1MAIA

Structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVQGLRKIIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords PHOSPHOLIPASE C DELTA-1
publication title Structure of the high affinity complex of inositol trisphosphate with a phospholipase C pleckstrin homology domain.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 33
structure length 119
sequence length 119
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1996-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1maiA00
1X1FA 2V76A 1U5DA 3PEGA 3D8DA 1FHWA 5CLLB 3GYPA 2COFA 1QQGA 4DXAB 5J3QA 3DXCA 4GMVA 2DX5A 1FHOA 3TW1A 2DHIA 3PVLA 1NU2A 2Y7BA 1V5MA 4HAZB 1I2HA 2N23A 2Z0PA 3SO6A 4A6FB 4IFSA 3A98B 2CY4A 4GPTB 1J19A 1TJ6A 1W1HA 4HAYB 4YL8A 1LB1A 5LONB 2I1JA 4IAPA 3ODXA 1M7RA 1UPQA 4Y94A 1V5PA 5FI1A 1FOEA 4TKNA 1FAOA 1UPRA 2R09A 1I7AA 3MDBC 1M7EA 2ZPYA 4WSFA 2VRWB 4Z2NA 1U5FA 3QWMA 2RVBB 2OTXA 3TFMA 2RLOA 3ZDTA 5L81A 1Z87A 1ZC3B 4EKUA 3QIJA 3UZTA 1WGUA 1LW3A 2P0DA 2D9VA 4K17A 5DHFB 3WYFB 2D4QA 2H7EA 1BTNA 1WGQA 1EAZA 2LYDA 1N3HA 3T06A 1PFJA 1V88A 2EC1A 4ZRIA 1EGXA 1KZGA 2RUKB 1OQNA 4DX8A 2N0YA 3ULCA 3KRXA 1NTVA 3KY9A 2D10A 1FGYA 2BCJA 4CHMA 2L1CA 1XX0A 1PMSA 2LULA 1AQCA 2MWNB 3HK0A 5HE2A 2OQBA 5GOWB 2UZRA 4HAVB 2UZSA 4PQ0A 5C5BB 3WA0A 3U8ZA 3NSUA 3RCPA 2XQNM 2Z0QA 1RRPB 2I5FA 2K2UA 2VSZA 4F7GA 3GYOA 3PVUA 1Y19B 3OANA 5C79A 2K2JA 2GJYA 2UVMA 1WJ1A 1FHXA 1KI1B 1WVHA 2QKMA 1DBHA 2EMTA 3CIKA 1RJ2A 1J0WA 1X05A 2KUPA 1MIXA 2ELAA 1H10A 2YSZA 1K5GB 1V5UA 1NTYA 2COCA 2DX1A 3FEHA 4F7UP 2W2XC 3VIAA 4MT7A 4CHJA 2J0MA 4TYZA 1BAKA 1X1GA 1B55A 1TQZA 1H4RA 4WVFB 2YVCA 4K2OA 4HB3B 1UEFA 3TCAA 2D9ZA 1WJMA 4HDQA 2P8VA 5C5BA 1PLSA 5JLJB 4KHAA 2P0HA 4ZRJA 1EF1A 3KRWA 3SYXA 2D9XA 1MK9B 1ZC4B 4XWXA 1U2BA 2L2IA 3AU5A 2CAYA 2DTCA 4P7IA 4YONA 4KHBB 3O96A 2I1KA 3KSYA 3TO1A 5D3VA 1DYNA 3BINA 1P3RA 2NZ8B 1W1GA 4Z2MB 2I5CA 5D3WA 4NY0A 4K81A 3SNHA 1ISNA 2IYBA 3BJIA 3D8EA 1W1DA 2CODA 1ZVRA 1SHCA 4EMOA 1GC7A 4HHVA 3ML4A 4PNKA 4C0AA 2J59M 2DKQA 1DROA 1UNRA 5D3XA 4GN1A 1GC6A 1UNQA 3CXBB 1EVHA 1X11A 2GCLA 3FM8C 2CRFA 4HB0B 2IFSA 4HB4B 2YS3A 2QKLA 3ULBA 2RSGA 1IRSA 3F0WA 1K5DB 3QBVB 2YS1A 1QC6A 2EMSA 4A6FA 3A8QA 4IOYX 2LKOA 2MDXA 3VOQA 2PZ1A 1XCGA 4WJ7A 3D8FA 1MIZB 1P6SA 4H8SA 4CYEA 4DBBA 5HE3A 1UNPA 3U7DA 5J3TA 4KHOA 2P0FA 2CY5A 1DDWA 5CLQB 4B6HA 4A5KA 3ODOA 4MK0A 5JHGA 3AJ4A 3DXDA 2EJ8A 4HAUB 2JP2A 1X86A 5J3YA 3KZ1A 5KCVA 5C16A 2AEHA 3LJUX 5DH9B 2ADZA 3N7CA 5D3YA 2YS5A 5KQ4A 3P6AA 3ZVRA 1XKEA 2MKRA 2LOXA 2YF0A 2E2XA 1BWNA 2D9YA 2J0KA 2NMBA 5DHAB 4NSWA 1OY2A 5C6RA 2DHJA 2W2XD 2R0DA 2LG1A 1XD4A 5D27A 2DLWA 2Y8FA 1XR0B 2ROVA 2DYNA 2DHKA 3ODWA 1GG3A 1MK7B 2YT1A 4HAXB 2GCJA 4D0NB 1ZM0A 1U5EA 1U27A 3DXEA 1DDMA 3MPXA 5HE0A 1Y5OA 2COAA 3IVFA 2J0JA 2FJLA 2M14A 3A8PA 4HB2B 4L6EA 4A6HA 1WI1A 2D2QA 4K2PA 2Q13A 1MAIA 2AL6A 4KAXB 1Q67A 2Y8GA 3PSCA 3HW2B 5HE1A 4GMXB 2MFQA 1MKEA 2RNRB 3PVWA 5JHHA 3SV1A 3V5WA 2DFKA 5FI0A 1KZ7A 1NI2A 1ZSQA 2DN6A 2DYQA 4ZRKA 5JP4A 2M38A 2ELBA 5DI9B 1DDVA 2D11A 3SUZA 1V61A 2RGNB 3FSSA 1TXDA 1V89A 3TVVA 1AWEA 2KGXB 1XODA 2G35A 2YT0A 4HDOA 2K00A 1WG7A 3AU4A 3P7ZA 1BTKA 2D9WA 4HATB 4A6KA 3PG7A 1SGHA 1MPHA 2ROZB 1E5WA 5DIFB 3F5RA 5LOPB 4GZUA 1FB8A 1FGZA 2DA0A 2H7DA 1OMWA 1U5GA 4F7HA 3X23A 4BBKA 2LOZA 2HE7A 1U29A 5KQ1A 1P5TA 2X18A 3PZDA 4DX90 4KVGB 3HQCA 2W2WA 2HTHB 2DKPA 3M1IB 2VKIA 4GXBA 3G9WA 4MY6A 4HAWB 2Z0OA 4EJNA 2GS0A 2YRYA 5EFXA 3PP2A 2KCJA
chains in the Genus database with same CATH superfamily
1X1FA 2V76A 1U5DA 3PEGA 3D8DA 1FHWA 5CLLB 3GYPA 2COFA 1QQGA 4DXAB 5J3QA 3DXCA 4GMVA 2DX5A 1FHOA 3TW1A 2KIEA 2DHIA 3PVLA 4QJ5B 1NU2A 2Y7BA 1V5MA 4HAZB 1I2HA 1MI1A 2N23A 2Z0PA 3SO6A 4A6FB 4IFSA 3A98B 2CY4A 4GPTB 1J19A 1TJ6A 1W1HA 4HAYB 4YL8A 1LB1A 5LONB 2I1JA 2KIGA 4IAPA 3ODXA 1M7RA 1UPQA 4Y94A 1V5PA 5FI1A 1FOEA 4TKNA 1FAOA 1UPRA 2R09A 1I7AA 3MDBC 1M7EA 2ZPYA 4WSFA 2VRWB 4Z2NA 1U5FA 3QWMA 4OT1A 3HIEA 2RVBB 2OTXA 3TFMA 2RLOA 3ZDTA 5L81A 1Z87A 1ZC3B 4EKUA 3QIJA 3UZTA 1WGUA 1LW3A 2P0DA 2D9VA 4K17A 5DHFB 3WYFB 5LG4B 2D4QA 2H7EA 1BTNA 1WGQA 1EAZA 4OSNA 2LYDA 1N3HA 3T06A 1PFJA 1V88A 2EC1A 2Z14A 4ZRIA 1EGXA 1KZGA 2RUKB 1OQNA 4DX8A 2N0YA 3ULCA 3KRXA 4GNKB 1NTVA 3KY9A 2D10A 1FGYA 2BCJA 4CHMA 2L1CA 1XX0A 1PMSA 2LULA 1AQCA 2MWNB 3HK0A 5HE2A 2OQBA 5GOWB 2UZRA 4HAVB 2UZSA 4PQ0A 5C5BB 3WA0A 3U8ZA 3NSUA 3RCPA 2XQNM 2Z0QA 1RRPB 2I5FA 2K2UA 2VSZA 4F7GA 3GYOA 3PVUA 1Y19B 3OANA 5C79A 2K2JA 4DIXA 2GUMA 2GJYA 2UVMA 1WJ1A 1FHXA 1KI1B 1WVHA 2QKMA 1DBHA 2EMTA 3CIKA 1RJ2A 5IRSA 1J0WA 1X05A 2KUPA 1MIXA 1ZYIA 2ELAA 3NW8A 1H10A 2YSZA 1K5GB 2ZKMX 1V5UA 1NTYA 2COCA 2DX1A 3FEHA 4F7UP 2RRFA 2W2XC 3VIAA 4MT7A 4CHJA 2J0MA 4TYZA 1BAKA 1X1GA 5I2SA 1B55A 1TQZA 1H4RA 4WVFB 3HSAA 2YVCA 4K2OA 4L1RA 4HB3B 1UEFA 3TCAA 2D9ZA 1WJMA 4HDQA 2P8VA 5C5BA 1PLSA 5JLJB 4KHAA 1T77A 2P0HA 4ZRJA 1EF1A 3KRWA 3SYXA 2D9XA 1MK9B 1ZC4B 4XWXA 5M4YB 1U2BA 2L2IA 3AU5A 2CAYA 2DTCA 4P7IA 4YONA 4KHBB 3O96A 3DCXA 4QJ3B 2I1KA 3KSYA 3TO1A 5D3VA 1DYNA 3BINA 1P3RA 2Z4DA 2NZ8B 1W1GA 4Z2MB 2I5CA 5D3WA 4NY0A 4K81A 3NWFA 3SNHA 1ISNA 2IYBA 3BJIA 3D8EA 1W1DA 2CODA 1ZVRA 1SHCA 4EMOA 1GC7A 4HHVA 3ML4A 4PNKA 4C0AA 2J59M 2DKQA 1DROA 1UNRA 5D3XA 4GN1A 1GC6A 1UNQA 3CXBB 1EVHA 1X11A 2GCLA 3FM8C 2CRFA 4HB0B 2IFSA 4HB4B 2YS3A 2QKLA 3OHMB 3ULBA 2RSGA 1IRSA 3F0WA 1K5DB 3QBVB 2YS1A 1QC6A 2EMSA 4A6FA 3A8QA 4IOYX 2LKOA 2MDXA 3VOQA 2PZ1A 1XCGA 4WJ7A 3D8FA 1MIZB 1P6SA 4H8SA 4CYEA 4DBBA 5HE3A 1UNPA 3U7DA 5J3TA 4KHOA 2FJUB 2P0FA 2CY5A 1DDWA 5CLQB 4B6HA 4A5KA 3ODOA 4MK0A 5JHGA 3AJ4A 4HSIA 3DXDA 2EJ8A 4HAUB 2JP2A 1X86A 5J3YA 3KZ1A 5KCVA 5C16A 2AEHA 3LJUX 5DH9B 3A58A 2ADZA 3N7CA 5D3YA 2YS5A 2Z13A 5KQ4A 3P6AA 3ZVRA 1XKEA 2MKRA 2LOXA 2YF0A 2E2XA 3U12A 4QJ4B 1BWNA 2D9YA 2J0KA 2NMBA 5DHAB 4NSWA 1OY2A 5C6RA 2DHJA 2W2XD 2R0DA 2LG1A 1XD4A 2R2YA 5D27A 2DLWA 2Y8FA 1XR0B 2ROVA 2DYNA 2DHKA 3ODWA 1GG3A 1MK7B 2YT1A 4HAXB 2NBVA 2GCJA 4D0NB 1ZM0A 1U5EA 1U27A 3DXEA 1DDMA 3MPXA 5HE0A 1Y5OA 2COAA 3IVFA 2J0JA 2FJLA 2M14A 3A8PA 4HB2B 4L6EA 2KUQA 4A6HA 1WI1A 2D2QA 4K2PA 2Q13A 4D6WA 1MAIA 3NWDA 2AL6A 3NWAA 3B77A 4KAXB 3FVCA 1Q67A 2Y8GA 3PSCA 3HW2B 5HE1A 4GMXB 2MFQA 1MKEA 2RNRB 3PVWA 5JHHA 3SV1A 3V5WA 2DFKA 5FI0A 1KZ7A 1NI2A 1ZSQA 2DN6A 2DYQA 4ZRKA 5JP4A 2M38A 2ELBA 4KHBA 5DI9B 1DDVA 2D11A 3SUZA 1V61A 2RGNB 5I2MA 3FSSA 1TXDA 1V89A 3TVVA 1AWEA 2KGXB 2K8EA 1XODA 2G35A 2YT0A 4HDOA 2KR0A 2K00A 1WG7A 3AU4A 3P7ZA 1BTKA 2D9WA 4HATB 4A6KA 3PG7A 1SGHA 1MPHA 2ROZB 1E5WA 2K49A 5DIFB 3F5RA 4QXAB 5LOPB 4GZUA 1FB8A 1FGZA 2DA0A 2H7DA 1OMWA 1U5GA 4F7HA 3X23A 4BBKA 2LOZA 2HE7A 1U29A 5KQ1A 1P5TA 2Z59A 2X18A 3PZDA 4DX90 4KVGB 2YT2A 4GOUA 3HQCA 2W2WA 2HTHB 2DKPA 3M1IB 2VKIA 4CSQA 4GXBA 3G9WA 4MY6A 4HAWB 2Z0OA 4EJNA 2GS0A 2YRYA 5EFXA 3PP2A 2KCJA
chains in the Genus database with same CATH topology
1X1FA 2V76A 1U5DA 3PEGA 3D8DA 1FHWA 5CLLB 3GYPA 2COFA 1QQGA 4DXAB 5J3QA 3DXCA 4GMVA 2DX5A 1FHOA 3TW1A 2DHIA 3PVLA 1NU2A 2Y7BA 1V5MA 4HAZB 1I2HA 2N23A 2Z0PA 3SO6A 4A6FB 4IFSA 3A98B 2CY4A 4GPTB 1J19A 1TJ6A 1W1HA 4HAYB 4YL8A 1LB1A 5LONB 2I1JA 4IAPA 3ODXA 1M7RA 1UPQA 4Y94A 1V5PA 5FI1A 1FOEA 4TKNA 1FAOA 1UPRA 2R09A 1I7AA 3MDBC 1M7EA 2ZPYA 4WSFA 2VRWB 4Z2NA 1U5FA 3QWMA 2RVBB 2OTXA 3TFMA 2RLOA 3ZDTA 5L81A 1Z87A 1ZC3B 4EKUA 3QIJA 3UZTA 1WGUA 1LW3A 2P0DA 2D9VA 4K17A 5DHFB 3WYFB 2D4QA 2H7EA 1BTNA 1WGQA 1EAZA 2LYDA 1N3HA 3T06A 1PFJA 1V88A 2EC1A 4ZRIA 1EGXA 1KZGA 2RUKB 1OQNA 4DX8A 2N0YA 3ULCA 3KRXA 1NTVA 3KY9A 2D10A 1FGYA 2BCJA 4CHMA 2L1CA 1XX0A 1PMSA 2LULA 1AQCA 2MWNB 3HK0A 5HE2A 2OQBA 5GOWB 2UZRA 4HAVB 2UZSA 4PQ0A 5C5BB 3WA0A 3U8ZA 3NSUA 3RCPA 2XQNM 2Z0QA 1RRPB 2I5FA 2K2UA 2VSZA 4F7GA 3GYOA 3PVUA 1Y19B 3OANA 5C79A 2K2JA 2GJYA 2UVMA 1WJ1A 1FHXA 1KI1B 1WVHA 2QKMA 1DBHA 2EMTA 3CIKA 1RJ2A 1J0WA 1X05A 2KUPA 1MIXA 2ELAA 1H10A 2YSZA 1K5GB 1V5UA 1NTYA 2COCA 2DX1A 3FEHA 4F7UP 2W2XC 3VIAA 4MT7A 4CHJA 2J0MA 4TYZA 1BAKA 1X1GA 1B55A 1TQZA 1H4RA 4WVFB 2YVCA 4K2OA 4HB3B 1UEFA 3TCAA 2D9ZA 1WJMA 4HDQA 2P8VA 5C5BA 1PLSA 5JLJB 4KHAA 2P0HA 4ZRJA 1EF1A 3KRWA 3SYXA 2D9XA 1MK9B 1ZC4B 4XWXA 1U2BA 2L2IA 3AU5A 2CAYA 2DTCA 4P7IA 4YONA 4KHBB 3O96A 2I1KA 3KSYA 3TO1A 5D3VA 1DYNA 3BINA 1P3RA 2NZ8B 1W1GA 4Z2MB 2I5CA 5D3WA 4NY0A 4K81A 3SNHA 1ISNA 2IYBA 3BJIA 3D8EA 1W1DA 2CODA 1ZVRA 1SHCA 4EMOA 1GC7A 4HHVA 3ML4A 4PNKA 4C0AA 2J59M 2DKQA 1DROA 1UNRA 5D3XA 4GN1A 1GC6A 1UNQA 3CXBB 1EVHA 1X11A 2GCLA 3FM8C 2CRFA 4HB0B 2IFSA 4HB4B 2YS3A 2QKLA 3ULBA 2RSGA 1IRSA 3F0WA 1K5DB 3QBVB 2YS1A 1QC6A 2EMSA 4A6FA 3A8QA 4IOYX 2LKOA 2MDXA 3VOQA 2PZ1A 1XCGA 4WJ7A 3D8FA 1MIZB 1P6SA 4H8SA 4CYEA 4DBBA 5HE3A 1UNPA 3U7DA 5J3TA 4KHOA 2P0FA 2CY5A 1DDWA 5CLQB 4B6HA 4A5KA 3ODOA 4MK0A 5JHGA 3AJ4A 3DXDA 2EJ8A 4HAUB 2JP2A 1X86A 5J3YA 3KZ1A 5KCVA 5C16A 2AEHA 3LJUX 5DH9B 2ADZA 3N7CA 5D3YA 2YS5A 5KQ4A 3P6AA 3ZVRA 1XKEA 2MKRA 2LOXA 2YF0A 2E2XA 1BWNA 2D9YA 2J0KA 2NMBA 5DHAB 4NSWA 1OY2A 5C6RA 2DHJA 2W2XD 2R0DA 2LG1A 1XD4A 5D27A 2DLWA 2Y8FA 1XR0B 2ROVA 2DYNA 2DHKA 3ODWA 1GG3A 1MK7B 2YT1A 4HAXB 2GCJA 4D0NB 1ZM0A 1U5EA 1U27A 3DXEA 1DDMA 3MPXA 5HE0A 1Y5OA 2COAA 3IVFA 2J0JA 2FJLA 2M14A 3A8PA 4HB2B 4L6EA 4A6HA 1WI1A 2D2QA 4K2PA 2Q13A 1MAIA 2AL6A 4KAXB 1Q67A 2Y8GA 3PSCA 3HW2B 5HE1A 4GMXB 2MFQA 1MKEA 2RNRB 3PVWA 5JHHA 3SV1A 3V5WA 2DFKA 5FI0A 1KZ7A 1NI2A 1ZSQA 2DN6A 2DYQA 4ZRKA 5JP4A 2M38A 2ELBA 5DI9B 1DDVA 2D11A 3SUZA 1V61A 2RGNB 3FSSA 1TXDA 1V89A 3TVVA 1AWEA 2KGXB 1XODA 2G35A 2YT0A 4HDOA 2K00A 1WG7A 3AU4A 3P7ZA 1BTKA 2D9WA 4HATB 4A6KA 3PG7A 1SGHA 1MPHA 2ROZB 1E5WA 5DIFB 3F5RA 5LOPB 4GZUA 1FB8A 1FGZA 2DA0A 2H7DA 1OMWA 1U5GA 4F7HA 3X23A 4BBKA 2LOZA 2HE7A 1U29A 5KQ1A 1P5TA 2X18A 3PZDA 4DX90 4KVGB 3HQCA 2W2WA 2HTHB 2DKPA 3M1IB 2VKIA 4GXBA 3G9WA 4MY6A 4HAWB 2Z0OA 4EJNA 2GS0A 2YRYA 5EFXA 3PP2A 2KCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1F A;  2V76 A;  1U5D A;  3PEG A;  3D8D A;  1FHW A;  5CLL B;  3GYP A;  2COF A;  1QQG A;  4DXA B;  5J3Q A;  3DXC A;  4GMV A;  2DX5 A;  1FHO A;  3TW1 A;  2DHI A;  3PVL A;  1NU2 A;  2Y7B A;  1V5M A;  4HAZ B;  1I2H A;  2N23 A;  2Z0P A;  3SO6 A;  4A6F B;  4IFS A;  3A98 B;  2CY4 A;  4GPT B;  1J19 A;  1TJ6 A;  1W1H A;  4HAY B;  4YL8 A;  1LB1 A;  5LON B;  2I1J A;  4IAP A;  3ODX A;  1M7R A;  1UPQ A;  4Y94 A;  1V5P A;  5FI1 A;  1FOE A;  4TKN A;  1FAO A;  1UPR A;  2R09 A;  1I7A A;  3MDB C;  1M7E A;  2ZPY A;  4WSF A;  2VRW B;  4Z2N A;  1U5F A;  3QWM A;  2RVB B;  2OTX A;  3TFM A;  2RLO A;  3ZDT A;  5L81 A;  1Z87 A;  1ZC3 B;  4EKU A;  3QIJ A;  3UZT A;  1WGU A;  1LW3 A;  2P0D A;  2D9V A;  4K17 A;  5DHF B;  3WYF B;  2D4Q A;  2H7E A;  1BTN A;  1WGQ A;  1EAZ A;  2LYD A;  1N3H A;  3T06 A;  1PFJ A;  1V88 A;  2EC1 A;  4ZRI A;  1EGX A;  1KZG A;  2RUK B;  1OQN A;  4DX8 A;  2N0Y A;  3ULC A;  3KRX A;  1NTV A;  3KY9 A;  2D10 A;  1FGY A;  2BCJ A;  4CHM A;  2L1C A;  1XX0 A;  1PMS A;  2LUL A;  1AQC A;  2MWN B;  3HK0 A;  5HE2 A;  2OQB A;  5GOW B;  2UZR A;  4HAV B;  2UZS A;  4PQ0 A;  5C5B B;  3WA0 A;  3U8Z A;  3NSU A;  3RCP A;  2XQN M;  2Z0Q A;  1RRP B;  2I5F A;  2K2U A;  2VSZ A;  4F7G A;  3GYO A;  3PVU A;  1Y19 B;  3OAN A;  5C79 A;  2K2J A;  2GJY A;  2UVM A;  1WJ1 A;  1FHX A;  1KI1 B;  1WVH A;  2QKM A;  1DBH A;  2EMT A;  3CIK A;  1RJ2 A;  1J0W A;  1X05 A;  2KUP A;  1MIX A;  2ELA A;  1H10 A;  2YSZ A;  1K5G B;  1V5U A;  1NTY A;  2COC A;  2DX1 A;  3FEH A;  4F7U P;  2W2X C;  3VIA A;  4MT7 A;  4CHJ A;  2J0M A;  4TYZ A;  1BAK A;  1X1G A;  1B55 A;  1TQZ A;  1H4R A;  4WVF B;  2YVC A;  4K2O A;  4HB3 B;  1UEF A;  3TCA A;  2D9Z A;  1WJM A;  4HDQ A;  2P8V A;  5C5B A;  1PLS A;  5JLJ B;  4KHA A;  2P0H A;  4ZRJ A;  1EF1 A;  3KRW A;  3SYX A;  2D9X A;  1MK9 B;  1ZC4 B;  4XWX A;  1U2B A;  2L2I A;  3AU5 A;  2CAY A;  2DTC A;  4P7I A;  4YON A;  4KHB B;  3O96 A;  2I1K A;  3KSY A;  3TO1 A;  5D3V A;  1DYN A;  3BIN A;  1P3R A;  2NZ8 B;  1W1G A;  4Z2M B;  2I5C A;  5D3W A;  4NY0 A;  4K81 A;  3SNH A;  1ISN A;  2IYB A;  3BJI A;  3D8E A;  1W1D A;  2COD A;  1ZVR A;  1SHC A;  4EMO A;  1GC7 A;  4HHV A;  3ML4 A;  4PNK A;  4C0A A;  2J59 M;  2DKQ A;  1DRO A;  1UNR A;  5D3X A;  4GN1 A;  1GC6 A;  1UNQ A;  3CXB B;  1EVH A;  1X11 A;  2GCL A;  3FM8 C;  2CRF A;  4HB0 B;  2IFS A;  4HB4 B;  2YS3 A;  2QKL A;  3ULB A;  2RSG A;  1IRS A;  3F0W A;  1K5D B;  3QBV B;  2YS1 A;  1QC6 A;  2EMS A;  4A6F A;  3A8Q A;  4IOY X;  2LKO A;  2MDX A;  3VOQ A;  2PZ1 A;  1XCG A;  4WJ7 A;  3D8F A;  1MIZ B;  1P6S A;  4H8S A;  4CYE A;  4DBB A;  5HE3 A;  1UNP A;  3U7D A;  5J3T A;  4KHO A;  2P0F A;  2CY5 A;  1DDW A;  5CLQ B;  4B6H A;  4A5K A;  3ODO A;  4MK0 A;  5JHG A;  3AJ4 A;  3DXD A;  2EJ8 A;  4HAU B;  2JP2 A;  1X86 A;  5J3Y A;  3KZ1 A;  5KCV A;  5C16 A;  2AEH A;  3LJU X;  5DH9 B;  2ADZ A;  3N7C A;  5D3Y A;  2YS5 A;  5KQ4 A;  3P6A A;  3ZVR A;  1XKE A;  2MKR A;  2LOX A;  2YF0 A;  2E2X A;  1BWN A;  2D9Y A;  2J0K A;  2NMB A;  5DHA B;  4NSW A;  1OY2 A;  5C6R A;  2DHJ A;  2W2X D;  2R0D A;  2LG1 A;  1XD4 A;  5D27 A;  2DLW A;  2Y8F A;  1XR0 B;  2ROV A;  2DYN A;  2DHK A;  3ODW A;  1GG3 A;  1MK7 B;  2YT1 A;  4HAX B;  2GCJ A;  4D0N B;  1ZM0 A;  1U5E A;  1U27 A;  3DXE A;  1DDM A;  3MPX A;  5HE0 A;  1Y5O A;  2COA A;  3IVF A;  2J0J A;  2FJL A;  2M14 A;  3A8P A;  4HB2 B;  4L6E A;  4A6H A;  1WI1 A;  2D2Q A;  4K2P A;  2Q13 A;  1MAI A;  2AL6 A;  4KAX B;  1Q67 A;  2Y8G A;  3PSC A;  3HW2 B;  5HE1 A;  4GMX B;  2MFQ A;  1MKE A;  2RNR B;  3PVW A;  5JHH A;  3SV1 A;  3V5W A;  2DFK A;  5FI0 A;  1KZ7 A;  1NI2 A;  1ZSQ A;  2DN6 A;  2DYQ A;  4ZRK A;  5JP4 A;  2M38 A;  2ELB A;  5DI9 B;  1DDV A;  2D11 A;  3SUZ A;  1V61 A;  2RGN B;  3FSS A;  1TXD A;  1V89 A;  3TVV A;  1AWE A;  2KGX B;  1XOD A;  2G35 A;  2YT0 A;  4HDO A;  2K00 A;  1WG7 A;  3AU4 A;  3P7Z A;  1BTK A;  2D9W A;  4HAT B;  4A6K A;  3PG7 A;  1SGH A;  1MPH A;  2ROZ B;  1E5W A;  5DIF B;  3F5R A;  5LOP B;  4GZU A;  1FB8 A;  1FGZ A;  2DA0 A;  2H7D A;  1OMW A;  1U5G A;  4F7H A;  3X23 A;  4BBK A;  2LOZ A;  2HE7 A;  1U29 A;  5KQ1 A;  1P5T A;  2X18 A;  3PZD A;  4DX9 0;  4KVG B;  3HQC A;  2W2W A;  2HTH B;  2DKP A;  3M1I B;  2VKI A;  4GXB A;  3G9W A;  4MY6 A;  4HAW B;  2Z0O A;  4EJN A;  2GS0 A;  2YRY A;  5EFX A;  3PP2 A;  2KCJ A; 
#chains in the Genus database with same CATH topology
 1X1F A;  2V76 A;  1U5D A;  3PEG A;  3D8D A;  1FHW A;  5CLL B;  3GYP A;  2COF A;  1QQG A;  4DXA B;  5J3Q A;  3DXC A;  4GMV A;  2DX5 A;  1FHO A;  3TW1 A;  2KIE A;  2DHI A;  3PVL A;  4QJ5 B;  1NU2 A;  2Y7B A;  1V5M A;  4HAZ B;  1I2H A;  1MI1 A;  2N23 A;  2Z0P A;  3SO6 A;  4A6F B;  4IFS A;  3A98 B;  2CY4 A;  4GPT B;  1J19 A;  1TJ6 A;  1W1H A;  4HAY B;  4YL8 A;  1LB1 A;  5LON B;  2I1J A;  2KIG A;  4IAP A;  3ODX A;  1M7R A;  1UPQ A;  4Y94 A;  1V5P A;  5FI1 A;  1FOE A;  4TKN A;  1FAO A;  1UPR A;  2R09 A;  1I7A A;  3MDB C;  1M7E A;  2ZPY A;  4WSF A;  2VRW B;  4Z2N A;  1U5F A;  3QWM A;  4OT1 A;  3HIE A;  2RVB B;  2OTX A;  3TFM A;  2RLO A;  3ZDT A;  5L81 A;  1Z87 A;  1ZC3 B;  4EKU A;  3QIJ A;  3UZT A;  1WGU A;  1LW3 A;  2P0D A;  2D9V A;  4K17 A;  5DHF B;  3WYF B;  5LG4 B;  2D4Q A;  2H7E A;  1BTN A;  1WGQ A;  1EAZ A;  4OSN A;  2LYD A;  1N3H A;  3T06 A;  1PFJ A;  1V88 A;  2EC1 A;  2Z14 A;  4ZRI A;  1EGX A;  1KZG A;  2RUK B;  1OQN A;  4DX8 A;  2N0Y A;  3ULC A;  3KRX A;  4GNK B;  1NTV A;  3KY9 A;  2D10 A;  1FGY A;  2BCJ A;  4CHM A;  2L1C A;  1XX0 A;  1PMS A;  2LUL A;  1AQC A;  2MWN B;  3HK0 A;  5HE2 A;  2OQB A;  5GOW B;  2UZR A;  4HAV B;  2UZS A;  4PQ0 A;  5C5B B;  3WA0 A;  3U8Z A;  3NSU A;  3RCP A;  2XQN M;  2Z0Q A;  1RRP B;  2I5F A;  2K2U A;  2VSZ A;  4F7G A;  3GYO A;  3PVU A;  1Y19 B;  3OAN A;  5C79 A;  2K2J A;  4DIX A;  2GUM A;  2GJY A;  2UVM A;  1WJ1 A;  1FHX A;  1KI1 B;  1WVH A;  2QKM A;  1DBH A;  2EMT A;  3CIK A;  1RJ2 A;  5IRS A;  1J0W A;  1X05 A;  2KUP A;  1MIX A;  1ZYI A;  2ELA A;  3NW8 A;  1H10 A;  2YSZ A;  1K5G B;  2ZKM X;  1V5U A;  1NTY A;  2COC A;  2DX1 A;  3FEH A;  4F7U P;  2RRF A;  2W2X C;  3VIA A;  4MT7 A;  4CHJ A;  2J0M A;  4TYZ A;  1BAK A;  1X1G A;  5I2S A;  1B55 A;  1TQZ A;  1H4R A;  4WVF B;  3HSA A;  2YVC A;  4K2O A;  4L1R A;  4HB3 B;  1UEF A;  3TCA A;  2D9Z A;  1WJM A;  4HDQ A;  2P8V A;  5C5B A;  1PLS A;  5JLJ B;  4KHA A;  1T77 A;  2P0H A;  4ZRJ A;  1EF1 A;  3KRW A;  3SYX A;  2D9X A;  1MK9 B;  1ZC4 B;  4XWX A;  5M4Y B;  1U2B A;  2L2I A;  3AU5 A;  2CAY A;  2DTC A;  4P7I A;  4YON A;  4KHB B;  3O96 A;  3DCX A;  4QJ3 B;  2I1K A;  3KSY A;  3TO1 A;  5D3V A;  1DYN A;  3BIN A;  1P3R A;  2Z4D A;  2NZ8 B;  1W1G A;  4Z2M B;  2I5C A;  5D3W A;  4NY0 A;  4K81 A;  3NWF A;  3SNH A;  1ISN A;  2IYB A;  3BJI A;  3D8E A;  1W1D A;  2COD A;  1ZVR A;  1SHC A;  4EMO A;  1GC7 A;  4HHV A;  3ML4 A;  4PNK A;  4C0A A;  2J59 M;  2DKQ A;  1DRO A;  1UNR A;  5D3X A;  4GN1 A;  1GC6 A;  1UNQ A;  3CXB B;  1EVH A;  1X11 A;  2GCL A;  3FM8 C;  2CRF A;  4HB0 B;  2IFS A;  4HB4 B;  2YS3 A;  2QKL A;  3OHM B;  3ULB A;  2RSG A;  1IRS A;  3F0W A;  1K5D B;  3QBV B;  2YS1 A;  1QC6 A;  2EMS A;  4A6F A;  3A8Q A;  4IOY X;  2LKO A;  2MDX A;  3VOQ A;  2PZ1 A;  1XCG A;  4WJ7 A;  3D8F A;  1MIZ B;  1P6S A;  4H8S A;  4CYE A;  4DBB A;  5HE3 A;  1UNP A;  3U7D A;  5J3T A;  4KHO A;  2FJU B;  2P0F A;  2CY5 A;  1DDW A;  5CLQ B;  4B6H A;  4A5K A;  3ODO A;  4MK0 A;  5JHG A;  3AJ4 A;  4HSI A;  3DXD A;  2EJ8 A;  4HAU B;  2JP2 A;  1X86 A;  5J3Y A;  3KZ1 A;  5KCV A;  5C16 A;  2AEH A;  3LJU X;  5DH9 B;  3A58 A;  2ADZ A;  3N7C A;  5D3Y A;  2YS5 A;  2Z13 A;  5KQ4 A;  3P6A A;  3ZVR A;  1XKE A;  2MKR A;  2LOX A;  2YF0 A;  2E2X A;  3U12 A;  4QJ4 B;  1BWN A;  2D9Y A;  2J0K A;  2NMB A;  5DHA B;  4NSW A;  1OY2 A;  5C6R A;  2DHJ A;  2W2X D;  2R0D A;  2LG1 A;  1XD4 A;  2R2Y A;  5D27 A;  2DLW A;  2Y8F A;  1XR0 B;  2ROV A;  2DYN A;  2DHK A;  3ODW A;  1GG3 A;  1MK7 B;  2YT1 A;  4HAX B;  2NBV A;  2GCJ A;  4D0N B;  1ZM0 A;  1U5E A;  1U27 A;  3DXE A;  1DDM A;  3MPX A;  5HE0 A;  1Y5O A;  2COA A;  3IVF A;  2J0J A;  2FJL A;  2M14 A;  3A8P A;  4HB2 B;  4L6E A;  2KUQ A;  4A6H A;  1WI1 A;  2D2Q A;  4K2P A;  2Q13 A;  4D6W A;  1MAI A;  3NWD A;  2AL6 A;  3NWA A;  3B77 A;  4KAX B;  3FVC A;  1Q67 A;  2Y8G A;  3PSC A;  3HW2 B;  5HE1 A;  4GMX B;  2MFQ A;  1MKE A;  2RNR B;  3PVW A;  5JHH A;  3SV1 A;  3V5W A;  2DFK A;  5FI0 A;  1KZ7 A;  1NI2 A;  1ZSQ A;  2DN6 A;  2DYQ A;  4ZRK A;  5JP4 A;  2M38 A;  2ELB A;  4KHB A;  5DI9 B;  1DDV A;  2D11 A;  3SUZ A;  1V61 A;  2RGN B;  5I2M A;  3FSS A;  1TXD A;  1V89 A;  3TVV A;  1AWE A;  2KGX B;  2K8E A;  1XOD A;  2G35 A;  2YT0 A;  4HDO A;  2KR0 A;  2K00 A;  1WG7 A;  3AU4 A;  3P7Z A;  1BTK A;  2D9W A;  4HAT B;  4A6K A;  3PG7 A;  1SGH A;  1MPH A;  2ROZ B;  1E5W A;  2K49 A;  5DIF B;  3F5R A;  4QXA B;  5LOP B;  4GZU A;  1FB8 A;  1FGZ A;  2DA0 A;  2H7D A;  1OMW A;  1U5G A;  4F7H A;  3X23 A;  4BBK A;  2LOZ A;  2HE7 A;  1U29 A;  5KQ1 A;  1P5T A;  2Z59 A;  2X18 A;  3PZD A;  4DX9 0;  4KVG B;  2YT2 A;  4GOU A;  3HQC A;  2W2W A;  2HTH B;  2DKP A;  3M1I B;  2VKI A;  4CSQ A;  4GXB A;  3G9W A;  4MY6 A;  4HAW B;  2Z0O A;  4EJN A;  2GS0 A;  2YRY A;  5EFX A;  3PP2 A;  2KCJ A; 
#chains in the Genus database with same CATH homology
 1X1F A;  2V76 A;  1U5D A;  3PEG A;  3D8D A;  1FHW A;  5CLL B;  3GYP A;  2COF A;  1QQG A;  4DXA B;  5J3Q A;  3DXC A;  4GMV A;  2DX5 A;  1FHO A;  3TW1 A;  2DHI A;  3PVL A;  1NU2 A;  2Y7B A;  1V5M A;  4HAZ B;  1I2H A;  2N23 A;  2Z0P A;  3SO6 A;  4A6F B;  4IFS A;  3A98 B;  2CY4 A;  4GPT B;  1J19 A;  1TJ6 A;  1W1H A;  4HAY B;  4YL8 A;  1LB1 A;  5LON B;  2I1J A;  4IAP A;  3ODX A;  1M7R A;  1UPQ A;  4Y94 A;  1V5P A;  5FI1 A;  1FOE A;  4TKN A;  1FAO A;  1UPR A;  2R09 A;  1I7A A;  3MDB C;  1M7E A;  2ZPY A;  4WSF A;  2VRW B;  4Z2N A;  1U5F A;  3QWM A;  2RVB B;  2OTX A;  3TFM A;  2RLO A;  3ZDT A;  5L81 A;  1Z87 A;  1ZC3 B;  4EKU A;  3QIJ A;  3UZT A;  1WGU A;  1LW3 A;  2P0D A;  2D9V A;  4K17 A;  5DHF B;  3WYF B;  2D4Q A;  2H7E A;  1BTN A;  1WGQ A;  1EAZ A;  2LYD A;  1N3H A;  3T06 A;  1PFJ A;  1V88 A;  2EC1 A;  4ZRI A;  1EGX A;  1KZG A;  2RUK B;  1OQN A;  4DX8 A;  2N0Y A;  3ULC A;  3KRX A;  1NTV A;  3KY9 A;  2D10 A;  1FGY A;  2BCJ A;  4CHM A;  2L1C A;  1XX0 A;  1PMS A;  2LUL A;  1AQC A;  2MWN B;  3HK0 A;  5HE2 A;  2OQB A;  5GOW B;  2UZR A;  4HAV B;  2UZS A;  4PQ0 A;  5C5B B;  3WA0 A;  3U8Z A;  3NSU A;  3RCP A;  2XQN M;  2Z0Q A;  1RRP B;  2I5F A;  2K2U A;  2VSZ A;  4F7G A;  3GYO A;  3PVU A;  1Y19 B;  3OAN A;  5C79 A;  2K2J A;  2GJY A;  2UVM A;  1WJ1 A;  1FHX A;  1KI1 B;  1WVH A;  2QKM A;  1DBH A;  2EMT A;  3CIK A;  1RJ2 A;  1J0W A;  1X05 A;  2KUP A;  1MIX A;  2ELA A;  1H10 A;  2YSZ A;  1K5G B;  1V5U A;  1NTY A;  2COC A;  2DX1 A;  3FEH A;  4F7U P;  2W2X C;  3VIA A;  4MT7 A;  4CHJ A;  2J0M A;  4TYZ A;  1BAK A;  1X1G A;  1B55 A;  1TQZ A;  1H4R A;  4WVF B;  2YVC A;  4K2O A;  4HB3 B;  1UEF A;  3TCA A;  2D9Z A;  1WJM A;  4HDQ A;  2P8V A;  5C5B A;  1PLS A;  5JLJ B;  4KHA A;  2P0H A;  4ZRJ A;  1EF1 A;  3KRW A;  3SYX A;  2D9X A;  1MK9 B;  1ZC4 B;  4XWX A;  1U2B A;  2L2I A;  3AU5 A;  2CAY A;  2DTC A;  4P7I A;  4YON A;  4KHB B;  3O96 A;  2I1K A;  3KSY A;  3TO1 A;  5D3V A;  1DYN A;  3BIN A;  1P3R A;  2NZ8 B;  1W1G A;  4Z2M B;  2I5C A;  5D3W A;  4NY0 A;  4K81 A;  3SNH A;  1ISN A;  2IYB A;  3BJI A;  3D8E A;  1W1D A;  2COD A;  1ZVR A;  1SHC A;  4EMO A;  1GC7 A;  4HHV A;  3ML4 A;  4PNK A;  4C0A A;  2J59 M;  2DKQ A;  1DRO A;  1UNR A;  5D3X A;  4GN1 A;  1GC6 A;  1UNQ A;  3CXB B;  1EVH A;  1X11 A;  2GCL A;  3FM8 C;  2CRF A;  4HB0 B;  2IFS A;  4HB4 B;  2YS3 A;  2QKL A;  3ULB A;  2RSG A;  1IRS A;  3F0W A;  1K5D B;  3QBV B;  2YS1 A;  1QC6 A;  2EMS A;  4A6F A;  3A8Q A;  4IOY X;  2LKO A;  2MDX A;  3VOQ A;  2PZ1 A;  1XCG A;  4WJ7 A;  3D8F A;  1MIZ B;  1P6S A;  4H8S A;  4CYE A;  4DBB A;  5HE3 A;  1UNP A;  3U7D A;  5J3T A;  4KHO A;  2P0F A;  2CY5 A;  1DDW A;  5CLQ B;  4B6H A;  4A5K A;  3ODO A;  4MK0 A;  5JHG A;  3AJ4 A;  3DXD A;  2EJ8 A;  4HAU B;  2JP2 A;  1X86 A;  5J3Y A;  3KZ1 A;  5KCV A;  5C16 A;  2AEH A;  3LJU X;  5DH9 B;  2ADZ A;  3N7C A;  5D3Y A;  2YS5 A;  5KQ4 A;  3P6A A;  3ZVR A;  1XKE A;  2MKR A;  2LOX A;  2YF0 A;  2E2X A;  1BWN A;  2D9Y A;  2J0K A;  2NMB A;  5DHA B;  4NSW A;  1OY2 A;  5C6R A;  2DHJ A;  2W2X D;  2R0D A;  2LG1 A;  1XD4 A;  5D27 A;  2DLW A;  2Y8F A;  1XR0 B;  2ROV A;  2DYN A;  2DHK A;  3ODW A;  1GG3 A;  1MK7 B;  2YT1 A;  4HAX B;  2GCJ A;  4D0N B;  1ZM0 A;  1U5E A;  1U27 A;  3DXE A;  1DDM A;  3MPX A;  5HE0 A;  1Y5O A;  2COA A;  3IVF A;  2J0J A;  2FJL A;  2M14 A;  3A8P A;  4HB2 B;  4L6E A;  4A6H A;  1WI1 A;  2D2Q A;  4K2P A;  2Q13 A;  1MAI A;  2AL6 A;  4KAX B;  1Q67 A;  2Y8G A;  3PSC A;  3HW2 B;  5HE1 A;  4GMX B;  2MFQ A;  1MKE A;  2RNR B;  3PVW A;  5JHH A;  3SV1 A;  3V5W A;  2DFK A;  5FI0 A;  1KZ7 A;  1NI2 A;  1ZSQ A;  2DN6 A;  2DYQ A;  4ZRK A;  5JP4 A;  2M38 A;  2ELB A;  5DI9 B;  1DDV A;  2D11 A;  3SUZ A;  1V61 A;  2RGN B;  3FSS A;  1TXD A;  1V89 A;  3TVV A;  1AWE A;  2KGX B;  1XOD A;  2G35 A;  2YT0 A;  4HDO A;  2K00 A;  1WG7 A;  3AU4 A;  3P7Z A;  1BTK A;  2D9W A;  4HAT B;  4A6K A;  3PG7 A;  1SGH A;  1MPH A;  2ROZ B;  1E5W A;  5DIF B;  3F5R A;  5LOP B;  4GZU A;  1FB8 A;  1FGZ A;  2DA0 A;  2H7D A;  1OMW A;  1U5G A;  4F7H A;  3X23 A;  4BBK A;  2LOZ A;  2HE7 A;  1U29 A;  5KQ1 A;  1P5T A;  2X18 A;  3PZD A;  4DX9 0;  4KVG B;  3HQC A;  2W2W A;  2HTH B;  2DKP A;  3M1I B;  2VKI A;  4GXB A;  3G9W A;  4MY6 A;  4HAW B;  2Z0O A;  4EJN A;  2GS0 A;  2YRY A;  5EFX A;  3PP2 A;  2KCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...