1MAIA

Structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'GLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVQGLRKIIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C DELTA-1
publication title Structure of the high affinity complex of inositol trisphosphate with a phospholipase C pleckstrin homology domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signal transduction protein
total genus 33
structure length 119
sequence length 119
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1maiA00
1X86A 1XKEA 2RNRB 1OMWA 4GN1A 2K00A 3OANA 5JHGA 2Y7BA 4F7UP 2W2XD 1FGZA 5L81A 3T06A 1UNPA 2L1CA 2YT0A 3A8QA 4ZRKA 3PP2A 1GC7A 2N23A 2QKMA 2IYBA 2L2IA 5HE3A 4KHAA 4A6KA 3NSUA 1OY2A 2DKQA 2MFQA 2YSZA 3DXDA 2DYNA 3ODXA 4YONA 3A8PA 2KCJA 3SV1A 2H7DA 2RLOA 2XQNM 1MAIA 3SYXA 3O96A 1MPHA 2D4QA 5KQ4A 2NZ8B 2DX1A 1P6SA 1U29A 4HDOA 3TVVA 3CIKA 1H10A 2Q13A 3FSSA 1XR0B 3DXCA 3P6AA 5C79A 1WGUA 3BINA 3AJ4A 4GXBA 5DHAB 1GG3A 4WJ7A 2M38A 4HAWB 1E5WA 2DKPA 3MPXA 2J0JA 3WA0A 2I5CA 1UNRA 2HTHB 4GZUA 1XODA 4HHVA 2VSZA 4GMVA 4HDQA 2VRWB 1Q67A 2CAYA 3TW1A 3D8FA 5J3TA 2LOZA 2E2XA 4ZRIA 2H7EA 1TQZA 1BWNA 4PQ0A 2GCJA 5KCVA 2LOXA 3PVWA 1WG7A 1V5PA 2D9VA 4HB4B 3QBVB 1M7RA 2ROVA 1MK9B 5FI0A 2P8VA 5LONB 2YS5A 1KI1B 5JLJB 3LJUX 2Z0OA 3SNHA 2YVCA 2W2XC 2G35A 2V76A 1Z87A 2RUKB 4D0NB 5CLLB 1X1FA 2ELAA 1NTVA 4L6EA 5JP4A 2M14A 2LKOA 3PG7A 4C0AA 3KRXA 4NSWA 3MDBC 1SGHA 3V5WA 2W2WA 1B55A 1U27A 4GMXB 1J0WA 2YT1A 3SUZA 5EFXA 1MKEA 1WI1A 2Z0QA 1ZM0A 1SHCA 4MY6A 4F7GA 1X1GA 2GS0A 3ODWA 3CXBB 1XCGA 2K2UA 4WSFA 1DYNA 4A6FA 2QKLA 5FI1A 2D9ZA 4A5KA 1TXDA 2J0KA 3G9WA 1EGXA 1DDVA 4KVGB 2KGXB 4CHMA 4EKUA 2CY5A 1MK7B 1KZ7A 2CY4A 2ZPYA 3FM8C 2YRYA 4F7HA 3AU5A 4H8SA 2ADZA 3WYFB 1P3RA 4K2PA 4DX8A 1X05A 4IAPA 2GJYA 4ZRJA 5C5BB 2RSGA 5J3QA 4HB2B 2BCJA 1U5DA 1FAOA 1ZC4B 2MDXA 1ZVRA 2I1KA 1M7EA 1FHOA 3P7ZA 2D2QA 2NMBA 2RVBB 5GOWB 5DI9B 2EMSA 2DHJA 2Z0PA 2UZSA 2COAA 2DTCA 4HAZB 3VIAA 1BAKA 4K81A 5D3YA 4HAUB 3BJIA 2IFSA 2YS3A 4XWXA 4EJNA 1UPQA 4NY0A 2EJ8A 5LOPB 3D8DA 2AL6A 4CHJA 4KAXB 1GC6A 1K5DB 2YS1A 3KY9A 4IFSA 2DLWA 2OQBA 1FHWA 3D8EA 5HE2A 4DX90 1W1DA 2VKIA 1U5EA 3PZDA 3TO1A 5C16A 2UVMA 1TJ6A 2OTXA 2ROZB 2COCA 5DHFB 1J19A 3KSYA 4DXAB 3TCAA 3DXEA 3FEHA 3ULBA 1EAZA 2MKRA 1K5GB 2R09A 3KRWA 3UZTA 4P7IA 3SO6A 1I2HA 4IOYX 4CYEA 1EVHA 2I1JA 3KZ1A 1DBHA 1NI2A 2ELBA 4HB3B 1ISNA 3VOQA 3RCPA 5HE1A 1H4RA 4TYZA 1V61A 3PVLA 3PVUA 2DYQA 5J3YA 1U2BA 2DA0A 1AWEA 4HAYB 5C6RA 1PMSA 3GYOA 1NTYA 1KZGA 3ZDTA 1PLSA 2P0HA 3N7CA 1W1HA 1DDMA 1I7AA 3F5RA 2P0FA 1V89A 2D9WA 2UZRA 3QIJA 4K2OA 2R0DA 4A6HA 4WVFB 2DFKA 2P0DA 4KHBB 1W1GA 5CLQB 4HB0B 2RGNB 1P5TA 1LW3A 4HAXB 1RRPB 3QWMA 4HATB 1V88A 2N0YA 2CRFA 1XD4A 4Y94A 1UEFA 3PEGA 1UNQA 5D3WA 4PNKA 3PSCA 2COFA 1BTNA 4B6HA 4Z2NA 2JP2A 1UPRA 1IRSA 2D11A 2I5FA 3X23A 5D27A 1MIXA 1PFJA 3HW2B 5JHHA 2D9XA 2MWNB 3F0WA 1QC6A 5D3XA 4YL8A 1V5UA 5HE0A 5DIFB 1WVHA 4HAVB 1WJMA 4MT7A 5DH9B 3A98B 2Y8FA 2LG1A 1NU2A 1V5MA 2DN6A 1AQCA 4GPTB 1DDWA 2DX5A 1ZC3B 2D10A 3GYPA 1BTKA 1XX0A 2GCLA 4MK0A 1RJ2A 3ODOA 3U8ZA 1X11A 1FGYA 2KUPA 3HK0A 4A6FB 1FOEA 5D3VA 2LYDA 2J0MA 5KQ1A 2HE7A 2EC1A 1WJ1A 1U5FA 2K2JA 3U7DA 1N3HA 2DHKA 2Y8GA 1FB8A 4K17A 4KHOA 3IVFA 1U5GA 1Y5OA 1WGQA 3M1IB 1DROA 3ZVRA 1Y19B 2AEHA 1FHXA 3TFMA 4TKNA 2FJLA 2PZ1A 4Z2MB 2X18A 1LB1A 5C5BA 3AU4A 1MIZB 1ZSQA 4BBKA 4EMOA 4DBBA 1EF1A 3HQCA 2CODA 2D9YA 1QQGA 3ULCA 2YF0A 2J59M 3ML4A 2EMTA 2LULA 1OQNA 2DHIA
chains in the Genus database with same CATH superfamily
1X86A 1XKEA 2RNRB 1OMWA 4GN1A 2K00A 3OHMB 5IRSA 3OANA 5JHGA 2Y7BA 4F7UP 2W2XD 1FGZA 5L81A 3T06A 1UNPA 2L1CA 2YT0A 3A8QA 4ZRKA 3PP2A 1GC7A 2N23A 2QKMA 2IYBA 2L2IA 5HE3A 4KHAA 4A6KA 3NSUA 1OY2A 2DKQA 2MFQA 2YSZA 3DXDA 2DYNA 3ODXA 4YONA 3A8PA 2KCJA 3SV1A 2H7DA 2RLOA 2XQNM 1MAIA 3SYXA 3O96A 1MPHA 2D4QA 2K49A 5KQ4A 2NZ8B 2DX1A 1P6SA 1U29A 4HDOA 3TVVA 3CIKA 1H10A 2Q13A 3FSSA 1XR0B 3DXCA 3P6AA 5C79A 1WGUA 3BINA 3AJ4A 4GXBA 3FVCA 5DHAB 1GG3A 4WJ7A 2M38A 4HAWB 1E5WA 2DKPA 3MPXA 2J0JA 3WA0A 2I5CA 1UNRA 2HTHB 4GZUA 1XODA 4HHVA 2VSZA 4GMVA 4HDQA 2VRWB 1Q67A 2CAYA 3TW1A 3D8FA 5J3TA 2LOZA 2E2XA 4ZRIA 2H7EA 1TQZA 1BWNA 4PQ0A 2GCJA 5KCVA 2LOXA 2ZKMX 3PVWA 1WG7A 1V5PA 2D9VA 4HB4B 3QBVB 4KHBA 1M7RA 2ROVA 1MK9B 5FI0A 2P8VA 5LG4B 5LONB 2GUMA 2YS5A 1KI1B 5JLJB 3LJUX 2Z0OA 3SNHA 3DCXA 1T77A 2YVCA 2W2XC 2G35A 2V76A 1Z87A 4CSQA 2RRFA 2RUKB 4D0NB 5CLLB 1X1FA 2ELAA 1NTVA 4L6EA 5JP4A 4QJ5B 2M14A 2LKOA 3PG7A 4C0AA 5I2SA 3KRXA 4NSWA 3MDBC 1SGHA 3V5WA 2W2WA 1B55A 1U27A 4GMXB 1J0WA 2YT1A 3SUZA 5EFXA 1MKEA 1WI1A 2Z0QA 1ZM0A 1SHCA 4MY6A 4F7GA 2KR0A 1X1GA 2GS0A 3ODWA 3CXBB 1XCGA 2K2UA 4WSFA 1DYNA 4A6FA 2QKLA 3A58A 5FI1A 2D9ZA 4A5KA 1TXDA 1ZYIA 2J0KA 3G9WA 1EGXA 1DDVA 4KVGB 2KGXB 4CHMA 5M4YB 4EKUA 2CY5A 1MK7B 1KZ7A 2CY4A 2ZPYA 3FM8C 2YRYA 1MI1A 4F7HA 3AU5A 4H8SA 2ADZA 3WYFB 2Z59A 1P3RA 4K2PA 4DX8A 1X05A 4IAPA 2GJYA 4ZRJA 5C5BB 5I2MA 2RSGA 5J3QA 2YT2A 4HB2B 2BCJA 2Z4DA 1U5DA 1FAOA 1ZC4B 2MDXA 1ZVRA 2I1KA 1M7EA 1FHOA 3P7ZA 2D2QA 2NMBA 2RVBB 5GOWB 5DI9B 4GOUA 2EMSA 2DHJA 2Z0PA 2UZSA 2COAA 2DTCA 4HAZB 3VIAA 1BAKA 4K81A 5D3YA 4HAUB 3BJIA 2IFSA 2YS3A 4XWXA 4EJNA 1UPQA 4NY0A 2EJ8A 5LOPB 3D8DA 2AL6A 4CHJA 4KAXB 1GC6A 1K5DB 2YS1A 3KY9A 4IFSA 2DLWA 2OQBA 1FHWA 2KIGA 4DIXA 3D8EA 5HE2A 4DX90 1W1DA 2VKIA 1U5EA 3PZDA 3TO1A 5C16A 2UVMA 1TJ6A 2OTXA 2ROZB 2COCA 5DHFB 1J19A 3KSYA 4DXAB 3TCAA 3DXEA 3FEHA 3ULBA 1EAZA 2MKRA 1K5GB 2R09A 3KRWA 2R2YA 3UZTA 4P7IA 3SO6A 4GNKB 1I2HA 4IOYX 4CYEA 3B77A 1EVHA 2I1JA 3KZ1A 1DBHA 1NI2A 2ELBA 4HB3B 1ISNA 3VOQA 3RCPA 5HE1A 1H4RA 4TYZA 1V61A 3NWFA 3PVLA 3PVUA 2DYQA 5J3YA 1U2BA 2DA0A 1AWEA 4HAYB 5C6RA 1PMSA 3GYOA 1NTYA 1KZGA 3ZDTA 4QXAB 1PLSA 2P0HA 3N7CA 1W1HA 1DDMA 1I7AA 3F5RA 2P0FA 1V89A 2Z13A 3HIEA 2D9WA 2UZRA 3QIJA 4K2OA 2KIEA 2R0DA 4A6HA 4WVFB 2DFKA 2P0DA 4KHBB 1W1GA 5CLQB 4HB0B 2RGNB 3NW8A 1P5TA 3U12A 4D6WA 1LW3A 4QJ4B 4HAXB 1RRPB 3QWMA 4HATB 1V88A 2N0YA 2CRFA 1XD4A 4Y94A 1UEFA 3PEGA 1UNQA 5D3WA 4PNKA 3PSCA 2COFA 1BTNA 4B6HA 4Z2NA 2JP2A 1UPRA 1IRSA 2D11A 2I5FA 3X23A 5D27A 1MIXA 1PFJA 3HW2B 5JHHA 2D9XA 2MWNB 3NWDA 4L1RA 3F0WA 1QC6A 2FJUB 5D3XA 4YL8A 1V5UA 5HE0A 5DIFB 1WVHA 4HAVB 1WJMA 4MT7A 5DH9B 3A98B 2Y8FA 2Z14A 2LG1A 1NU2A 1V5MA 2DN6A 1AQCA 4GPTB 1DDWA 2DX5A 1ZC3B 2D10A 3GYPA 1BTKA 1XX0A 2K8EA 2GCLA 4MK0A 1RJ2A 3ODOA 3U8ZA 1X11A 1FGYA 2KUPA 3HK0A 4A6FB 4QJ3B 1FOEA 5D3VA 2LYDA 2J0MA 5KQ1A 2HE7A 3HSAA 2EC1A 1WJ1A 1U5FA 3NWAA 2K2JA 3U7DA 1N3HA 2DHKA 2Y8GA 1FB8A 4K17A 4KHOA 3IVFA 1U5GA 1Y5OA 1WGQA 3M1IB 1DROA 3ZVRA 1Y19B 2AEHA 1FHXA 3TFMA 4TKNA 2FJLA 2PZ1A 4OSNA 4Z2MB 2X18A 1LB1A 4HSIA 2NBVA 5C5BA 3AU4A 1MIZB 1ZSQA 4BBKA 4EMOA 4DBBA 1EF1A 3HQCA 2CODA 2D9YA 1QQGA 3ULCA 2YF0A 2J59M 3ML4A 2EMTA 2KUQA 2LULA 4OT1A 1OQNA 2DHIA
chains in the Genus database with same CATH topology
1X86A 1XKEA 2RNRB 1OMWA 4GN1A 2K00A 3OANA 5JHGA 2Y7BA 4F7UP 2W2XD 1FGZA 5L81A 3T06A 1UNPA 2L1CA 2YT0A 3A8QA 4ZRKA 3PP2A 1GC7A 2N23A 2QKMA 2IYBA 2L2IA 5HE3A 4KHAA 4A6KA 3NSUA 1OY2A 2DKQA 2MFQA 2YSZA 3DXDA 2DYNA 3ODXA 4YONA 3A8PA 2KCJA 3SV1A 2H7DA 2RLOA 2XQNM 1MAIA 3SYXA 3O96A 1MPHA 2D4QA 5KQ4A 2NZ8B 2DX1A 1P6SA 1U29A 4HDOA 3TVVA 3CIKA 1H10A 2Q13A 3FSSA 1XR0B 3DXCA 3P6AA 5C79A 1WGUA 3BINA 3AJ4A 4GXBA 5DHAB 1GG3A 4WJ7A 2M38A 4HAWB 1E5WA 2DKPA 3MPXA 2J0JA 3WA0A 2I5CA 1UNRA 2HTHB 4GZUA 1XODA 4HHVA 2VSZA 4GMVA 4HDQA 2VRWB 1Q67A 2CAYA 3TW1A 3D8FA 5J3TA 2LOZA 2E2XA 4ZRIA 2H7EA 1TQZA 1BWNA 4PQ0A 2GCJA 5KCVA 2LOXA 3PVWA 1WG7A 1V5PA 2D9VA 4HB4B 3QBVB 1M7RA 2ROVA 1MK9B 5FI0A 2P8VA 5LONB 2YS5A 1KI1B 5JLJB 3LJUX 2Z0OA 3SNHA 2YVCA 2W2XC 2G35A 2V76A 1Z87A 2RUKB 4D0NB 5CLLB 1X1FA 2ELAA 1NTVA 4L6EA 5JP4A 2M14A 2LKOA 3PG7A 4C0AA 3KRXA 4NSWA 3MDBC 1SGHA 3V5WA 2W2WA 1B55A 1U27A 4GMXB 1J0WA 2YT1A 3SUZA 5EFXA 1MKEA 1WI1A 2Z0QA 1ZM0A 1SHCA 4MY6A 4F7GA 1X1GA 2GS0A 3ODWA 3CXBB 1XCGA 2K2UA 4WSFA 1DYNA 4A6FA 2QKLA 5FI1A 2D9ZA 4A5KA 1TXDA 2J0KA 3G9WA 1EGXA 1DDVA 4KVGB 2KGXB 4CHMA 4EKUA 2CY5A 1MK7B 1KZ7A 2CY4A 2ZPYA 3FM8C 2YRYA 4F7HA 3AU5A 4H8SA 2ADZA 3WYFB 1P3RA 4K2PA 4DX8A 1X05A 4IAPA 2GJYA 4ZRJA 5C5BB 2RSGA 5J3QA 4HB2B 2BCJA 1U5DA 1FAOA 1ZC4B 2MDXA 1ZVRA 2I1KA 1M7EA 1FHOA 3P7ZA 2D2QA 2NMBA 2RVBB 5GOWB 5DI9B 2EMSA 2DHJA 2Z0PA 2UZSA 2COAA 2DTCA 4HAZB 3VIAA 1BAKA 4K81A 5D3YA 4HAUB 3BJIA 2IFSA 2YS3A 4XWXA 4EJNA 1UPQA 4NY0A 2EJ8A 5LOPB 3D8DA 2AL6A 4CHJA 4KAXB 1GC6A 1K5DB 2YS1A 3KY9A 4IFSA 2DLWA 2OQBA 1FHWA 3D8EA 5HE2A 4DX90 1W1DA 2VKIA 1U5EA 3PZDA 3TO1A 5C16A 2UVMA 1TJ6A 2OTXA 2ROZB 2COCA 5DHFB 1J19A 3KSYA 4DXAB 3TCAA 3DXEA 3FEHA 3ULBA 1EAZA 2MKRA 1K5GB 2R09A 3KRWA 3UZTA 4P7IA 3SO6A 1I2HA 4IOYX 4CYEA 1EVHA 2I1JA 3KZ1A 1DBHA 1NI2A 2ELBA 4HB3B 1ISNA 3VOQA 3RCPA 5HE1A 1H4RA 4TYZA 1V61A 3PVLA 3PVUA 2DYQA 5J3YA 1U2BA 2DA0A 1AWEA 4HAYB 5C6RA 1PMSA 3GYOA 1NTYA 1KZGA 3ZDTA 1PLSA 2P0HA 3N7CA 1W1HA 1DDMA 1I7AA 3F5RA 2P0FA 1V89A 2D9WA 2UZRA 3QIJA 4K2OA 2R0DA 4A6HA 4WVFB 2DFKA 2P0DA 4KHBB 1W1GA 5CLQB 4HB0B 2RGNB 1P5TA 1LW3A 4HAXB 1RRPB 3QWMA 4HATB 1V88A 2N0YA 2CRFA 1XD4A 4Y94A 1UEFA 3PEGA 1UNQA 5D3WA 4PNKA 3PSCA 2COFA 1BTNA 4B6HA 4Z2NA 2JP2A 1UPRA 1IRSA 2D11A 2I5FA 3X23A 5D27A 1MIXA 1PFJA 3HW2B 5JHHA 2D9XA 2MWNB 3F0WA 1QC6A 5D3XA 4YL8A 1V5UA 5HE0A 5DIFB 1WVHA 4HAVB 1WJMA 4MT7A 5DH9B 3A98B 2Y8FA 2LG1A 1NU2A 1V5MA 2DN6A 1AQCA 4GPTB 1DDWA 2DX5A 1ZC3B 2D10A 3GYPA 1BTKA 1XX0A 2GCLA 4MK0A 1RJ2A 3ODOA 3U8ZA 1X11A 1FGYA 2KUPA 3HK0A 4A6FB 1FOEA 5D3VA 2LYDA 2J0MA 5KQ1A 2HE7A 2EC1A 1WJ1A 1U5FA 2K2JA 3U7DA 1N3HA 2DHKA 2Y8GA 1FB8A 4K17A 4KHOA 3IVFA 1U5GA 1Y5OA 1WGQA 3M1IB 1DROA 3ZVRA 1Y19B 2AEHA 1FHXA 3TFMA 4TKNA 2FJLA 2PZ1A 4Z2MB 2X18A 1LB1A 5C5BA 3AU4A 1MIZB 1ZSQA 4BBKA 4EMOA 4DBBA 1EF1A 3HQCA 2CODA 2D9YA 1QQGA 3ULCA 2YF0A 2J59M 3ML4A 2EMTA 2LULA 1OQNA 2DHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  1XKE A;  2RNR B;  1OMW A;  4GN1 A;  2K00 A;  3OAN A;  5JHG A;  2Y7B A;  4F7U P;  2W2X D;  1FGZ A;  5L81 A;  3T06 A;  1UNP A;  2L1C A;  2YT0 A;  3A8Q A;  4ZRK A;  3PP2 A;  1GC7 A;  2N23 A;  2QKM A;  2IYB A;  2L2I A;  5HE3 A;  4KHA A;  4A6K A;  3NSU A;  1OY2 A;  2DKQ A;  2MFQ A;  2YSZ A;  3DXD A;  2DYN A;  3ODX A;  4YON A;  3A8P A;  2KCJ A;  3SV1 A;  2H7D A;  2RLO A;  2XQN M;  1MAI A;  3SYX A;  3O96 A;  1MPH A;  2D4Q A;  5KQ4 A;  2NZ8 B;  2DX1 A;  1P6S A;  1U29 A;  4HDO A;  3TVV A;  3CIK A;  1H10 A;  2Q13 A;  3FSS A;  1XR0 B;  3DXC A;  3P6A A;  5C79 A;  1WGU A;  3BIN A;  3AJ4 A;  4GXB A;  5DHA B;  1GG3 A;  4WJ7 A;  2M38 A;  4HAW B;  1E5W A;  2DKP A;  3MPX A;  2J0J A;  3WA0 A;  2I5C A;  1UNR A;  2HTH B;  4GZU A;  1XOD A;  4HHV A;  2VSZ A;  4GMV A;  4HDQ A;  2VRW B;  1Q67 A;  2CAY A;  3TW1 A;  3D8F A;  5J3T A;  2LOZ A;  2E2X A;  4ZRI A;  2H7E A;  1TQZ A;  1BWN A;  4PQ0 A;  2GCJ A;  5KCV A;  2LOX A;  3PVW A;  1WG7 A;  1V5P A;  2D9V A;  4HB4 B;  3QBV B;  1M7R A;  2ROV A;  1MK9 B;  5FI0 A;  2P8V A;  5LON B;  2YS5 A;  1KI1 B;  5JLJ B;  3LJU X;  2Z0O A;  3SNH A;  2YVC A;  2W2X C;  2G35 A;  2V76 A;  1Z87 A;  2RUK B;  4D0N B;  5CLL B;  1X1F A;  2ELA A;  1NTV A;  4L6E A;  5JP4 A;  2M14 A;  2LKO A;  3PG7 A;  4C0A A;  3KRX A;  4NSW A;  3MDB C;  1SGH A;  3V5W A;  2W2W A;  1B55 A;  1U27 A;  4GMX B;  1J0W A;  2YT1 A;  3SUZ A;  5EFX A;  1MKE A;  1WI1 A;  2Z0Q A;  1ZM0 A;  1SHC A;  4MY6 A;  4F7G A;  1X1G A;  2GS0 A;  3ODW A;  3CXB B;  1XCG A;  2K2U A;  4WSF A;  1DYN A;  4A6F A;  2QKL A;  5FI1 A;  2D9Z A;  4A5K A;  1TXD A;  2J0K A;  3G9W A;  1EGX A;  1DDV A;  4KVG B;  2KGX B;  4CHM A;  4EKU A;  2CY5 A;  1MK7 B;  1KZ7 A;  2CY4 A;  2ZPY A;  3FM8 C;  2YRY A;  4F7H A;  3AU5 A;  4H8S A;  2ADZ A;  3WYF B;  1P3R A;  4K2P A;  4DX8 A;  1X05 A;  4IAP A;  2GJY A;  4ZRJ A;  5C5B B;  2RSG A;  5J3Q A;  4HB2 B;  2BCJ A;  1U5D A;  1FAO A;  1ZC4 B;  2MDX A;  1ZVR A;  2I1K A;  1M7E A;  1FHO A;  3P7Z A;  2D2Q A;  2NMB A;  2RVB B;  5GOW B;  5DI9 B;  2EMS A;  2DHJ A;  2Z0P A;  2UZS A;  2COA A;  2DTC A;  4HAZ B;  3VIA A;  1BAK A;  4K81 A;  5D3Y A;  4HAU B;  3BJI A;  2IFS A;  2YS3 A;  4XWX A;  4EJN A;  1UPQ A;  4NY0 A;  2EJ8 A;  5LOP B;  3D8D A;  2AL6 A;  4CHJ A;  4KAX B;  1GC6 A;  1K5D B;  2YS1 A;  3KY9 A;  4IFS A;  2DLW A;  2OQB A;  1FHW A;  3D8E A;  5HE2 A;  4DX9 0;  1W1D A;  2VKI A;  1U5E A;  3PZD A;  3TO1 A;  5C16 A;  2UVM A;  1TJ6 A;  2OTX A;  2ROZ B;  2COC A;  5DHF B;  1J19 A;  3KSY A;  4DXA B;  3TCA A;  3DXE A;  3FEH A;  3ULB A;  1EAZ A;  2MKR A;  1K5G B;  2R09 A;  3KRW A;  3UZT A;  4P7I A;  3SO6 A;  1I2H A;  4IOY X;  4CYE A;  1EVH A;  2I1J A;  3KZ1 A;  1DBH A;  1NI2 A;  2ELB A;  4HB3 B;  1ISN A;  3VOQ A;  3RCP A;  5HE1 A;  1H4R A;  4TYZ A;  1V61 A;  3PVL A;  3PVU A;  2DYQ A;  5J3Y A;  1U2B A;  2DA0 A;  1AWE A;  4HAY B;  5C6R A;  1PMS A;  3GYO A;  1NTY A;  1KZG A;  3ZDT A;  1PLS A;  2P0H A;  3N7C A;  1W1H A;  1DDM A;  1I7A A;  3F5R A;  2P0F A;  1V89 A;  2D9W A;  2UZR A;  3QIJ A;  4K2O A;  2R0D A;  4A6H A;  4WVF B;  2DFK A;  2P0D A;  4KHB B;  1W1G A;  5CLQ B;  4HB0 B;  2RGN B;  1P5T A;  1LW3 A;  4HAX B;  1RRP B;  3QWM A;  4HAT B;  1V88 A;  2N0Y A;  2CRF A;  1XD4 A;  4Y94 A;  1UEF A;  3PEG A;  1UNQ A;  5D3W A;  4PNK A;  3PSC A;  2COF A;  1BTN A;  4B6H A;  4Z2N A;  2JP2 A;  1UPR A;  1IRS A;  2D11 A;  2I5F A;  3X23 A;  5D27 A;  1MIX A;  1PFJ A;  3HW2 B;  5JHH A;  2D9X A;  2MWN B;  3F0W A;  1QC6 A;  5D3X A;  4YL8 A;  1V5U A;  5HE0 A;  5DIF B;  1WVH A;  4HAV B;  1WJM A;  4MT7 A;  5DH9 B;  3A98 B;  2Y8F A;  2LG1 A;  1NU2 A;  1V5M A;  2DN6 A;  1AQC A;  4GPT B;  1DDW A;  2DX5 A;  1ZC3 B;  2D10 A;  3GYP A;  1BTK A;  1XX0 A;  2GCL A;  4MK0 A;  1RJ2 A;  3ODO A;  3U8Z A;  1X11 A;  1FGY A;  2KUP A;  3HK0 A;  4A6F B;  1FOE A;  5D3V A;  2LYD A;  2J0M A;  5KQ1 A;  2HE7 A;  2EC1 A;  1WJ1 A;  1U5F A;  2K2J A;  3U7D A;  1N3H A;  2DHK A;  2Y8G A;  1FB8 A;  4K17 A;  4KHO A;  3IVF A;  1U5G A;  1Y5O A;  1WGQ A;  3M1I B;  1DRO A;  3ZVR A;  1Y19 B;  2AEH A;  1FHX A;  3TFM A;  4TKN A;  2FJL A;  2PZ1 A;  4Z2M B;  2X18 A;  1LB1 A;  5C5B A;  3AU4 A;  1MIZ B;  1ZSQ A;  4BBK A;  4EMO A;  4DBB A;  1EF1 A;  3HQC A;  2COD A;  2D9Y A;  1QQG A;  3ULC A;  2YF0 A;  2J59 M;  3ML4 A;  2EMT A;  2LUL A;  1OQN A;  2DHI A; 
#chains in the Genus database with same CATH topology
 1X86 A;  1XKE A;  2RNR B;  1OMW A;  4GN1 A;  2K00 A;  3OHM B;  5IRS A;  3OAN A;  5JHG A;  2Y7B A;  4F7U P;  2W2X D;  1FGZ A;  5L81 A;  3T06 A;  1UNP A;  2L1C A;  2YT0 A;  3A8Q A;  4ZRK A;  3PP2 A;  1GC7 A;  2N23 A;  2QKM A;  2IYB A;  2L2I A;  5HE3 A;  4KHA A;  4A6K A;  3NSU A;  1OY2 A;  2DKQ A;  2MFQ A;  2YSZ A;  3DXD A;  2DYN A;  3ODX A;  4YON A;  3A8P A;  2KCJ A;  3SV1 A;  2H7D A;  2RLO A;  2XQN M;  1MAI A;  3SYX A;  3O96 A;  1MPH A;  2D4Q A;  2K49 A;  5KQ4 A;  2NZ8 B;  2DX1 A;  1P6S A;  1U29 A;  4HDO A;  3TVV A;  3CIK A;  1H10 A;  2Q13 A;  3FSS A;  1XR0 B;  3DXC A;  3P6A A;  5C79 A;  1WGU A;  3BIN A;  3AJ4 A;  4GXB A;  3FVC A;  5DHA B;  1GG3 A;  4WJ7 A;  2M38 A;  4HAW B;  1E5W A;  2DKP A;  3MPX A;  2J0J A;  3WA0 A;  2I5C A;  1UNR A;  2HTH B;  4GZU A;  1XOD A;  4HHV A;  2VSZ A;  4GMV A;  4HDQ A;  2VRW B;  1Q67 A;  2CAY A;  3TW1 A;  3D8F A;  5J3T A;  2LOZ A;  2E2X A;  4ZRI A;  2H7E A;  1TQZ A;  1BWN A;  4PQ0 A;  2GCJ A;  5KCV A;  2LOX A;  2ZKM X;  3PVW A;  1WG7 A;  1V5P A;  2D9V A;  4HB4 B;  3QBV B;  4KHB A;  1M7R A;  2ROV A;  1MK9 B;  5FI0 A;  2P8V A;  5LG4 B;  5LON B;  2GUM A;  2YS5 A;  1KI1 B;  5JLJ B;  3LJU X;  2Z0O A;  3SNH A;  3DCX A;  1T77 A;  2YVC A;  2W2X C;  2G35 A;  2V76 A;  1Z87 A;  4CSQ A;  2RRF A;  2RUK B;  4D0N B;  5CLL B;  1X1F A;  2ELA A;  1NTV A;  4L6E A;  5JP4 A;  4QJ5 B;  2M14 A;  2LKO A;  3PG7 A;  4C0A A;  5I2S A;  3KRX A;  4NSW A;  3MDB C;  1SGH A;  3V5W A;  2W2W A;  1B55 A;  1U27 A;  4GMX B;  1J0W A;  2YT1 A;  3SUZ A;  5EFX A;  1MKE A;  1WI1 A;  2Z0Q A;  1ZM0 A;  1SHC A;  4MY6 A;  4F7G A;  2KR0 A;  1X1G A;  2GS0 A;  3ODW A;  3CXB B;  1XCG A;  2K2U A;  4WSF A;  1DYN A;  4A6F A;  2QKL A;  3A58 A;  5FI1 A;  2D9Z A;  4A5K A;  1TXD A;  1ZYI A;  2J0K A;  3G9W A;  1EGX A;  1DDV A;  4KVG B;  2KGX B;  4CHM A;  5M4Y B;  4EKU A;  2CY5 A;  1MK7 B;  1KZ7 A;  2CY4 A;  2ZPY A;  3FM8 C;  2YRY A;  1MI1 A;  4F7H A;  3AU5 A;  4H8S A;  2ADZ A;  3WYF B;  2Z59 A;  1P3R A;  4K2P A;  4DX8 A;  1X05 A;  4IAP A;  2GJY A;  4ZRJ A;  5C5B B;  5I2M A;  2RSG A;  5J3Q A;  2YT2 A;  4HB2 B;  2BCJ A;  2Z4D A;  1U5D A;  1FAO A;  1ZC4 B;  2MDX A;  1ZVR A;  2I1K A;  1M7E A;  1FHO A;  3P7Z A;  2D2Q A;  2NMB A;  2RVB B;  5GOW B;  5DI9 B;  4GOU A;  2EMS A;  2DHJ A;  2Z0P A;  2UZS A;  2COA A;  2DTC A;  4HAZ B;  3VIA A;  1BAK A;  4K81 A;  5D3Y A;  4HAU B;  3BJI A;  2IFS A;  2YS3 A;  4XWX A;  4EJN A;  1UPQ A;  4NY0 A;  2EJ8 A;  5LOP B;  3D8D A;  2AL6 A;  4CHJ A;  4KAX B;  1GC6 A;  1K5D B;  2YS1 A;  3KY9 A;  4IFS A;  2DLW A;  2OQB A;  1FHW A;  2KIG A;  4DIX A;  3D8E A;  5HE2 A;  4DX9 0;  1W1D A;  2VKI A;  1U5E A;  3PZD A;  3TO1 A;  5C16 A;  2UVM A;  1TJ6 A;  2OTX A;  2ROZ B;  2COC A;  5DHF B;  1J19 A;  3KSY A;  4DXA B;  3TCA A;  3DXE A;  3FEH A;  3ULB A;  1EAZ A;  2MKR A;  1K5G B;  2R09 A;  3KRW A;  2R2Y A;  3UZT A;  4P7I A;  3SO6 A;  4GNK B;  1I2H A;  4IOY X;  4CYE A;  3B77 A;  1EVH A;  2I1J A;  3KZ1 A;  1DBH A;  1NI2 A;  2ELB A;  4HB3 B;  1ISN A;  3VOQ A;  3RCP A;  5HE1 A;  1H4R A;  4TYZ A;  1V61 A;  3NWF A;  3PVL A;  3PVU A;  2DYQ A;  5J3Y A;  1U2B A;  2DA0 A;  1AWE A;  4HAY B;  5C6R A;  1PMS A;  3GYO A;  1NTY A;  1KZG A;  3ZDT A;  4QXA B;  1PLS A;  2P0H A;  3N7C A;  1W1H A;  1DDM A;  1I7A A;  3F5R A;  2P0F A;  1V89 A;  2Z13 A;  3HIE A;  2D9W A;  2UZR A;  3QIJ A;  4K2O A;  2KIE A;  2R0D A;  4A6H A;  4WVF B;  2DFK A;  2P0D A;  4KHB B;  1W1G A;  5CLQ B;  4HB0 B;  2RGN B;  3NW8 A;  1P5T A;  3U12 A;  4D6W A;  1LW3 A;  4QJ4 B;  4HAX B;  1RRP B;  3QWM A;  4HAT B;  1V88 A;  2N0Y A;  2CRF A;  1XD4 A;  4Y94 A;  1UEF A;  3PEG A;  1UNQ A;  5D3W A;  4PNK A;  3PSC A;  2COF A;  1BTN A;  4B6H A;  4Z2N A;  2JP2 A;  1UPR A;  1IRS A;  2D11 A;  2I5F A;  3X23 A;  5D27 A;  1MIX A;  1PFJ A;  3HW2 B;  5JHH A;  2D9X A;  2MWN B;  3NWD A;  4L1R A;  3F0W A;  1QC6 A;  2FJU B;  5D3X A;  4YL8 A;  1V5U A;  5HE0 A;  5DIF B;  1WVH A;  4HAV B;  1WJM A;  4MT7 A;  5DH9 B;  3A98 B;  2Y8F A;  2Z14 A;  2LG1 A;  1NU2 A;  1V5M A;  2DN6 A;  1AQC A;  4GPT B;  1DDW A;  2DX5 A;  1ZC3 B;  2D10 A;  3GYP A;  1BTK A;  1XX0 A;  2K8E A;  2GCL A;  4MK0 A;  1RJ2 A;  3ODO A;  3U8Z A;  1X11 A;  1FGY A;  2KUP A;  3HK0 A;  4A6F B;  4QJ3 B;  1FOE A;  5D3V A;  2LYD A;  2J0M A;  5KQ1 A;  2HE7 A;  3HSA A;  2EC1 A;  1WJ1 A;  1U5F A;  3NWA A;  2K2J A;  3U7D A;  1N3H A;  2DHK A;  2Y8G A;  1FB8 A;  4K17 A;  4KHO A;  3IVF A;  1U5G A;  1Y5O A;  1WGQ A;  3M1I B;  1DRO A;  3ZVR A;  1Y19 B;  2AEH A;  1FHX A;  3TFM A;  4TKN A;  2FJL A;  2PZ1 A;  4OSN A;  4Z2M B;  2X18 A;  1LB1 A;  4HSI A;  2NBV A;  5C5B A;  3AU4 A;  1MIZ B;  1ZSQ A;  4BBK A;  4EMO A;  4DBB A;  1EF1 A;  3HQC A;  2COD A;  2D9Y A;  1QQG A;  3ULC A;  2YF0 A;  2J59 M;  3ML4 A;  2EMT A;  2KUQ A;  2LUL A;  4OT1 A;  1OQN A;  2DHI A; 
#chains in the Genus database with same CATH homology
 1X86 A;  1XKE A;  2RNR B;  1OMW A;  4GN1 A;  2K00 A;  3OAN A;  5JHG A;  2Y7B A;  4F7U P;  2W2X D;  1FGZ A;  5L81 A;  3T06 A;  1UNP A;  2L1C A;  2YT0 A;  3A8Q A;  4ZRK A;  3PP2 A;  1GC7 A;  2N23 A;  2QKM A;  2IYB A;  2L2I A;  5HE3 A;  4KHA A;  4A6K A;  3NSU A;  1OY2 A;  2DKQ A;  2MFQ A;  2YSZ A;  3DXD A;  2DYN A;  3ODX A;  4YON A;  3A8P A;  2KCJ A;  3SV1 A;  2H7D A;  2RLO A;  2XQN M;  1MAI A;  3SYX A;  3O96 A;  1MPH A;  2D4Q A;  5KQ4 A;  2NZ8 B;  2DX1 A;  1P6S A;  1U29 A;  4HDO A;  3TVV A;  3CIK A;  1H10 A;  2Q13 A;  3FSS A;  1XR0 B;  3DXC A;  3P6A A;  5C79 A;  1WGU A;  3BIN A;  3AJ4 A;  4GXB A;  5DHA B;  1GG3 A;  4WJ7 A;  2M38 A;  4HAW B;  1E5W A;  2DKP A;  3MPX A;  2J0J A;  3WA0 A;  2I5C A;  1UNR A;  2HTH B;  4GZU A;  1XOD A;  4HHV A;  2VSZ A;  4GMV A;  4HDQ A;  2VRW B;  1Q67 A;  2CAY A;  3TW1 A;  3D8F A;  5J3T A;  2LOZ A;  2E2X A;  4ZRI A;  2H7E A;  1TQZ A;  1BWN A;  4PQ0 A;  2GCJ A;  5KCV A;  2LOX A;  3PVW A;  1WG7 A;  1V5P A;  2D9V A;  4HB4 B;  3QBV B;  1M7R A;  2ROV A;  1MK9 B;  5FI0 A;  2P8V A;  5LON B;  2YS5 A;  1KI1 B;  5JLJ B;  3LJU X;  2Z0O A;  3SNH A;  2YVC A;  2W2X C;  2G35 A;  2V76 A;  1Z87 A;  2RUK B;  4D0N B;  5CLL B;  1X1F A;  2ELA A;  1NTV A;  4L6E A;  5JP4 A;  2M14 A;  2LKO A;  3PG7 A;  4C0A A;  3KRX A;  4NSW A;  3MDB C;  1SGH A;  3V5W A;  2W2W A;  1B55 A;  1U27 A;  4GMX B;  1J0W A;  2YT1 A;  3SUZ A;  5EFX A;  1MKE A;  1WI1 A;  2Z0Q A;  1ZM0 A;  1SHC A;  4MY6 A;  4F7G A;  1X1G A;  2GS0 A;  3ODW A;  3CXB B;  1XCG A;  2K2U A;  4WSF A;  1DYN A;  4A6F A;  2QKL A;  5FI1 A;  2D9Z A;  4A5K A;  1TXD A;  2J0K A;  3G9W A;  1EGX A;  1DDV A;  4KVG B;  2KGX B;  4CHM A;  4EKU A;  2CY5 A;  1MK7 B;  1KZ7 A;  2CY4 A;  2ZPY A;  3FM8 C;  2YRY A;  4F7H A;  3AU5 A;  4H8S A;  2ADZ A;  3WYF B;  1P3R A;  4K2P A;  4DX8 A;  1X05 A;  4IAP A;  2GJY A;  4ZRJ A;  5C5B B;  2RSG A;  5J3Q A;  4HB2 B;  2BCJ A;  1U5D A;  1FAO A;  1ZC4 B;  2MDX A;  1ZVR A;  2I1K A;  1M7E A;  1FHO A;  3P7Z A;  2D2Q A;  2NMB A;  2RVB B;  5GOW B;  5DI9 B;  2EMS A;  2DHJ A;  2Z0P A;  2UZS A;  2COA A;  2DTC A;  4HAZ B;  3VIA A;  1BAK A;  4K81 A;  5D3Y A;  4HAU B;  3BJI A;  2IFS A;  2YS3 A;  4XWX A;  4EJN A;  1UPQ A;  4NY0 A;  2EJ8 A;  5LOP B;  3D8D A;  2AL6 A;  4CHJ A;  4KAX B;  1GC6 A;  1K5D B;  2YS1 A;  3KY9 A;  4IFS A;  2DLW A;  2OQB A;  1FHW A;  3D8E A;  5HE2 A;  4DX9 0;  1W1D A;  2VKI A;  1U5E A;  3PZD A;  3TO1 A;  5C16 A;  2UVM A;  1TJ6 A;  2OTX A;  2ROZ B;  2COC A;  5DHF B;  1J19 A;  3KSY A;  4DXA B;  3TCA A;  3DXE A;  3FEH A;  3ULB A;  1EAZ A;  2MKR A;  1K5G B;  2R09 A;  3KRW A;  3UZT A;  4P7I A;  3SO6 A;  1I2H A;  4IOY X;  4CYE A;  1EVH A;  2I1J A;  3KZ1 A;  1DBH A;  1NI2 A;  2ELB A;  4HB3 B;  1ISN A;  3VOQ A;  3RCP A;  5HE1 A;  1H4R A;  4TYZ A;  1V61 A;  3PVL A;  3PVU A;  2DYQ A;  5J3Y A;  1U2B A;  2DA0 A;  1AWE A;  4HAY B;  5C6R A;  1PMS A;  3GYO A;  1NTY A;  1KZG A;  3ZDT A;  1PLS A;  2P0H A;  3N7C A;  1W1H A;  1DDM A;  1I7A A;  3F5R A;  2P0F A;  1V89 A;  2D9W A;  2UZR A;  3QIJ A;  4K2O A;  2R0D A;  4A6H A;  4WVF B;  2DFK A;  2P0D A;  4KHB B;  1W1G A;  5CLQ B;  4HB0 B;  2RGN B;  1P5T A;  1LW3 A;  4HAX B;  1RRP B;  3QWM A;  4HAT B;  1V88 A;  2N0Y A;  2CRF A;  1XD4 A;  4Y94 A;  1UEF A;  3PEG A;  1UNQ A;  5D3W A;  4PNK A;  3PSC A;  2COF A;  1BTN A;  4B6H A;  4Z2N A;  2JP2 A;  1UPR A;  1IRS A;  2D11 A;  2I5F A;  3X23 A;  5D27 A;  1MIX A;  1PFJ A;  3HW2 B;  5JHH A;  2D9X A;  2MWN B;  3F0W A;  1QC6 A;  5D3X A;  4YL8 A;  1V5U A;  5HE0 A;  5DIF B;  1WVH A;  4HAV B;  1WJM A;  4MT7 A;  5DH9 B;  3A98 B;  2Y8F A;  2LG1 A;  1NU2 A;  1V5M A;  2DN6 A;  1AQC A;  4GPT B;  1DDW A;  2DX5 A;  1ZC3 B;  2D10 A;  3GYP A;  1BTK A;  1XX0 A;  2GCL A;  4MK0 A;  1RJ2 A;  3ODO A;  3U8Z A;  1X11 A;  1FGY A;  2KUP A;  3HK0 A;  4A6F B;  1FOE A;  5D3V A;  2LYD A;  2J0M A;  5KQ1 A;  2HE7 A;  2EC1 A;  1WJ1 A;  1U5F A;  2K2J A;  3U7D A;  1N3H A;  2DHK A;  2Y8G A;  1FB8 A;  4K17 A;  4KHO A;  3IVF A;  1U5G A;  1Y5O A;  1WGQ A;  3M1I B;  1DRO A;  3ZVR A;  1Y19 B;  2AEH A;  1FHX A;  3TFM A;  4TKN A;  2FJL A;  2PZ1 A;  4Z2M B;  2X18 A;  1LB1 A;  5C5B A;  3AU4 A;  1MIZ B;  1ZSQ A;  4BBK A;  4EMO A;  4DBB A;  1EF1 A;  3HQC A;  2COD A;  2D9Y A;  1QQG A;  3ULC A;  2YF0 A;  2J59 M;  3ML4 A;  2EMT A;  2LUL A;  1OQN A;  2DHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...