1DROA

Nmr structure of the cytoskeleton/signal transduction protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
GSGTGAGEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSDSTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords BETA-SPECTRIN
publication title Solution structure of the pleckstrin homology domain of Drosophila beta-spectrin.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1995-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1droA00
3WYFB 1SGHA 2DHIA 1W1GA 3M1IB 1IRSA 2D9XA 1EVHA 1U5EA 4YL8A 3ZDTA 1M7RA 5FI1A 2D4QA 1E5WA 3UZTA 3ZVRA 1U5GA 2GCJA 4MK0A 2D9YA 3KRXA 3IVFA 3FM8C 3ODXA 4HDQA 5CLLB 2H7DA 5EFXA 3FEHA 5CLQB 3QWMA 1W1DA 3CIKA 2DN6A 4BBKA 4GN1A 1TJ6A 2YF0A 1P5TA 3TW1A 2VKIA 2QKMA 4WJ7A 4Y94A 3DXDA 1ZC4B 5HE2A 4F7GA 2Z0OA 1QQGA 1NU2A 3T06A 1BAKA 2DA0A 2RGNB 2GS0A 1X11A 1V88A 2UZRA 2XQNM 1V89A 2V76A 1M7EA 4K2OA 2P0DA 3MPXA 3PSCA 2E2XA 5C5BB 5KCVA 1DDWA 2G35A 2AL6A 2D9ZA 1OMWA 2YS3A 1U5DA 2YVCA 4EKUA 1UNPA 2W2XD 4PQ0A 1FHXA 3ODWA 1NTYA 2K2UA 2D11A 2FJLA 1OY2A 1FGZA 1WJ1A 3F0WA 2K2JA 2Y7BA 1V5UA 1Y5OA 2K00A 5D3XA 1DROA 2YS5A 3O96A 2DX5A 4ZRIA 1K5GB 2CY5A 4A6KA 1J19A 5D3VA 4DBBA 4ZRKA 1UEFA 2RVBB 5HE3A 3V5WA 5L81A 2J59M 3TO1A 1FHOA 4C0AA 4KHAA 5D3WA 2R09A 2IFSA 4A6FB 1RRPB 2JP2A 4HDOA 1RJ2A 2MKRA 2ELBA 2COAA 2ELAA 1H10A 1EF1A 3PVWA 1N3HA 1ZM0A 2AEHA 4DX8A 1W1HA 2D10A 4K2PA 4H8SA 2GCLA 5C79A 3ULBA 4K81A 3OANA 5FI0A 4IAPA 3KY9A 1UNRA 3GYOA 1BTNA 1EAZA 3TFMA 3AU5A 4KAXB 2DKPA 4HHVA 4EJNA 2EMSA 2LYDA 4HAZB 1AQCA 4HAUB 2J0KA 1ZSQA 1X1FA 3G9WA 4KHOA 2P8VA 2D9VA 1P6SA 2DFKA 3U7DA 1MIZB 4PNKA 1GC7A 1XD4A 3U8ZA 2J0MA 2NMBA 2YSZA 4CHMA 4Z2MB 2NZ8B 2MDXA 3A8QA 2I1KA 3D8EA 2RLOA 2DKQA 2KCJA 5KQ4A 1H4RA 2P0FA 2I1JA 3SNHA 4D0NB 1MIXA 3VIAA 2EJ8A 1UPQA 4A6HA 2ROZB 1MKEA 3ML4A 1Y19B 5D3YA 2X18A 5GOWB 3NSUA 4IFSA 2CRFA 4Z2NA 4GXBA 2L1CA 1MAIA 1TXDA 3BJIA 1V5PA 3ULCA 5C6RA 1MPHA 2Y8FA 4CYEA 4HATB 3TCAA 1ISNA 1WGQA 1MK7B 1XKEA 2R0DA 1P3RA 4HAYB 1U29A 1FGYA 2CAYA 2Y8GA 5D27A 1U2BA 3N7CA 1U5FA 3PVUA 2UZSA 3VOQA 1EGXA 2IYBA 3CXBB 2CODA 1B55A 3SYXA 3PG7A 2GJYA 1DBHA 1TQZA 1Q67A 3BINA 1PMSA 1ZC3B 2D9WA 3A98B 4DX90 5C5BA 2EC1A 2YS1A 1XR0B 1X05A 3HQCA 3F5RA 2Q13A 5DI9B 5JHHA 4WVFB 1Z87A 2N23A 1QC6A 1OQNA 3PZDA 2I5FA 2BCJA 1SHCA 2DLWA 1FOEA 2ZPYA 4HB0B 2VRWB 2Z0PA 2Z0QA 1KI1B 2LKOA 5J3QA 1I7AA 1WG7A 2DYQA 3P6AA 3SV1A 4F7HA 3QIJA 4CHJA 3AJ4A 1KZ7A 3SO6A 2H7EA 2VSZA 2COFA 3LJUX 4P7IA 4NY0A 2DTCA 3MDBC 4MY6A 3ODOA 5J3TA 1NTVA 3PP2A 4TKNA 4K17A 2ADZA 4IOYX 1WI1A 3D8DA 1LW3A 4A6FA 1K5DB 5DIFB 1FAOA 4KHBB 3AU4A 5HE0A 5LONB 3PEGA 4GMXB 2RSGA 2DHKA 4L6EA 2YT0A 1V61A 3KSYA 3PVLA 1ZVRA 2QKLA 1XODA 3RCPA 1UPRA 2W2WA 5DHAB 3KZ1A 2L2IA 5HE1A 5KQ1A 4HAWB 2KGXB 2DHJA 4WSFA 5DH9B 4HB4B 3QBVB 1MK9B 1WJMA 2N0YA 4F7UP 3TVVA 1GG3A 1KZGA 2LOZA 1X86A 4ZRJA 4TYZA 1WGUA 1XCGA 5DHFB 1LB1A 3P7ZA 2DYNA 1X1GA 2EMTA 3D8FA 2HTHB 2W2XC 3DXEA 3DXCA 5J3YA 4HAXB 2LULA 2OQBA 5LOPB 3GYPA 1V5MA 4MT7A 2MFQA 4GMVA 1UNQA 4XWXA 1FHWA 4YONA 5JP4A 3A8PA 4HB3B 1DDMA 2RUKB 5C16A 1I2HA 3SUZA 4NSWA 2M38A 3HK0A 4EMOA 4HB2B 1WVHA 3KRWA 4KVGB 3WA0A 2YT1A 3X23A 1FB8A 3FSSA 2P0HA 3HW2B 2YRYA 2KUPA 2HE7A 2RNRB 1XX0A 1PLSA 2D2QA 2MWNB 2UVMA 2J0JA 5JHGA 2ROVA 2CY4A 1J0WA 1NI2A 2COCA 1GC6A 1U27A 4HAVB 4DXAB 1DYNA 2LOXA 2M14A 1BTKA 4B6HA 2DX1A 4A5KA 2PZ1A 1DDVA 4GZUA 4GPTB 1AWEA 5JLJB 2OTXA 2LG1A 2I5CA 1BWNA 1PFJA
chains in the Genus database with same CATH superfamily
2ZKMX 3WYFB 1SGHA 4GNKB 2DHIA 1W1GA 3M1IB 1IRSA 2D9XA 1EVHA 1U5EA 4YL8A 3ZDTA 1M7RA 1T77A 5FI1A 4QJ4B 2D4QA 1E5WA 3UZTA 3ZVRA 1U5GA 2GCJA 2Z14A 4MK0A 3DCXA 2D9YA 3KRXA 3IVFA 3FM8C 3ODXA 4HDQA 5CLLB 2H7DA 4DIXA 2NBVA 5EFXA 3FEHA 5CLQB 3QWMA 1W1DA 3CIKA 2DN6A 4BBKA 4GN1A 1TJ6A 2YF0A 1P5TA 3TW1A 4GOUA 2VKIA 5IRSA 2QKMA 4WJ7A 4Y94A 3DXDA 1ZC4B 5HE2A 4CSQA 4F7GA 2Z0OA 3U12A 1QQGA 1NU2A 3T06A 1BAKA 2DA0A 2K8EA 2RGNB 2GS0A 1X11A 1V88A 2UZRA 2XQNM 1V89A 2V76A 1M7EA 4K2OA 2P0DA 3MPXA 3PSCA 3B77A 4L1RA 5I2SA 2E2XA 5C5BB 5KCVA 1DDWA 2G35A 2AL6A 2D9ZA 2KR0A 5M4YB 1OMWA 2YS3A 4KHBA 1U5DA 2YVCA 4EKUA 3NW8A 1UNPA 2W2XD 4PQ0A 1FHXA 3ODWA 1NTYA 2K2UA 2D11A 2FJLA 1OY2A 1FGZA 1WJ1A 3F0WA 2K2JA 2Y7BA 1V5UA 1Y5OA 2K00A 2KUQA 5D3XA 1DROA 2R2YA 2YS5A 3O96A 2DX5A 4ZRIA 1K5GB 2CY5A 4A6KA 1J19A 5D3VA 4DBBA 4ZRKA 1UEFA 2RVBB 5HE3A 3V5WA 5L81A 2GUMA 2J59M 3TO1A 4QJ5B 1FHOA 4C0AA 3FVCA 4KHAA 5D3WA 2R09A 2IFSA 4A6FB 1RRPB 2JP2A 4HDOA 1RJ2A 2MKRA 3NWFA 2ELBA 2COAA 2ELAA 4D6WA 1H10A 1EF1A 3PVWA 1N3HA 1ZM0A 2AEHA 4DX8A 1W1HA 2D10A 4K2PA 2Z13A 4H8SA 2GCLA 5C79A 3ULBA 4K81A 3OANA 5FI0A 4IAPA 3KY9A 1UNRA 3GYOA 1BTNA 1EAZA 3TFMA 2K49A 3AU5A 4KAXB 2DKPA 4HHVA 4EJNA 2EMSA 2LYDA 4HAZB 1AQCA 4HAUB 2J0KA 1ZSQA 1X1FA 3G9WA 4KHOA 2P8VA 2D9VA 1P6SA 2DFKA 3U7DA 1MIZB 4PNKA 1GC7A 1XD4A 3U8ZA 2J0MA 2NMBA 2YSZA 4CHMA 4Z2MB 2NZ8B 2KIEA 2MDXA 3A8QA 2I1KA 3D8EA 2RLOA 2DKQA 2KCJA 5KQ4A 1H4RA 2P0FA 2I1JA 3SNHA 4D0NB 1MIXA 3VIAA 2EJ8A 1UPQA 5I2MA 4A6HA 2ROZB 2FJUB 1MKEA 3ML4A 1Y19B 5D3YA 2X18A 5GOWB 3NSUA 4IFSA 2CRFA 4Z2NA 4GXBA 2L1CA 2RRFA 1MAIA 1TXDA 3BJIA 1V5PA 3NWDA 3ULCA 5C6RA 1MPHA 2Y8FA 4CYEA 4HATB 3TCAA 1ISNA 1WGQA 1MK7B 1XKEA 2R0DA 1P3RA 4HAYB 4OT1A 3OHMB 1U29A 1FGYA 4HSIA 2CAYA 2Y8GA 4QJ3B 2Z4DA 5D27A 1U2BA 3N7CA 1U5FA 3PVUA 2UZSA 3VOQA 1EGXA 2IYBA 3CXBB 2CODA 1B55A 3SYXA 2GJYA 3PG7A 1TQZA 1DBHA 1Q67A 3NWAA 3BINA 1PMSA 1ZC3B 2D9WA 3A98B 4DX90 5C5BA 2EC1A 2YS1A 2Z59A 1XR0B 1X05A 3HQCA 3F5RA 2Q13A 5DI9B 5JHHA 4WVFB 1Z87A 2N23A 1QC6A 1OQNA 3PZDA 2I5FA 2BCJA 1SHCA 2DLWA 1FOEA 2ZPYA 4HB0B 2VRWB 2Z0PA 2Z0QA 1KI1B 2LKOA 5J3QA 1I7AA 1WG7A 2DYQA 3P6AA 3SV1A 4F7HA 3QIJA 4CHJA 3AJ4A 1KZ7A 3SO6A 2H7EA 2VSZA 2COFA 3LJUX 4P7IA 4NY0A 2DTCA 3MDBC 4MY6A 3ODOA 5J3TA 1NTVA 3PP2A 4TKNA 4K17A 2ADZA 4IOYX 1WI1A 3D8DA 1LW3A 4A6FA 1K5DB 5DIFB 1FAOA 4KHBB 3AU4A 5HE0A 5LONB 3PEGA 4GMXB 2RSGA 2DHKA 4L6EA 2YT0A 1V61A 3KSYA 3PVLA 1ZVRA 2QKLA 1XODA 3HIEA 3RCPA 1UPRA 2W2WA 5DHAB 3KZ1A 2L2IA 5HE1A 5KQ1A 4HAWB 2KGXB 2DHJA 4WSFA 5DH9B 4HB4B 3QBVB 2YT2A 1MK9B 1WJMA 2N0YA 4F7UP 3TVVA 1GG3A 1KZGA 2LOZA 1X86A 4ZRJA 4TYZA 1WGUA 1XCGA 5DHFB 1LB1A 3P7ZA 2DYNA 1X1GA 2EMTA 3D8FA 2HTHB 2W2XC 3DXEA 4OSNA 3DXCA 5J3YA 4HAXB 2LULA 2OQBA 5LOPB 3GYPA 1V5MA 4MT7A 2MFQA 4GMVA 1UNQA 4XWXA 1FHWA 5LG4B 4YONA 5JP4A 3A8PA 4HB3B 1DDMA 2RUKB 5C16A 1I2HA 3SUZA 4NSWA 2M38A 3HK0A 4EMOA 4HB2B 1WVHA 3KRWA 4KVGB 3WA0A 2YT1A 3X23A 1FB8A 3FSSA 2P0HA 3HW2B 2YRYA 2KUPA 2HE7A 2RNRB 3A58A 1XX0A 1PLSA 2D2QA 2MWNB 1MI1A 2UVMA 2J0JA 5JHGA 2ROVA 2CY4A 1J0WA 1NI2A 2KIGA 2COCA 1GC6A 1U27A 4HAVB 4DXAB 1DYNA 2LOXA 2M14A 3HSAA 1BTKA 4B6HA 4QXAB 1ZYIA 2DX1A 2PZ1A 1DDVA 4GZUA 4A5KA 4GPTB 1AWEA 5JLJB 2OTXA 2LG1A 2I5CA 1BWNA 1PFJA
chains in the Genus database with same CATH topology
3WYFB 1SGHA 2DHIA 1W1GA 3M1IB 1IRSA 2D9XA 1EVHA 1U5EA 4YL8A 3ZDTA 1M7RA 5FI1A 2D4QA 1E5WA 3UZTA 3ZVRA 1U5GA 2GCJA 4MK0A 2D9YA 3KRXA 3IVFA 3FM8C 3ODXA 4HDQA 5CLLB 2H7DA 5EFXA 3FEHA 5CLQB 3QWMA 1W1DA 3CIKA 2DN6A 4BBKA 4GN1A 1TJ6A 2YF0A 1P5TA 3TW1A 2VKIA 2QKMA 4WJ7A 4Y94A 3DXDA 1ZC4B 5HE2A 4F7GA 2Z0OA 1QQGA 1NU2A 3T06A 1BAKA 2DA0A 2RGNB 2GS0A 1X11A 1V88A 2UZRA 2XQNM 1V89A 2V76A 1M7EA 4K2OA 2P0DA 3MPXA 3PSCA 2E2XA 5C5BB 5KCVA 1DDWA 2G35A 2AL6A 2D9ZA 1OMWA 2YS3A 1U5DA 2YVCA 4EKUA 1UNPA 2W2XD 4PQ0A 1FHXA 3ODWA 1NTYA 2K2UA 2D11A 2FJLA 1OY2A 1FGZA 1WJ1A 3F0WA 2K2JA 2Y7BA 1V5UA 1Y5OA 2K00A 5D3XA 1DROA 2YS5A 3O96A 2DX5A 4ZRIA 1K5GB 2CY5A 4A6KA 1J19A 5D3VA 4DBBA 4ZRKA 1UEFA 2RVBB 5HE3A 3V5WA 5L81A 2J59M 3TO1A 1FHOA 4C0AA 4KHAA 5D3WA 2R09A 2IFSA 4A6FB 1RRPB 2JP2A 4HDOA 1RJ2A 2MKRA 2ELBA 2COAA 2ELAA 1H10A 1EF1A 3PVWA 1N3HA 1ZM0A 2AEHA 4DX8A 1W1HA 2D10A 4K2PA 4H8SA 2GCLA 5C79A 3ULBA 4K81A 3OANA 5FI0A 4IAPA 3KY9A 1UNRA 3GYOA 1BTNA 1EAZA 3TFMA 3AU5A 4KAXB 2DKPA 4HHVA 4EJNA 2EMSA 2LYDA 4HAZB 1AQCA 4HAUB 2J0KA 1ZSQA 1X1FA 3G9WA 4KHOA 2P8VA 2D9VA 1P6SA 2DFKA 3U7DA 1MIZB 4PNKA 1GC7A 1XD4A 3U8ZA 2J0MA 2NMBA 2YSZA 4CHMA 4Z2MB 2NZ8B 2MDXA 3A8QA 2I1KA 3D8EA 2RLOA 2DKQA 2KCJA 5KQ4A 1H4RA 2P0FA 2I1JA 3SNHA 4D0NB 1MIXA 3VIAA 2EJ8A 1UPQA 4A6HA 2ROZB 1MKEA 3ML4A 1Y19B 5D3YA 2X18A 5GOWB 3NSUA 4IFSA 2CRFA 4Z2NA 4GXBA 2L1CA 1MAIA 1TXDA 3BJIA 1V5PA 3ULCA 5C6RA 1MPHA 2Y8FA 4CYEA 4HATB 3TCAA 1ISNA 1WGQA 1MK7B 1XKEA 2R0DA 1P3RA 4HAYB 1U29A 1FGYA 2CAYA 2Y8GA 5D27A 1U2BA 3N7CA 1U5FA 3PVUA 2UZSA 3VOQA 1EGXA 2IYBA 3CXBB 2CODA 1B55A 3SYXA 3PG7A 2GJYA 1DBHA 1TQZA 1Q67A 3BINA 1PMSA 1ZC3B 2D9WA 3A98B 4DX90 5C5BA 2EC1A 2YS1A 1XR0B 1X05A 3HQCA 3F5RA 2Q13A 5DI9B 5JHHA 4WVFB 1Z87A 2N23A 1QC6A 1OQNA 3PZDA 2I5FA 2BCJA 1SHCA 2DLWA 1FOEA 2ZPYA 4HB0B 2VRWB 2Z0PA 2Z0QA 1KI1B 2LKOA 5J3QA 1I7AA 1WG7A 2DYQA 3P6AA 3SV1A 4F7HA 3QIJA 4CHJA 3AJ4A 1KZ7A 3SO6A 2H7EA 2VSZA 2COFA 3LJUX 4P7IA 4NY0A 2DTCA 3MDBC 4MY6A 3ODOA 5J3TA 1NTVA 3PP2A 4TKNA 4K17A 2ADZA 4IOYX 1WI1A 3D8DA 1LW3A 4A6FA 1K5DB 5DIFB 1FAOA 4KHBB 3AU4A 5HE0A 5LONB 3PEGA 4GMXB 2RSGA 2DHKA 4L6EA 2YT0A 1V61A 3KSYA 3PVLA 1ZVRA 2QKLA 1XODA 3RCPA 1UPRA 2W2WA 5DHAB 3KZ1A 2L2IA 5HE1A 5KQ1A 4HAWB 2KGXB 2DHJA 4WSFA 5DH9B 4HB4B 3QBVB 1MK9B 1WJMA 2N0YA 4F7UP 3TVVA 1GG3A 1KZGA 2LOZA 1X86A 4ZRJA 4TYZA 1WGUA 1XCGA 5DHFB 1LB1A 3P7ZA 2DYNA 1X1GA 2EMTA 3D8FA 2HTHB 2W2XC 3DXEA 3DXCA 5J3YA 4HAXB 2LULA 2OQBA 5LOPB 3GYPA 1V5MA 4MT7A 2MFQA 4GMVA 1UNQA 4XWXA 1FHWA 4YONA 5JP4A 3A8PA 4HB3B 1DDMA 2RUKB 5C16A 1I2HA 3SUZA 4NSWA 2M38A 3HK0A 4EMOA 4HB2B 1WVHA 3KRWA 4KVGB 3WA0A 2YT1A 3X23A 1FB8A 3FSSA 2P0HA 3HW2B 2YRYA 2KUPA 2HE7A 2RNRB 1XX0A 1PLSA 2D2QA 2MWNB 2UVMA 2J0JA 5JHGA 2ROVA 2CY4A 1J0WA 1NI2A 2COCA 1GC6A 1U27A 4HAVB 4DXAB 1DYNA 2LOXA 2M14A 1BTKA 4B6HA 2DX1A 4A5KA 2PZ1A 1DDVA 4GZUA 4GPTB 1AWEA 5JLJB 2OTXA 2LG1A 2I5CA 1BWNA 1PFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WYF B;  1SGH A;  2DHI A;  1W1G A;  3M1I B;  1IRS A;  2D9X A;  1EVH A;  1U5E A;  4YL8 A;  3ZDT A;  1M7R A;  5FI1 A;  2D4Q A;  1E5W A;  3UZT A;  3ZVR A;  1U5G A;  2GCJ A;  4MK0 A;  2D9Y A;  3KRX A;  3IVF A;  3FM8 C;  3ODX A;  4HDQ A;  5CLL B;  2H7D A;  5EFX A;  3FEH A;  5CLQ B;  3QWM A;  1W1D A;  3CIK A;  2DN6 A;  4BBK A;  4GN1 A;  1TJ6 A;  2YF0 A;  1P5T A;  3TW1 A;  2VKI A;  2QKM A;  4WJ7 A;  4Y94 A;  3DXD A;  1ZC4 B;  5HE2 A;  4F7G A;  2Z0O A;  1QQG A;  1NU2 A;  3T06 A;  1BAK A;  2DA0 A;  2RGN B;  2GS0 A;  1X11 A;  1V88 A;  2UZR A;  2XQN M;  1V89 A;  2V76 A;  1M7E A;  4K2O A;  2P0D A;  3MPX A;  3PSC A;  2E2X A;  5C5B B;  5KCV A;  1DDW A;  2G35 A;  2AL6 A;  2D9Z A;  1OMW A;  2YS3 A;  1U5D A;  2YVC A;  4EKU A;  1UNP A;  2W2X D;  4PQ0 A;  1FHX A;  3ODW A;  1NTY A;  2K2U A;  2D11 A;  2FJL A;  1OY2 A;  1FGZ A;  1WJ1 A;  3F0W A;  2K2J A;  2Y7B A;  1V5U A;  1Y5O A;  2K00 A;  5D3X A;  1DRO A;  2YS5 A;  3O96 A;  2DX5 A;  4ZRI A;  1K5G B;  2CY5 A;  4A6K A;  1J19 A;  5D3V A;  4DBB A;  4ZRK A;  1UEF A;  2RVB B;  5HE3 A;  3V5W A;  5L81 A;  2J59 M;  3TO1 A;  1FHO A;  4C0A A;  4KHA A;  5D3W A;  2R09 A;  2IFS A;  4A6F B;  1RRP B;  2JP2 A;  4HDO A;  1RJ2 A;  2MKR A;  2ELB A;  2COA A;  2ELA A;  1H10 A;  1EF1 A;  3PVW A;  1N3H A;  1ZM0 A;  2AEH A;  4DX8 A;  1W1H A;  2D10 A;  4K2P A;  4H8S A;  2GCL A;  5C79 A;  3ULB A;  4K81 A;  3OAN A;  5FI0 A;  4IAP A;  3KY9 A;  1UNR A;  3GYO A;  1BTN A;  1EAZ A;  3TFM A;  3AU5 A;  4KAX B;  2DKP A;  4HHV A;  4EJN A;  2EMS A;  2LYD A;  4HAZ B;  1AQC A;  4HAU B;  2J0K A;  1ZSQ A;  1X1F A;  3G9W A;  4KHO A;  2P8V A;  2D9V A;  1P6S A;  2DFK A;  3U7D A;  1MIZ B;  4PNK A;  1GC7 A;  1XD4 A;  3U8Z A;  2J0M A;  2NMB A;  2YSZ A;  4CHM A;  4Z2M B;  2NZ8 B;  2MDX A;  3A8Q A;  2I1K A;  3D8E A;  2RLO A;  2DKQ A;  2KCJ A;  5KQ4 A;  1H4R A;  2P0F A;  2I1J A;  3SNH A;  4D0N B;  1MIX A;  3VIA A;  2EJ8 A;  1UPQ A;  4A6H A;  2ROZ B;  1MKE A;  3ML4 A;  1Y19 B;  5D3Y A;  2X18 A;  5GOW B;  3NSU A;  4IFS A;  2CRF A;  4Z2N A;  4GXB A;  2L1C A;  1MAI A;  1TXD A;  3BJI A;  1V5P A;  3ULC A;  5C6R A;  1MPH A;  2Y8F A;  4CYE A;  4HAT B;  3TCA A;  1ISN A;  1WGQ A;  1MK7 B;  1XKE A;  2R0D A;  1P3R A;  4HAY B;  1U29 A;  1FGY A;  2CAY A;  2Y8G A;  5D27 A;  1U2B A;  3N7C A;  1U5F A;  3PVU A;  2UZS A;  3VOQ A;  1EGX A;  2IYB A;  3CXB B;  2COD A;  1B55 A;  3SYX A;  3PG7 A;  2GJY A;  1DBH A;  1TQZ A;  1Q67 A;  3BIN A;  1PMS A;  1ZC3 B;  2D9W A;  3A98 B;  4DX9 0;  5C5B A;  2EC1 A;  2YS1 A;  1XR0 B;  1X05 A;  3HQC A;  3F5R A;  2Q13 A;  5DI9 B;  5JHH A;  4WVF B;  1Z87 A;  2N23 A;  1QC6 A;  1OQN A;  3PZD A;  2I5F A;  2BCJ A;  1SHC A;  2DLW A;  1FOE A;  2ZPY A;  4HB0 B;  2VRW B;  2Z0P A;  2Z0Q A;  1KI1 B;  2LKO A;  5J3Q A;  1I7A A;  1WG7 A;  2DYQ A;  3P6A A;  3SV1 A;  4F7H A;  3QIJ A;  4CHJ A;  3AJ4 A;  1KZ7 A;  3SO6 A;  2H7E A;  2VSZ A;  2COF A;  3LJU X;  4P7I A;  4NY0 A;  2DTC A;  3MDB C;  4MY6 A;  3ODO A;  5J3T A;  1NTV A;  3PP2 A;  4TKN A;  4K17 A;  2ADZ A;  4IOY X;  1WI1 A;  3D8D A;  1LW3 A;  4A6F A;  1K5D B;  5DIF B;  1FAO A;  4KHB B;  3AU4 A;  5HE0 A;  5LON B;  3PEG A;  4GMX B;  2RSG A;  2DHK A;  4L6E A;  2YT0 A;  1V61 A;  3KSY A;  3PVL A;  1ZVR A;  2QKL A;  1XOD A;  3RCP A;  1UPR A;  2W2W A;  5DHA B;  3KZ1 A;  2L2I A;  5HE1 A;  5KQ1 A;  4HAW B;  2KGX B;  2DHJ A;  4WSF A;  5DH9 B;  4HB4 B;  3QBV B;  1MK9 B;  1WJM A;  2N0Y A;  4F7U P;  3TVV A;  1GG3 A;  1KZG A;  2LOZ A;  1X86 A;  4ZRJ A;  4TYZ A;  1WGU A;  1XCG A;  5DHF B;  1LB1 A;  3P7Z A;  2DYN A;  1X1G A;  2EMT A;  3D8F A;  2HTH B;  2W2X C;  3DXE A;  3DXC A;  5J3Y A;  4HAX B;  2LUL A;  2OQB A;  5LOP B;  3GYP A;  1V5M A;  4MT7 A;  2MFQ A;  4GMV A;  1UNQ A;  4XWX A;  1FHW A;  4YON A;  5JP4 A;  3A8P A;  4HB3 B;  1DDM A;  2RUK B;  5C16 A;  1I2H A;  3SUZ A;  4NSW A;  2M38 A;  3HK0 A;  4EMO A;  4HB2 B;  1WVH A;  3KRW A;  4KVG B;  3WA0 A;  2YT1 A;  3X23 A;  1FB8 A;  3FSS A;  2P0H A;  3HW2 B;  2YRY A;  2KUP A;  2HE7 A;  2RNR B;  1XX0 A;  1PLS A;  2D2Q A;  2MWN B;  2UVM A;  2J0J A;  5JHG A;  2ROV A;  2CY4 A;  1J0W A;  1NI2 A;  2COC A;  1GC6 A;  1U27 A;  4HAV B;  4DXA B;  1DYN A;  2LOX A;  2M14 A;  1BTK A;  4B6H A;  2DX1 A;  4A5K A;  2PZ1 A;  1DDV A;  4GZU A;  4GPT B;  1AWE A;  5JLJ B;  2OTX A;  2LG1 A;  2I5C A;  1BWN A;  1PFJ A; 
#chains in the Genus database with same CATH topology
 2ZKM X;  3WYF B;  1SGH A;  4GNK B;  2DHI A;  1W1G A;  3M1I B;  1IRS A;  2D9X A;  1EVH A;  1U5E A;  4YL8 A;  3ZDT A;  1M7R A;  1T77 A;  5FI1 A;  4QJ4 B;  2D4Q A;  1E5W A;  3UZT A;  3ZVR A;  1U5G A;  2GCJ A;  2Z14 A;  4MK0 A;  3DCX A;  2D9Y A;  3KRX A;  3IVF A;  3FM8 C;  3ODX A;  4HDQ A;  5CLL B;  2H7D A;  4DIX A;  2NBV A;  5EFX A;  3FEH A;  5CLQ B;  3QWM A;  1W1D A;  3CIK A;  2DN6 A;  4BBK A;  4GN1 A;  1TJ6 A;  2YF0 A;  1P5T A;  3TW1 A;  4GOU A;  2VKI A;  5IRS A;  2QKM A;  4WJ7 A;  4Y94 A;  3DXD A;  1ZC4 B;  5HE2 A;  4CSQ A;  4F7G A;  2Z0O A;  3U12 A;  1QQG A;  1NU2 A;  3T06 A;  1BAK A;  2DA0 A;  2K8E A;  2RGN B;  2GS0 A;  1X11 A;  1V88 A;  2UZR A;  2XQN M;  1V89 A;  2V76 A;  1M7E A;  4K2O A;  2P0D A;  3MPX A;  3PSC A;  3B77 A;  4L1R A;  5I2S A;  2E2X A;  5C5B B;  5KCV A;  1DDW A;  2G35 A;  2AL6 A;  2D9Z A;  2KR0 A;  5M4Y B;  1OMW A;  2YS3 A;  4KHB A;  1U5D A;  2YVC A;  4EKU A;  3NW8 A;  1UNP A;  2W2X D;  4PQ0 A;  1FHX A;  3ODW A;  1NTY A;  2K2U A;  2D11 A;  2FJL A;  1OY2 A;  1FGZ A;  1WJ1 A;  3F0W A;  2K2J A;  2Y7B A;  1V5U A;  1Y5O A;  2K00 A;  2KUQ A;  5D3X A;  1DRO A;  2R2Y A;  2YS5 A;  3O96 A;  2DX5 A;  4ZRI A;  1K5G B;  2CY5 A;  4A6K A;  1J19 A;  5D3V A;  4DBB A;  4ZRK A;  1UEF A;  2RVB B;  5HE3 A;  3V5W A;  5L81 A;  2GUM A;  2J59 M;  3TO1 A;  4QJ5 B;  1FHO A;  4C0A A;  3FVC A;  4KHA A;  5D3W A;  2R09 A;  2IFS A;  4A6F B;  1RRP B;  2JP2 A;  4HDO A;  1RJ2 A;  2MKR A;  3NWF A;  2ELB A;  2COA A;  2ELA A;  4D6W A;  1H10 A;  1EF1 A;  3PVW A;  1N3H A;  1ZM0 A;  2AEH A;  4DX8 A;  1W1H A;  2D10 A;  4K2P A;  2Z13 A;  4H8S A;  2GCL A;  5C79 A;  3ULB A;  4K81 A;  3OAN A;  5FI0 A;  4IAP A;  3KY9 A;  1UNR A;  3GYO A;  1BTN A;  1EAZ A;  3TFM A;  2K49 A;  3AU5 A;  4KAX B;  2DKP A;  4HHV A;  4EJN A;  2EMS A;  2LYD A;  4HAZ B;  1AQC A;  4HAU B;  2J0K A;  1ZSQ A;  1X1F A;  3G9W A;  4KHO A;  2P8V A;  2D9V A;  1P6S A;  2DFK A;  3U7D A;  1MIZ B;  4PNK A;  1GC7 A;  1XD4 A;  3U8Z A;  2J0M A;  2NMB A;  2YSZ A;  4CHM A;  4Z2M B;  2NZ8 B;  2KIE A;  2MDX A;  3A8Q A;  2I1K A;  3D8E A;  2RLO A;  2DKQ A;  2KCJ A;  5KQ4 A;  1H4R A;  2P0F A;  2I1J A;  3SNH A;  4D0N B;  1MIX A;  3VIA A;  2EJ8 A;  1UPQ A;  5I2M A;  4A6H A;  2ROZ B;  2FJU B;  1MKE A;  3ML4 A;  1Y19 B;  5D3Y A;  2X18 A;  5GOW B;  3NSU A;  4IFS A;  2CRF A;  4Z2N A;  4GXB A;  2L1C A;  2RRF A;  1MAI A;  1TXD A;  3BJI A;  1V5P A;  3NWD A;  3ULC A;  5C6R A;  1MPH A;  2Y8F A;  4CYE A;  4HAT B;  3TCA A;  1ISN A;  1WGQ A;  1MK7 B;  1XKE A;  2R0D A;  1P3R A;  4HAY B;  4OT1 A;  3OHM B;  1U29 A;  1FGY A;  4HSI A;  2CAY A;  2Y8G A;  4QJ3 B;  2Z4D A;  5D27 A;  1U2B A;  3N7C A;  1U5F A;  3PVU A;  2UZS A;  3VOQ A;  1EGX A;  2IYB A;  3CXB B;  2COD A;  1B55 A;  3SYX A;  2GJY A;  3PG7 A;  1TQZ A;  1DBH A;  1Q67 A;  3NWA A;  3BIN A;  1PMS A;  1ZC3 B;  2D9W A;  3A98 B;  4DX9 0;  5C5B A;  2EC1 A;  2YS1 A;  2Z59 A;  1XR0 B;  1X05 A;  3HQC A;  3F5R A;  2Q13 A;  5DI9 B;  5JHH A;  4WVF B;  1Z87 A;  2N23 A;  1QC6 A;  1OQN A;  3PZD A;  2I5F A;  2BCJ A;  1SHC A;  2DLW A;  1FOE A;  2ZPY A;  4HB0 B;  2VRW B;  2Z0P A;  2Z0Q A;  1KI1 B;  2LKO A;  5J3Q A;  1I7A A;  1WG7 A;  2DYQ A;  3P6A A;  3SV1 A;  4F7H A;  3QIJ A;  4CHJ A;  3AJ4 A;  1KZ7 A;  3SO6 A;  2H7E A;  2VSZ A;  2COF A;  3LJU X;  4P7I A;  4NY0 A;  2DTC A;  3MDB C;  4MY6 A;  3ODO A;  5J3T A;  1NTV A;  3PP2 A;  4TKN A;  4K17 A;  2ADZ A;  4IOY X;  1WI1 A;  3D8D A;  1LW3 A;  4A6F A;  1K5D B;  5DIF B;  1FAO A;  4KHB B;  3AU4 A;  5HE0 A;  5LON B;  3PEG A;  4GMX B;  2RSG A;  2DHK A;  4L6E A;  2YT0 A;  1V61 A;  3KSY A;  3PVL A;  1ZVR A;  2QKL A;  1XOD A;  3HIE A;  3RCP A;  1UPR A;  2W2W A;  5DHA B;  3KZ1 A;  2L2I A;  5HE1 A;  5KQ1 A;  4HAW B;  2KGX B;  2DHJ A;  4WSF A;  5DH9 B;  4HB4 B;  3QBV B;  2YT2 A;  1MK9 B;  1WJM A;  2N0Y A;  4F7U P;  3TVV A;  1GG3 A;  1KZG A;  2LOZ A;  1X86 A;  4ZRJ A;  4TYZ A;  1WGU A;  1XCG A;  5DHF B;  1LB1 A;  3P7Z A;  2DYN A;  1X1G A;  2EMT A;  3D8F A;  2HTH B;  2W2X C;  3DXE A;  4OSN A;  3DXC A;  5J3Y A;  4HAX B;  2LUL A;  2OQB A;  5LOP B;  3GYP A;  1V5M A;  4MT7 A;  2MFQ A;  4GMV A;  1UNQ A;  4XWX A;  1FHW A;  5LG4 B;  4YON A;  5JP4 A;  3A8P A;  4HB3 B;  1DDM A;  2RUK B;  5C16 A;  1I2H A;  3SUZ A;  4NSW A;  2M38 A;  3HK0 A;  4EMO A;  4HB2 B;  1WVH A;  3KRW A;  4KVG B;  3WA0 A;  2YT1 A;  3X23 A;  1FB8 A;  3FSS A;  2P0H A;  3HW2 B;  2YRY A;  2KUP A;  2HE7 A;  2RNR B;  3A58 A;  1XX0 A;  1PLS A;  2D2Q A;  2MWN B;  1MI1 A;  2UVM A;  2J0J A;  5JHG A;  2ROV A;  2CY4 A;  1J0W A;  1NI2 A;  2KIG A;  2COC A;  1GC6 A;  1U27 A;  4HAV B;  4DXA B;  1DYN A;  2LOX A;  2M14 A;  3HSA A;  1BTK A;  4B6H A;  4QXA B;  1ZYI A;  2DX1 A;  2PZ1 A;  1DDV A;  4GZU A;  4A5K A;  4GPT B;  1AWE A;  5JLJ B;  2OTX A;  2LG1 A;  2I5C A;  1BWN A;  1PFJ A; 
#chains in the Genus database with same CATH homology
 3WYF B;  1SGH A;  2DHI A;  1W1G A;  3M1I B;  1IRS A;  2D9X A;  1EVH A;  1U5E A;  4YL8 A;  3ZDT A;  1M7R A;  5FI1 A;  2D4Q A;  1E5W A;  3UZT A;  3ZVR A;  1U5G A;  2GCJ A;  4MK0 A;  2D9Y A;  3KRX A;  3IVF A;  3FM8 C;  3ODX A;  4HDQ A;  5CLL B;  2H7D A;  5EFX A;  3FEH A;  5CLQ B;  3QWM A;  1W1D A;  3CIK A;  2DN6 A;  4BBK A;  4GN1 A;  1TJ6 A;  2YF0 A;  1P5T A;  3TW1 A;  2VKI A;  2QKM A;  4WJ7 A;  4Y94 A;  3DXD A;  1ZC4 B;  5HE2 A;  4F7G A;  2Z0O A;  1QQG A;  1NU2 A;  3T06 A;  1BAK A;  2DA0 A;  2RGN B;  2GS0 A;  1X11 A;  1V88 A;  2UZR A;  2XQN M;  1V89 A;  2V76 A;  1M7E A;  4K2O A;  2P0D A;  3MPX A;  3PSC A;  2E2X A;  5C5B B;  5KCV A;  1DDW A;  2G35 A;  2AL6 A;  2D9Z A;  1OMW A;  2YS3 A;  1U5D A;  2YVC A;  4EKU A;  1UNP A;  2W2X D;  4PQ0 A;  1FHX A;  3ODW A;  1NTY A;  2K2U A;  2D11 A;  2FJL A;  1OY2 A;  1FGZ A;  1WJ1 A;  3F0W A;  2K2J A;  2Y7B A;  1V5U A;  1Y5O A;  2K00 A;  5D3X A;  1DRO A;  2YS5 A;  3O96 A;  2DX5 A;  4ZRI A;  1K5G B;  2CY5 A;  4A6K A;  1J19 A;  5D3V A;  4DBB A;  4ZRK A;  1UEF A;  2RVB B;  5HE3 A;  3V5W A;  5L81 A;  2J59 M;  3TO1 A;  1FHO A;  4C0A A;  4KHA A;  5D3W A;  2R09 A;  2IFS A;  4A6F B;  1RRP B;  2JP2 A;  4HDO A;  1RJ2 A;  2MKR A;  2ELB A;  2COA A;  2ELA A;  1H10 A;  1EF1 A;  3PVW A;  1N3H A;  1ZM0 A;  2AEH A;  4DX8 A;  1W1H A;  2D10 A;  4K2P A;  4H8S A;  2GCL A;  5C79 A;  3ULB A;  4K81 A;  3OAN A;  5FI0 A;  4IAP A;  3KY9 A;  1UNR A;  3GYO A;  1BTN A;  1EAZ A;  3TFM A;  3AU5 A;  4KAX B;  2DKP A;  4HHV A;  4EJN A;  2EMS A;  2LYD A;  4HAZ B;  1AQC A;  4HAU B;  2J0K A;  1ZSQ A;  1X1F A;  3G9W A;  4KHO A;  2P8V A;  2D9V A;  1P6S A;  2DFK A;  3U7D A;  1MIZ B;  4PNK A;  1GC7 A;  1XD4 A;  3U8Z A;  2J0M A;  2NMB A;  2YSZ A;  4CHM A;  4Z2M B;  2NZ8 B;  2MDX A;  3A8Q A;  2I1K A;  3D8E A;  2RLO A;  2DKQ A;  2KCJ A;  5KQ4 A;  1H4R A;  2P0F A;  2I1J A;  3SNH A;  4D0N B;  1MIX A;  3VIA A;  2EJ8 A;  1UPQ A;  4A6H A;  2ROZ B;  1MKE A;  3ML4 A;  1Y19 B;  5D3Y A;  2X18 A;  5GOW B;  3NSU A;  4IFS A;  2CRF A;  4Z2N A;  4GXB A;  2L1C A;  1MAI A;  1TXD A;  3BJI A;  1V5P A;  3ULC A;  5C6R A;  1MPH A;  2Y8F A;  4CYE A;  4HAT B;  3TCA A;  1ISN A;  1WGQ A;  1MK7 B;  1XKE A;  2R0D A;  1P3R A;  4HAY B;  1U29 A;  1FGY A;  2CAY A;  2Y8G A;  5D27 A;  1U2B A;  3N7C A;  1U5F A;  3PVU A;  2UZS A;  3VOQ A;  1EGX A;  2IYB A;  3CXB B;  2COD A;  1B55 A;  3SYX A;  3PG7 A;  2GJY A;  1DBH A;  1TQZ A;  1Q67 A;  3BIN A;  1PMS A;  1ZC3 B;  2D9W A;  3A98 B;  4DX9 0;  5C5B A;  2EC1 A;  2YS1 A;  1XR0 B;  1X05 A;  3HQC A;  3F5R A;  2Q13 A;  5DI9 B;  5JHH A;  4WVF B;  1Z87 A;  2N23 A;  1QC6 A;  1OQN A;  3PZD A;  2I5F A;  2BCJ A;  1SHC A;  2DLW A;  1FOE A;  2ZPY A;  4HB0 B;  2VRW B;  2Z0P A;  2Z0Q A;  1KI1 B;  2LKO A;  5J3Q A;  1I7A A;  1WG7 A;  2DYQ A;  3P6A A;  3SV1 A;  4F7H A;  3QIJ A;  4CHJ A;  3AJ4 A;  1KZ7 A;  3SO6 A;  2H7E A;  2VSZ A;  2COF A;  3LJU X;  4P7I A;  4NY0 A;  2DTC A;  3MDB C;  4MY6 A;  3ODO A;  5J3T A;  1NTV A;  3PP2 A;  4TKN A;  4K17 A;  2ADZ A;  4IOY X;  1WI1 A;  3D8D A;  1LW3 A;  4A6F A;  1K5D B;  5DIF B;  1FAO A;  4KHB B;  3AU4 A;  5HE0 A;  5LON B;  3PEG A;  4GMX B;  2RSG A;  2DHK A;  4L6E A;  2YT0 A;  1V61 A;  3KSY A;  3PVL A;  1ZVR A;  2QKL A;  1XOD A;  3RCP A;  1UPR A;  2W2W A;  5DHA B;  3KZ1 A;  2L2I A;  5HE1 A;  5KQ1 A;  4HAW B;  2KGX B;  2DHJ A;  4WSF A;  5DH9 B;  4HB4 B;  3QBV B;  1MK9 B;  1WJM A;  2N0Y A;  4F7U P;  3TVV A;  1GG3 A;  1KZG A;  2LOZ A;  1X86 A;  4ZRJ A;  4TYZ A;  1WGU A;  1XCG A;  5DHF B;  1LB1 A;  3P7Z A;  2DYN A;  1X1G A;  2EMT A;  3D8F A;  2HTH B;  2W2X C;  3DXE A;  3DXC A;  5J3Y A;  4HAX B;  2LUL A;  2OQB A;  5LOP B;  3GYP A;  1V5M A;  4MT7 A;  2MFQ A;  4GMV A;  1UNQ A;  4XWX A;  1FHW A;  4YON A;  5JP4 A;  3A8P A;  4HB3 B;  1DDM A;  2RUK B;  5C16 A;  1I2H A;  3SUZ A;  4NSW A;  2M38 A;  3HK0 A;  4EMO A;  4HB2 B;  1WVH A;  3KRW A;  4KVG B;  3WA0 A;  2YT1 A;  3X23 A;  1FB8 A;  3FSS A;  2P0H A;  3HW2 B;  2YRY A;  2KUP A;  2HE7 A;  2RNR B;  1XX0 A;  1PLS A;  2D2Q A;  2MWN B;  2UVM A;  2J0J A;  5JHG A;  2ROV A;  2CY4 A;  1J0W A;  1NI2 A;  2COC A;  1GC6 A;  1U27 A;  4HAV B;  4DXA B;  1DYN A;  2LOX A;  2M14 A;  1BTK A;  4B6H A;  2DX1 A;  4A5K A;  2PZ1 A;  1DDV A;  4GZU A;  4GPT B;  1AWE A;  5JLJ B;  2OTX A;  2LG1 A;  2I5C A;  1BWN A;  1PFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...