1MAIA

Structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVQGLRKIIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C DELTA-1
publication title Structure of the high affinity complex of inositol trisphosphate with a phospholipase C pleckstrin homology domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signal transduction protein
total genus 33
structure length 119
sequence length 119
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1maiA00
3BJIA 3ZDTA 2Z0PA 4HATB 1MPHA 2CRFA 3AJ4A 2GCJA 4XWXA 2N0YA 5D27A 3SV1A 4IAPA 1ZM0A 2L1CA 3OANA 2YRYA 1LB1A 3KSYA 2D2QA 2W2WA 3CIKA 2QKLA 1DDVA 1UNQA 2IYBA 2DYNA 4Z2NA 2DHKA 5C79A 2D9WA 2YSZA 4K17A 1UNRA 1V61A 3PZDA 3V5WA 3D8FA 1GG3A 2HTHB 2LG1A 1RRPB 4DX90 1FHXA 2AL6A 2ELBA 2NZ8B 3PVUA 2D9VA 3QWMA 2DX5A 2CY5A 5C5BA 5FI0A 2LOXA 2Y7BA 2PZ1A 2YF0A 1I7AA 4WSFA 1KZ7A 1LW3A 1P5TA 1FB8A 2Y8FA 4WVFB 1GC7A 5HE1A 2R0DA 4CHJA 3D8EA 1AWEA 4HAVB 4KHBB 3TCAA 2W2XD 2DFKA 3CXBB 5D3XA 4YL8A 2G35A 3UZTA 2DN6A 4P7IA 1ZC4B 2EJ8A 2K2UA 1WGQA 4HDOA 3KY9A 2H7DA 1QQGA 1NI2A 1UPRA 1V5MA 2R09A 3A8PA 4D0NB 4MY6A 2Z0OA 2FJLA 2RGNB 2LKOA 1TJ6A 3DXDA 5JHGA 1M7RA 1P3RA 3M1IB 5CLLB 2W2XC 3P6AA 4HAWB 3SUZA 2KUPA 2DHIA 1PFJA 4GXBA 1XCGA 3ML4A 5GOWB 1U29A 2K00A 1UEFA 4A5KA 2COCA 4HB2B 4HAUB 2YS3A 4GMXB 1DBHA 2XQNM 1FGYA 1V89A 1X05A 4Y94A 2COAA 1Q67A 3PVLA 2D4QA 1NU2A 2RVBB 1MKEA 3F0WA 2D9ZA 4HAYB 4CHMA 1WI1A 2OTXA 4DXAB 1AQCA 3DXCA 1N3HA 5JHHA 3HK0A 2AEHA 3LJUX 2L2IA 3P7ZA 2GCLA 2I5CA 2VRWB 4HDQA 3QBVB 1V5PA 1PMSA 5LOPB 4B6HA 5LONB 2J0JA 1ZSQA 3ULBA 4CYEA 3ZVRA 2I1KA 3MPXA 2GJYA 1U5GA 1EF1A 1MAIA 2EMTA 1PLSA 4HB4B 3AU5A 3QIJA 2ROVA 1XKEA 3TVVA 5C16A 1H10A 1Y19B 4TKNA 2LOZA 1BAKA 1U2BA 4DX8A 2VKIA 4GN1A 4K2PA 5C5BB 5D3VA 5JP4A 2DYQA 1FHWA 1WGUA 2MKRA 1X86A 1EVHA 2ZPYA 4HAZB 2IFSA 2UZRA 2YT0A 3RCPA 2DA0A 4KHAA 2DTCA 3A98B 2UVMA 4HHVA 3FM8C 2JP2A 1X1GA 1OQNA 1EAZA 2LULA 3ODOA 1OY2A 2P8VA 3VIAA 2YS1A 5L81A 4L6EA 3D8DA 1K5GB 3ULCA 3X23A 3KRXA 4EKUA 1P6SA 2D9YA 1U27A 4K81A 3VOQA 1W1DA 4H8SA 2D11A 3A8QA 1WJ1A 4PQ0A 5D3WA 3IVFA 2KCJA 5KQ4A 2ELAA 1XODA 4K2OA 4HB3B 4EMOA 4KHOA 2D9XA 2E2XA 1NTYA 4HAXB 4DBBA 1H4RA 1MK9B 1W1GA 3T06A 1FHOA 2M14A 3O96A 3ODXA 1XD4A 3N7CA 1I2HA 1XX0A 2DKQA 1GC6A 3PVWA 2CODA 5DH9B 1U5DA 1ZC3B 4ZRJA 1U5FA 3HW2B 3AU4A 4GMVA 2N23A 1DROA 3WA0A 4C0AA 1TQZA 3HQCA 4ZRIA 3G9WA 1BTKA 4YONA 3FSSA 2DLWA 4GZUA 1W1HA 2ADZA 1EGXA 4A6FA 1X1FA 1MIXA 1J19A 3GYPA 5KQ1A 3TFMA 4A6KA 2J0KA 4IOYX 5HE0A 5DI9B 3PSCA 3PG7A 3NSUA 2NMBA 1KZGA 1DDWA 2QKMA 4HB0B 1V5UA 2J0MA 2MFQA 5DIFB 5D3YA 1OMWA 2I5FA 2H7EA 4ZRKA 4KAXB 3KRWA 3SYXA 1IRSA 3TO1A 2J59M 1WJMA 3ODWA 2RLOA 4Z2MB 3GYOA 1ISNA 3WYFB 4BBKA 2MDXA 4F7HA 4A6HA 1MIZB 2LYDA 2VSZA 2YT1A 1DDMA 2X18A 1RJ2A 5HE2A 1BWNA 2EMSA 2I1JA 1NTVA 1U5EA 2V76A 3PP2A 2CAYA 3F5RA 2DKPA 5KCVA 2RSGA 1ZVRA 4NY0A 1WG7A 2M38A 2OQBA 1BTNA 1XR0B 1UPQA 4NSWA 2ROZB 1SHCA 1DYNA 1SGHA 3KZ1A 4IFSA 2P0FA 5EFXA 5J3TA 1M7EA 2Z0QA 2HE7A 3MDBC 4PNKA 1V88A 3DXEA 2D10A 5FI1A 1TXDA 5HE3A 2YVCA 1MK7B 1X11A 2GS0A 1E5WA 1WVHA 3SNHA 2Q13A 2DX1A 1Z87A 3PEGA 3U8ZA 4MT7A 5J3QA 2K2JA 2DHJA 5C6RA 2UZSA 1B55A 2BCJA 2COFA 2MWNB 1QC6A 4WJ7A 2YS5A 4F7UP 1FOEA 2KGXB 3TW1A 5J3YA 1FAOA 1KI1B 2CY4A 5CLQB 1Y5OA 1K5DB 2P0DA 2RNRB 4GPTB 3U7DA 4EJNA 5DHFB 2EC1A 3SO6A 2Y8GA 4A6FB 2RUKB 2P0HA 4F7GA 4MK0A 4TYZA 3FEHA 5JLJB 1FGZA 5DHAB 4KVGB 1J0WA 1UNPA 3BINA
chains in the Genus database with same CATH superfamily
3BJIA 3ZDTA 2Z0PA 4HATB 1MPHA 2CRFA 3AJ4A 2GCJA 4XWXA 2N0YA 5D27A 3SV1A 4GNKB 4IAPA 1ZM0A 2L1CA 3OANA 2YRYA 1LB1A 3KSYA 2D2QA 2W2WA 3CIKA 2QKLA 1DDVA 1UNQA 2IYBA 2DYNA 4Z2NA 2DHKA 5C79A 2D9WA 2YSZA 4K17A 1UNRA 1V61A 3B77A 3PZDA 3V5WA 3D8FA 1GG3A 2HTHB 2LG1A 1RRPB 4DX90 1FHXA 2AL6A 2ELBA 2NZ8B 3PVUA 2D9VA 3QWMA 2DX5A 2CY5A 5C5BA 5FI0A 2LOXA 2Y7BA 2PZ1A 2YF0A 1I7AA 4WSFA 1KZ7A 1LW3A 1P5TA 1FB8A 2Y8FA 4WVFB 1GC7A 5HE1A 2R0DA 4CHJA 3D8EA 1AWEA 4HAVB 4KHBB 3TCAA 2W2XD 2DFKA 3CXBB 5D3XA 4YL8A 2G35A 3UZTA 2DN6A 4P7IA 1ZC4B 2EJ8A 2K2UA 1WGQA 4KHBA 4HDOA 3KY9A 2H7DA 1QQGA 1NI2A 1UPRA 1V5MA 2R09A 3A8PA 4D0NB 4MY6A 2Z0OA 2FJLA 2RGNB 2LKOA 1TJ6A 3DXDA 4OT1A 1T77A 5JHGA 1M7RA 1P3RA 3M1IB 5CLLB 2W2XC 3P6AA 4HAWB 3SUZA 2KUPA 2DHIA 1PFJA 4GXBA 1XCGA 3ML4A 5GOWB 1U29A 2K00A 1UEFA 4A5KA 2COCA 3HSAA 4HB2B 4HAUB 2YS3A 4GMXB 1DBHA 2XQNM 1FGYA 1V89A 1X05A 4Y94A 2COAA 1Q67A 2Z59A 3PVLA 2D4QA 1NU2A 2RVBB 3HIEA 1MKEA 3F0WA 2D9ZA 4HAYB 4CHMA 5LG4B 3OHMB 1WI1A 2OTXA 4DXAB 1AQCA 3DXCA 1N3HA 5JHHA 3HK0A 2AEHA 3LJUX 2L2IA 3P7ZA 2NBVA 4GOUA 2GCLA 2KIGA 2I5CA 2VRWB 4HDQA 3QBVB 1V5PA 2KUQA 1PMSA 5LOPB 3DCXA 4L1RA 4B6HA 5LONB 2J0JA 1ZSQA 3ULBA 4CYEA 3ZVRA 2I1KA 3MPXA 2GJYA 1U5GA 1EF1A 1MAIA 2EMTA 1PLSA 3NWDA 4HB4B 3AU5A 3QIJA 2ROVA 5M4YB 1XKEA 3TVVA 5C16A 1H10A 1Y19B 4TKNA 2LOZA 1BAKA 1U2BA 4DX8A 2VKIA 4GN1A 4K2PA 5C5BB 4QXAB 5D3VA 5JP4A 2ZKMX 2DYQA 3A58A 1FHWA 1WGUA 2MKRA 1X86A 1EVHA 2ZPYA 4HAZB 2IFSA 2UZRA 2YT0A 3RCPA 2DA0A 4KHAA 2DTCA 3A98B 2UVMA 3NW8A 4HHVA 3FM8C 2JP2A 1X1GA 1OQNA 1EAZA 2LULA 3ODOA 1OY2A 2P8VA 3VIAA 2YS1A 4QJ3B 5L81A 4L6EA 3D8DA 1K5GB 5IRSA 3ULCA 2Z13A 3X23A 3KRXA 4EKUA 1P6SA 2D9YA 1U27A 4K81A 3VOQA 1W1DA 4H8SA 2D11A 3A8QA 1WJ1A 4PQ0A 5D3WA 2KIEA 3IVFA 2KCJA 5KQ4A 2ELAA 1XODA 4K2OA 4HB3B 4EMOA 4KHOA 2D9XA 2E2XA 1NTYA 4HAXB 4DBBA 2FJUB 1H4RA 1MK9B 1W1GA 3T06A 4DIXA 1FHOA 2M14A 3O96A 3ODXA 1XD4A 3N7CA 1I2HA 1XX0A 2DKQA 1GC6A 3PVWA 2CODA 5DH9B 2K49A 1U5DA 1ZC3B 4ZRJA 1U5FA 3HW2B 3AU4A 4GMVA 2N23A 1DROA 3WA0A 4C0AA 1TQZA 3HQCA 4ZRIA 3G9WA 1BTKA 4YONA 3FSSA 2DLWA 4GZUA 3FVCA 1W1HA 2ADZA 1EGXA 3NWFA 4A6FA 1X1FA 1MIXA 1J19A 3GYPA 5KQ1A 3TFMA 4QJ4B 4A6KA 2J0KA 4IOYX 5HE0A 5DI9B 3PSCA 4D6WA 3PG7A 3NSUA 2NMBA 1KZGA 1DDWA 2QKMA 4HSIA 4HB0B 1V5UA 2J0MA 2MFQA 5DIFB 5D3YA 1OMWA 2I5FA 2H7EA 4ZRKA 4KAXB 3KRWA 3SYXA 1IRSA 3TO1A 2J59M 1WJMA 2Z4DA 3ODWA 2RLOA 4Z2MB 3GYOA 1ISNA 3WYFB 4BBKA 2MDXA 4F7HA 3NWAA 4A6HA 1MIZB 2LYDA 2VSZA 2YT1A 1DDMA 2X18A 1RJ2A 5HE2A 1BWNA 2EMSA 2I1JA 1NTVA 1U5EA 2V76A 3PP2A 2CAYA 3F5RA 2DKPA 5KCVA 2RSGA 2R2YA 1ZVRA 4NY0A 3U12A 1WG7A 2M38A 2OQBA 1BTNA 1XR0B 1UPQA 4NSWA 2ROZB 1SHCA 1DYNA 1SGHA 3KZ1A 4IFSA 2P0FA 5EFXA 5J3TA 1M7EA 2Z0QA 2HE7A 3MDBC 4PNKA 1MI1A 1V88A 3DXEA 2D10A 5FI1A 2YT2A 1TXDA 5HE3A 2YVCA 1MK7B 1X11A 2GS0A 1E5WA 1WVHA 3SNHA 2Q13A 2DX1A 1Z87A 3PEGA 3U8ZA 4MT7A 2GUMA 5J3QA 2K2JA 2DHJA 5I2MA 2Z14A 5C6RA 2UZSA 1B55A 2BCJA 2COFA 2MWNB 1QC6A 4WJ7A 2YS5A 4F7UP 1FOEA 2KGXB 3TW1A 5I2SA 5J3YA 4CSQA 1FAOA 1KI1B 2CY4A 4OSNA 4QJ5B 5CLQB 1Y5OA 1K5DB 2P0DA 2RNRB 2RRFA 4GPTB 3U7DA 4EJNA 5DHFB 2EC1A 2K8EA 3SO6A 2KR0A 2Y8GA 4A6FB 2RUKB 2P0HA 4F7GA 4MK0A 4TYZA 3FEHA 5JLJB 1ZYIA 1FGZA 5DHAB 4KVGB 1J0WA 1UNPA 3BINA
chains in the Genus database with same CATH topology
3BJIA 3ZDTA 2Z0PA 4HATB 1MPHA 2CRFA 3AJ4A 2GCJA 4XWXA 2N0YA 5D27A 3SV1A 4IAPA 1ZM0A 2L1CA 3OANA 2YRYA 1LB1A 3KSYA 2D2QA 2W2WA 3CIKA 2QKLA 1DDVA 1UNQA 2IYBA 2DYNA 4Z2NA 2DHKA 5C79A 2D9WA 2YSZA 4K17A 1UNRA 1V61A 3PZDA 3V5WA 3D8FA 1GG3A 2HTHB 2LG1A 1RRPB 4DX90 1FHXA 2AL6A 2ELBA 2NZ8B 3PVUA 2D9VA 3QWMA 2DX5A 2CY5A 5C5BA 5FI0A 2LOXA 2Y7BA 2PZ1A 2YF0A 1I7AA 4WSFA 1KZ7A 1LW3A 1P5TA 1FB8A 2Y8FA 4WVFB 1GC7A 5HE1A 2R0DA 4CHJA 3D8EA 1AWEA 4HAVB 4KHBB 3TCAA 2W2XD 2DFKA 3CXBB 5D3XA 4YL8A 2G35A 3UZTA 2DN6A 4P7IA 1ZC4B 2EJ8A 2K2UA 1WGQA 4HDOA 3KY9A 2H7DA 1QQGA 1NI2A 1UPRA 1V5MA 2R09A 3A8PA 4D0NB 4MY6A 2Z0OA 2FJLA 2RGNB 2LKOA 1TJ6A 3DXDA 5JHGA 1M7RA 1P3RA 3M1IB 5CLLB 2W2XC 3P6AA 4HAWB 3SUZA 2KUPA 2DHIA 1PFJA 4GXBA 1XCGA 3ML4A 5GOWB 1U29A 2K00A 1UEFA 4A5KA 2COCA 4HB2B 4HAUB 2YS3A 4GMXB 1DBHA 2XQNM 1FGYA 1V89A 1X05A 4Y94A 2COAA 1Q67A 3PVLA 2D4QA 1NU2A 2RVBB 1MKEA 3F0WA 2D9ZA 4HAYB 4CHMA 1WI1A 2OTXA 4DXAB 1AQCA 3DXCA 1N3HA 5JHHA 3HK0A 2AEHA 3LJUX 2L2IA 3P7ZA 2GCLA 2I5CA 2VRWB 4HDQA 3QBVB 1V5PA 1PMSA 5LOPB 4B6HA 5LONB 2J0JA 1ZSQA 3ULBA 4CYEA 3ZVRA 2I1KA 3MPXA 2GJYA 1U5GA 1EF1A 1MAIA 2EMTA 1PLSA 4HB4B 3AU5A 3QIJA 2ROVA 1XKEA 3TVVA 5C16A 1H10A 1Y19B 4TKNA 2LOZA 1BAKA 1U2BA 4DX8A 2VKIA 4GN1A 4K2PA 5C5BB 5D3VA 5JP4A 2DYQA 1FHWA 1WGUA 2MKRA 1X86A 1EVHA 2ZPYA 4HAZB 2IFSA 2UZRA 2YT0A 3RCPA 2DA0A 4KHAA 2DTCA 3A98B 2UVMA 4HHVA 3FM8C 2JP2A 1X1GA 1OQNA 1EAZA 2LULA 3ODOA 1OY2A 2P8VA 3VIAA 2YS1A 5L81A 4L6EA 3D8DA 1K5GB 3ULCA 3X23A 3KRXA 4EKUA 1P6SA 2D9YA 1U27A 4K81A 3VOQA 1W1DA 4H8SA 2D11A 3A8QA 1WJ1A 4PQ0A 5D3WA 3IVFA 2KCJA 5KQ4A 2ELAA 1XODA 4K2OA 4HB3B 4EMOA 4KHOA 2D9XA 2E2XA 1NTYA 4HAXB 4DBBA 1H4RA 1MK9B 1W1GA 3T06A 1FHOA 2M14A 3O96A 3ODXA 1XD4A 3N7CA 1I2HA 1XX0A 2DKQA 1GC6A 3PVWA 2CODA 5DH9B 1U5DA 1ZC3B 4ZRJA 1U5FA 3HW2B 3AU4A 4GMVA 2N23A 1DROA 3WA0A 4C0AA 1TQZA 3HQCA 4ZRIA 3G9WA 1BTKA 4YONA 3FSSA 2DLWA 4GZUA 1W1HA 2ADZA 1EGXA 4A6FA 1X1FA 1MIXA 1J19A 3GYPA 5KQ1A 3TFMA 4A6KA 2J0KA 4IOYX 5HE0A 5DI9B 3PSCA 3PG7A 3NSUA 2NMBA 1KZGA 1DDWA 2QKMA 4HB0B 1V5UA 2J0MA 2MFQA 5DIFB 5D3YA 1OMWA 2I5FA 2H7EA 4ZRKA 4KAXB 3KRWA 3SYXA 1IRSA 3TO1A 2J59M 1WJMA 3ODWA 2RLOA 4Z2MB 3GYOA 1ISNA 3WYFB 4BBKA 2MDXA 4F7HA 4A6HA 1MIZB 2LYDA 2VSZA 2YT1A 1DDMA 2X18A 1RJ2A 5HE2A 1BWNA 2EMSA 2I1JA 1NTVA 1U5EA 2V76A 3PP2A 2CAYA 3F5RA 2DKPA 5KCVA 2RSGA 1ZVRA 4NY0A 1WG7A 2M38A 2OQBA 1BTNA 1XR0B 1UPQA 4NSWA 2ROZB 1SHCA 1DYNA 1SGHA 3KZ1A 4IFSA 2P0FA 5EFXA 5J3TA 1M7EA 2Z0QA 2HE7A 3MDBC 4PNKA 1V88A 3DXEA 2D10A 5FI1A 1TXDA 5HE3A 2YVCA 1MK7B 1X11A 2GS0A 1E5WA 1WVHA 3SNHA 2Q13A 2DX1A 1Z87A 3PEGA 3U8ZA 4MT7A 5J3QA 2K2JA 2DHJA 5C6RA 2UZSA 1B55A 2BCJA 2COFA 2MWNB 1QC6A 4WJ7A 2YS5A 4F7UP 1FOEA 2KGXB 3TW1A 5J3YA 1FAOA 1KI1B 2CY4A 5CLQB 1Y5OA 1K5DB 2P0DA 2RNRB 4GPTB 3U7DA 4EJNA 5DHFB 2EC1A 3SO6A 2Y8GA 4A6FB 2RUKB 2P0HA 4F7GA 4MK0A 4TYZA 3FEHA 5JLJB 1FGZA 5DHAB 4KVGB 1J0WA 1UNPA 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJI A;  3ZDT A;  2Z0P A;  4HAT B;  1MPH A;  2CRF A;  3AJ4 A;  2GCJ A;  4XWX A;  2N0Y A;  5D27 A;  3SV1 A;  4IAP A;  1ZM0 A;  2L1C A;  3OAN A;  2YRY A;  1LB1 A;  3KSY A;  2D2Q A;  2W2W A;  3CIK A;  2QKL A;  1DDV A;  1UNQ A;  2IYB A;  2DYN A;  4Z2N A;  2DHK A;  5C79 A;  2D9W A;  2YSZ A;  4K17 A;  1UNR A;  1V61 A;  3PZD A;  3V5W A;  3D8F A;  1GG3 A;  2HTH B;  2LG1 A;  1RRP B;  4DX9 0;  1FHX A;  2AL6 A;  2ELB A;  2NZ8 B;  3PVU A;  2D9V A;  3QWM A;  2DX5 A;  2CY5 A;  5C5B A;  5FI0 A;  2LOX A;  2Y7B A;  2PZ1 A;  2YF0 A;  1I7A A;  4WSF A;  1KZ7 A;  1LW3 A;  1P5T A;  1FB8 A;  2Y8F A;  4WVF B;  1GC7 A;  5HE1 A;  2R0D A;  4CHJ A;  3D8E A;  1AWE A;  4HAV B;  4KHB B;  3TCA A;  2W2X D;  2DFK A;  3CXB B;  5D3X A;  4YL8 A;  2G35 A;  3UZT A;  2DN6 A;  4P7I A;  1ZC4 B;  2EJ8 A;  2K2U A;  1WGQ A;  4HDO A;  3KY9 A;  2H7D A;  1QQG A;  1NI2 A;  1UPR A;  1V5M A;  2R09 A;  3A8P A;  4D0N B;  4MY6 A;  2Z0O A;  2FJL A;  2RGN B;  2LKO A;  1TJ6 A;  3DXD A;  5JHG A;  1M7R A;  1P3R A;  3M1I B;  5CLL B;  2W2X C;  3P6A A;  4HAW B;  3SUZ A;  2KUP A;  2DHI A;  1PFJ A;  4GXB A;  1XCG A;  3ML4 A;  5GOW B;  1U29 A;  2K00 A;  1UEF A;  4A5K A;  2COC A;  4HB2 B;  4HAU B;  2YS3 A;  4GMX B;  1DBH A;  2XQN M;  1FGY A;  1V89 A;  1X05 A;  4Y94 A;  2COA A;  1Q67 A;  3PVL A;  2D4Q A;  1NU2 A;  2RVB B;  1MKE A;  3F0W A;  2D9Z A;  4HAY B;  4CHM A;  1WI1 A;  2OTX A;  4DXA B;  1AQC A;  3DXC A;  1N3H A;  5JHH A;  3HK0 A;  2AEH A;  3LJU X;  2L2I A;  3P7Z A;  2GCL A;  2I5C A;  2VRW B;  4HDQ A;  3QBV B;  1V5P A;  1PMS A;  5LOP B;  4B6H A;  5LON B;  2J0J A;  1ZSQ A;  3ULB A;  4CYE A;  3ZVR A;  2I1K A;  3MPX A;  2GJY A;  1U5G A;  1EF1 A;  1MAI A;  2EMT A;  1PLS A;  4HB4 B;  3AU5 A;  3QIJ A;  2ROV A;  1XKE A;  3TVV A;  5C16 A;  1H10 A;  1Y19 B;  4TKN A;  2LOZ A;  1BAK A;  1U2B A;  4DX8 A;  2VKI A;  4GN1 A;  4K2P A;  5C5B B;  5D3V A;  5JP4 A;  2DYQ A;  1FHW A;  1WGU A;  2MKR A;  1X86 A;  1EVH A;  2ZPY A;  4HAZ B;  2IFS A;  2UZR A;  2YT0 A;  3RCP A;  2DA0 A;  4KHA A;  2DTC A;  3A98 B;  2UVM A;  4HHV A;  3FM8 C;  2JP2 A;  1X1G A;  1OQN A;  1EAZ A;  2LUL A;  3ODO A;  1OY2 A;  2P8V A;  3VIA A;  2YS1 A;  5L81 A;  4L6E A;  3D8D A;  1K5G B;  3ULC A;  3X23 A;  3KRX A;  4EKU A;  1P6S A;  2D9Y A;  1U27 A;  4K81 A;  3VOQ A;  1W1D A;  4H8S A;  2D11 A;  3A8Q A;  1WJ1 A;  4PQ0 A;  5D3W A;  3IVF A;  2KCJ A;  5KQ4 A;  2ELA A;  1XOD A;  4K2O A;  4HB3 B;  4EMO A;  4KHO A;  2D9X A;  2E2X A;  1NTY A;  4HAX B;  4DBB A;  1H4R A;  1MK9 B;  1W1G A;  3T06 A;  1FHO A;  2M14 A;  3O96 A;  3ODX A;  1XD4 A;  3N7C A;  1I2H A;  1XX0 A;  2DKQ A;  1GC6 A;  3PVW A;  2COD A;  5DH9 B;  1U5D A;  1ZC3 B;  4ZRJ A;  1U5F A;  3HW2 B;  3AU4 A;  4GMV A;  2N23 A;  1DRO A;  3WA0 A;  4C0A A;  1TQZ A;  3HQC A;  4ZRI A;  3G9W A;  1BTK A;  4YON A;  3FSS A;  2DLW A;  4GZU A;  1W1H A;  2ADZ A;  1EGX A;  4A6F A;  1X1F A;  1MIX A;  1J19 A;  3GYP A;  5KQ1 A;  3TFM A;  4A6K A;  2J0K A;  4IOY X;  5HE0 A;  5DI9 B;  3PSC A;  3PG7 A;  3NSU A;  2NMB A;  1KZG A;  1DDW A;  2QKM A;  4HB0 B;  1V5U A;  2J0M A;  2MFQ A;  5DIF B;  5D3Y A;  1OMW A;  2I5F A;  2H7E A;  4ZRK A;  4KAX B;  3KRW A;  3SYX A;  1IRS A;  3TO1 A;  2J59 M;  1WJM A;  3ODW A;  2RLO A;  4Z2M B;  3GYO A;  1ISN A;  3WYF B;  4BBK A;  2MDX A;  4F7H A;  4A6H A;  1MIZ B;  2LYD A;  2VSZ A;  2YT1 A;  1DDM A;  2X18 A;  1RJ2 A;  5HE2 A;  1BWN A;  2EMS A;  2I1J A;  1NTV A;  1U5E A;  2V76 A;  3PP2 A;  2CAY A;  3F5R A;  2DKP A;  5KCV A;  2RSG A;  1ZVR A;  4NY0 A;  1WG7 A;  2M38 A;  2OQB A;  1BTN A;  1XR0 B;  1UPQ A;  4NSW A;  2ROZ B;  1SHC A;  1DYN A;  1SGH A;  3KZ1 A;  4IFS A;  2P0F A;  5EFX A;  5J3T A;  1M7E A;  2Z0Q A;  2HE7 A;  3MDB C;  4PNK A;  1V88 A;  3DXE A;  2D10 A;  5FI1 A;  1TXD A;  5HE3 A;  2YVC A;  1MK7 B;  1X11 A;  2GS0 A;  1E5W A;  1WVH A;  3SNH A;  2Q13 A;  2DX1 A;  1Z87 A;  3PEG A;  3U8Z A;  4MT7 A;  5J3Q A;  2K2J A;  2DHJ A;  5C6R A;  2UZS A;  1B55 A;  2BCJ A;  2COF A;  2MWN B;  1QC6 A;  4WJ7 A;  2YS5 A;  4F7U P;  1FOE A;  2KGX B;  3TW1 A;  5J3Y A;  1FAO A;  1KI1 B;  2CY4 A;  5CLQ B;  1Y5O A;  1K5D B;  2P0D A;  2RNR B;  4GPT B;  3U7D A;  4EJN A;  5DHF B;  2EC1 A;  3SO6 A;  2Y8G A;  4A6F B;  2RUK B;  2P0H A;  4F7G A;  4MK0 A;  4TYZ A;  3FEH A;  5JLJ B;  1FGZ A;  5DHA B;  4KVG B;  1J0W A;  1UNP A;  3BIN A; 
#chains in the Genus database with same CATH topology
 3BJI A;  3ZDT A;  2Z0P A;  4HAT B;  1MPH A;  2CRF A;  3AJ4 A;  2GCJ A;  4XWX A;  2N0Y A;  5D27 A;  3SV1 A;  4GNK B;  4IAP A;  1ZM0 A;  2L1C A;  3OAN A;  2YRY A;  1LB1 A;  3KSY A;  2D2Q A;  2W2W A;  3CIK A;  2QKL A;  1DDV A;  1UNQ A;  2IYB A;  2DYN A;  4Z2N A;  2DHK A;  5C79 A;  2D9W A;  2YSZ A;  4K17 A;  1UNR A;  1V61 A;  3B77 A;  3PZD A;  3V5W A;  3D8F A;  1GG3 A;  2HTH B;  2LG1 A;  1RRP B;  4DX9 0;  1FHX A;  2AL6 A;  2ELB A;  2NZ8 B;  3PVU A;  2D9V A;  3QWM A;  2DX5 A;  2CY5 A;  5C5B A;  5FI0 A;  2LOX A;  2Y7B A;  2PZ1 A;  2YF0 A;  1I7A A;  4WSF A;  1KZ7 A;  1LW3 A;  1P5T A;  1FB8 A;  2Y8F A;  4WVF B;  1GC7 A;  5HE1 A;  2R0D A;  4CHJ A;  3D8E A;  1AWE A;  4HAV B;  4KHB B;  3TCA A;  2W2X D;  2DFK A;  3CXB B;  5D3X A;  4YL8 A;  2G35 A;  3UZT A;  2DN6 A;  4P7I A;  1ZC4 B;  2EJ8 A;  2K2U A;  1WGQ A;  4KHB A;  4HDO A;  3KY9 A;  2H7D A;  1QQG A;  1NI2 A;  1UPR A;  1V5M A;  2R09 A;  3A8P A;  4D0N B;  4MY6 A;  2Z0O A;  2FJL A;  2RGN B;  2LKO A;  1TJ6 A;  3DXD A;  4OT1 A;  1T77 A;  5JHG A;  1M7R A;  1P3R A;  3M1I B;  5CLL B;  2W2X C;  3P6A A;  4HAW B;  3SUZ A;  2KUP A;  2DHI A;  1PFJ A;  4GXB A;  1XCG A;  3ML4 A;  5GOW B;  1U29 A;  2K00 A;  1UEF A;  4A5K A;  2COC A;  3HSA A;  4HB2 B;  4HAU B;  2YS3 A;  4GMX B;  1DBH A;  2XQN M;  1FGY A;  1V89 A;  1X05 A;  4Y94 A;  2COA A;  1Q67 A;  2Z59 A;  3PVL A;  2D4Q A;  1NU2 A;  2RVB B;  3HIE A;  1MKE A;  3F0W A;  2D9Z A;  4HAY B;  4CHM A;  5LG4 B;  3OHM B;  1WI1 A;  2OTX A;  4DXA B;  1AQC A;  3DXC A;  1N3H A;  5JHH A;  3HK0 A;  2AEH A;  3LJU X;  2L2I A;  3P7Z A;  2NBV A;  4GOU A;  2GCL A;  2KIG A;  2I5C A;  2VRW B;  4HDQ A;  3QBV B;  1V5P A;  2KUQ A;  1PMS A;  5LOP B;  3DCX A;  4L1R A;  4B6H A;  5LON B;  2J0J A;  1ZSQ A;  3ULB A;  4CYE A;  3ZVR A;  2I1K A;  3MPX A;  2GJY A;  1U5G A;  1EF1 A;  1MAI A;  2EMT A;  1PLS A;  3NWD A;  4HB4 B;  3AU5 A;  3QIJ A;  2ROV A;  5M4Y B;  1XKE A;  3TVV A;  5C16 A;  1H10 A;  1Y19 B;  4TKN A;  2LOZ A;  1BAK A;  1U2B A;  4DX8 A;  2VKI A;  4GN1 A;  4K2P A;  5C5B B;  4QXA B;  5D3V A;  5JP4 A;  2ZKM X;  2DYQ A;  3A58 A;  1FHW A;  1WGU A;  2MKR A;  1X86 A;  1EVH A;  2ZPY A;  4HAZ B;  2IFS A;  2UZR A;  2YT0 A;  3RCP A;  2DA0 A;  4KHA A;  2DTC A;  3A98 B;  2UVM A;  3NW8 A;  4HHV A;  3FM8 C;  2JP2 A;  1X1G A;  1OQN A;  1EAZ A;  2LUL A;  3ODO A;  1OY2 A;  2P8V A;  3VIA A;  2YS1 A;  4QJ3 B;  5L81 A;  4L6E A;  3D8D A;  1K5G B;  5IRS A;  3ULC A;  2Z13 A;  3X23 A;  3KRX A;  4EKU A;  1P6S A;  2D9Y A;  1U27 A;  4K81 A;  3VOQ A;  1W1D A;  4H8S A;  2D11 A;  3A8Q A;  1WJ1 A;  4PQ0 A;  5D3W A;  2KIE A;  3IVF A;  2KCJ A;  5KQ4 A;  2ELA A;  1XOD A;  4K2O A;  4HB3 B;  4EMO A;  4KHO A;  2D9X A;  2E2X A;  1NTY A;  4HAX B;  4DBB A;  2FJU B;  1H4R A;  1MK9 B;  1W1G A;  3T06 A;  4DIX A;  1FHO A;  2M14 A;  3O96 A;  3ODX A;  1XD4 A;  3N7C A;  1I2H A;  1XX0 A;  2DKQ A;  1GC6 A;  3PVW A;  2COD A;  5DH9 B;  2K49 A;  1U5D A;  1ZC3 B;  4ZRJ A;  1U5F A;  3HW2 B;  3AU4 A;  4GMV A;  2N23 A;  1DRO A;  3WA0 A;  4C0A A;  1TQZ A;  3HQC A;  4ZRI A;  3G9W A;  1BTK A;  4YON A;  3FSS A;  2DLW A;  4GZU A;  3FVC A;  1W1H A;  2ADZ A;  1EGX A;  3NWF A;  4A6F A;  1X1F A;  1MIX A;  1J19 A;  3GYP A;  5KQ1 A;  3TFM A;  4QJ4 B;  4A6K A;  2J0K A;  4IOY X;  5HE0 A;  5DI9 B;  3PSC A;  4D6W A;  3PG7 A;  3NSU A;  2NMB A;  1KZG A;  1DDW A;  2QKM A;  4HSI A;  4HB0 B;  1V5U A;  2J0M A;  2MFQ A;  5DIF B;  5D3Y A;  1OMW A;  2I5F A;  2H7E A;  4ZRK A;  4KAX B;  3KRW A;  3SYX A;  1IRS A;  3TO1 A;  2J59 M;  1WJM A;  2Z4D A;  3ODW A;  2RLO A;  4Z2M B;  3GYO A;  1ISN A;  3WYF B;  4BBK A;  2MDX A;  4F7H A;  3NWA A;  4A6H A;  1MIZ B;  2LYD A;  2VSZ A;  2YT1 A;  1DDM A;  2X18 A;  1RJ2 A;  5HE2 A;  1BWN A;  2EMS A;  2I1J A;  1NTV A;  1U5E A;  2V76 A;  3PP2 A;  2CAY A;  3F5R A;  2DKP A;  5KCV A;  2RSG A;  2R2Y A;  1ZVR A;  4NY0 A;  3U12 A;  1WG7 A;  2M38 A;  2OQB A;  1BTN A;  1XR0 B;  1UPQ A;  4NSW A;  2ROZ B;  1SHC A;  1DYN A;  1SGH A;  3KZ1 A;  4IFS A;  2P0F A;  5EFX A;  5J3T A;  1M7E A;  2Z0Q A;  2HE7 A;  3MDB C;  4PNK A;  1MI1 A;  1V88 A;  3DXE A;  2D10 A;  5FI1 A;  2YT2 A;  1TXD A;  5HE3 A;  2YVC A;  1MK7 B;  1X11 A;  2GS0 A;  1E5W A;  1WVH A;  3SNH A;  2Q13 A;  2DX1 A;  1Z87 A;  3PEG A;  3U8Z A;  4MT7 A;  2GUM A;  5J3Q A;  2K2J A;  2DHJ A;  5I2M A;  2Z14 A;  5C6R A;  2UZS A;  1B55 A;  2BCJ A;  2COF A;  2MWN B;  1QC6 A;  4WJ7 A;  2YS5 A;  4F7U P;  1FOE A;  2KGX B;  3TW1 A;  5I2S A;  5J3Y A;  4CSQ A;  1FAO A;  1KI1 B;  2CY4 A;  4OSN A;  4QJ5 B;  5CLQ B;  1Y5O A;  1K5D B;  2P0D A;  2RNR B;  2RRF A;  4GPT B;  3U7D A;  4EJN A;  5DHF B;  2EC1 A;  2K8E A;  3SO6 A;  2KR0 A;  2Y8G A;  4A6F B;  2RUK B;  2P0H A;  4F7G A;  4MK0 A;  4TYZ A;  3FEH A;  5JLJ B;  1ZYI A;  1FGZ A;  5DHA B;  4KVG B;  1J0W A;  1UNP A;  3BIN A; 
#chains in the Genus database with same CATH homology
 3BJI A;  3ZDT A;  2Z0P A;  4HAT B;  1MPH A;  2CRF A;  3AJ4 A;  2GCJ A;  4XWX A;  2N0Y A;  5D27 A;  3SV1 A;  4IAP A;  1ZM0 A;  2L1C A;  3OAN A;  2YRY A;  1LB1 A;  3KSY A;  2D2Q A;  2W2W A;  3CIK A;  2QKL A;  1DDV A;  1UNQ A;  2IYB A;  2DYN A;  4Z2N A;  2DHK A;  5C79 A;  2D9W A;  2YSZ A;  4K17 A;  1UNR A;  1V61 A;  3PZD A;  3V5W A;  3D8F A;  1GG3 A;  2HTH B;  2LG1 A;  1RRP B;  4DX9 0;  1FHX A;  2AL6 A;  2ELB A;  2NZ8 B;  3PVU A;  2D9V A;  3QWM A;  2DX5 A;  2CY5 A;  5C5B A;  5FI0 A;  2LOX A;  2Y7B A;  2PZ1 A;  2YF0 A;  1I7A A;  4WSF A;  1KZ7 A;  1LW3 A;  1P5T A;  1FB8 A;  2Y8F A;  4WVF B;  1GC7 A;  5HE1 A;  2R0D A;  4CHJ A;  3D8E A;  1AWE A;  4HAV B;  4KHB B;  3TCA A;  2W2X D;  2DFK A;  3CXB B;  5D3X A;  4YL8 A;  2G35 A;  3UZT A;  2DN6 A;  4P7I A;  1ZC4 B;  2EJ8 A;  2K2U A;  1WGQ A;  4HDO A;  3KY9 A;  2H7D A;  1QQG A;  1NI2 A;  1UPR A;  1V5M A;  2R09 A;  3A8P A;  4D0N B;  4MY6 A;  2Z0O A;  2FJL A;  2RGN B;  2LKO A;  1TJ6 A;  3DXD A;  5JHG A;  1M7R A;  1P3R A;  3M1I B;  5CLL B;  2W2X C;  3P6A A;  4HAW B;  3SUZ A;  2KUP A;  2DHI A;  1PFJ A;  4GXB A;  1XCG A;  3ML4 A;  5GOW B;  1U29 A;  2K00 A;  1UEF A;  4A5K A;  2COC A;  4HB2 B;  4HAU B;  2YS3 A;  4GMX B;  1DBH A;  2XQN M;  1FGY A;  1V89 A;  1X05 A;  4Y94 A;  2COA A;  1Q67 A;  3PVL A;  2D4Q A;  1NU2 A;  2RVB B;  1MKE A;  3F0W A;  2D9Z A;  4HAY B;  4CHM A;  1WI1 A;  2OTX A;  4DXA B;  1AQC A;  3DXC A;  1N3H A;  5JHH A;  3HK0 A;  2AEH A;  3LJU X;  2L2I A;  3P7Z A;  2GCL A;  2I5C A;  2VRW B;  4HDQ A;  3QBV B;  1V5P A;  1PMS A;  5LOP B;  4B6H A;  5LON B;  2J0J A;  1ZSQ A;  3ULB A;  4CYE A;  3ZVR A;  2I1K A;  3MPX A;  2GJY A;  1U5G A;  1EF1 A;  1MAI A;  2EMT A;  1PLS A;  4HB4 B;  3AU5 A;  3QIJ A;  2ROV A;  1XKE A;  3TVV A;  5C16 A;  1H10 A;  1Y19 B;  4TKN A;  2LOZ A;  1BAK A;  1U2B A;  4DX8 A;  2VKI A;  4GN1 A;  4K2P A;  5C5B B;  5D3V A;  5JP4 A;  2DYQ A;  1FHW A;  1WGU A;  2MKR A;  1X86 A;  1EVH A;  2ZPY A;  4HAZ B;  2IFS A;  2UZR A;  2YT0 A;  3RCP A;  2DA0 A;  4KHA A;  2DTC A;  3A98 B;  2UVM A;  4HHV A;  3FM8 C;  2JP2 A;  1X1G A;  1OQN A;  1EAZ A;  2LUL A;  3ODO A;  1OY2 A;  2P8V A;  3VIA A;  2YS1 A;  5L81 A;  4L6E A;  3D8D A;  1K5G B;  3ULC A;  3X23 A;  3KRX A;  4EKU A;  1P6S A;  2D9Y A;  1U27 A;  4K81 A;  3VOQ A;  1W1D A;  4H8S A;  2D11 A;  3A8Q A;  1WJ1 A;  4PQ0 A;  5D3W A;  3IVF A;  2KCJ A;  5KQ4 A;  2ELA A;  1XOD A;  4K2O A;  4HB3 B;  4EMO A;  4KHO A;  2D9X A;  2E2X A;  1NTY A;  4HAX B;  4DBB A;  1H4R A;  1MK9 B;  1W1G A;  3T06 A;  1FHO A;  2M14 A;  3O96 A;  3ODX A;  1XD4 A;  3N7C A;  1I2H A;  1XX0 A;  2DKQ A;  1GC6 A;  3PVW A;  2COD A;  5DH9 B;  1U5D A;  1ZC3 B;  4ZRJ A;  1U5F A;  3HW2 B;  3AU4 A;  4GMV A;  2N23 A;  1DRO A;  3WA0 A;  4C0A A;  1TQZ A;  3HQC A;  4ZRI A;  3G9W A;  1BTK A;  4YON A;  3FSS A;  2DLW A;  4GZU A;  1W1H A;  2ADZ A;  1EGX A;  4A6F A;  1X1F A;  1MIX A;  1J19 A;  3GYP A;  5KQ1 A;  3TFM A;  4A6K A;  2J0K A;  4IOY X;  5HE0 A;  5DI9 B;  3PSC A;  3PG7 A;  3NSU A;  2NMB A;  1KZG A;  1DDW A;  2QKM A;  4HB0 B;  1V5U A;  2J0M A;  2MFQ A;  5DIF B;  5D3Y A;  1OMW A;  2I5F A;  2H7E A;  4ZRK A;  4KAX B;  3KRW A;  3SYX A;  1IRS A;  3TO1 A;  2J59 M;  1WJM A;  3ODW A;  2RLO A;  4Z2M B;  3GYO A;  1ISN A;  3WYF B;  4BBK A;  2MDX A;  4F7H A;  4A6H A;  1MIZ B;  2LYD A;  2VSZ A;  2YT1 A;  1DDM A;  2X18 A;  1RJ2 A;  5HE2 A;  1BWN A;  2EMS A;  2I1J A;  1NTV A;  1U5E A;  2V76 A;  3PP2 A;  2CAY A;  3F5R A;  2DKP A;  5KCV A;  2RSG A;  1ZVR A;  4NY0 A;  1WG7 A;  2M38 A;  2OQB A;  1BTN A;  1XR0 B;  1UPQ A;  4NSW A;  2ROZ B;  1SHC A;  1DYN A;  1SGH A;  3KZ1 A;  4IFS A;  2P0F A;  5EFX A;  5J3T A;  1M7E A;  2Z0Q A;  2HE7 A;  3MDB C;  4PNK A;  1V88 A;  3DXE A;  2D10 A;  5FI1 A;  1TXD A;  5HE3 A;  2YVC A;  1MK7 B;  1X11 A;  2GS0 A;  1E5W A;  1WVH A;  3SNH A;  2Q13 A;  2DX1 A;  1Z87 A;  3PEG A;  3U8Z A;  4MT7 A;  5J3Q A;  2K2J A;  2DHJ A;  5C6R A;  2UZS A;  1B55 A;  2BCJ A;  2COF A;  2MWN B;  1QC6 A;  4WJ7 A;  2YS5 A;  4F7U P;  1FOE A;  2KGX B;  3TW1 A;  5J3Y A;  1FAO A;  1KI1 B;  2CY4 A;  5CLQ B;  1Y5O A;  1K5D B;  2P0D A;  2RNR B;  4GPT B;  3U7D A;  4EJN A;  5DHF B;  2EC1 A;  3SO6 A;  2Y8G A;  4A6F B;  2RUK B;  2P0H A;  4F7G A;  4MK0 A;  4TYZ A;  3FEH A;  5JLJ B;  1FGZ A;  5DHA B;  4KVG B;  1J0W A;  1UNP A;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...