5GOWB

Solution structure of the complex between dp1 acidic region and tfiih p62 ph domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DP1
publication title The Interaction Mode of the Acidic Region of the Cell Cycle Transcription Factor DP1 with TFIIH
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5gowB00
2QKLA 2D9ZA 1DROA 2R09A 4WJ7A 3SNHA 1DBHA 4A6KA 2YS1A 2H7DA 3SUZA 2J0KA 2Q13A 1FHOA 1NTYA 1OMWA 2DX1A 3ODXA 1W1HA 2G35A 3QWMA 3TW1A 3CXBB 1V89A 1K5GB 2D11A 2D9WA 1ZSQA 5HE3A 3P7ZA 1K5DB 4DBBA 4P7IA 1ZC3B 3CIKA 3PG7A 3D8FA 4KVGB 4F7HA 2L1CA 2N23A 3KRWA 1FB8A 4PQ0A 2MDXA 3AU5A 1AWEA 1WJ1A 1XKEA 2LYDA 4XWXA 4YONA 1BWNA 2AEHA 4A6HA 2GJYA 1FHXA 1I7AA 3KY9A 3ZDTA 1RJ2A 1MK7B 2DHJA 2J0JA 1AQCA 2DFKA 2W2XD 4KHBB 1MIZB 4DX90 4CHMA 2CRFA 3V5WA 5C16A 3D8EA 2RUKB 4D0NB 3QIJA 1ZVRA 4HAVB 3VIAA 2DYNA 1DDWA 4EKUA 1PMSA 2H7EA 5L81A 1DDVA 2DHIA 5JHGA 2QKMA 3F0WA 2KGXB 5C6RA 1J19A 2I5CA 1NU2A 2K00A 1PFJA 3ML4A 2X18A 2OTXA 1RRPB 5D27A 5D3WA 3PZDA 1U5GA 2VRWB 2Z0PA 5D3XA 3DXDA 3ZVRA 4BBKA 2LKOA 2UVMA 2P0FA 1XD4A 2HE7A 2RNRB 2DYQA 5C5BA 1GC6A 2V76A 5HE2A 3ODWA 1ZM0A 4B6HA 2YS3A 1U27A 2Z0OA 3AU4A 4HB2B 1P6SA 1U5EA 1W1GA 4ZRJA 1WG7A 2N0YA 1SGHA 4CYEA 2YVCA 1M7EA 4CHJA 2DLWA 2DKQA 3PVWA 4GN1A 3U7DA 4A5KA 3F5RA 3HQCA 1UEFA 4NSWA 5FI0A 2ELAA 1FAOA 3KZ1A 2J59M 4HHVA 4HAUB 5DHFB 1UPQA 1TQZA 2IFSA 1Z87A 2YT1A 2ELBA 4IFSA 1OY2A 1X1GA 3G9WA 4Y94A 1UNQA 1E5WA 2M38A 4EMOA 5C79A 2L2IA 2JP2A 2RVBB 1GG3A 3A8QA 1EGXA 4TYZA 1U5FA 3KSYA 3KRXA 2RLOA 2P0HA 2Y7BA 2YSZA 1EF1A 3QBVB 1MAIA 2GCJA 2EMTA 1XODA 5DHAB 2EJ8A 2D9VA 1KZ7A 4L6EA 1ISNA 3SO6A 1KI1B 2J0MA 1P3RA 2PZ1A 2W2WA 4KHAA 2GCLA 2HTHB 2LOZA 4HDQA 4HATB 3TCAA 3RCPA 4NY0A 3WYFB 3PVUA 2CODA 4K2OA 1BAKA 4GMXB 1FHWA 4TKNA 3BINA 3ULBA 4Z2NA 3IVFA 3AJ4A 3BJIA 2DX5A 5EFXA 2VSZA 1MIXA 4MK0A 1V61A 2KUPA 3DXCA 5DI9B 4WVFB 2E2XA 2I1JA 4ZRIA 2EMSA 3HW2B 5GOWB 4MY6A 4A6FB 4Z2MB 3HK0A 2D10A 4HAWB 2IYBA 4YL8A 1EAZA 5J3YA 4GPTB 3TVVA 1ZC4B 2LOXA 4HAZB 2D2QA 1M7RA 2CAYA 1WI1A 2W2XC 2I5FA 2DKPA 4HB4B 2NZ8B 3FEHA 5JP4A 4GXBA 1GC7A 2ROZB 2I1KA 4ZRKA 3X23A 4IOYX 4K81A 4EJNA 4F7UP 2UZRA 3M1IB 1V5UA 1DDMA 1N3HA 1BTNA 2OQBA 1PLSA 1KZGA 1W1DA 1Y5OA 2UZSA 1TXDA 5J3QA 3N7CA 3UZTA 2MWNB 3GYOA 3O96A 5DIFB 1WJMA 4HDOA 3ULCA 2RSGA 3VOQA 4K2PA 4PNKA 1H4RA 2COCA 1I2HA 2NMBA 1X86A 5HE1A 1J0WA 3PEGA 2EC1A 5KQ1A 3TFMA 3FM8C 2DTCA 3GYPA 4GZUA 5FI1A 4A6FA 1UNPA 5J3TA 1NI2A 3SYXA 1IRSA 2GS0A 3SV1A 2FJLA 1H10A 2Y8FA 2DHKA 5C5BB 3ODOA 4HAYB 1P5TA 3OANA 4K17A 4C0AA 3WA0A 2VKIA 2R0DA 1XCGA 4IAPA 2ZPYA 2YS5A 2D4QA 2D9YA 2CY4A 1EVHA 2K2UA 5CLQB 4F7GA 2COAA 2MFQA 1UPRA 5KCVA 5D3YA 2CY5A 1TJ6A 1FGZA 1MPHA 2Z0QA 1U2BA 4DXAB 2RGNB 1X05A 1Y19B 5DH9B 1UNRA 5KQ4A 2DN6A 4WSFA 5D3VA 2KCJA 5CLLB 3MPXA 1QC6A 1WGQA 2ROVA 2LULA 1NTVA 3NSUA 4KHOA 3D8DA 5JHHA 1LB1A 3FSSA 2LG1A 4KAXB 3U8ZA 1B55A 3A98B 2DA0A 1MK9B 1SHCA 1WVHA 2XQNM 1FOEA 1XR0B 1OQNA 1X11A 5LONB 2MKRA 1V88A 3PVLA 2YF0A 2AL6A 2BCJA 2COFA 4GMVA 1XX0A 3P6AA 3PSCA 3PP2A 1V5MA 2D9XA 1LW3A 4HB3B 2YRYA 3LJUX 1U5DA 2P8VA 2YT0A 3MDBC 1Q67A 1U29A 4HAXB 2P0DA 5JLJB 2Y8GA 4HB0B 1FGYA 2K2JA 1WGUA 5HE0A 5LOPB 1X1FA 2M14A 1BTKA 3DXEA 1MKEA 4DX8A 1V5PA 1DYNA 2ADZA 3T06A 4MT7A 3TO1A 4H8SA 3A8PA 1QQGA
chains in the Genus database with same CATH superfamily
2QKLA 3NWAA 1ZYIA 2D9ZA 1DROA 2R09A 4WJ7A 3SNHA 1DBHA 4A6KA 2YS1A 5I2MA 2H7DA 3SUZA 2J0KA 2Q13A 1FHOA 1NTYA 1OMWA 2DX1A 3ODXA 1W1HA 2G35A 3QWMA 3TW1A 3CXBB 2RRFA 1V89A 1K5GB 2D11A 2D9WA 1ZSQA 5HE3A 3P7ZA 1K5DB 3A58A 4DBBA 4P7IA 1ZC3B 3CIKA 3PG7A 3D8FA 4KVGB 4F7HA 2L1CA 2N23A 3KRWA 1FB8A 4PQ0A 2MDXA 3AU5A 1AWEA 1WJ1A 1XKEA 2LYDA 4XWXA 4YONA 1BWNA 3NWFA 2AEHA 4A6HA 2GJYA 1FHXA 1I7AA 3KY9A 3ZDTA 1RJ2A 1MK7B 2DHJA 2J0JA 1AQCA 2DFKA 2W2XD 4KHBB 1MIZB 4DX90 4CHMA 2CRFA 3V5WA 5C16A 3D8EA 2RUKB 4D0NB 3QIJA 1ZVRA 4HAVB 3VIAA 2DYNA 1DDWA 4EKUA 4CSQA 1PMSA 2H7EA 3NW8A 5L81A 1DDVA 2DHIA 5JHGA 2Z13A 2QKMA 5M4YB 3F0WA 2KGXB 5C6RA 4OSNA 1J19A 2I5CA 1NU2A 2K00A 1PFJA 2GUMA 3ML4A 2X18A 2OTXA 1RRPB 5D27A 5D3WA 3PZDA 2KIGA 1U5GA 2VRWB 2Z0PA 5D3XA 3DXDA 3ZVRA 4BBKA 2LKOA 2UVMA 2P0FA 1XD4A 2HE7A 2RNRB 2DYQA 1T77A 5C5BA 2KIEA 1GC6A 2V76A 3HIEA 5HE2A 3ODWA 1ZM0A 4B6HA 2YS3A 1U27A 2Z0OA 3AU4A 4HB2B 1P6SA 1U5EA 1W1GA 4ZRJA 1WG7A 2N0YA 1SGHA 4CYEA 2YVCA 1M7EA 4CHJA 2DLWA 4D6WA 2DKQA 3PVWA 3OHMB 4GN1A 3U7DA 4A5KA 4KHBA 3F5RA 3HQCA 1UEFA 4NSWA 5FI0A 4DIXA 2ELAA 1FAOA 3KZ1A 2J59M 4HHVA 4HAUB 3B77A 2ZKMX 5DHFB 3DCXA 1UPQA 1TQZA 2IFSA 1Z87A 2YT1A 2ELBA 4IFSA 1OY2A 1X1GA 3G9WA 4Y94A 1UNQA 1E5WA 2M38A 4EMOA 5C79A 2L2IA 2JP2A 4HSIA 2RVBB 2R2YA 1GG3A 3A8QA 1EGXA 4TYZA 1U5FA 3KSYA 2RLOA 3KRXA 2P0HA 2Y7BA 2YSZA 1EF1A 3QBVB 1MAIA 2GCJA 2EMTA 1XODA 5DHAB 2EJ8A 2D9VA 4L1RA 1KZ7A 4L6EA 1ISNA 3SO6A 1KI1B 2J0MA 1P3RA 2PZ1A 2NBVA 2W2WA 4KHAA 2GCLA 4QJ4B 2HTHB 2LOZA 4HDQA 4HATB 3TCAA 3RCPA 4NY0A 3WYFB 3PVUA 2CODA 4K2OA 1BAKA 4GMXB 1FHWA 4TKNA 3BINA 3ULBA 4Z2NA 3IVFA 4OT1A 3AJ4A 3BJIA 2DX5A 5EFXA 2Z14A 2VSZA 1MIXA 4MK0A 1V61A 2KUPA 3DXCA 5DI9B 4WVFB 2E2XA 4QJ5B 2FJUB 2I1JA 4ZRIA 2K8EA 2EMSA 3HW2B 2KUQA 5GOWB 4MY6A 4A6FB 4Z2MB 3HK0A 5I2SA 2D10A 4HAWB 2IYBA 4YL8A 1EAZA 5J3YA 4GPTB 4GNKB 3TVVA 1ZC4B 2Z4DA 2LOXA 4HAZB 2D2QA 1M7RA 2CAYA 1WI1A 2W2XC 4QJ3B 2YT2A 2I5FA 2DKPA 4HB4B 2NZ8B 3FEHA 5JP4A 4GXBA 1GC7A 2ROZB 2I1KA 4ZRKA 3X23A 4IOYX 4K81A 4EJNA 4F7UP 2UZRA 3M1IB 1V5UA 1DDMA 1N3HA 1BTNA 2OQBA 3U12A 1MI1A 1PLSA 1KZGA 1W1DA 1Y5OA 2UZSA 1TXDA 5J3QA 3N7CA 3UZTA 2MWNB 3GYOA 3O96A 5DIFB 1WJMA 4HDOA 3ULCA 2RSGA 3VOQA 4K2PA 4PNKA 1H4RA 2COCA 1I2HA 2NMBA 1X86A 5HE1A 1J0WA 3PEGA 2EC1A 5KQ1A 3TFMA 3FM8C 2DTCA 3GYPA 4GZUA 5FI1A 4A6FA 1UNPA 5J3TA 1NI2A 3SYXA 1IRSA 2GS0A 3SV1A 2FJLA 1H10A 2Y8FA 2DHKA 5C5BB 3ODOA 4HAYB 1P5TA 3OANA 4K17A 4C0AA 3WA0A 2VKIA 2R0DA 1XCGA 4IAPA 2ZPYA 2YS5A 2D4QA 2D9YA 2CY4A 2KR0A 1EVHA 2K2UA 5CLQB 4F7GA 2COAA 2MFQA 1UPRA 5KCVA 5D3YA 2CY5A 1TJ6A 1FGZA 1MPHA 2Z0QA 1U2BA 4DXAB 2RGNB 1X05A 1Y19B 5DH9B 1UNRA 5KQ4A 2DN6A 4WSFA 5D3VA 2KCJA 5CLLB 3MPXA 5LG4B 1QC6A 1WGQA 2ROVA 2LULA 1NTVA 3NSUA 4KHOA 3D8DA 5JHHA 1LB1A 4QXAB 3FSSA 2LG1A 4KAXB 3U8ZA 1B55A 3A98B 2DA0A 1MK9B 1SHCA 1WVHA 2XQNM 1FOEA 1XR0B 1OQNA 2K49A 4GOUA 1X11A 5LONB 2Z59A 2MKRA 1V88A 3NWDA 3PVLA 2YF0A 2AL6A 2BCJA 2COFA 4GMVA 1XX0A 3P6AA 3PSCA 3PP2A 1V5MA 2D9XA 1LW3A 4HB3B 2YRYA 3LJUX 1U5DA 2P8VA 2YT0A 3MDBC 1Q67A 1U29A 4HAXB 2P0DA 5JLJB 5IRSA 2Y8GA 4HB0B 3HSAA 1FGYA 2K2JA 1WGUA 5HE0A 5LOPB 1X1FA 2M14A 1BTKA 3DXEA 1MKEA 4DX8A 1V5PA 1DYNA 2ADZA 3FVCA 3T06A 4MT7A 3TO1A 4H8SA 3A8PA 1QQGA
chains in the Genus database with same CATH topology
2QKLA 2D9ZA 1DROA 2R09A 4WJ7A 3SNHA 1DBHA 4A6KA 2YS1A 2H7DA 3SUZA 2J0KA 2Q13A 1FHOA 1NTYA 1OMWA 2DX1A 3ODXA 1W1HA 2G35A 3QWMA 3TW1A 3CXBB 1V89A 1K5GB 2D11A 2D9WA 1ZSQA 5HE3A 3P7ZA 1K5DB 4DBBA 4P7IA 1ZC3B 3CIKA 3PG7A 3D8FA 4KVGB 4F7HA 2L1CA 2N23A 3KRWA 1FB8A 4PQ0A 2MDXA 3AU5A 1AWEA 1WJ1A 1XKEA 2LYDA 4XWXA 4YONA 1BWNA 2AEHA 4A6HA 2GJYA 1FHXA 1I7AA 3KY9A 3ZDTA 1RJ2A 1MK7B 2DHJA 2J0JA 1AQCA 2DFKA 2W2XD 4KHBB 1MIZB 4DX90 4CHMA 2CRFA 3V5WA 5C16A 3D8EA 2RUKB 4D0NB 3QIJA 1ZVRA 4HAVB 3VIAA 2DYNA 1DDWA 4EKUA 1PMSA 2H7EA 5L81A 1DDVA 2DHIA 5JHGA 2QKMA 3F0WA 2KGXB 5C6RA 1J19A 2I5CA 1NU2A 2K00A 1PFJA 3ML4A 2X18A 2OTXA 1RRPB 5D27A 5D3WA 3PZDA 1U5GA 2VRWB 2Z0PA 5D3XA 3DXDA 3ZVRA 4BBKA 2LKOA 2UVMA 2P0FA 1XD4A 2HE7A 2RNRB 2DYQA 5C5BA 1GC6A 2V76A 5HE2A 3ODWA 1ZM0A 4B6HA 2YS3A 1U27A 2Z0OA 3AU4A 4HB2B 1P6SA 1U5EA 1W1GA 4ZRJA 1WG7A 2N0YA 1SGHA 4CYEA 2YVCA 1M7EA 4CHJA 2DLWA 2DKQA 3PVWA 4GN1A 3U7DA 4A5KA 3F5RA 3HQCA 1UEFA 4NSWA 5FI0A 2ELAA 1FAOA 3KZ1A 2J59M 4HHVA 4HAUB 5DHFB 1UPQA 1TQZA 2IFSA 1Z87A 2YT1A 2ELBA 4IFSA 1OY2A 1X1GA 3G9WA 4Y94A 1UNQA 1E5WA 2M38A 4EMOA 5C79A 2L2IA 2JP2A 2RVBB 1GG3A 3A8QA 1EGXA 4TYZA 1U5FA 3KSYA 3KRXA 2RLOA 2P0HA 2Y7BA 2YSZA 1EF1A 3QBVB 1MAIA 2GCJA 2EMTA 1XODA 5DHAB 2EJ8A 2D9VA 1KZ7A 4L6EA 1ISNA 3SO6A 1KI1B 2J0MA 1P3RA 2PZ1A 2W2WA 4KHAA 2GCLA 2HTHB 2LOZA 4HDQA 4HATB 3TCAA 3RCPA 4NY0A 3WYFB 3PVUA 2CODA 4K2OA 1BAKA 4GMXB 1FHWA 4TKNA 3BINA 3ULBA 4Z2NA 3IVFA 3AJ4A 3BJIA 2DX5A 5EFXA 2VSZA 1MIXA 4MK0A 1V61A 2KUPA 3DXCA 5DI9B 4WVFB 2E2XA 2I1JA 4ZRIA 2EMSA 3HW2B 5GOWB 4MY6A 4A6FB 4Z2MB 3HK0A 2D10A 4HAWB 2IYBA 4YL8A 1EAZA 5J3YA 4GPTB 3TVVA 1ZC4B 2LOXA 4HAZB 2D2QA 1M7RA 2CAYA 1WI1A 2W2XC 2I5FA 2DKPA 4HB4B 2NZ8B 3FEHA 5JP4A 4GXBA 1GC7A 2ROZB 2I1KA 4ZRKA 3X23A 4IOYX 4K81A 4EJNA 4F7UP 2UZRA 3M1IB 1V5UA 1DDMA 1N3HA 1BTNA 2OQBA 1PLSA 1KZGA 1W1DA 1Y5OA 2UZSA 1TXDA 5J3QA 3N7CA 3UZTA 2MWNB 3GYOA 3O96A 5DIFB 1WJMA 4HDOA 3ULCA 2RSGA 3VOQA 4K2PA 4PNKA 1H4RA 2COCA 1I2HA 2NMBA 1X86A 5HE1A 1J0WA 3PEGA 2EC1A 5KQ1A 3TFMA 3FM8C 2DTCA 3GYPA 4GZUA 5FI1A 4A6FA 1UNPA 5J3TA 1NI2A 3SYXA 1IRSA 2GS0A 3SV1A 2FJLA 1H10A 2Y8FA 2DHKA 5C5BB 3ODOA 4HAYB 1P5TA 3OANA 4K17A 4C0AA 3WA0A 2VKIA 2R0DA 1XCGA 4IAPA 2ZPYA 2YS5A 2D4QA 2D9YA 2CY4A 1EVHA 2K2UA 5CLQB 4F7GA 2COAA 2MFQA 1UPRA 5KCVA 5D3YA 2CY5A 1TJ6A 1FGZA 1MPHA 2Z0QA 1U2BA 4DXAB 2RGNB 1X05A 1Y19B 5DH9B 1UNRA 5KQ4A 2DN6A 4WSFA 5D3VA 2KCJA 5CLLB 3MPXA 1QC6A 1WGQA 2ROVA 2LULA 1NTVA 3NSUA 4KHOA 3D8DA 5JHHA 1LB1A 3FSSA 2LG1A 4KAXB 3U8ZA 1B55A 3A98B 2DA0A 1MK9B 1SHCA 1WVHA 2XQNM 1FOEA 1XR0B 1OQNA 1X11A 5LONB 2MKRA 1V88A 3PVLA 2YF0A 2AL6A 2BCJA 2COFA 4GMVA 1XX0A 3P6AA 3PSCA 3PP2A 1V5MA 2D9XA 1LW3A 4HB3B 2YRYA 3LJUX 1U5DA 2P8VA 2YT0A 3MDBC 1Q67A 1U29A 4HAXB 2P0DA 5JLJB 2Y8GA 4HB0B 1FGYA 2K2JA 1WGUA 5HE0A 5LOPB 1X1FA 2M14A 1BTKA 3DXEA 1MKEA 4DX8A 1V5PA 1DYNA 2ADZA 3T06A 4MT7A 3TO1A 4H8SA 3A8PA 1QQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKL A;  2D9Z A;  1DRO A;  2R09 A;  4WJ7 A;  3SNH A;  1DBH A;  4A6K A;  2YS1 A;  2H7D A;  3SUZ A;  2J0K A;  2Q13 A;  1FHO A;  1NTY A;  1OMW A;  2DX1 A;  3ODX A;  1W1H A;  2G35 A;  3QWM A;  3TW1 A;  3CXB B;  1V89 A;  1K5G B;  2D11 A;  2D9W A;  1ZSQ A;  5HE3 A;  3P7Z A;  1K5D B;  4DBB A;  4P7I A;  1ZC3 B;  3CIK A;  3PG7 A;  3D8F A;  4KVG B;  4F7H A;  2L1C A;  2N23 A;  3KRW A;  1FB8 A;  4PQ0 A;  2MDX A;  3AU5 A;  1AWE A;  1WJ1 A;  1XKE A;  2LYD A;  4XWX A;  4YON A;  1BWN A;  2AEH A;  4A6H A;  2GJY A;  1FHX A;  1I7A A;  3KY9 A;  3ZDT A;  1RJ2 A;  1MK7 B;  2DHJ A;  2J0J A;  1AQC A;  2DFK A;  2W2X D;  4KHB B;  1MIZ B;  4DX9 0;  4CHM A;  2CRF A;  3V5W A;  5C16 A;  3D8E A;  2RUK B;  4D0N B;  3QIJ A;  1ZVR A;  4HAV B;  3VIA A;  2DYN A;  1DDW A;  4EKU A;  1PMS A;  2H7E A;  5L81 A;  1DDV A;  2DHI A;  5JHG A;  2QKM A;  3F0W A;  2KGX B;  5C6R A;  1J19 A;  2I5C A;  1NU2 A;  2K00 A;  1PFJ A;  3ML4 A;  2X18 A;  2OTX A;  1RRP B;  5D27 A;  5D3W A;  3PZD A;  1U5G A;  2VRW B;  2Z0P A;  5D3X A;  3DXD A;  3ZVR A;  4BBK A;  2LKO A;  2UVM A;  2P0F A;  1XD4 A;  2HE7 A;  2RNR B;  2DYQ A;  5C5B A;  1GC6 A;  2V76 A;  5HE2 A;  3ODW A;  1ZM0 A;  4B6H A;  2YS3 A;  1U27 A;  2Z0O A;  3AU4 A;  4HB2 B;  1P6S A;  1U5E A;  1W1G A;  4ZRJ A;  1WG7 A;  2N0Y A;  1SGH A;  4CYE A;  2YVC A;  1M7E A;  4CHJ A;  2DLW A;  2DKQ A;  3PVW A;  4GN1 A;  3U7D A;  4A5K A;  3F5R A;  3HQC A;  1UEF A;  4NSW A;  5FI0 A;  2ELA A;  1FAO A;  3KZ1 A;  2J59 M;  4HHV A;  4HAU B;  5DHF B;  1UPQ A;  1TQZ A;  2IFS A;  1Z87 A;  2YT1 A;  2ELB A;  4IFS A;  1OY2 A;  1X1G A;  3G9W A;  4Y94 A;  1UNQ A;  1E5W A;  2M38 A;  4EMO A;  5C79 A;  2L2I A;  2JP2 A;  2RVB B;  1GG3 A;  3A8Q A;  1EGX A;  4TYZ A;  1U5F A;  3KSY A;  3KRX A;  2RLO A;  2P0H A;  2Y7B A;  2YSZ A;  1EF1 A;  3QBV B;  1MAI A;  2GCJ A;  2EMT A;  1XOD A;  5DHA B;  2EJ8 A;  2D9V A;  1KZ7 A;  4L6E A;  1ISN A;  3SO6 A;  1KI1 B;  2J0M A;  1P3R A;  2PZ1 A;  2W2W A;  4KHA A;  2GCL A;  2HTH B;  2LOZ A;  4HDQ A;  4HAT B;  3TCA A;  3RCP A;  4NY0 A;  3WYF B;  3PVU A;  2COD A;  4K2O A;  1BAK A;  4GMX B;  1FHW A;  4TKN A;  3BIN A;  3ULB A;  4Z2N A;  3IVF A;  3AJ4 A;  3BJI A;  2DX5 A;  5EFX A;  2VSZ A;  1MIX A;  4MK0 A;  1V61 A;  2KUP A;  3DXC A;  5DI9 B;  4WVF B;  2E2X A;  2I1J A;  4ZRI A;  2EMS A;  3HW2 B;  5GOW B;  4MY6 A;  4A6F B;  4Z2M B;  3HK0 A;  2D10 A;  4HAW B;  2IYB A;  4YL8 A;  1EAZ A;  5J3Y A;  4GPT B;  3TVV A;  1ZC4 B;  2LOX A;  4HAZ B;  2D2Q A;  1M7R A;  2CAY A;  1WI1 A;  2W2X C;  2I5F A;  2DKP A;  4HB4 B;  2NZ8 B;  3FEH A;  5JP4 A;  4GXB A;  1GC7 A;  2ROZ B;  2I1K A;  4ZRK A;  3X23 A;  4IOY X;  4K81 A;  4EJN A;  4F7U P;  2UZR A;  3M1I B;  1V5U A;  1DDM A;  1N3H A;  1BTN A;  2OQB A;  1PLS A;  1KZG A;  1W1D A;  1Y5O A;  2UZS A;  1TXD A;  5J3Q A;  3N7C A;  3UZT A;  2MWN B;  3GYO A;  3O96 A;  5DIF B;  1WJM A;  4HDO A;  3ULC A;  2RSG A;  3VOQ A;  4K2P A;  4PNK A;  1H4R A;  2COC A;  1I2H A;  2NMB A;  1X86 A;  5HE1 A;  1J0W A;  3PEG A;  2EC1 A;  5KQ1 A;  3TFM A;  3FM8 C;  2DTC A;  3GYP A;  4GZU A;  5FI1 A;  4A6F A;  1UNP A;  5J3T A;  1NI2 A;  3SYX A;  1IRS A;  2GS0 A;  3SV1 A;  2FJL A;  1H10 A;  2Y8F A;  2DHK A;  5C5B B;  3ODO A;  4HAY B;  1P5T A;  3OAN A;  4K17 A;  4C0A A;  3WA0 A;  2VKI A;  2R0D A;  1XCG A;  4IAP A;  2ZPY A;  2YS5 A;  2D4Q A;  2D9Y A;  2CY4 A;  1EVH A;  2K2U A;  5CLQ B;  4F7G A;  2COA A;  2MFQ A;  1UPR A;  5KCV A;  5D3Y A;  2CY5 A;  1TJ6 A;  1FGZ A;  1MPH A;  2Z0Q A;  1U2B A;  4DXA B;  2RGN B;  1X05 A;  1Y19 B;  5DH9 B;  1UNR A;  5KQ4 A;  2DN6 A;  4WSF A;  5D3V A;  2KCJ A;  5CLL B;  3MPX A;  1QC6 A;  1WGQ A;  2ROV A;  2LUL A;  1NTV A;  3NSU A;  4KHO A;  3D8D A;  5JHH A;  1LB1 A;  3FSS A;  2LG1 A;  4KAX B;  3U8Z A;  1B55 A;  3A98 B;  2DA0 A;  1MK9 B;  1SHC A;  1WVH A;  2XQN M;  1FOE A;  1XR0 B;  1OQN A;  1X11 A;  5LON B;  2MKR A;  1V88 A;  3PVL A;  2YF0 A;  2AL6 A;  2BCJ A;  2COF A;  4GMV A;  1XX0 A;  3P6A A;  3PSC A;  3PP2 A;  1V5M A;  2D9X A;  1LW3 A;  4HB3 B;  2YRY A;  3LJU X;  1U5D A;  2P8V A;  2YT0 A;  3MDB C;  1Q67 A;  1U29 A;  4HAX B;  2P0D A;  5JLJ B;  2Y8G A;  4HB0 B;  1FGY A;  2K2J A;  1WGU A;  5HE0 A;  5LOP B;  1X1F A;  2M14 A;  1BTK A;  3DXE A;  1MKE A;  4DX8 A;  1V5P A;  1DYN A;  2ADZ A;  3T06 A;  4MT7 A;  3TO1 A;  4H8S A;  3A8P A;  1QQG A; 
#chains in the Genus database with same CATH topology
 2QKL A;  3NWA A;  1ZYI A;  2D9Z A;  1DRO A;  2R09 A;  4WJ7 A;  3SNH A;  1DBH A;  4A6K A;  2YS1 A;  5I2M A;  2H7D A;  3SUZ A;  2J0K A;  2Q13 A;  1FHO A;  1NTY A;  1OMW A;  2DX1 A;  3ODX A;  1W1H A;  2G35 A;  3QWM A;  3TW1 A;  3CXB B;  2RRF A;  1V89 A;  1K5G B;  2D11 A;  2D9W A;  1ZSQ A;  5HE3 A;  3P7Z A;  1K5D B;  3A58 A;  4DBB A;  4P7I A;  1ZC3 B;  3CIK A;  3PG7 A;  3D8F A;  4KVG B;  4F7H A;  2L1C A;  2N23 A;  3KRW A;  1FB8 A;  4PQ0 A;  2MDX A;  3AU5 A;  1AWE A;  1WJ1 A;  1XKE A;  2LYD A;  4XWX A;  4YON A;  1BWN A;  3NWF A;  2AEH A;  4A6H A;  2GJY A;  1FHX A;  1I7A A;  3KY9 A;  3ZDT A;  1RJ2 A;  1MK7 B;  2DHJ A;  2J0J A;  1AQC A;  2DFK A;  2W2X D;  4KHB B;  1MIZ B;  4DX9 0;  4CHM A;  2CRF A;  3V5W A;  5C16 A;  3D8E A;  2RUK B;  4D0N B;  3QIJ A;  1ZVR A;  4HAV B;  3VIA A;  2DYN A;  1DDW A;  4EKU A;  4CSQ A;  1PMS A;  2H7E A;  3NW8 A;  5L81 A;  1DDV A;  2DHI A;  5JHG A;  2Z13 A;  2QKM A;  5M4Y B;  3F0W A;  2KGX B;  5C6R A;  4OSN A;  1J19 A;  2I5C A;  1NU2 A;  2K00 A;  1PFJ A;  2GUM A;  3ML4 A;  2X18 A;  2OTX A;  1RRP B;  5D27 A;  5D3W A;  3PZD A;  2KIG A;  1U5G A;  2VRW B;  2Z0P A;  5D3X A;  3DXD A;  3ZVR A;  4BBK A;  2LKO A;  2UVM A;  2P0F A;  1XD4 A;  2HE7 A;  2RNR B;  2DYQ A;  1T77 A;  5C5B A;  2KIE A;  1GC6 A;  2V76 A;  3HIE A;  5HE2 A;  3ODW A;  1ZM0 A;  4B6H A;  2YS3 A;  1U27 A;  2Z0O A;  3AU4 A;  4HB2 B;  1P6S A;  1U5E A;  1W1G A;  4ZRJ A;  1WG7 A;  2N0Y A;  1SGH A;  4CYE A;  2YVC A;  1M7E A;  4CHJ A;  2DLW A;  4D6W A;  2DKQ A;  3PVW A;  3OHM B;  4GN1 A;  3U7D A;  4A5K A;  4KHB A;  3F5R A;  3HQC A;  1UEF A;  4NSW A;  5FI0 A;  4DIX A;  2ELA A;  1FAO A;  3KZ1 A;  2J59 M;  4HHV A;  4HAU B;  3B77 A;  2ZKM X;  5DHF B;  3DCX A;  1UPQ A;  1TQZ A;  2IFS A;  1Z87 A;  2YT1 A;  2ELB A;  4IFS A;  1OY2 A;  1X1G A;  3G9W A;  4Y94 A;  1UNQ A;  1E5W A;  2M38 A;  4EMO A;  5C79 A;  2L2I A;  2JP2 A;  4HSI A;  2RVB B;  2R2Y A;  1GG3 A;  3A8Q A;  1EGX A;  4TYZ A;  1U5F A;  3KSY A;  2RLO A;  3KRX A;  2P0H A;  2Y7B A;  2YSZ A;  1EF1 A;  3QBV B;  1MAI A;  2GCJ A;  2EMT A;  1XOD A;  5DHA B;  2EJ8 A;  2D9V A;  4L1R A;  1KZ7 A;  4L6E A;  1ISN A;  3SO6 A;  1KI1 B;  2J0M A;  1P3R A;  2PZ1 A;  2NBV A;  2W2W A;  4KHA A;  2GCL A;  4QJ4 B;  2HTH B;  2LOZ A;  4HDQ A;  4HAT B;  3TCA A;  3RCP A;  4NY0 A;  3WYF B;  3PVU A;  2COD A;  4K2O A;  1BAK A;  4GMX B;  1FHW A;  4TKN A;  3BIN A;  3ULB A;  4Z2N A;  3IVF A;  4OT1 A;  3AJ4 A;  3BJI A;  2DX5 A;  5EFX A;  2Z14 A;  2VSZ A;  1MIX A;  4MK0 A;  1V61 A;  2KUP A;  3DXC A;  5DI9 B;  4WVF B;  2E2X A;  4QJ5 B;  2FJU B;  2I1J A;  4ZRI A;  2K8E A;  2EMS A;  3HW2 B;  2KUQ A;  5GOW B;  4MY6 A;  4A6F B;  4Z2M B;  3HK0 A;  5I2S A;  2D10 A;  4HAW B;  2IYB A;  4YL8 A;  1EAZ A;  5J3Y A;  4GPT B;  4GNK B;  3TVV A;  1ZC4 B;  2Z4D A;  2LOX A;  4HAZ B;  2D2Q A;  1M7R A;  2CAY A;  1WI1 A;  2W2X C;  4QJ3 B;  2YT2 A;  2I5F A;  2DKP A;  4HB4 B;  2NZ8 B;  3FEH A;  5JP4 A;  4GXB A;  1GC7 A;  2ROZ B;  2I1K A;  4ZRK A;  3X23 A;  4IOY X;  4K81 A;  4EJN A;  4F7U P;  2UZR A;  3M1I B;  1V5U A;  1DDM A;  1N3H A;  1BTN A;  2OQB A;  3U12 A;  1MI1 A;  1PLS A;  1KZG A;  1W1D A;  1Y5O A;  2UZS A;  1TXD A;  5J3Q A;  3N7C A;  3UZT A;  2MWN B;  3GYO A;  3O96 A;  5DIF B;  1WJM A;  4HDO A;  3ULC A;  2RSG A;  3VOQ A;  4K2P A;  4PNK A;  1H4R A;  2COC A;  1I2H A;  2NMB A;  1X86 A;  5HE1 A;  1J0W A;  3PEG A;  2EC1 A;  5KQ1 A;  3TFM A;  3FM8 C;  2DTC A;  3GYP A;  4GZU A;  5FI1 A;  4A6F A;  1UNP A;  5J3T A;  1NI2 A;  3SYX A;  1IRS A;  2GS0 A;  3SV1 A;  2FJL A;  1H10 A;  2Y8F A;  2DHK A;  5C5B B;  3ODO A;  4HAY B;  1P5T A;  3OAN A;  4K17 A;  4C0A A;  3WA0 A;  2VKI A;  2R0D A;  1XCG A;  4IAP A;  2ZPY A;  2YS5 A;  2D4Q A;  2D9Y A;  2CY4 A;  2KR0 A;  1EVH A;  2K2U A;  5CLQ B;  4F7G A;  2COA A;  2MFQ A;  1UPR A;  5KCV A;  5D3Y A;  2CY5 A;  1TJ6 A;  1FGZ A;  1MPH A;  2Z0Q A;  1U2B A;  4DXA B;  2RGN B;  1X05 A;  1Y19 B;  5DH9 B;  1UNR A;  5KQ4 A;  2DN6 A;  4WSF A;  5D3V A;  2KCJ A;  5CLL B;  3MPX A;  5LG4 B;  1QC6 A;  1WGQ A;  2ROV A;  2LUL A;  1NTV A;  3NSU A;  4KHO A;  3D8D A;  5JHH A;  1LB1 A;  4QXA B;  3FSS A;  2LG1 A;  4KAX B;  3U8Z A;  1B55 A;  3A98 B;  2DA0 A;  1MK9 B;  1SHC A;  1WVH A;  2XQN M;  1FOE A;  1XR0 B;  1OQN A;  2K49 A;  4GOU A;  1X11 A;  5LON B;  2Z59 A;  2MKR A;  1V88 A;  3NWD A;  3PVL A;  2YF0 A;  2AL6 A;  2BCJ A;  2COF A;  4GMV A;  1XX0 A;  3P6A A;  3PSC A;  3PP2 A;  1V5M A;  2D9X A;  1LW3 A;  4HB3 B;  2YRY A;  3LJU X;  1U5D A;  2P8V A;  2YT0 A;  3MDB C;  1Q67 A;  1U29 A;  4HAX B;  2P0D A;  5JLJ B;  5IRS A;  2Y8G A;  4HB0 B;  3HSA A;  1FGY A;  2K2J A;  1WGU A;  5HE0 A;  5LOP B;  1X1F A;  2M14 A;  1BTK A;  3DXE A;  1MKE A;  4DX8 A;  1V5P A;  1DYN A;  2ADZ A;  3FVC A;  3T06 A;  4MT7 A;  3TO1 A;  4H8S A;  3A8P A;  1QQG A; 
#chains in the Genus database with same CATH homology
 2QKL A;  2D9Z A;  1DRO A;  2R09 A;  4WJ7 A;  3SNH A;  1DBH A;  4A6K A;  2YS1 A;  2H7D A;  3SUZ A;  2J0K A;  2Q13 A;  1FHO A;  1NTY A;  1OMW A;  2DX1 A;  3ODX A;  1W1H A;  2G35 A;  3QWM A;  3TW1 A;  3CXB B;  1V89 A;  1K5G B;  2D11 A;  2D9W A;  1ZSQ A;  5HE3 A;  3P7Z A;  1K5D B;  4DBB A;  4P7I A;  1ZC3 B;  3CIK A;  3PG7 A;  3D8F A;  4KVG B;  4F7H A;  2L1C A;  2N23 A;  3KRW A;  1FB8 A;  4PQ0 A;  2MDX A;  3AU5 A;  1AWE A;  1WJ1 A;  1XKE A;  2LYD A;  4XWX A;  4YON A;  1BWN A;  2AEH A;  4A6H A;  2GJY A;  1FHX A;  1I7A A;  3KY9 A;  3ZDT A;  1RJ2 A;  1MK7 B;  2DHJ A;  2J0J A;  1AQC A;  2DFK A;  2W2X D;  4KHB B;  1MIZ B;  4DX9 0;  4CHM A;  2CRF A;  3V5W A;  5C16 A;  3D8E A;  2RUK B;  4D0N B;  3QIJ A;  1ZVR A;  4HAV B;  3VIA A;  2DYN A;  1DDW A;  4EKU A;  1PMS A;  2H7E A;  5L81 A;  1DDV A;  2DHI A;  5JHG A;  2QKM A;  3F0W A;  2KGX B;  5C6R A;  1J19 A;  2I5C A;  1NU2 A;  2K00 A;  1PFJ A;  3ML4 A;  2X18 A;  2OTX A;  1RRP B;  5D27 A;  5D3W A;  3PZD A;  1U5G A;  2VRW B;  2Z0P A;  5D3X A;  3DXD A;  3ZVR A;  4BBK A;  2LKO A;  2UVM A;  2P0F A;  1XD4 A;  2HE7 A;  2RNR B;  2DYQ A;  5C5B A;  1GC6 A;  2V76 A;  5HE2 A;  3ODW A;  1ZM0 A;  4B6H A;  2YS3 A;  1U27 A;  2Z0O A;  3AU4 A;  4HB2 B;  1P6S A;  1U5E A;  1W1G A;  4ZRJ A;  1WG7 A;  2N0Y A;  1SGH A;  4CYE A;  2YVC A;  1M7E A;  4CHJ A;  2DLW A;  2DKQ A;  3PVW A;  4GN1 A;  3U7D A;  4A5K A;  3F5R A;  3HQC A;  1UEF A;  4NSW A;  5FI0 A;  2ELA A;  1FAO A;  3KZ1 A;  2J59 M;  4HHV A;  4HAU B;  5DHF B;  1UPQ A;  1TQZ A;  2IFS A;  1Z87 A;  2YT1 A;  2ELB A;  4IFS A;  1OY2 A;  1X1G A;  3G9W A;  4Y94 A;  1UNQ A;  1E5W A;  2M38 A;  4EMO A;  5C79 A;  2L2I A;  2JP2 A;  2RVB B;  1GG3 A;  3A8Q A;  1EGX A;  4TYZ A;  1U5F A;  3KSY A;  3KRX A;  2RLO A;  2P0H A;  2Y7B A;  2YSZ A;  1EF1 A;  3QBV B;  1MAI A;  2GCJ A;  2EMT A;  1XOD A;  5DHA B;  2EJ8 A;  2D9V A;  1KZ7 A;  4L6E A;  1ISN A;  3SO6 A;  1KI1 B;  2J0M A;  1P3R A;  2PZ1 A;  2W2W A;  4KHA A;  2GCL A;  2HTH B;  2LOZ A;  4HDQ A;  4HAT B;  3TCA A;  3RCP A;  4NY0 A;  3WYF B;  3PVU A;  2COD A;  4K2O A;  1BAK A;  4GMX B;  1FHW A;  4TKN A;  3BIN A;  3ULB A;  4Z2N A;  3IVF A;  3AJ4 A;  3BJI A;  2DX5 A;  5EFX A;  2VSZ A;  1MIX A;  4MK0 A;  1V61 A;  2KUP A;  3DXC A;  5DI9 B;  4WVF B;  2E2X A;  2I1J A;  4ZRI A;  2EMS A;  3HW2 B;  5GOW B;  4MY6 A;  4A6F B;  4Z2M B;  3HK0 A;  2D10 A;  4HAW B;  2IYB A;  4YL8 A;  1EAZ A;  5J3Y A;  4GPT B;  3TVV A;  1ZC4 B;  2LOX A;  4HAZ B;  2D2Q A;  1M7R A;  2CAY A;  1WI1 A;  2W2X C;  2I5F A;  2DKP A;  4HB4 B;  2NZ8 B;  3FEH A;  5JP4 A;  4GXB A;  1GC7 A;  2ROZ B;  2I1K A;  4ZRK A;  3X23 A;  4IOY X;  4K81 A;  4EJN A;  4F7U P;  2UZR A;  3M1I B;  1V5U A;  1DDM A;  1N3H A;  1BTN A;  2OQB A;  1PLS A;  1KZG A;  1W1D A;  1Y5O A;  2UZS A;  1TXD A;  5J3Q A;  3N7C A;  3UZT A;  2MWN B;  3GYO A;  3O96 A;  5DIF B;  1WJM A;  4HDO A;  3ULC A;  2RSG A;  3VOQ A;  4K2P A;  4PNK A;  1H4R A;  2COC A;  1I2H A;  2NMB A;  1X86 A;  5HE1 A;  1J0W A;  3PEG A;  2EC1 A;  5KQ1 A;  3TFM A;  3FM8 C;  2DTC A;  3GYP A;  4GZU A;  5FI1 A;  4A6F A;  1UNP A;  5J3T A;  1NI2 A;  3SYX A;  1IRS A;  2GS0 A;  3SV1 A;  2FJL A;  1H10 A;  2Y8F A;  2DHK A;  5C5B B;  3ODO A;  4HAY B;  1P5T A;  3OAN A;  4K17 A;  4C0A A;  3WA0 A;  2VKI A;  2R0D A;  1XCG A;  4IAP A;  2ZPY A;  2YS5 A;  2D4Q A;  2D9Y A;  2CY4 A;  1EVH A;  2K2U A;  5CLQ B;  4F7G A;  2COA A;  2MFQ A;  1UPR A;  5KCV A;  5D3Y A;  2CY5 A;  1TJ6 A;  1FGZ A;  1MPH A;  2Z0Q A;  1U2B A;  4DXA B;  2RGN B;  1X05 A;  1Y19 B;  5DH9 B;  1UNR A;  5KQ4 A;  2DN6 A;  4WSF A;  5D3V A;  2KCJ A;  5CLL B;  3MPX A;  1QC6 A;  1WGQ A;  2ROV A;  2LUL A;  1NTV A;  3NSU A;  4KHO A;  3D8D A;  5JHH A;  1LB1 A;  3FSS A;  2LG1 A;  4KAX B;  3U8Z A;  1B55 A;  3A98 B;  2DA0 A;  1MK9 B;  1SHC A;  1WVH A;  2XQN M;  1FOE A;  1XR0 B;  1OQN A;  1X11 A;  5LON B;  2MKR A;  1V88 A;  3PVL A;  2YF0 A;  2AL6 A;  2BCJ A;  2COF A;  4GMV A;  1XX0 A;  3P6A A;  3PSC A;  3PP2 A;  1V5M A;  2D9X A;  1LW3 A;  4HB3 B;  2YRY A;  3LJU X;  1U5D A;  2P8V A;  2YT0 A;  3MDB C;  1Q67 A;  1U29 A;  4HAX B;  2P0D A;  5JLJ B;  2Y8G A;  4HB0 B;  1FGY A;  2K2J A;  1WGU A;  5HE0 A;  5LOP B;  1X1F A;  2M14 A;  1BTK A;  3DXE A;  1MKE A;  4DX8 A;  1V5P A;  1DYN A;  2ADZ A;  3T06 A;  4MT7 A;  3TO1 A;  4H8S A;  3A8P A;  1QQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...