  2ZKM X;  4TYZ A;  1TXD A;  4ZRK A;  1FOE A;  5DHF B;  4GPT B;  1OY2 A;  1AQC A;  2Z0P A;  2OTX A;  1ISN A;  2IYB A;  2RUK B;  1UNQ A;  4IOY X;  5CLQ B;  4YL8 A;  1FB8 A;  2Y8G A;  4CSQ A;  2UVM A;  1NI2 A;  1U29 A;  1KZG A;  3CIK A;  4HAZ B;  2RLO A;  4KAX B;  4HSI A;  1RRP B;  1W1D A;  1XOD A;  1N3H A;  3N7C A;  1BTK A;  1UNR A;  3RCP A;  1U5E A;  4A6F A;  2COA A;  1WI1 A;  5C5B A;  5KCV A;  4K81 A;  1P3R A;  1SHC A;  2QKL A;  2VRW B;  5CLL B;  3CXB B;  3D8F A;  2CY4 A;  4GMX B;  2GJY A;  3ODW A;  4TKN A;  1V88 A;  2DN6 A;  4NSW A;  5LG4 B;  2YSZ A;  2D9W A;  3TO1 A;  1NU2 A;  1V5U A;  4K2O A; 
#chains in the Genus database with same CATH homology
 3F5R A;  2ROV A;  2I5F A;  2I1J A;  1WGQ A;  1FHO A;  1ZVR A;  3OAN A;  5GOW B;  4C0A A;  3KY9 A;  2LOX A;  3KZ1 A;  1BWN A;  1X11 A;  1WGU A;  4HAU B;  2N23 A;  2W2X C;  5HE0 A;  3U7D A;  1J19 A;  1X1G A;  4HAX B;  1KZ7 A;  4HAW B;  4YON A;  1QC6 A;  1EGX A;  4WJ7 A;  3VOQ A;  4HB4 B;  1NTV A;  4DX9 0;  2VSZ A;  4A6H A;  5L81 A;  4HB2 B;  2RVB B;  2M14 A;  2CY5 A;  3X23 A;  2D9X A;  1P5T A;  3DXC A;  4L6E A;  1FAO A;  3MPX A;  1W1H A;  2CAY A;  1I7A A;  2W2X D;  2VKI A;  1Y5O A;  3T06 A;  2AEH A;  3SYX A;  1ZC3 B;  5HE3 A;  3QWM A;  1H10 A;  1V89 A;  1FGY A;  1U5F A;  2DHK A;  2AL6 A;  4H8S A;  2MWN B;  3PP2 A;  2GCJ A;  3VIA A;  5DHA B;  3SNH A;  2I5C A;  1U5D A;  3ODO A;  1UPR A;  1U2B A;  1KI1 B;  3P6A A;  3PSC A;  3U8Z A;  1MKE A;  3NSU A;  2Y8F A;  2E2X A;  4MY6 A;  3ZVR A;  5HE2 A;  5LON B;  4CYE A;  1DYN A;  4EMO A;  4KHO A;  2MKR A;  2W2W A;  1AWE A;  3KRX A;  2KGX B;  4F7H A;  4P7I A;  3FM8 C;  1X86 A;  2R0D A;  4F7G A;  1OMW A;  2NMB A;  5J3Y A;  4XWX A;  3WA0 A;  3UZT A;  4IFS A;  1W1G A;  2YS5 A;  1XD4 A;  2D11 A;  1Z87 A;  3G9W A;  1IRS A;  1E5W A;  4EJN A;  1TQZ A;  4KHB B;  5EFX A;  3KSY A;  1UPQ A;  2EMS A;  1EVH A;  5D3X A;  1H4R A;  2GS0 A;  3IVF A;  4B6H A;  2DLW A;  5J3T A;  1XX0 A;  4BBK A;  2RNR B;  1U5G A;  2Z0Q A;  4Z2N A;  1SGH A;  2N0Y A;  1PFJ A;  1P6S A;  3SV1 A;  3QBV B;  3TCA A;  2P0D A;  1NTY A;  4MK0 A;  1OQN A;  4D0N B;  2J59 M;  3TVV A;  5JHG A;  4IAP A;  3HW2 B;  3PZD A;  2RSG A;  4DX8 A;  1X1F A;  1WVH A;  3AU5 A;  2ADZ A;  5DH9 B;  4F7U P;  4DXA B;  5JHH A;  1U27 A;  2CRF A;  1PMS A;  2I1K A;  2K2J A;  3PVL A;  5C79 A;  3D8D A;  2L2I A;  5C6R A;  2DKQ A;  1ZM0 A;  2DX5 A;  2DYN A;  2EC1 A;  2R09 A;  2ELB A;  1EAZ A;  5FI0 A;  2RGN B;  4HB3 B;  4HDO A;  3DXE A;  1MK9 B;  3MDB C;  5DIF B;  3TW1 A;  5D27 A;  4A6F B;  3WYF B;  2EJ8 A;  4HDQ A;  2Z0O A;  3ULC A;  2JP2 A;  4GN1 A;  5C5B B;  1QQG A;  1ZC4 B;  3HK0 A;  1UNP A;  4HHV A;  3GYO A;  1BTN A;  3PVW A;  1MIX A;  3O96 A;  2PZ1 A;  3A8Q A;  2YT1 A;  4NY0 A;  4HAT B;  1MAI A;  3SUZ A;  3ML4 A;  2DKP A;  5KQ1 A;  2P8V A;  2YS3 A;  3ODX A;  2D9Y A;  4Z2M B;  1M7E A;  3GYP A;  5FI1 A;  2IFS A;  4GXB A;  2YS1 A;  4CHM A;  4WSF A;  3A98 B;  4ZRI A;  2D10 A;  2DX1 A;  2J0M A;  2Q13 A;  2LUL A;  2UZS A;  2DHJ A;  3PEG A;  4CHJ A;  4KHA A;  1GC7 A;  2D9V A;  5HE1 A;  4KVG B;  1XCG A;  2X18 A;  4HAV B;  1TJ6 A;  2COF A;  1Q67 A;  3A8P A;  2DHI A;  2MFQ A;  5JP4 A;  1K5D B;  3D8E A;  3AU4 A;  2MDX A;  3ULB A;  2DA0 A;  3PG7 A;  3FSS A;  5J3Q A;  1DRO A;  2YVC A;  4PQ0 A;  1I2H A;  3PVU A;  1DBH A;  1UEF A;  1MK7 B;  2OQB A;  3BJI A;  1LB1 A;  5JLJ B;  2HE7 A;  4ZRJ A;  2COD A;  2L1C A;  1MIZ B;  1V61 A;  1RJ2 A;  2YT0 A;  1DDV A;  3BIN A;  1LW3 A;  2KUP A;  3DXD A;  1DDW A;  1WJ1 A;  4Y94 A;  3QIJ A;  4A6K A;  4MT7 A;  5D3W A;  3M1I B;  5C16 A;  2LKO A;  2LOZ A;  1J0W A;  2DTC A;  2LYD A;  2P0H A;  1GC6 A;  1MPH A;  2M38 A;  4EKU A;  3TFM A;  2D4Q A;  3LJU X;  2COC A;  2KCJ A;  3FEH A;  2DYQ A;  1BAK A;  1M7R A;  1WJM A;  3V5W A;  1PLS A;  1V5P A;  1FHX A;  1V5M A;  1X05 A;  3F0W A;  2ZPY A;  1GG3 A;  2K00 A;  5KQ4 A;  4A5K A;  2BCJ A;  1DDM A;  2XQN M;  4WVF B;  3SO6 A;  2H7E A;  2K2U A;  4GMV A;  1B55 A;  2QKM A;  2J0K A;  4PNK A;  4K2P A;  2D9Z A;  4DBB A;  5DI9 B;  2NZ8 B;  1XR0 B;  1XKE A;  2ROZ B;  3ZDT A;  5LOP B;  2LG1 A;  3P7Z A;  4HB0 B;  3HQC A;  3KRW A;  2H7D A;  2DFK A;  2UZR A;  1K5G B;  4GZU A;  1FGZ A;  2D2Q A;  4K17 A;  2YF0 A;  2J0J A;  1Y19 B;  2Y7B A;  5D3Y A;  2ELA A;  1EF1 A;  2FJL A;  1WG7 A;  2EMT A;  1ZSQ A;  4HAY B;  5D3V A;  3AJ4 A;  2V76 A;  2G35 A;  2GCL A;  2HTH B;  1FHW A;  2YRY A;  2P0F A;  4TYZ A;  1TXD A;  4ZRK A;  1FOE A;  5DHF B;  4GPT B;  1OY2 A;  1AQC A;  2Z0P A;  2OTX A;  1ISN A;  2IYB A;  2RUK B;  1UNQ A;  4IOY X;  5CLQ B;  4YL8 A;  1FB8 A;  2Y8G A;  2UVM A;  1NI2 A;  1U29 A;  1KZG A;  3CIK A;  4HAZ B;  2RLO A;  4KAX B;  1RRP B;  1W1D A;  1XOD A;  1N3H A;  3N7C A;  1BTK A;  1UNR A;  3RCP A;  1U5E A;  4A6F A;  2COA A;  1WI1 A;  5C5B A;  5KCV A;  4K81 A;  1P3R A;  1SHC A;  2QKL A;  2VRW B;  5CLL B;  3CXB B;  3D8F A;  2CY4 A;  4GMX B;  2GJY A;  3ODW A;  4TKN A;  1V88 A;  2DN6 A;  4NSW A;  2YSZ A;  2D9W A;  3TO1 A;  1NU2 A;  1V5U A;  4K2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...