5GOWB

Solution structure of the complex between dp1 acidic region and tfiih p62 ph domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DP1
publication title The Interaction Mode of the Acidic Region of the Cell Cycle Transcription Factor DP1 with TFIIH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5gowB00
1V5PA 1XR0B 2COFA 2I5FA 3SYXA 5GOWB 2H7EA 3A98B 3T06A 1KZGA 1J0WA 4HB4B 1ZVRA 2J59M 2K2JA 1ZSQA 2YT1A 1TXDA 1XX0A 1BAKA 3SNHA 1K5GB 1UNQA 3DXDA 1X86A 3AU5A 5C16A 4KHOA 3PVLA 1M7EA 2RSGA 1OQNA 2DHJA 5D3WA 1IRSA 1U5EA 2LOXA 4IFSA 1AQCA 3TFMA 2EC1A 3G9WA 1H10A 1NTYA 1P3RA 4IOYX 1PFJA 4F7UP 2XQNM 5J3TA 2M14A 3PVWA 1V89A 4GMVA 1FGYA 3TW1A 2DYNA 3AU4A 2RNRB 4CHMA 2IYBA 4D0NB 3HQCA 1MIXA 5EFXA 4DX90 4KVGB 4TYZA 4HAVB 1FHOA 3D8EA 1LW3A 2EJ8A 2ZPYA 2P0DA 4MY6A 2YF0A 5DIFB 2CAYA 1WVHA 4ZRIA 3VOQA 1GC7A 3HW2B 1PLSA 3ODWA 3A8PA 4K2PA 2D2QA 4C0AA 3QBVB 1H4RA 1KZ7A 2D9WA 4DBBA 4WVFB 2J0JA 3RCPA 1K5DB 2G35A 1Y5OA 3NSUA 2PZ1A 1U5DA 1XODA 1UEFA 1BTKA 3PEGA 4HB2B 5CLLB 3PVUA 2Y8GA 3DXCA 1PMSA 2J0KA 3SV1A 1QQGA 4HAXB 4HATB 1FHWA 1U5GA 2RGNB 4EMOA 5C79A 4K2OA 3PG7A 1RRPB 4GPTB 1XKEA 5C5BA 5JHHA 1XCGA 2W2XC 1LB1A 5HE3A 1MK9B 1SGHA 2DYQA 2ADZA 2YS5A 2GS0A 4GZUA 2M38A 2ROVA 1X1FA 5D3YA 1I2HA 2NMBA 4HB3B 2DX1A 2KUPA 2P8VA 4P7IA 4A5KA 2KGXB 2Z0PA 4WJ7A 2COAA 1M7RA 3CIKA 3KSYA 1WJ1A 1UPRA 2HTHB 2W2XD 4KHAA 1U27A 2ELBA 2QKMA 2RLOA 5KQ1A 3N7CA 3M1IB 5KCVA 1NTVA 1N3HA 4IAPA 3TVVA 3TO1A 1I7AA 2D9YA 5CLQB 2K2UA 2JP2A 1P5TA 3IVFA 2YT0A 5C5BB 2L1CA 2X18A 3D8FA 2L2IA 3ODXA 4YONA 2D11A 2DKPA 2NZ8B 2N0YA 3PP2A 1WI1A 3D8DA 5LONB 4Y94A 3OANA 3U8ZA 1MIZB 2DHIA 2BCJA 5J3QA 5FI1A 3BJIA 3SO6A 2I1KA 4YL8A 4A6HA 2UZRA 1EVHA 2VRWB 1NU2A 2D4QA 1DBHA 2H7DA 3U7DA 2EMSA 3VIAA 1OY2A 4EJNA 4A6FA 1X11A 3WA0A 1RJ2A 3O96A 2RVBB 1SHCA 2I1JA 4DX8A 3QWMA 4HAYB 2AL6A 4K81A 5KQ4A 2LULA 2CY5A 2YS3A 4L6EA 2D9VA 2R09A 2P0HA 2R0DA 1MK7B 2W2WA 1ZC4B 1FB8A 2FJLA 2KCJA 2DX5A 2OQBA 5DI9B 5D3XA 4K17A 1AWEA 4NY0A 1Y19B 1EGXA 1FAOA 2Z0QA 1V5UA 1U5FA 4DXAB 1E5WA 4Z2NA 1UNPA 5DHFB 1KI1B 1MPHA 1QC6A 2Z0OA 2E2XA 1TQZA 2DA0A 3FM8C 2K00A 1X05A 2ELAA 2CRFA 3FEHA 1DDMA 1V5MA 4HAWB 2QKLA 2DN6A 4A6FB 3UZTA 2P0FA 2UVMA 5DH9B 1UNRA 2RUKB 2EMTA 3PZDA 2J0MA 2Y7BA 1EAZA 3DXEA 2MDXA 2DKQA 5L81A 2Y8FA 1P6SA 3MPXA 1BWNA 2AEHA 1WG7A 4ZRKA 3BINA 3KRXA 2YSZA 3PSCA 1ZM0A 3ML4A 1FGZA 1FOEA 5LOPB 4HB0B 4GMXB 2Q13A 4MK0A 2DHKA 3CXBB 2MKRA 3KRWA 3FSSA 4GN1A 4H8SA 4HAUB 1J19A 2DLWA 3KZ1A 2VSZA 5J3YA 4NSWA 2OTXA 3P7ZA 2D9ZA 2LOZA 1XD4A 2D9XA 5HE0A 1FHXA 2UZSA 1W1HA 5JLJB 5C6RA 5D3VA 3ULBA 4ZRJA 3GYOA 1EF1A 3X23A 4A6KA 4Z2MB 3ODOA 2YVCA 2LKOA 1MAIA 3GYPA 1V61A 2ROZB 1GC6A 2YS1A 1UPQA 3P6AA 4WSFA 2GJYA 4B6HA 5D27A 1ZC3B 4CHJA 4PQ0A 1ISNA 3KY9A 2D10A 1DDWA 5JP4A 2CY4A 3QIJA 4HDOA 2VKIA 3ULCA 2MWNB 2V76A 2YRYA 2HE7A 1W1DA 3ZVRA 1V88A 1DDVA 1U29A 5DHAB 4KHBB 2MFQA 3WYFB 4HDQA 5JHGA 4BBKA 5HE2A 1WGUA 4HHVA 4PNKA 2DTCA 2N23A 3SUZA 2LYDA 1NI2A 4HAZB 5HE1A 4MT7A 3V5WA 1BTNA 4XWXA 1DROA 1OMWA 2DFKA 5FI0A 4CYEA 3LJUX 1Q67A 3F0WA 1WJMA 1U2BA 1GG3A 1X1GA 2CODA 2LG1A 1WGQA 1W1GA 2IFSA 1Z87A 3A8QA 1TJ6A 4GXBA 3MDBC 1B55A 2GCJA 4F7GA 3AJ4A 2COCA 3TCAA 4F7HA 1MKEA 3HK0A 2GCLA 1DYNA 2I5CA 4EKUA 3ZDTA 3F5RA 4KAXB 4TKNA
chains in the Genus database with same CATH superfamily
1V5PA 1XR0B 2COFA 2I5FA 2NBVA 3SYXA 5GOWB 2H7EA 3A98B 3T06A 1KZGA 1J0WA 4HB4B 1ZVRA 2J59M 2K2JA 1ZSQA 2YT1A 1TXDA 1XX0A 3OHMB 1BAKA 3SNHA 1MI1A 1K5GB 1UNQA 3DXDA 1X86A 3AU5A 5C16A 4KHOA 3HIEA 3PVLA 1M7EA 2RSGA 1OQNA 2DHJA 5D3WA 1IRSA 1U5EA 2LOXA 4IFSA 1AQCA 3TFMA 2EC1A 3G9WA 1H10A 1NTYA 1P3RA 4IOYX 1PFJA 4F7UP 2XQNM 5M4YB 5J3TA 2M14A 3PVWA 1V89A 4GMVA 1FGYA 3TW1A 4QJ4B 2DYNA 3AU4A 2RNRB 4CHMA 2Z59A 2IYBA 4D0NB 3HQCA 1MIXA 5EFXA 4D6WA 4DX90 4KVGB 4TYZA 4HAVB 4QJ3B 1FHOA 3D8EA 1LW3A 2EJ8A 2ZPYA 2P0DA 4MY6A 2YF0A 5DIFB 2CAYA 1WVHA 4ZRIA 3VOQA 1GC7A 3HW2B 1PLSA 3ODWA 3A8PA 3NW8A 4K2PA 2D2QA 4C0AA 3QBVB 1H4RA 1KZ7A 2D9WA 4DBBA 4WVFB 2J0JA 3RCPA 4OT1A 1K5DB 3NWDA 3DCXA 2G35A 2Z13A 1Y5OA 3NSUA 2YT2A 2PZ1A 4DIXA 1U5DA 1XODA 1UEFA 1BTKA 3PEGA 4HB2B 5CLLB 3PVUA 2Y8GA 3DXCA 3NWAA 1PMSA 2KIEA 2J0KA 3SV1A 1QQGA 4HAXB 4HATB 1FHWA 1U5GA 2RGNB 4EMOA 5C79A 4K2OA 3PG7A 1RRPB 4GPTB 1XKEA 5C5BA 5JHHA 1XCGA 2W2XC 1LB1A 5HE3A 1MK9B 1SGHA 2DYQA 4QJ5B 2ADZA 2YS5A 2GS0A 4GZUA 3FVCA 2M38A 2ROVA 1X1FA 2RRFA 1I2HA 2NMBA 5D3YA 4HB3B 4GNKB 2DX1A 2KUPA 2P8VA 4P7IA 4A5KA 2KGXB 2Z0PA 4WJ7A 2COAA 1M7RA 3CIKA 3KSYA 1WJ1A 1UPRA 2HTHB 2W2XD 4KHAA 1U27A 5IRSA 2ELBA 2QKMA 2RLOA 5KQ1A 3N7CA 3M1IB 5KCVA 1NTVA 1N3HA 4IAPA 3TVVA 3TO1A 1I7AA 2D9YA 5CLQB 2K2UA 2JP2A 1P5TA 3IVFA 2YT0A 5C5BB 2L1CA 2X18A 3D8FA 2L2IA 3ODXA 4YONA 2D11A 2Z14A 1ZYIA 2DKPA 2NZ8B 2N0YA 2GUMA 3PP2A 1WI1A 3D8DA 5LONB 4L1RA 2KR0A 4Y94A 3OANA 3U8ZA 1MIZB 2DHIA 2BCJA 5J3QA 5FI1A 3BJIA 3SO6A 2I1KA 4YL8A 2K49A 4A6HA 2UZRA 1EVHA 2VRWB 1NU2A 2D4QA 1DBHA 2H7DA 3U7DA 2EMSA 3VIAA 1OY2A 4EJNA 4A6FA 1X11A 3WA0A 1RJ2A 2RVBB 1SHCA 2I1JA 3O96A 4DX8A 3QWMA 4HAYB 2AL6A 4K81A 5KQ4A 2LULA 2CY5A 2YS3A 4L6EA 2D9VA 2KIGA 2P0HA 1T77A 1MK7B 2R0DA 2R09A 2W2WA 1ZC4B 1FB8A 2FJLA 2ZKMX 2KCJA 2DX5A 3U12A 2OQBA 5DI9B 5D3XA 4K17A 1AWEA 4NY0A 1Y19B 1EGXA 1FAOA 2Z0QA 1V5UA 1U5FA 4DXAB 1E5WA 4Z2NA 1UNPA 5DHFB 1KI1B 1MPHA 1QC6A 2Z0OA 2E2XA 4HSIA 1TQZA 2DA0A 3FM8C 2K00A 1X05A 2ELAA 2CRFA 3FEHA 1DDMA 1V5MA 2KUQA 3B77A 4HAWB 5LG4B 2QKLA 2DN6A 4A6FB 3UZTA 2P0FA 2UVMA 5DH9B 1UNRA 2RUKB 2EMTA 3PZDA 2J0MA 2Y7BA 1EAZA 3DXEA 2MDXA 2DKQA 5L81A 2Y8FA 1P6SA 3MPXA 1BWNA 2AEHA 1WG7A 4ZRKA 3BINA 3KRXA 5I2SA 2YSZA 5I2MA 3PSCA 1ZM0A 2R2YA 3ML4A 1FGZA 1FOEA 5LOPB 4HB0B 4GMXB 2Q13A 4MK0A 2DHKA 3CXBB 2MKRA 3KRWA 3FSSA 4GN1A 4H8SA 4HAUB 1J19A 2DLWA 3KZ1A 2VSZA 5J3YA 4NSWA 2OTXA 3P7ZA 2D9ZA 3HSAA 2LOZA 1XD4A 2D9XA 4KHBA 4OSNA 5HE0A 1FHXA 2UZSA 1W1HA 5JLJB 5C6RA 5D3VA 3ULBA 4ZRJA 3GYOA 3A58A 1EF1A 3X23A 4A6KA 4Z2MB 3ODOA 2YVCA 2LKOA 2FJUB 1MAIA 3GYPA 1V61A 2ROZB 1GC6A 4GOUA 2YS1A 1UPQA 3P6AA 4WSFA 2GJYA 4B6HA 5D27A 3NWFA 1ZC3B 4CHJA 4PQ0A 1ISNA 3KY9A 2D10A 1DDWA 5JP4A 2CY4A 3QIJA 4HDOA 2VKIA 3ULCA 2MWNB 2V76A 2YRYA 2HE7A 1W1DA 3ZVRA 1V88A 1DDVA 1U29A 5DHAB 4CSQA 4KHBB 2MFQA 2K8EA 3WYFB 4HDQA 5JHGA 4QXAB 4BBKA 5HE2A 1WGUA 4HHVA 4PNKA 2DTCA 2N23A 3SUZA 2LYDA 1NI2A 4HAZB 5HE1A 4MT7A 3V5WA 1BTNA 4XWXA 1DROA 1OMWA 2DFKA 5FI0A 4CYEA 3LJUX 1Q67A 3F0WA 1WJMA 1U2BA 1GG3A 1X1GA 2CODA 2LG1A 1WGQA 1W1GA 2IFSA 1Z87A 3A8QA 1TJ6A 4GXBA 3MDBC 1B55A 2GCJA 4F7GA 3AJ4A 2COCA 3TCAA 4F7HA 1MKEA 3HK0A 2GCLA 1DYNA 2I5CA 2Z4DA 4EKUA 3ZDTA 3F5RA 4KAXB 4TKNA
chains in the Genus database with same CATH topology
1V5PA 1XR0B 2COFA 2I5FA 3SYXA 5GOWB 2H7EA 3A98B 3T06A 1KZGA 1J0WA 4HB4B 1ZVRA 2J59M 2K2JA 1ZSQA 2YT1A 1TXDA 1XX0A 1BAKA 3SNHA 1K5GB 1UNQA 3DXDA 1X86A 3AU5A 5C16A 4KHOA 3PVLA 1M7EA 2RSGA 1OQNA 2DHJA 5D3WA 1IRSA 1U5EA 2LOXA 4IFSA 1AQCA 3TFMA 2EC1A 3G9WA 1H10A 1NTYA 1P3RA 4IOYX 1PFJA 4F7UP 2XQNM 5J3TA 2M14A 3PVWA 1V89A 4GMVA 1FGYA 3TW1A 2DYNA 3AU4A 2RNRB 4CHMA 2IYBA 4D0NB 3HQCA 1MIXA 5EFXA 4DX90 4KVGB 4TYZA 4HAVB 1FHOA 3D8EA 1LW3A 2EJ8A 2ZPYA 2P0DA 4MY6A 2YF0A 5DIFB 2CAYA 1WVHA 4ZRIA 3VOQA 1GC7A 3HW2B 1PLSA 3ODWA 3A8PA 4K2PA 2D2QA 4C0AA 3QBVB 1H4RA 1KZ7A 2D9WA 4DBBA 4WVFB 2J0JA 3RCPA 1K5DB 2G35A 1Y5OA 3NSUA 2PZ1A 1U5DA 1XODA 1UEFA 1BTKA 3PEGA 4HB2B 5CLLB 3PVUA 2Y8GA 3DXCA 1PMSA 2J0KA 3SV1A 1QQGA 4HAXB 4HATB 1FHWA 1U5GA 2RGNB 4EMOA 5C79A 4K2OA 3PG7A 1RRPB 4GPTB 1XKEA 5C5BA 5JHHA 1XCGA 2W2XC 1LB1A 5HE3A 1MK9B 1SGHA 2DYQA 2ADZA 2YS5A 2GS0A 4GZUA 2M38A 2ROVA 1X1FA 5D3YA 1I2HA 2NMBA 4HB3B 2DX1A 2KUPA 2P8VA 4P7IA 4A5KA 2KGXB 2Z0PA 4WJ7A 2COAA 1M7RA 3CIKA 3KSYA 1WJ1A 1UPRA 2HTHB 2W2XD 4KHAA 1U27A 2ELBA 2QKMA 2RLOA 5KQ1A 3N7CA 3M1IB 5KCVA 1NTVA 1N3HA 4IAPA 3TVVA 3TO1A 1I7AA 2D9YA 5CLQB 2K2UA 2JP2A 1P5TA 3IVFA 2YT0A 5C5BB 2L1CA 2X18A 3D8FA 2L2IA 3ODXA 4YONA 2D11A 2DKPA 2NZ8B 2N0YA 3PP2A 1WI1A 3D8DA 5LONB 4Y94A 3OANA 3U8ZA 1MIZB 2DHIA 2BCJA 5J3QA 5FI1A 3BJIA 3SO6A 2I1KA 4YL8A 4A6HA 2UZRA 1EVHA 2VRWB 1NU2A 2D4QA 1DBHA 2H7DA 3U7DA 2EMSA 3VIAA 1OY2A 4EJNA 4A6FA 1X11A 3WA0A 1RJ2A 3O96A 2RVBB 1SHCA 2I1JA 4DX8A 3QWMA 4HAYB 2AL6A 4K81A 5KQ4A 2LULA 2CY5A 2YS3A 4L6EA 2D9VA 2R09A 2P0HA 2R0DA 1MK7B 2W2WA 1ZC4B 1FB8A 2FJLA 2KCJA 2DX5A 2OQBA 5DI9B 5D3XA 4K17A 1AWEA 4NY0A 1Y19B 1EGXA 1FAOA 2Z0QA 1V5UA 1U5FA 4DXAB 1E5WA 4Z2NA 1UNPA 5DHFB 1KI1B 1MPHA 1QC6A 2Z0OA 2E2XA 1TQZA 2DA0A 3FM8C 2K00A 1X05A 2ELAA 2CRFA 3FEHA 1DDMA 1V5MA 4HAWB 2QKLA 2DN6A 4A6FB 3UZTA 2P0FA 2UVMA 5DH9B 1UNRA 2RUKB 2EMTA 3PZDA 2J0MA 2Y7BA 1EAZA 3DXEA 2MDXA 2DKQA 5L81A 2Y8FA 1P6SA 3MPXA 1BWNA 2AEHA 1WG7A 4ZRKA 3BINA 3KRXA 2YSZA 3PSCA 1ZM0A 3ML4A 1FGZA 1FOEA 5LOPB 4HB0B 4GMXB 2Q13A 4MK0A 2DHKA 3CXBB 2MKRA 3KRWA 3FSSA 4GN1A 4H8SA 4HAUB 1J19A 2DLWA 3KZ1A 2VSZA 5J3YA 4NSWA 2OTXA 3P7ZA 2D9ZA 2LOZA 1XD4A 2D9XA 5HE0A 1FHXA 2UZSA 1W1HA 5JLJB 5C6RA 5D3VA 3ULBA 4ZRJA 3GYOA 1EF1A 3X23A 4A6KA 4Z2MB 3ODOA 2YVCA 2LKOA 1MAIA 3GYPA 1V61A 2ROZB 1GC6A 2YS1A 1UPQA 3P6AA 4WSFA 2GJYA 4B6HA 5D27A 1ZC3B 4CHJA 4PQ0A 1ISNA 3KY9A 2D10A 1DDWA 5JP4A 2CY4A 3QIJA 4HDOA 2VKIA 3ULCA 2MWNB 2V76A 2YRYA 2HE7A 1W1DA 3ZVRA 1V88A 1DDVA 1U29A 5DHAB 4KHBB 2MFQA 3WYFB 4HDQA 5JHGA 4BBKA 5HE2A 1WGUA 4HHVA 4PNKA 2DTCA 2N23A 3SUZA 2LYDA 1NI2A 4HAZB 5HE1A 4MT7A 3V5WA 1BTNA 4XWXA 1DROA 1OMWA 2DFKA 5FI0A 4CYEA 3LJUX 1Q67A 3F0WA 1WJMA 1U2BA 1GG3A 1X1GA 2CODA 2LG1A 1WGQA 1W1GA 2IFSA 1Z87A 3A8QA 1TJ6A 4GXBA 3MDBC 1B55A 2GCJA 4F7GA 3AJ4A 2COCA 3TCAA 4F7HA 1MKEA 3HK0A 2GCLA 1DYNA 2I5CA 4EKUA 3ZDTA 3F5RA 4KAXB 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5P A;  1XR0 B;  2COF A;  2I5F A;  3SYX A;  5GOW B;  2H7E A;  3A98 B;  3T06 A;  1KZG A;  1J0W A;  4HB4 B;  1ZVR A;  2J59 M;  2K2J A;  1ZSQ A;  2YT1 A;  1TXD A;  1XX0 A;  1BAK A;  3SNH A;  1K5G B;  1UNQ A;  3DXD A;  1X86 A;  3AU5 A;  5C16 A;  4KHO A;  3PVL A;  1M7E A;  2RSG A;  1OQN A;  2DHJ A;  5D3W A;  1IRS A;  1U5E A;  2LOX A;  4IFS A;  1AQC A;  3TFM A;  2EC1 A;  3G9W A;  1H10 A;  1NTY A;  1P3R A;  4IOY X;  1PFJ A;  4F7U P;  2XQN M;  5J3T A;  2M14 A;  3PVW A;  1V89 A;  4GMV A;  1FGY A;  3TW1 A;  2DYN A;  3AU4 A;  2RNR B;  4CHM A;  2IYB A;  4D0N B;  3HQC A;  1MIX A;  5EFX A;  4DX9 0;  4KVG B;  4TYZ A;  4HAV B;  1FHO A;  3D8E A;  1LW3 A;  2EJ8 A;  2ZPY A;  2P0D A;  4MY6 A;  2YF0 A;  5DIF B;  2CAY A;  1WVH A;  4ZRI A;  3VOQ A;  1GC7 A;  3HW2 B;  1PLS A;  3ODW A;  3A8P A;  4K2P A;  2D2Q A;  4C0A A;  3QBV B;  1H4R A;  1KZ7 A;  2D9W A;  4DBB A;  4WVF B;  2J0J A;  3RCP A;  1K5D B;  2G35 A;  1Y5O A;  3NSU A;  2PZ1 A;  1U5D A;  1XOD A;  1UEF A;  1BTK A;  3PEG A;  4HB2 B;  5CLL B;  3PVU A;  2Y8G A;  3DXC A;  1PMS A;  2J0K A;  3SV1 A;  1QQG A;  4HAX B;  4HAT B;  1FHW A;  1U5G A;  2RGN B;  4EMO A;  5C79 A;  4K2O A;  3PG7 A;  1RRP B;  4GPT B;  1XKE A;  5C5B A;  5JHH A;  1XCG A;  2W2X C;  1LB1 A;  5HE3 A;  1MK9 B;  1SGH A;  2DYQ A;  2ADZ A;  2YS5 A;  2GS0 A;  4GZU A;  2M38 A;  2ROV A;  1X1F A;  5D3Y A;  1I2H A;  2NMB A;  4HB3 B;  2DX1 A;  2KUP A;  2P8V A;  4P7I A;  4A5K A;  2KGX B;  2Z0P A;  4WJ7 A;  2COA A;  1M7R A;  3CIK A;  3KSY A;  1WJ1 A;  1UPR A;  2HTH B;  2W2X D;  4KHA A;  1U27 A;  2ELB A;  2QKM A;  2RLO A;  5KQ1 A;  3N7C A;  3M1I B;  5KCV A;  1NTV A;  1N3H A;  4IAP A;  3TVV A;  3TO1 A;  1I7A A;  2D9Y A;  5CLQ B;  2K2U A;  2JP2 A;  1P5T A;  3IVF A;  2YT0 A;  5C5B B;  2L1C A;  2X18 A;  3D8F A;  2L2I A;  3ODX A;  4YON A;  2D11 A;  2DKP A;  2NZ8 B;  2N0Y A;  3PP2 A;  1WI1 A;  3D8D A;  5LON B;  4Y94 A;  3OAN A;  3U8Z A;  1MIZ B;  2DHI A;  2BCJ A;  5J3Q A;  5FI1 A;  3BJI A;  3SO6 A;  2I1K A;  4YL8 A;  4A6H A;  2UZR A;  1EVH A;  2VRW B;  1NU2 A;  2D4Q A;  1DBH A;  2H7D A;  3U7D A;  2EMS A;  3VIA A;  1OY2 A;  4EJN A;  4A6F A;  1X11 A;  3WA0 A;  1RJ2 A;  3O96 A;  2RVB B;  1SHC A;  2I1J A;  4DX8 A;  3QWM A;  4HAY B;  2AL6 A;  4K81 A;  5KQ4 A;  2LUL A;  2CY5 A;  2YS3 A;  4L6E A;  2D9V A;  2R09 A;  2P0H A;  2R0D A;  1MK7 B;  2W2W A;  1ZC4 B;  1FB8 A;  2FJL A;  2KCJ A;  2DX5 A;  2OQB A;  5DI9 B;  5D3X A;  4K17 A;  1AWE A;  4NY0 A;  1Y19 B;  1EGX A;  1FAO A;  2Z0Q A;  1V5U A;  1U5F A;  4DXA B;  1E5W A;  4Z2N A;  1UNP A;  5DHF B;  1KI1 B;  1MPH A;  1QC6 A;  2Z0O A;  2E2X A;  1TQZ A;  2DA0 A;  3FM8 C;  2K00 A;  1X05 A;  2ELA A;  2CRF A;  3FEH A;  1DDM A;  1V5M A;  4HAW B;  2QKL A;  2DN6 A;  4A6F B;  3UZT A;  2P0F A;  2UVM A;  5DH9 B;  1UNR A;  2RUK B;  2EMT A;  3PZD A;  2J0M A;  2Y7B A;  1EAZ A;  3DXE A;  2MDX A;  2DKQ A;  5L81 A;  2Y8F A;  1P6S A;  3MPX A;  1BWN A;  2AEH A;  1WG7 A;  4ZRK A;  3BIN A;  3KRX A;  2YSZ A;  3PSC A;  1ZM0 A;  3ML4 A;  1FGZ A;  1FOE A;  5LOP B;  4HB0 B;  4GMX B;  2Q13 A;  4MK0 A;  2DHK A;  3CXB B;  2MKR A;  3KRW A;  3FSS A;  4GN1 A;  4H8S A;  4HAU B;  1J19 A;  2DLW A;  3KZ1 A;  2VSZ A;  5J3Y A;  4NSW A;  2OTX A;  3P7Z A;  2D9Z A;  2LOZ A;  1XD4 A;  2D9X A;  5HE0 A;  1FHX A;  2UZS A;  1W1H A;  5JLJ B;  5C6R A;  5D3V A;  3ULB A;  4ZRJ A;  3GYO A;  1EF1 A;  3X23 A;  4A6K A;  4Z2M B;  3ODO A;  2YVC A;  2LKO A;  1MAI A;  3GYP A;  1V61 A;  2ROZ B;  1GC6 A;  2YS1 A;  1UPQ A;  3P6A A;  4WSF A;  2GJY A;  4B6H A;  5D27 A;  1ZC3 B;  4CHJ A;  4PQ0 A;  1ISN A;  3KY9 A;  2D10 A;  1DDW A;  5JP4 A;  2CY4 A;  3QIJ A;  4HDO A;  2VKI A;  3ULC A;  2MWN B;  2V76 A;  2YRY A;  2HE7 A;  1W1D A;  3ZVR A;  1V88 A;  1DDV A;  1U29 A;  5DHA B;  4KHB B;  2MFQ A;  3WYF B;  4HDQ A;  5JHG A;  4BBK A;  5HE2 A;  1WGU A;  4HHV A;  4PNK A;  2DTC A;  2N23 A;  3SUZ A;  2LYD A;  1NI2 A;  4HAZ B;  5HE1 A;  4MT7 A;  3V5W A;  1BTN A;  4XWX A;  1DRO A;  1OMW A;  2DFK A;  5FI0 A;  4CYE A;  3LJU X;  1Q67 A;  3F0W A;  1WJM A;  1U2B A;  1GG3 A;  1X1G A;  2COD A;  2LG1 A;  1WGQ A;  1W1G A;  2IFS A;  1Z87 A;  3A8Q A;  1TJ6 A;  4GXB A;  3MDB C;  1B55 A;  2GCJ A;  4F7G A;  3AJ4 A;  2COC A;  3TCA A;  4F7H A;  1MKE A;  3HK0 A;  2GCL A;  1DYN A;  2I5C A;  4EKU A;  3ZDT A;  3F5R A;  4KAX B;  4TKN A; 
#chains in the Genus database with same CATH topology
 1V5P A;  1XR0 B;  2COF A;  2I5F A;  2NBV A;  3SYX A;  5GOW B;  2H7E A;  3A98 B;  3T06 A;  1KZG A;  1J0W A;  4HB4 B;  1ZVR A;  2J59 M;  2K2J A;  1ZSQ A;  2YT1 A;  1TXD A;  1XX0 A;  3OHM B;  1BAK A;  3SNH A;  1MI1 A;  1K5G B;  1UNQ A;  3DXD A;  1X86 A;  3AU5 A;  5C16 A;  4KHO A;  3HIE A;  3PVL A;  1M7E A;  2RSG A;  1OQN A;  2DHJ A;  5D3W A;  1IRS A;  1U5E A;  2LOX A;  4IFS A;  1AQC A;  3TFM A;  2EC1 A;  3G9W A;  1H10 A;  1NTY A;  1P3R A;  4IOY X;  1PFJ A;  4F7U P;  2XQN M;  5M4Y B;  5J3T A;  2M14 A;  3PVW A;  1V89 A;  4GMV A;  1FGY A;  3TW1 A;  4QJ4 B;  2DYN A;  3AU4 A;  2RNR B;  4CHM A;  2Z59 A;  2IYB A;  4D0N B;  3HQC A;  1MIX A;  5EFX A;  4D6W A;  4DX9 0;  4KVG B;  4TYZ A;  4HAV B;  4QJ3 B;  1FHO A;  3D8E A;  1LW3 A;  2EJ8 A;  2ZPY A;  2P0D A;  4MY6 A;  2YF0 A;  5DIF B;  2CAY A;  1WVH A;  4ZRI A;  3VOQ A;  1GC7 A;  3HW2 B;  1PLS A;  3ODW A;  3A8P A;  3NW8 A;  4K2P A;  2D2Q A;  4C0A A;  3QBV B;  1H4R A;  1KZ7 A;  2D9W A;  4DBB A;  4WVF B;  2J0J A;  3RCP A;  4OT1 A;  1K5D B;  3NWD A;  3DCX A;  2G35 A;  2Z13 A;  1Y5O A;  3NSU A;  2YT2 A;  2PZ1 A;  4DIX A;  1U5D A;  1XOD A;  1UEF A;  1BTK A;  3PEG A;  4HB2 B;  5CLL B;  3PVU A;  2Y8G A;  3DXC A;  3NWA A;  1PMS A;  2KIE A;  2J0K A;  3SV1 A;  1QQG A;  4HAX B;  4HAT B;  1FHW A;  1U5G A;  2RGN B;  4EMO A;  5C79 A;  4K2O A;  3PG7 A;  1RRP B;  4GPT B;  1XKE A;  5C5B A;  5JHH A;  1XCG A;  2W2X C;  1LB1 A;  5HE3 A;  1MK9 B;  1SGH A;  2DYQ A;  4QJ5 B;  2ADZ A;  2YS5 A;  2GS0 A;  4GZU A;  3FVC A;  2M38 A;  2ROV A;  1X1F A;  2RRF A;  1I2H A;  2NMB A;  5D3Y A;  4HB3 B;  4GNK B;  2DX1 A;  2KUP A;  2P8V A;  4P7I A;  4A5K A;  2KGX B;  2Z0P A;  4WJ7 A;  2COA A;  1M7R A;  3CIK A;  3KSY A;  1WJ1 A;  1UPR A;  2HTH B;  2W2X D;  4KHA A;  1U27 A;  5IRS A;  2ELB A;  2QKM A;  2RLO A;  5KQ1 A;  3N7C A;  3M1I B;  5KCV A;  1NTV A;  1N3H A;  4IAP A;  3TVV A;  3TO1 A;  1I7A A;  2D9Y A;  5CLQ B;  2K2U A;  2JP2 A;  1P5T A;  3IVF A;  2YT0 A;  5C5B B;  2L1C A;  2X18 A;  3D8F A;  2L2I A;  3ODX A;  4YON A;  2D11 A;  2Z14 A;  1ZYI A;  2DKP A;  2NZ8 B;  2N0Y A;  2GUM A;  3PP2 A;  1WI1 A;  3D8D A;  5LON B;  4L1R A;  2KR0 A;  4Y94 A;  3OAN A;  3U8Z A;  1MIZ B;  2DHI A;  2BCJ A;  5J3Q A;  5FI1 A;  3BJI A;  3SO6 A;  2I1K A;  4YL8 A;  2K49 A;  4A6H A;  2UZR A;  1EVH A;  2VRW B;  1NU2 A;  2D4Q A;  1DBH A;  2H7D A;  3U7D A;  2EMS A;  3VIA A;  1OY2 A;  4EJN A;  4A6F A;  1X11 A;  3WA0 A;  1RJ2 A;  2RVB B;  1SHC A;  2I1J A;  3O96 A;  4DX8 A;  3QWM A;  4HAY B;  2AL6 A;  4K81 A;  5KQ4 A;  2LUL A;  2CY5 A;  2YS3 A;  4L6E A;  2D9V A;  2KIG A;  2P0H A;  1T77 A;  1MK7 B;  2R0D A;  2R09 A;  2W2W A;  1ZC4 B;  1FB8 A;  2FJL A;  2ZKM X;  2KCJ A;  2DX5 A;  3U12 A;  2OQB A;  5DI9 B;  5D3X A;  4K17 A;  1AWE A;  4NY0 A;  1Y19 B;  1EGX A;  1FAO A;  2Z0Q A;  1V5U A;  1U5F A;  4DXA B;  1E5W A;  4Z2N A;  1UNP A;  5DHF B;  1KI1 B;  1MPH A;  1QC6 A;  2Z0O A;  2E2X A;  4HSI A;  1TQZ A;  2DA0 A;  3FM8 C;  2K00 A;  1X05 A;  2ELA A;  2CRF A;  3FEH A;  1DDM A;  1V5M A;  2KUQ A;  3B77 A;  4HAW B;  5LG4 B;  2QKL A;  2DN6 A;  4A6F B;  3UZT A;  2P0F A;  2UVM A;  5DH9 B;  1UNR A;  2RUK B;  2EMT A;  3PZD A;  2J0M A;  2Y7B A;  1EAZ A;  3DXE A;  2MDX A;  2DKQ A;  5L81 A;  2Y8F A;  1P6S A;  3MPX A;  1BWN A;  2AEH A;  1WG7 A;  4ZRK A;  3BIN A;  3KRX A;  5I2S A;  2YSZ A;  5I2M A;  3PSC A;  1ZM0 A;  2R2Y A;  3ML4 A;  1FGZ A;  1FOE A;  5LOP B;  4HB0 B;  4GMX B;  2Q13 A;  4MK0 A;  2DHK A;  3CXB B;  2MKR A;  3KRW A;  3FSS A;  4GN1 A;  4H8S A;  4HAU B;  1J19 A;  2DLW A;  3KZ1 A;  2VSZ A;  5J3Y A;  4NSW A;  2OTX A;  3P7Z A;  2D9Z A;  3HSA A;  2LOZ A;  1XD4 A;  2D9X A;  4KHB A;  4OSN A;  5HE0 A;  1FHX A;  2UZS A;  1W1H A;  5JLJ B;  5C6R A;  5D3V A;  3ULB A;  4ZRJ A;  3GYO A;  3A58 A;  1EF1 A;  3X23 A;  4A6K A;  4Z2M B;  3ODO A;  2YVC A;  2LKO A;  2FJU B;  1MAI A;  3GYP A;  1V61 A;  2ROZ B;  1GC6 A;  4GOU A;  2YS1 A;  1UPQ A;  3P6A A;  4WSF A;  2GJY A;  4B6H A;  5D27 A;  3NWF A;  1ZC3 B;  4CHJ A;  4PQ0 A;  1ISN A;  3KY9 A;  2D10 A;  1DDW A;  5JP4 A;  2CY4 A;  3QIJ A;  4HDO A;  2VKI A;  3ULC A;  2MWN B;  2V76 A;  2YRY A;  2HE7 A;  1W1D A;  3ZVR A;  1V88 A;  1DDV A;  1U29 A;  5DHA B;  4CSQ A;  4KHB B;  2MFQ A;  2K8E A;  3WYF B;  4HDQ A;  5JHG A;  4QXA B;  4BBK A;  5HE2 A;  1WGU A;  4HHV A;  4PNK A;  2DTC A;  2N23 A;  3SUZ A;  2LYD A;  1NI2 A;  4HAZ B;  5HE1 A;  4MT7 A;  3V5W A;  1BTN A;  4XWX A;  1DRO A;  1OMW A;  2DFK A;  5FI0 A;  4CYE A;  3LJU X;  1Q67 A;  3F0W A;  1WJM A;  1U2B A;  1GG3 A;  1X1G A;  2COD A;  2LG1 A;  1WGQ A;  1W1G A;  2IFS A;  1Z87 A;  3A8Q A;  1TJ6 A;  4GXB A;  3MDB C;  1B55 A;  2GCJ A;  4F7G A;  3AJ4 A;  2COC A;  3TCA A;  4F7H A;  1MKE A;  3HK0 A;  2GCL A;  1DYN A;  2I5C A;  2Z4D A;  4EKU A;  3ZDT A;  3F5R A;  4KAX B;  4TKN A; 
#chains in the Genus database with same CATH homology
 1V5P A;  1XR0 B;  2COF A;  2I5F A;  3SYX A;  5GOW B;  2H7E A;  3A98 B;  3T06 A;  1KZG A;  1J0W A;  4HB4 B;  1ZVR A;  2J59 M;  2K2J A;  1ZSQ A;  2YT1 A;  1TXD A;  1XX0 A;  1BAK A;  3SNH A;  1K5G B;  1UNQ A;  3DXD A;  1X86 A;  3AU5 A;  5C16 A;  4KHO A;  3PVL A;  1M7E A;  2RSG A;  1OQN A;  2DHJ A;  5D3W A;  1IRS A;  1U5E A;  2LOX A;  4IFS A;  1AQC A;  3TFM A;  2EC1 A;  3G9W A;  1H10 A;  1NTY A;  1P3R A;  4IOY X;  1PFJ A;  4F7U P;  2XQN M;  5J3T A;  2M14 A;  3PVW A;  1V89 A;  4GMV A;  1FGY A;  3TW1 A;  2DYN A;  3AU4 A;  2RNR B;  4CHM A;  2IYB A;  4D0N B;  3HQC A;  1MIX A;  5EFX A;  4DX9 0;  4KVG B;  4TYZ A;  4HAV B;  1FHO A;  3D8E A;  1LW3 A;  2EJ8 A;  2ZPY A;  2P0D A;  4MY6 A;  2YF0 A;  5DIF B;  2CAY A;  1WVH A;  4ZRI A;  3VOQ A;  1GC7 A;  3HW2 B;  1PLS A;  3ODW A;  3A8P A;  4K2P A;  2D2Q A;  4C0A A;  3QBV B;  1H4R A;  1KZ7 A;  2D9W A;  4DBB A;  4WVF B;  2J0J A;  3RCP A;  1K5D B;  2G35 A;  1Y5O A;  3NSU A;  2PZ1 A;  1U5D A;  1XOD A;  1UEF A;  1BTK A;  3PEG A;  4HB2 B;  5CLL B;  3PVU A;  2Y8G A;  3DXC A;  1PMS A;  2J0K A;  3SV1 A;  1QQG A;  4HAX B;  4HAT B;  1FHW A;  1U5G A;  2RGN B;  4EMO A;  5C79 A;  4K2O A;  3PG7 A;  1RRP B;  4GPT B;  1XKE A;  5C5B A;  5JHH A;  1XCG A;  2W2X C;  1LB1 A;  5HE3 A;  1MK9 B;  1SGH A;  2DYQ A;  2ADZ A;  2YS5 A;  2GS0 A;  4GZU A;  2M38 A;  2ROV A;  1X1F A;  5D3Y A;  1I2H A;  2NMB A;  4HB3 B;  2DX1 A;  2KUP A;  2P8V A;  4P7I A;  4A5K A;  2KGX B;  2Z0P A;  4WJ7 A;  2COA A;  1M7R A;  3CIK A;  3KSY A;  1WJ1 A;  1UPR A;  2HTH B;  2W2X D;  4KHA A;  1U27 A;  2ELB A;  2QKM A;  2RLO A;  5KQ1 A;  3N7C A;  3M1I B;  5KCV A;  1NTV A;  1N3H A;  4IAP A;  3TVV A;  3TO1 A;  1I7A A;  2D9Y A;  5CLQ B;  2K2U A;  2JP2 A;  1P5T A;  3IVF A;  2YT0 A;  5C5B B;  2L1C A;  2X18 A;  3D8F A;  2L2I A;  3ODX A;  4YON A;  2D11 A;  2DKP A;  2NZ8 B;  2N0Y A;  3PP2 A;  1WI1 A;  3D8D A;  5LON B;  4Y94 A;  3OAN A;  3U8Z A;  1MIZ B;  2DHI A;  2BCJ A;  5J3Q A;  5FI1 A;  3BJI A;  3SO6 A;  2I1K A;  4YL8 A;  4A6H A;  2UZR A;  1EVH A;  2VRW B;  1NU2 A;  2D4Q A;  1DBH A;  2H7D A;  3U7D A;  2EMS A;  3VIA A;  1OY2 A;  4EJN A;  4A6F A;  1X11 A;  3WA0 A;  1RJ2 A;  3O96 A;  2RVB B;  1SHC A;  2I1J A;  4DX8 A;  3QWM A;  4HAY B;  2AL6 A;  4K81 A;  5KQ4 A;  2LUL A;  2CY5 A;  2YS3 A;  4L6E A;  2D9V A;  2R09 A;  2P0H A;  2R0D A;  1MK7 B;  2W2W A;  1ZC4 B;  1FB8 A;  2FJL A;  2KCJ A;  2DX5 A;  2OQB A;  5DI9 B;  5D3X A;  4K17 A;  1AWE A;  4NY0 A;  1Y19 B;  1EGX A;  1FAO A;  2Z0Q A;  1V5U A;  1U5F A;  4DXA B;  1E5W A;  4Z2N A;  1UNP A;  5DHF B;  1KI1 B;  1MPH A;  1QC6 A;  2Z0O A;  2E2X A;  1TQZ A;  2DA0 A;  3FM8 C;  2K00 A;  1X05 A;  2ELA A;  2CRF A;  3FEH A;  1DDM A;  1V5M A;  4HAW B;  2QKL A;  2DN6 A;  4A6F B;  3UZT A;  2P0F A;  2UVM A;  5DH9 B;  1UNR A;  2RUK B;  2EMT A;  3PZD A;  2J0M A;  2Y7B A;  1EAZ A;  3DXE A;  2MDX A;  2DKQ A;  5L81 A;  2Y8F A;  1P6S A;  3MPX A;  1BWN A;  2AEH A;  1WG7 A;  4ZRK A;  3BIN A;  3KRX A;  2YSZ A;  3PSC A;  1ZM0 A;  3ML4 A;  1FGZ A;  1FOE A;  5LOP B;  4HB0 B;  4GMX B;  2Q13 A;  4MK0 A;  2DHK A;  3CXB B;  2MKR A;  3KRW A;  3FSS A;  4GN1 A;  4H8S A;  4HAU B;  1J19 A;  2DLW A;  3KZ1 A;  2VSZ A;  5J3Y A;  4NSW A;  2OTX A;  3P7Z A;  2D9Z A;  2LOZ A;  1XD4 A;  2D9X A;  5HE0 A;  1FHX A;  2UZS A;  1W1H A;  5JLJ B;  5C6R A;  5D3V A;  3ULB A;  4ZRJ A;  3GYO A;  1EF1 A;  3X23 A;  4A6K A;  4Z2M B;  3ODO A;  2YVC A;  2LKO A;  1MAI A;  3GYP A;  1V61 A;  2ROZ B;  1GC6 A;  2YS1 A;  1UPQ A;  3P6A A;  4WSF A;  2GJY A;  4B6H A;  5D27 A;  1ZC3 B;  4CHJ A;  4PQ0 A;  1ISN A;  3KY9 A;  2D10 A;  1DDW A;  5JP4 A;  2CY4 A;  3QIJ A;  4HDO A;  2VKI A;  3ULC A;  2MWN B;  2V76 A;  2YRY A;  2HE7 A;  1W1D A;  3ZVR A;  1V88 A;  1DDV A;  1U29 A;  5DHA B;  4KHB B;  2MFQ A;  3WYF B;  4HDQ A;  5JHG A;  4BBK A;  5HE2 A;  1WGU A;  4HHV A;  4PNK A;  2DTC A;  2N23 A;  3SUZ A;  2LYD A;  1NI2 A;  4HAZ B;  5HE1 A;  4MT7 A;  3V5W A;  1BTN A;  4XWX A;  1DRO A;  1OMW A;  2DFK A;  5FI0 A;  4CYE A;  3LJU X;  1Q67 A;  3F0W A;  1WJM A;  1U2B A;  1GG3 A;  1X1G A;  2COD A;  2LG1 A;  1WGQ A;  1W1G A;  2IFS A;  1Z87 A;  3A8Q A;  1TJ6 A;  4GXB A;  3MDB C;  1B55 A;  2GCJ A;  4F7G A;  3AJ4 A;  2COC A;  3TCA A;  4F7H A;  1MKE A;  3HK0 A;  2GCL A;  1DYN A;  2I5C A;  4EKU A;  3ZDT A;  3F5R A;  4KAX B;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...