1DROA

Nmr structure of the cytoskeleton/signal transduction protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
b'GSGTGAGEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSDSTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-SPECTRIN
publication title Solution structure of the pleckstrin homology domain of Drosophila beta-spectrin.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cytoskeleton
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1995-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1droA00
3A98B 2V76A 1WGQA 1LB1A 3PG7A 5DIFB 3TVVA 1E5WA 1DROA 5JHGA 1U5FA 2M38A 1U29A 4KAXB 4HAVB 1BTKA 4ZRIA 2LG1A 2D9WA 2YS3A 2G35A 1KZGA 2DA0A 5D3VA 2D9ZA 1MK7B 3HK0A 4A5KA 1FHWA 2FJLA 3PSCA 5JHHA 4CYEA 2J59M 4CHMA 4EJNA 1RRPB 2EMSA 2D2QA 3A8QA 3TCAA 3GYPA 1V5UA 2CY5A 1X1GA 3CIKA 2UZRA 2DHIA 3AU5A 3QBVB 3WYFB 1MK9B 2VSZA 3OANA 1XR0B 2RUKB 1NTYA 2GS0A 3HQCA 2D9YA 2DN6A 4HDOA 2N0YA 1DBHA 2ROVA 5LONB 2H7EA 4IOYX 4YL8A 3MPXA 4YONA 1WI1A 4HDQA 3TFMA 1EF1A 2AL6A 3F5RA 4NSWA 1NTVA 1I2HA 1W1DA 1WGUA 3ZDTA 4B6HA 2GCJA 2J0MA 2RVBB 3SV1A 3TO1A 1P6SA 2LKOA 3FM8C 1H10A 2AEHA 5C16A 1IRSA 3G9WA 3SNHA 5KQ1A 1EVHA 1EGXA 3DXDA 1EAZA 5JLJB 2Y8GA 5J3TA 1ZVRA 5J3QA 2M14A 3ML4A 2MDXA 4C0AA 1XCGA 1Y19B 1GC6A 2Q13A 1N3HA 3AJ4A 4K2OA 4WVFB 4DBBA 5D3XA 1H4RA 1DDWA 4ZRJA 1XX0A 2Z0PA 4DXAB 1FHOA 1MPHA 3QWMA 4PNKA 1V88A 1MAIA 1DYNA 2CY4A 2COCA 2RGNB 2KCJA 2I1JA 4Z2MB 2K2UA 1OMWA 3PP2A 1KI1B 2XQNM 1M7RA 4K17A 3PEGA 2W2XC 1ZC3B 2OQBA 2QKMA 3LJUX 4MK0A 1UNRA 4A6KA 1V5MA 2K2JA 3D8EA 2IYBA 4IAPA 4H8SA 2YF0A 4GPTB 5CLQB 2QKLA 2DTCA 4A6FB 3ODOA 5C6RA 3GYOA 1X1FA 4P7IA 4MY6A 1I7AA 2LOXA 5C5BB 1DDMA 3KY9A 3MDBC 2K00A 3KZ1A 2ADZA 4K2PA 1AQCA 2KGXB 1FGZA 2LOZA 2H7DA 3RCPA 1FGYA 2I1KA 2YS5A 4WJ7A 1OY2A 3P6AA 5L81A 2VRWB 1WJMA 1Y5OA 3ODXA 4BBKA 1WG7A 2DYQA 2I5CA 2Z0QA 4HHVA 2UZSA 1UNQA 2P0FA 1OQNA 3QIJA 4A6FA 5JP4A 1J0WA 5GOWB 5D3YA 1K5GB 4HAZB 2ZPYA 4WSFA 3P7ZA 3PVUA 1P3RA 2NMBA 5C5BA 4HB0B 2PZ1A 3NSUA 4GMVA 2YSZA 2EC1A 1V89A 1W1HA 1FHXA 1XD4A 5FI0A 1V5PA 1J19A 1KZ7A 5KCVA 1NU2A 3PVWA 2HE7A 2COFA 4KHBB 2YVCA 2DYNA 4TKNA 4Y94A 2DHKA 3VIAA 1B55A 2IFSA 5HE0A 2EMTA 2JP2A 1UPQA 3ZVRA 1U5GA 2X18A 2CAYA 5C79A 1V61A 2MFQA 2UVMA 4HAXB 4HAUB 4CHJA 4GN1A 3ULBA 1ZC4B 3A8PA 2P8VA 2YRYA 2D9VA 2YS1A 2Z0OA 5D3WA 3D8FA 4HB4B 2D4QA 4XWXA 5J3YA 4KHAA 4D0NB 2R0DA 3N7CA 1X05A 1Q67A 1ZM0A 2YT1A 2YT0A 1X86A 3T06A 4ZRKA 1U5EA 3DXCA 2MKRA 3WA0A 4L6EA 2RNRB 1WVHA 2W2WA 1BAKA 1UEFA 1NI2A 4A6HA 2D10A 2DX5A 5D27A 5KQ4A 3PVLA 1U5DA 1BTNA 5FI1A 3SUZA 2ELAA 2Y7BA 2W2XD 4GXBA 2HTHB 5DHFB 5DI9B 1U2BA 3SO6A 4F7GA 5EFXA 1SGHA 1TQZA 4EMOA 2Y8FA 2DKPA 1UPRA 2DX1A 4IFSA 3ODWA 3O96A 2RSGA 4HB3B 5HE1A 2L1CA 5HE3A 1PLSA 1GC7A 5DHAB 1GG3A 2GCLA 4F7UP 3HW2B 1DDVA 4MT7A 3ULCA 2R09A 2CRFA 3KSYA 4HB2B 2LULA 2N23A 2ROZB 4GZUA 1QQGA 2LYDA 3AU4A 1RJ2A 2P0DA 1K5DB 1BWNA 4Z2NA 4KHOA 2KUPA 4TYZA 1U27A 1WJ1A 3FSSA 1P5TA 1QC6A 2DLWA 1UNPA 4HAYB 3X23A 1M7EA 1FB8A 2ELBA 1FOEA 2J0KA 5LOPB 2GJYA 1FAOA 1LW3A 3KRWA 4KVGB 2RLOA 3DXEA 5DH9B 4DX90 1TJ6A 3M1IB 4GMXB 3TW1A 2E2XA 3F0WA 4K81A 2OTXA 1AWEA 3BJIA 2BCJA 2CODA 1XODA 3PZDA 3U8ZA 1MIXA 1SHCA 4NY0A 2D9XA 4DX8A 3U7DA 2J0JA 2I5FA 3FEHA 2NZ8B 1ISNA 3V5WA 2DHJA 3SYXA 2EJ8A 4F7HA 2DKQA 1PMSA 1ZSQA 2MWNB 4HATB 3D8DA 3UZTA 2VKIA 1XKEA 2P0HA 1W1GA 4HAWB 1TXDA 3KRXA 4PQ0A 5HE2A 1PFJA 3IVFA 1X11A 3CXBB 1MIZB 1Z87A 3BINA 1MKEA 2DFKA 5CLLB 2COAA 2L2IA 4EKUA 3VOQA 2D11A
chains in the Genus database with same CATH superfamily
3A98B 2V76A 1WGQA 1LB1A 3PG7A 5DIFB 3TVVA 1E5WA 1DROA 5JHGA 1U5FA 3FVCA 2M38A 1U29A 4KAXB 4HAVB 1BTKA 4ZRIA 2LG1A 2D9WA 2YS3A 3A58A 2G35A 1KZGA 2DA0A 5D3VA 2D9ZA 1MK7B 3HK0A 4A5KA 1FHWA 2FJLA 3PSCA 5JHHA 4CYEA 2J59M 5LG4B 4CHMA 4EJNA 1RRPB 2EMSA 2D2QA 5M4YB 3A8QA 3TCAA 3GYPA 1V5UA 2CY5A 1X1GA 3CIKA 2UZRA 2DHIA 3AU5A 3QBVB 3WYFB 1MK9B 2ZKMX 2VSZA 3OANA 1XR0B 2RUKB 1NTYA 2GS0A 4L1RA 3HQCA 2D9YA 2DN6A 4HDOA 2N0YA 1DBHA 2ROVA 5LONB 2H7EA 4IOYX 4YL8A 3MPXA 4YONA 1WI1A 3B77A 4HDQA 3TFMA 1EF1A 2AL6A 3F5RA 4NSWA 1NTVA 1I2HA 1W1DA 4QXAB 1WGUA 3ZDTA 4B6HA 2GCJA 2J0MA 2RVBB 3SV1A 3TO1A 1P6SA 2LKOA 3FM8C 1H10A 2AEHA 5C16A 1IRSA 3G9WA 3SNHA 5KQ1A 1EVHA 1EGXA 3DXDA 1EAZA 5JLJB 2Y8GA 4HSIA 5J3TA 1ZVRA 5J3QA 2M14A 3ML4A 2MDXA 4C0AA 1XCGA 1Y19B 1GC6A 2Q13A 3U12A 1N3HA 2KR0A 3AJ4A 4K2OA 4WVFB 4DBBA 5D3XA 1H4RA 1DDWA 4ZRJA 1XX0A 2Z0PA 4DXAB 1FHOA 2K49A 1MPHA 3QWMA 4PNKA 1V88A 1MAIA 2K8EA 1DYNA 2CY4A 2COCA 2RGNB 2KCJA 2I1JA 4Z2MB 2K2UA 1OMWA 3PP2A 1KI1B 2XQNM 1M7RA 3NWAA 4K17A 3PEGA 4CSQA 2W2XC 1ZC3B 2OQBA 2QKMA 3LJUX 4MK0A 1UNRA 4A6KA 1V5MA 2K2JA 3D8EA 2IYBA 4IAPA 3NWFA 4H8SA 2YF0A 4GPTB 4D6WA 5CLQB 2QKLA 2DTCA 4A6FB 3ODOA 5C6RA 3GYOA 1X1FA 4P7IA 2KIGA 4MY6A 1I7AA 2LOXA 5C5BB 1DDMA 3KY9A 3MDBC 2K00A 3KZ1A 2ADZA 4K2PA 1AQCA 2KGXB 1FGZA 2NBVA 2LOZA 2H7DA 3RCPA 1FGYA 2I1KA 2YS5A 4WJ7A 1OY2A 3P6AA 5L81A 2VRWB 1WJMA 1Y5OA 3ODXA 4BBKA 1WG7A 2DYQA 2I5CA 2Z0QA 4HHVA 2UZSA 1UNQA 2P0FA 1OQNA 2Z59A 3QIJA 4A6FA 1J0WA 5GOWB 5JP4A 5D3YA 1K5GB 4HAZB 2ZPYA 4WSFA 2YT2A 3P7ZA 3PVUA 1P3RA 2NMBA 5C5BA 4HB0B 2KUQA 4QJ5B 2PZ1A 3NSUA 4GMVA 2YSZA 2EC1A 1V89A 1W1HA 1FHXA 1XD4A 5FI0A 1V5PA 1J19A 1KZ7A 5KCVA 2KIEA 1NU2A 3PVWA 2HE7A 1MI1A 2COFA 4KHBB 2YVCA 2DYNA 4TKNA 2RRFA 4Y94A 2DHKA 2GUMA 3VIAA 1B55A 2IFSA 5HE0A 2EMTA 2JP2A 1UPQA 3ZVRA 1U5GA 2X18A 2CAYA 5C79A 1V61A 2MFQA 2UVMA 4HAXB 4HAUB 4OSNA 4CHJA 4GN1A 3ULBA 1ZC4B 3A8PA 2P8VA 2YRYA 2D9VA 2YS1A 2Z0OA 4DIXA 5D3WA 3D8FA 4HB4B 2D4QA 4XWXA 5J3YA 4KHAA 4D0NB 2R0DA 4KHBA 1T77A 3N7CA 1X05A 1Q67A 1ZM0A 2YT1A 2YT0A 1X86A 3HSAA 3T06A 4ZRKA 1U5EA 3DXCA 2MKRA 3WA0A 4L6EA 2RNRB 1WVHA 2W2WA 1BAKA 1UEFA 1NI2A 4A6HA 2D10A 2DX5A 5D27A 5KQ4A 3PVLA 1U5DA 1BTNA 4GOUA 5FI1A 3SUZA 2ELAA 2Y7BA 2W2XD 4GXBA 2HTHB 5DHFB 5DI9B 1U2BA 3SO6A 4F7GA 5EFXA 1SGHA 1TQZA 4EMOA 2Y8FA 2DKPA 1UPRA 2DX1A 4IFSA 3ODWA 3O96A 2RSGA 4HB3B 2Z13A 5HE1A 2L1CA 5IRSA 5HE3A 4QJ4B 1PLSA 2Z4DA 1GC7A 5DHAB 1GG3A 2GCLA 4F7UP 3HW2B 1DDVA 4MT7A 3ULCA 2R09A 2CRFA 3KSYA 4HB2B 2LULA 2N23A 2ROZB 4GZUA 1QQGA 2LYDA 3AU4A 1RJ2A 2P0DA 1K5DB 3HIEA 5I2MA 1BWNA 3NW8A 4Z2NA 4KHOA 2KUPA 4TYZA 1U27A 1WJ1A 3FSSA 1P5TA 4GNKB 1QC6A 2Z14A 2DLWA 1UNPA 4HAYB 3X23A 3DCXA 1M7EA 1FB8A 2ELBA 1FOEA 2J0KA 5LOPB 2FJUB 1FAOA 2GJYA 1LW3A 3KRWA 4KVGB 2RLOA 3DXEA 5DH9B 4DX90 1TJ6A 1ZYIA 3M1IB 4OT1A 4GMXB 3TW1A 2E2XA 3F0WA 4K81A 2OTXA 1AWEA 3BJIA 2BCJA 3NWDA 2CODA 1XODA 3PZDA 3U8ZA 1MIXA 1SHCA 4NY0A 2D9XA 4DX8A 3U7DA 2J0JA 2I5FA 3OHMB 3FEHA 2NZ8B 1ISNA 3V5WA 2DHJA 3SYXA 2EJ8A 4F7HA 2DKQA 1PMSA 1ZSQA 2MWNB 4HATB 3D8DA 3UZTA 2VKIA 1XKEA 2P0HA 1W1GA 4HAWB 1TXDA 3KRXA 4PQ0A 5HE2A 1PFJA 2R2YA 3IVFA 4QJ3B 1X11A 3CXBB 1MIZB 1Z87A 3BINA 1MKEA 2DFKA 5CLLB 2COAA 2L2IA 4EKUA 3VOQA 5I2SA 2D11A
chains in the Genus database with same CATH topology
3A98B 2V76A 1WGQA 1LB1A 3PG7A 5DIFB 3TVVA 1E5WA 1DROA 5JHGA 1U5FA 2M38A 1U29A 4KAXB 4HAVB 1BTKA 4ZRIA 2LG1A 2D9WA 2YS3A 2G35A 1KZGA 2DA0A 5D3VA 2D9ZA 1MK7B 3HK0A 4A5KA 1FHWA 2FJLA 3PSCA 5JHHA 4CYEA 2J59M 4CHMA 4EJNA 1RRPB 2EMSA 2D2QA 3A8QA 3TCAA 3GYPA 1V5UA 2CY5A 1X1GA 3CIKA 2UZRA 2DHIA 3AU5A 3QBVB 3WYFB 1MK9B 2VSZA 3OANA 1XR0B 2RUKB 1NTYA 2GS0A 3HQCA 2D9YA 2DN6A 4HDOA 2N0YA 1DBHA 2ROVA 5LONB 2H7EA 4IOYX 4YL8A 3MPXA 4YONA 1WI1A 4HDQA 3TFMA 1EF1A 2AL6A 3F5RA 4NSWA 1NTVA 1I2HA 1W1DA 1WGUA 3ZDTA 4B6HA 2GCJA 2J0MA 2RVBB 3SV1A 3TO1A 1P6SA 2LKOA 3FM8C 1H10A 2AEHA 5C16A 1IRSA 3G9WA 3SNHA 5KQ1A 1EVHA 1EGXA 3DXDA 1EAZA 5JLJB 2Y8GA 5J3TA 1ZVRA 5J3QA 2M14A 3ML4A 2MDXA 4C0AA 1XCGA 1Y19B 1GC6A 2Q13A 1N3HA 3AJ4A 4K2OA 4WVFB 4DBBA 5D3XA 1H4RA 1DDWA 4ZRJA 1XX0A 2Z0PA 4DXAB 1FHOA 1MPHA 3QWMA 4PNKA 1V88A 1MAIA 1DYNA 2CY4A 2COCA 2RGNB 2KCJA 2I1JA 4Z2MB 2K2UA 1OMWA 3PP2A 1KI1B 2XQNM 1M7RA 4K17A 3PEGA 2W2XC 1ZC3B 2OQBA 2QKMA 3LJUX 4MK0A 1UNRA 4A6KA 1V5MA 2K2JA 3D8EA 2IYBA 4IAPA 4H8SA 2YF0A 4GPTB 5CLQB 2QKLA 2DTCA 4A6FB 3ODOA 5C6RA 3GYOA 1X1FA 4P7IA 4MY6A 1I7AA 2LOXA 5C5BB 1DDMA 3KY9A 3MDBC 2K00A 3KZ1A 2ADZA 4K2PA 1AQCA 2KGXB 1FGZA 2LOZA 2H7DA 3RCPA 1FGYA 2I1KA 2YS5A 4WJ7A 1OY2A 3P6AA 5L81A 2VRWB 1WJMA 1Y5OA 3ODXA 4BBKA 1WG7A 2DYQA 2I5CA 2Z0QA 4HHVA 2UZSA 1UNQA 2P0FA 1OQNA 3QIJA 4A6FA 5JP4A 1J0WA 5GOWB 5D3YA 1K5GB 4HAZB 2ZPYA 4WSFA 3P7ZA 3PVUA 1P3RA 2NMBA 5C5BA 4HB0B 2PZ1A 3NSUA 4GMVA 2YSZA 2EC1A 1V89A 1W1HA 1FHXA 1XD4A 5FI0A 1V5PA 1J19A 1KZ7A 5KCVA 1NU2A 3PVWA 2HE7A 2COFA 4KHBB 2YVCA 2DYNA 4TKNA 4Y94A 2DHKA 3VIAA 1B55A 2IFSA 5HE0A 2EMTA 2JP2A 1UPQA 3ZVRA 1U5GA 2X18A 2CAYA 5C79A 1V61A 2MFQA 2UVMA 4HAXB 4HAUB 4CHJA 4GN1A 3ULBA 1ZC4B 3A8PA 2P8VA 2YRYA 2D9VA 2YS1A 2Z0OA 5D3WA 3D8FA 4HB4B 2D4QA 4XWXA 5J3YA 4KHAA 4D0NB 2R0DA 3N7CA 1X05A 1Q67A 1ZM0A 2YT1A 2YT0A 1X86A 3T06A 4ZRKA 1U5EA 3DXCA 2MKRA 3WA0A 4L6EA 2RNRB 1WVHA 2W2WA 1BAKA 1UEFA 1NI2A 4A6HA 2D10A 2DX5A 5D27A 5KQ4A 3PVLA 1U5DA 1BTNA 5FI1A 3SUZA 2ELAA 2Y7BA 2W2XD 4GXBA 2HTHB 5DHFB 5DI9B 1U2BA 3SO6A 4F7GA 5EFXA 1SGHA 1TQZA 4EMOA 2Y8FA 2DKPA 1UPRA 2DX1A 4IFSA 3ODWA 3O96A 2RSGA 4HB3B 5HE1A 2L1CA 5HE3A 1PLSA 1GC7A 5DHAB 1GG3A 2GCLA 4F7UP 3HW2B 1DDVA 4MT7A 3ULCA 2R09A 2CRFA 3KSYA 4HB2B 2LULA 2N23A 2ROZB 4GZUA 1QQGA 2LYDA 3AU4A 1RJ2A 2P0DA 1K5DB 1BWNA 4Z2NA 4KHOA 2KUPA 4TYZA 1U27A 1WJ1A 3FSSA 1P5TA 1QC6A 2DLWA 1UNPA 4HAYB 3X23A 1M7EA 1FB8A 2ELBA 1FOEA 2J0KA 5LOPB 2GJYA 1FAOA 1LW3A 3KRWA 4KVGB 2RLOA 3DXEA 5DH9B 4DX90 1TJ6A 3M1IB 4GMXB 3TW1A 2E2XA 3F0WA 4K81A 2OTXA 1AWEA 3BJIA 2BCJA 2CODA 1XODA 3PZDA 3U8ZA 1MIXA 1SHCA 4NY0A 2D9XA 4DX8A 3U7DA 2J0JA 2I5FA 3FEHA 2NZ8B 1ISNA 3V5WA 2DHJA 3SYXA 2EJ8A 4F7HA 2DKQA 1PMSA 1ZSQA 2MWNB 4HATB 3D8DA 3UZTA 2VKIA 1XKEA 2P0HA 1W1GA 4HAWB 1TXDA 3KRXA 4PQ0A 5HE2A 1PFJA 3IVFA 1X11A 3CXBB 1MIZB 1Z87A 3BINA 1MKEA 2DFKA 5CLLB 2COAA 2L2IA 4EKUA 3VOQA 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A98 B;  2V76 A;  1WGQ A;  1LB1 A;  3PG7 A;  5DIF B;  3TVV A;  1E5W A;  1DRO A;  5JHG A;  1U5F A;  2M38 A;  1U29 A;  4KAX B;  4HAV B;  1BTK A;  4ZRI A;  2LG1 A;  2D9W A;  2YS3 A;  2G35 A;  1KZG A;  2DA0 A;  5D3V A;  2D9Z A;  1MK7 B;  3HK0 A;  4A5K A;  1FHW A;  2FJL A;  3PSC A;  5JHH A;  4CYE A;  2J59 M;  4CHM A;  4EJN A;  1RRP B;  2EMS A;  2D2Q A;  3A8Q A;  3TCA A;  3GYP A;  1V5U A;  2CY5 A;  1X1G A;  3CIK A;  2UZR A;  2DHI A;  3AU5 A;  3QBV B;  3WYF B;  1MK9 B;  2VSZ A;  3OAN A;  1XR0 B;  2RUK B;  1NTY A;  2GS0 A;  3HQC A;  2D9Y A;  2DN6 A;  4HDO A;  2N0Y A;  1DBH A;  2ROV A;  5LON B;  2H7E A;  4IOY X;  4YL8 A;  3MPX A;  4YON A;  1WI1 A;  4HDQ A;  3TFM A;  1EF1 A;  2AL6 A;  3F5R A;  4NSW A;  1NTV A;  1I2H A;  1W1D A;  1WGU A;  3ZDT A;  4B6H A;  2GCJ A;  2J0M A;  2RVB B;  3SV1 A;  3TO1 A;  1P6S A;  2LKO A;  3FM8 C;  1H10 A;  2AEH A;  5C16 A;  1IRS A;  3G9W A;  3SNH A;  5KQ1 A;  1EVH A;  1EGX A;  3DXD A;  1EAZ A;  5JLJ B;  2Y8G A;  5J3T A;  1ZVR A;  5J3Q A;  2M14 A;  3ML4 A;  2MDX A;  4C0A A;  1XCG A;  1Y19 B;  1GC6 A;  2Q13 A;  1N3H A;  3AJ4 A;  4K2O A;  4WVF B;  4DBB A;  5D3X A;  1H4R A;  1DDW A;  4ZRJ A;  1XX0 A;  2Z0P A;  4DXA B;  1FHO A;  1MPH A;  3QWM A;  4PNK A;  1V88 A;  1MAI A;  1DYN A;  2CY4 A;  2COC A;  2RGN B;  2KCJ A;  2I1J A;  4Z2M B;  2K2U A;  1OMW A;  3PP2 A;  1KI1 B;  2XQN M;  1M7R A;  4K17 A;  3PEG A;  2W2X C;  1ZC3 B;  2OQB A;  2QKM A;  3LJU X;  4MK0 A;  1UNR A;  4A6K A;  1V5M A;  2K2J A;  3D8E A;  2IYB A;  4IAP A;  4H8S A;  2YF0 A;  4GPT B;  5CLQ B;  2QKL A;  2DTC A;  4A6F B;  3ODO A;  5C6R A;  3GYO A;  1X1F A;  4P7I A;  4MY6 A;  1I7A A;  2LOX A;  5C5B B;  1DDM A;  3KY9 A;  3MDB C;  2K00 A;  3KZ1 A;  2ADZ A;  4K2P A;  1AQC A;  2KGX B;  1FGZ A;  2LOZ A;  2H7D A;  3RCP A;  1FGY A;  2I1K A;  2YS5 A;  4WJ7 A;  1OY2 A;  3P6A A;  5L81 A;  2VRW B;  1WJM A;  1Y5O A;  3ODX A;  4BBK A;  1WG7 A;  2DYQ A;  2I5C A;  2Z0Q A;  4HHV A;  2UZS A;  1UNQ A;  2P0F A;  1OQN A;  3QIJ A;  4A6F A;  5JP4 A;  1J0W A;  5GOW B;  5D3Y A;  1K5G B;  4HAZ B;  2ZPY A;  4WSF A;  3P7Z A;  3PVU A;  1P3R A;  2NMB A;  5C5B A;  4HB0 B;  2PZ1 A;  3NSU A;  4GMV A;  2YSZ A;  2EC1 A;  1V89 A;  1W1H A;  1FHX A;  1XD4 A;  5FI0 A;  1V5P A;  1J19 A;  1KZ7 A;  5KCV A;  1NU2 A;  3PVW A;  2HE7 A;  2COF A;  4KHB B;  2YVC A;  2DYN A;  4TKN A;  4Y94 A;  2DHK A;  3VIA A;  1B55 A;  2IFS A;  5HE0 A;  2EMT A;  2JP2 A;  1UPQ A;  3ZVR A;  1U5G A;  2X18 A;  2CAY A;  5C79 A;  1V61 A;  2MFQ A;  2UVM A;  4HAX B;  4HAU B;  4CHJ A;  4GN1 A;  3ULB A;  1ZC4 B;  3A8P A;  2P8V A;  2YRY A;  2D9V A;  2YS1 A;  2Z0O A;  5D3W A;  3D8F A;  4HB4 B;  2D4Q A;  4XWX A;  5J3Y A;  4KHA A;  4D0N B;  2R0D A;  3N7C A;  1X05 A;  1Q67 A;  1ZM0 A;  2YT1 A;  2YT0 A;  1X86 A;  3T06 A;  4ZRK A;  1U5E A;  3DXC A;  2MKR A;  3WA0 A;  4L6E A;  2RNR B;  1WVH A;  2W2W A;  1BAK A;  1UEF A;  1NI2 A;  4A6H A;  2D10 A;  2DX5 A;  5D27 A;  5KQ4 A;  3PVL A;  1U5D A;  1BTN A;  5FI1 A;  3SUZ A;  2ELA A;  2Y7B A;  2W2X D;  4GXB A;  2HTH B;  5DHF B;  5DI9 B;  1U2B A;  3SO6 A;  4F7G A;  5EFX A;  1SGH A;  1TQZ A;  4EMO A;  2Y8F A;  2DKP A;  1UPR A;  2DX1 A;  4IFS A;  3ODW A;  3O96 A;  2RSG A;  4HB3 B;  5HE1 A;  2L1C A;  5HE3 A;  1PLS A;  1GC7 A;  5DHA B;  1GG3 A;  2GCL A;  4F7U P;  3HW2 B;  1DDV A;  4MT7 A;  3ULC A;  2R09 A;  2CRF A;  3KSY A;  4HB2 B;  2LUL A;  2N23 A;  2ROZ B;  4GZU A;  1QQG A;  2LYD A;  3AU4 A;  1RJ2 A;  2P0D A;  1K5D B;  1BWN A;  4Z2N A;  4KHO A;  2KUP A;  4TYZ A;  1U27 A;  1WJ1 A;  3FSS A;  1P5T A;  1QC6 A;  2DLW A;  1UNP A;  4HAY B;  3X23 A;  1M7E A;  1FB8 A;  2ELB A;  1FOE A;  2J0K A;  5LOP B;  2GJY A;  1FAO A;  1LW3 A;  3KRW A;  4KVG B;  2RLO A;  3DXE A;  5DH9 B;  4DX9 0;  1TJ6 A;  3M1I B;  4GMX B;  3TW1 A;  2E2X A;  3F0W A;  4K81 A;  2OTX A;  1AWE A;  3BJI A;  2BCJ A;  2COD A;  1XOD A;  3PZD A;  3U8Z A;  1MIX A;  1SHC A;  4NY0 A;  2D9X A;  4DX8 A;  3U7D A;  2J0J A;  2I5F A;  3FEH A;  2NZ8 B;  1ISN A;  3V5W A;  2DHJ A;  3SYX A;  2EJ8 A;  4F7H A;  2DKQ A;  1PMS A;  1ZSQ A;  2MWN B;  4HAT B;  3D8D A;  3UZT A;  2VKI A;  1XKE A;  2P0H A;  1W1G A;  4HAW B;  1TXD A;  3KRX A;  4PQ0 A;  5HE2 A;  1PFJ A;  3IVF A;  1X11 A;  3CXB B;  1MIZ B;  1Z87 A;  3BIN A;  1MKE A;  2DFK A;  5CLL B;  2COA A;  2L2I A;  4EKU A;  3VOQ A;  2D11 A; 
#chains in the Genus database with same CATH topology
 3A98 B;  2V76 A;  1WGQ A;  1LB1 A;  3PG7 A;  5DIF B;  3TVV A;  1E5W A;  1DRO A;  5JHG A;  1U5F A;  3FVC A;  2M38 A;  1U29 A;  4KAX B;  4HAV B;  1BTK A;  4ZRI A;  2LG1 A;  2D9W A;  2YS3 A;  3A58 A;  2G35 A;  1KZG A;  2DA0 A;  5D3V A;  2D9Z A;  1MK7 B;  3HK0 A;  4A5K A;  1FHW A;  2FJL A;  3PSC A;  5JHH A;  4CYE A;  2J59 M;  5LG4 B;  4CHM A;  4EJN A;  1RRP B;  2EMS A;  2D2Q A;  5M4Y B;  3A8Q A;  3TCA A;  3GYP A;  1V5U A;  2CY5 A;  1X1G A;  3CIK A;  2UZR A;  2DHI A;  3AU5 A;  3QBV B;  3WYF B;  1MK9 B;  2ZKM X;  2VSZ A;  3OAN A;  1XR0 B;  2RUK B;  1NTY A;  2GS0 A;  4L1R A;  3HQC A;  2D9Y A;  2DN6 A;  4HDO A;  2N0Y A;  1DBH A;  2ROV A;  5LON B;  2H7E A;  4IOY X;  4YL8 A;  3MPX A;  4YON A;  1WI1 A;  3B77 A;  4HDQ A;  3TFM A;  1EF1 A;  2AL6 A;  3F5R A;  4NSW A;  1NTV A;  1I2H A;  1W1D A;  4QXA B;  1WGU A;  3ZDT A;  4B6H A;  2GCJ A;  2J0M A;  2RVB B;  3SV1 A;  3TO1 A;  1P6S A;  2LKO A;  3FM8 C;  1H10 A;  2AEH A;  5C16 A;  1IRS A;  3G9W A;  3SNH A;  5KQ1 A;  1EVH A;  1EGX A;  3DXD A;  1EAZ A;  5JLJ B;  2Y8G A;  4HSI A;  5J3T A;  1ZVR A;  5J3Q A;  2M14 A;  3ML4 A;  2MDX A;  4C0A A;  1XCG A;  1Y19 B;  1GC6 A;  2Q13 A;  3U12 A;  1N3H A;  2KR0 A;  3AJ4 A;  4K2O A;  4WVF B;  4DBB A;  5D3X A;  1H4R A;  1DDW A;  4ZRJ A;  1XX0 A;  2Z0P A;  4DXA B;  1FHO A;  2K49 A;  1MPH A;  3QWM A;  4PNK A;  1V88 A;  1MAI A;  2K8E A;  1DYN A;  2CY4 A;  2COC A;  2RGN B;  2KCJ A;  2I1J A;  4Z2M B;  2K2U A;  1OMW A;  3PP2 A;  1KI1 B;  2XQN M;  1M7R A;  3NWA A;  4K17 A;  3PEG A;  4CSQ A;  2W2X C;  1ZC3 B;  2OQB A;  2QKM A;  3LJU X;  4MK0 A;  1UNR A;  4A6K A;  1V5M A;  2K2J A;  3D8E A;  2IYB A;  4IAP A;  3NWF A;  4H8S A;  2YF0 A;  4GPT B;  4D6W A;  5CLQ B;  2QKL A;  2DTC A;  4A6F B;  3ODO A;  5C6R A;  3GYO A;  1X1F A;  4P7I A;  2KIG A;  4MY6 A;  1I7A A;  2LOX A;  5C5B B;  1DDM A;  3KY9 A;  3MDB C;  2K00 A;  3KZ1 A;  2ADZ A;  4K2P A;  1AQC A;  2KGX B;  1FGZ A;  2NBV A;  2LOZ A;  2H7D A;  3RCP A;  1FGY A;  2I1K A;  2YS5 A;  4WJ7 A;  1OY2 A;  3P6A A;  5L81 A;  2VRW B;  1WJM A;  1Y5O A;  3ODX A;  4BBK A;  1WG7 A;  2DYQ A;  2I5C A;  2Z0Q A;  4HHV A;  2UZS A;  1UNQ A;  2P0F A;  1OQN A;  2Z59 A;  3QIJ A;  4A6F A;  1J0W A;  5GOW B;  5JP4 A;  5D3Y A;  1K5G B;  4HAZ B;  2ZPY A;  4WSF A;  2YT2 A;  3P7Z A;  3PVU A;  1P3R A;  2NMB A;  5C5B A;  4HB0 B;  2KUQ A;  4QJ5 B;  2PZ1 A;  3NSU A;  4GMV A;  2YSZ A;  2EC1 A;  1V89 A;  1W1H A;  1FHX A;  1XD4 A;  5FI0 A;  1V5P A;  1J19 A;  1KZ7 A;  5KCV A;  2KIE A;  1NU2 A;  3PVW A;  2HE7 A;  1MI1 A;  2COF A;  4KHB B;  2YVC A;  2DYN A;  4TKN A;  2RRF A;  4Y94 A;  2DHK A;  2GUM A;  3VIA A;  1B55 A;  2IFS A;  5HE0 A;  2EMT A;  2JP2 A;  1UPQ A;  3ZVR A;  1U5G A;  2X18 A;  2CAY A;  5C79 A;  1V61 A;  2MFQ A;  2UVM A;  4HAX B;  4HAU B;  4OSN A;  4CHJ A;  4GN1 A;  3ULB A;  1ZC4 B;  3A8P A;  2P8V A;  2YRY A;  2D9V A;  2YS1 A;  2Z0O A;  4DIX A;  5D3W A;  3D8F A;  4HB4 B;  2D4Q A;  4XWX A;  5J3Y A;  4KHA A;  4D0N B;  2R0D A;  4KHB A;  1T77 A;  3N7C A;  1X05 A;  1Q67 A;  1ZM0 A;  2YT1 A;  2YT0 A;  1X86 A;  3HSA A;  3T06 A;  4ZRK A;  1U5E A;  3DXC A;  2MKR A;  3WA0 A;  4L6E A;  2RNR B;  1WVH A;  2W2W A;  1BAK A;  1UEF A;  1NI2 A;  4A6H A;  2D10 A;  2DX5 A;  5D27 A;  5KQ4 A;  3PVL A;  1U5D A;  1BTN A;  4GOU A;  5FI1 A;  3SUZ A;  2ELA A;  2Y7B A;  2W2X D;  4GXB A;  2HTH B;  5DHF B;  5DI9 B;  1U2B A;  3SO6 A;  4F7G A;  5EFX A;  1SGH A;  1TQZ A;  4EMO A;  2Y8F A;  2DKP A;  1UPR A;  2DX1 A;  4IFS A;  3ODW A;  3O96 A;  2RSG A;  4HB3 B;  2Z13 A;  5HE1 A;  2L1C A;  5IRS A;  5HE3 A;  4QJ4 B;  1PLS A;  2Z4D A;  1GC7 A;  5DHA B;  1GG3 A;  2GCL A;  4F7U P;  3HW2 B;  1DDV A;  4MT7 A;  3ULC A;  2R09 A;  2CRF A;  3KSY A;  4HB2 B;  2LUL A;  2N23 A;  2ROZ B;  4GZU A;  1QQG A;  2LYD A;  3AU4 A;  1RJ2 A;  2P0D A;  1K5D B;  3HIE A;  5I2M A;  1BWN A;  3NW8 A;  4Z2N A;  4KHO A;  2KUP A;  4TYZ A;  1U27 A;  1WJ1 A;  3FSS A;  1P5T A;  4GNK B;  1QC6 A;  2Z14 A;  2DLW A;  1UNP A;  4HAY B;  3X23 A;  3DCX A;  1M7E A;  1FB8 A;  2ELB A;  1FOE A;  2J0K A;  5LOP B;  2FJU B;  1FAO A;  2GJY A;  1LW3 A;  3KRW A;  4KVG B;  2RLO A;  3DXE A;  5DH9 B;  4DX9 0;  1TJ6 A;  1ZYI A;  3M1I B;  4OT1 A;  4GMX B;  3TW1 A;  2E2X A;  3F0W A;  4K81 A;  2OTX A;  1AWE A;  3BJI A;  2BCJ A;  3NWD A;  2COD A;  1XOD A;  3PZD A;  3U8Z A;  1MIX A;  1SHC A;  4NY0 A;  2D9X A;  4DX8 A;  3U7D A;  2J0J A;  2I5F A;  3OHM B;  3FEH A;  2NZ8 B;  1ISN A;  3V5W A;  2DHJ A;  3SYX A;  2EJ8 A;  4F7H A;  2DKQ A;  1PMS A;  1ZSQ A;  2MWN B;  4HAT B;  3D8D A;  3UZT A;  2VKI A;  1XKE A;  2P0H A;  1W1G A;  4HAW B;  1TXD A;  3KRX A;  4PQ0 A;  5HE2 A;  1PFJ A;  2R2Y A;  3IVF A;  4QJ3 B;  1X11 A;  3CXB B;  1MIZ B;  1Z87 A;  3BIN A;  1MKE A;  2DFK A;  5CLL B;  2COA A;  2L2I A;  4EKU A;  3VOQ A;  5I2S A;  2D11 A; 
#chains in the Genus database with same CATH homology
 3A98 B;  2V76 A;  1WGQ A;  1LB1 A;  3PG7 A;  5DIF B;  3TVV A;  1E5W A;  1DRO A;  5JHG A;  1U5F A;  2M38 A;  1U29 A;  4KAX B;  4HAV B;  1BTK A;  4ZRI A;  2LG1 A;  2D9W A;  2YS3 A;  2G35 A;  1KZG A;  2DA0 A;  5D3V A;  2D9Z A;  1MK7 B;  3HK0 A;  4A5K A;  1FHW A;  2FJL A;  3PSC A;  5JHH A;  4CYE A;  2J59 M;  4CHM A;  4EJN A;  1RRP B;  2EMS A;  2D2Q A;  3A8Q A;  3TCA A;  3GYP A;  1V5U A;  2CY5 A;  1X1G A;  3CIK A;  2UZR A;  2DHI A;  3AU5 A;  3QBV B;  3WYF B;  1MK9 B;  2VSZ A;  3OAN A;  1XR0 B;  2RUK B;  1NTY A;  2GS0 A;  3HQC A;  2D9Y A;  2DN6 A;  4HDO A;  2N0Y A;  1DBH A;  2ROV A;  5LON B;  2H7E A;  4IOY X;  4YL8 A;  3MPX A;  4YON A;  1WI1 A;  4HDQ A;  3TFM A;  1EF1 A;  2AL6 A;  3F5R A;  4NSW A;  1NTV A;  1I2H A;  1W1D A;  1WGU A;  3ZDT A;  4B6H A;  2GCJ A;  2J0M A;  2RVB B;  3SV1 A;  3TO1 A;  1P6S A;  2LKO A;  3FM8 C;  1H10 A;  2AEH A;  5C16 A;  1IRS A;  3G9W A;  3SNH A;  5KQ1 A;  1EVH A;  1EGX A;  3DXD A;  1EAZ A;  5JLJ B;  2Y8G A;  5J3T A;  1ZVR A;  5J3Q A;  2M14 A;  3ML4 A;  2MDX A;  4C0A A;  1XCG A;  1Y19 B;  1GC6 A;  2Q13 A;  1N3H A;  3AJ4 A;  4K2O A;  4WVF B;  4DBB A;  5D3X A;  1H4R A;  1DDW A;  4ZRJ A;  1XX0 A;  2Z0P A;  4DXA B;  1FHO A;  1MPH A;  3QWM A;  4PNK A;  1V88 A;  1MAI A;  1DYN A;  2CY4 A;  2COC A;  2RGN B;  2KCJ A;  2I1J A;  4Z2M B;  2K2U A;  1OMW A;  3PP2 A;  1KI1 B;  2XQN M;  1M7R A;  4K17 A;  3PEG A;  2W2X C;  1ZC3 B;  2OQB A;  2QKM A;  3LJU X;  4MK0 A;  1UNR A;  4A6K A;  1V5M A;  2K2J A;  3D8E A;  2IYB A;  4IAP A;  4H8S A;  2YF0 A;  4GPT B;  5CLQ B;  2QKL A;  2DTC A;  4A6F B;  3ODO A;  5C6R A;  3GYO A;  1X1F A;  4P7I A;  4MY6 A;  1I7A A;  2LOX A;  5C5B B;  1DDM A;  3KY9 A;  3MDB C;  2K00 A;  3KZ1 A;  2ADZ A;  4K2P A;  1AQC A;  2KGX B;  1FGZ A;  2LOZ A;  2H7D A;  3RCP A;  1FGY A;  2I1K A;  2YS5 A;  4WJ7 A;  1OY2 A;  3P6A A;  5L81 A;  2VRW B;  1WJM A;  1Y5O A;  3ODX A;  4BBK A;  1WG7 A;  2DYQ A;  2I5C A;  2Z0Q A;  4HHV A;  2UZS A;  1UNQ A;  2P0F A;  1OQN A;  3QIJ A;  4A6F A;  5JP4 A;  1J0W A;  5GOW B;  5D3Y A;  1K5G B;  4HAZ B;  2ZPY A;  4WSF A;  3P7Z A;  3PVU A;  1P3R A;  2NMB A;  5C5B A;  4HB0 B;  2PZ1 A;  3NSU A;  4GMV A;  2YSZ A;  2EC1 A;  1V89 A;  1W1H A;  1FHX A;  1XD4 A;  5FI0 A;  1V5P A;  1J19 A;  1KZ7 A;  5KCV A;  1NU2 A;  3PVW A;  2HE7 A;  2COF A;  4KHB B;  2YVC A;  2DYN A;  4TKN A;  4Y94 A;  2DHK A;  3VIA A;  1B55 A;  2IFS A;  5HE0 A;  2EMT A;  2JP2 A;  1UPQ A;  3ZVR A;  1U5G A;  2X18 A;  2CAY A;  5C79 A;  1V61 A;  2MFQ A;  2UVM A;  4HAX B;  4HAU B;  4CHJ A;  4GN1 A;  3ULB A;  1ZC4 B;  3A8P A;  2P8V A;  2YRY A;  2D9V A;  2YS1 A;  2Z0O A;  5D3W A;  3D8F A;  4HB4 B;  2D4Q A;  4XWX A;  5J3Y A;  4KHA A;  4D0N B;  2R0D A;  3N7C A;  1X05 A;  1Q67 A;  1ZM0 A;  2YT1 A;  2YT0 A;  1X86 A;  3T06 A;  4ZRK A;  1U5E A;  3DXC A;  2MKR A;  3WA0 A;  4L6E A;  2RNR B;  1WVH A;  2W2W A;  1BAK A;  1UEF A;  1NI2 A;  4A6H A;  2D10 A;  2DX5 A;  5D27 A;  5KQ4 A;  3PVL A;  1U5D A;  1BTN A;  5FI1 A;  3SUZ A;  2ELA A;  2Y7B A;  2W2X D;  4GXB A;  2HTH B;  5DHF B;  5DI9 B;  1U2B A;  3SO6 A;  4F7G A;  5EFX A;  1SGH A;  1TQZ A;  4EMO A;  2Y8F A;  2DKP A;  1UPR A;  2DX1 A;  4IFS A;  3ODW A;  3O96 A;  2RSG A;  4HB3 B;  5HE1 A;  2L1C A;  5HE3 A;  1PLS A;  1GC7 A;  5DHA B;  1GG3 A;  2GCL A;  4F7U P;  3HW2 B;  1DDV A;  4MT7 A;  3ULC A;  2R09 A;  2CRF A;  3KSY A;  4HB2 B;  2LUL A;  2N23 A;  2ROZ B;  4GZU A;  1QQG A;  2LYD A;  3AU4 A;  1RJ2 A;  2P0D A;  1K5D B;  1BWN A;  4Z2N A;  4KHO A;  2KUP A;  4TYZ A;  1U27 A;  1WJ1 A;  3FSS A;  1P5T A;  1QC6 A;  2DLW A;  1UNP A;  4HAY B;  3X23 A;  1M7E A;  1FB8 A;  2ELB A;  1FOE A;  2J0K A;  5LOP B;  2GJY A;  1FAO A;  1LW3 A;  3KRW A;  4KVG B;  2RLO A;  3DXE A;  5DH9 B;  4DX9 0;  1TJ6 A;  3M1I B;  4GMX B;  3TW1 A;  2E2X A;  3F0W A;  4K81 A;  2OTX A;  1AWE A;  3BJI A;  2BCJ A;  2COD A;  1XOD A;  3PZD A;  3U8Z A;  1MIX A;  1SHC A;  4NY0 A;  2D9X A;  4DX8 A;  3U7D A;  2J0J A;  2I5F A;  3FEH A;  2NZ8 B;  1ISN A;  3V5W A;  2DHJ A;  3SYX A;  2EJ8 A;  4F7H A;  2DKQ A;  1PMS A;  1ZSQ A;  2MWN B;  4HAT B;  3D8D A;  3UZT A;  2VKI A;  1XKE A;  2P0H A;  1W1G A;  4HAW B;  1TXD A;  3KRX A;  4PQ0 A;  5HE2 A;  1PFJ A;  3IVF A;  1X11 A;  3CXB B;  1MIZ B;  1Z87 A;  3BIN A;  1MKE A;  2DFK A;  5CLL B;  2COA A;  2L2I A;  4EKU A;  3VOQ A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...