1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system/signaling protein
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
1SGHA 1MKEA 3SV1A 1P6SA 1BTKA 2RLOA 5KQ1A 1FGYA 1DBHA 2GS0A 3D8FA 2QKLA 1I2HA 4HDOA 1V89A 2DYNA 4HAYB 4A6FA 5DHAB 3N7CA 1MPHA 1WI1A 1BY1A 3DXEA 2DX1A 5J3YA 3WA0A 1P3RA 3EO2A 2MKRA 4IOYX 3D8DA 1XKEA 2J0JA 3AU5A 4MK0A 2AL6A 5C5BA 3HQCA 3PEGA 4KVGB 2L2IA 1Y5OA 1X86A 2CY4A 2EMTA 2M14A 1DDVA 2D11A 2KUPA 3A8QA 2UZRA 2M38A 2IFSA 2N0YA 4CHJA 2DFKA 1K5GB 4HAZB 1XR0B 2I1KA 1KZGA 1FHOA 3VOQA 2HTHB 2EC1A 1V61A 4YONA 1WG7A 2W2XC 2YRYA 4A6HA 4GMXB 1U5DA 2YS5A 5KQ4A 3CXBB 2EJ8A 2Q13A 1MK9B 2YT1A 3FSSA 4EMOA 4YL8A 3DXCA 1XX0A 1RRPB 1ZM0A 1OQNA 3GF9A 3P7ZA 1ZVRA 2RNRB 2DN6A 5L81A 3NSUA 1DDWA 5J3TA 4HATB 5HE2A 1V5PA 2DLWA 1BAKA 1N3HA 1M7EA 1M7RA 2H7EA 3KZ1A 2YVCA 1XCGA 3A98B 3KRXA 4KAXB 3GYPA 4MY6A 2GCJA 5KCVA 2E2XA 1FOEA 1FAOA 2VRWB 1MIZB 2P0HA 1PMSA 1FGZA 1U5FA 4GOUA 2NZ8B 4ZRKA 3LJUX 2ROVA 5D3WA 3PSCA 4D0OA 2I1JA 1UNPA 4PQ0A 5JHHA 4F7UP 1DROA 4KHBB 5JHGA 4DBBA 4GYVA 2COCA 3RCPA 3PVUA 1UNRA 2D9VA 1KI1B 4KHOA 2K2UA 3TO1A 2COAA 2ELBA 5LONB 1Y19B 4ZRIA 3X23A 1WVHA 1DDMA 4KHAA 1MIXA 1BTNA 2NMBA 3U7DA 5D3YA 3KSYA 5C79A 2DHJA 4H8SA 1Q67A 2GJYA 3D8EA 4B6HA 5FI1A 1WGUA 2MFQA 3TVVA 3TFMA 1B55A 4K17A 1TQZA 2LKOA 2D9XA 2YS1A 3ODOA 1EAZA 4XWXA 5DI9B 2LOZA 5DH9B 1QQGA 2I5CA 2KCJA 2PZ1A 1TJ6A 2ZPYA 5HE0A 2D9WA 4WJ7A 2MWNB 4GPTB 4NSWA 3SYXA 1ZC3B 2DKPA 4CYEA 4DX8A 4NY0A 3PVWA 4A5KA 1X1FA 3BJIA 4HB0B 1GG3A 2N23A 3ODXA 4K81A 4TYZA 3T06A 4PNKA 1BWNA 4HAVB 5D3VA 2DTCA 2D10A 2YSZA 2D9YA 4HAXB 3V5WA 1XD4A 1PLSA 1OMWA 4HHVA 2P0FA 1FHWA 1WJ1A 3CIKA 1NTVA 3FEHA 3ZDTA 1IRSA 2YF0A 4HB2B 1MAIA 3G9WA 3FM8C 3TCAA 1EGXA 5D27A 1V5MA 4DX90 2DHIA 2J59M 3KY9A 4IFSA 1SHCA 1UEFA 2EMSA 2RVBB 2J0MA 1V88A 2LG1A 2RSGA 1EF1A 2MDXA 4GXBA 2V76A 5HE3A 2ROZB 2YT0A 2DKQA 4EKUA 1X05A 2UVMA 1Z87A 5JP4A 5J3QA 1FB8A 2OQBA 1MK7B 1H4RA 5HE1A 1DYNA 4K2OA 1AWEA 2G35A 1QC6A 1TXDA 2Y7BA 4C0AA 1NTYA 1RJ2A 3VIAA 2UZSA 3OANA 5CLQB 1EVHA 2L1CA 3QWMA 2DHKA 2KGXB 4F7GA 1UPRA 1ZSQA 1UNQA 3O96A 3ML4A 4A6KA 2VKIA 5FI0A 2X18A 1X11A 1GC7A 1WGQA 2OTXA 2P8VA 2D2QA 1I7AA 5C6RA 2DX5A 4HAUB 2ELAA 5GOWB 2BCJA 1H10A 4F7HA 1F5XA 2COFA 1PFJA 4CHMA 4D0NB 3SUZA 1OY2A 4WVFB 2CODA 2IYBA 1E5WA 2W2WA 2XQNM 2YS3A 3MDBC 4P7IA 3QIJA 3AU4A 5EFXA 4TKNA 1U29A 3GYOA 4IAPA 5CLLB 3ZVRA 2LULA 3MPXA 4K2PA 1U5EA 2J0KA 3TW1A 4MT7A 4BBKA 1NU2A 2CRFA 2KR9A 1WJMA 2Z0PA 1J19A 2DYQA 1K5DB 3HW2B 3PZDA 2Y8GA 4HDQA 3QBVB 2P0DA 3DXDA 3IVFA 3ULCA 2LOXA 3JV3A 4Z2NA 1U2BA 3PP2A 2K00A 2LYDA 1LW3A 3A8PA 1ISNA 2Y8FA 4GN1A 2VSZA 2JP2A 4L6EA 1J0WA 1AQCA 3M1IB 4GZUA 1W1HA 1KZ7A 5DHFB 2R0DA 4ZRJA 4EJNA 2RGNB 1W1DA 3WYFB 1U27A 2CAYA 4A6FB 2D9ZA 2Z0QA 2R09A 2I5FA 1FHXA 4HAWB 4WSFA 4DXAB 3SNHA 2H7DA 2W2XD 2D4QA 2RUKB 2QKMA 5C16A 3F0WA 5D3XA 5LOPB 2ADZA 3PVLA 5C5BB 3HK0A 3AJ4A 3P6AA 2K2JA 3SO6A 1NI2A 1X1GA 4GMVA 3F5RA 1UPQA 3KRWA 4Z2MB 3ODWA 3PG7A 5DIFB 3UZTA 4HB4B 1W1GA 2CY5A 1V5UA 2HE7A 1GC6A 1U5GA 2FJLA 1XODA 2AEHA 2DA0A 3U8ZA 1P5TA 5JLJB 3BINA 1ZC4B 2Z0OA 3ULBA 4HB3B 1LB1A 2GCLA 4Y94A
chains in the Genus database with same CATH superfamily
1SGHA 1MKEA 3SV1A 1P6SA 1BTKA 2RLOA 5KQ1A 1FGYA 1DBHA 2GS0A 3D8FA 3FVCA 2QKLA 1I2HA 4HDOA 1V89A 2DYNA 4HAYB 4A6FA 5DHAB 3N7CA 4QXAB 1MPHA 2KIGA 2FJUB 1WI1A 1BY1A 3DXEA 2DX1A 5J3YA 5IRSA 3WA0A 1P3RA 3EO2A 2MKRA 4IOYX 2Z4DA 3D8DA 1XKEA 2J0JA 3AU5A 4MK0A 2AL6A 5C5BA 2GUMA 3HQCA 3PEGA 4KVGB 2L2IA 1Y5OA 1X86A 2CY4A 2EMTA 2M14A 1DDVA 2D11A 2KUPA 3U12A 3A8QA 2UZRA 2M38A 2IFSA 2N0YA 4CHJA 3OHMB 2DFKA 1K5GB 4KHBA 4HAZB 1XR0B 2I1KA 1KZGA 1FHOA 3VOQA 2HTHB 2EC1A 1V61A 4YONA 1WG7A 5I2SA 2W2XC 2YRYA 4A6HA 4GMXB 1U5DA 4QJ5B 2YS5A 5KQ4A 3CXBB 2EJ8A 2Q13A 1MK9B 2YT1A 3FSSA 4EMOA 4YL8A 3DXCA 1XX0A 1RRPB 1ZM0A 2NBVA 1OQNA 3GF9A 3P7ZA 1ZVRA 2RNRB 2DN6A 5L81A 3NSUA 1DDWA 5J3TA 3A58A 4HATB 1V5PA 2DLWA 5HE2A 1BAKA 1N3HA 1M7EA 1M7RA 2H7EA 3KZ1A 2YVCA 1XCGA 3A98B 3KRXA 4KAXB 3GYPA 4MY6A 2GCJA 5KCVA 2E2XA 1FOEA 1FAOA 2VRWB 1MIZB 2P0HA 2K49A 1PMSA 1FGZA 1U5FA 4GOUA 2NZ8B 4ZRKA 3LJUX 2ROVA 5D3WA 3PSCA 4D0OA 2I1JA 1UNPA 4PQ0A 5JHHA 4F7UP 1DROA 4KHBB 5JHGA 4DBBA 4GYVA 2COCA 3HSAA 3RCPA 3NWAA 3PVUA 1UNRA 2D9VA 1KI1B 4KHOA 2K2UA 3TO1A 2COAA 2ELBA 3NWDA 5LONB 1Y19B 4QJ4B 4ZRIA 3X23A 1WVHA 1DDMA 4KHAA 1MIXA 1BTNA 2NMBA 3U7DA 5D3YA 3KSYA 5C79A 2DHJA 2RRFA 4H8SA 1Q67A 2GJYA 3D8EA 4B6HA 5FI1A 1WGUA 2ZKMX 2MFQA 3TVVA 3TFMA 1B55A 4K17A 1TQZA 2LKOA 2D9XA 2YS1A 3ODOA 1EAZA 4XWXA 5DI9B 2LOZA 2R2YA 4D6WA 5DH9B 3DCXA 1QQGA 2I5CA 2KCJA 2K8EA 2PZ1A 1TJ6A 2ZPYA 5HE0A 2D9WA 4WJ7A 2MWNB 4GPTB 2Z13A 4NSWA 4OSNA 3SYXA 1ZC3B 2DKPA 4CYEA 4DX8A 4NY0A 3PVWA 4A5KA 1X1FA 3BJIA 4HB0B 1GG3A 2N23A 3ODXA 4K81A 4TYZA 3T06A 4PNKA 1BWNA 4HAVB 5D3VA 3NW8A 2DTCA 2D10A 2YSZA 2D9YA 4HAXB 3V5WA 1XD4A 1PLSA 1OMWA 4DIXA 4HHVA 2P0FA 1FHWA 1WJ1A 3CIKA 1NTVA 2KR0A 3FEHA 3ZDTA 1IRSA 2YF0A 4HB2B 1MAIA 3G9WA 3FM8C 1T77A 3TCAA 1EGXA 5D27A 1V5MA 4CSQA 4DX90 2DHIA 2J59M 3KY9A 4IFSA 1SHCA 1UEFA 2EMSA 2RVBB 2J0MA 1V88A 2LG1A 2RSGA 4GNKB 1EF1A 2MDXA 4GXBA 2V76A 5HE3A 2ROZB 2YT0A 2DKQA 4EKUA 2Z59A 1X05A 2UVMA 1Z87A 5JP4A 5J3QA 1FB8A 2OQBA 1MK7B 1H4RA 5HE1A 1DYNA 4K2OA 1AWEA 2G35A 1QC6A 1TXDA 2Y7BA 4C0AA 1NTYA 1RJ2A 3VIAA 2UZSA 4L1RA 3OANA 5CLQB 1EVHA 2L1CA 3QWMA 2DHKA 2KGXB 4F7GA 1UPRA 1ZSQA 1UNQA 3O96A 3ML4A 4A6KA 2VKIA 5FI0A 2X18A 1X11A 1GC7A 1WGQA 2OTXA 2P8VA 2D2QA 1I7AA 5C6RA 2DX5A 4HAUB 2ELAA 5GOWB 2BCJA 1H10A 4F7HA 1F5XA 1ZYIA 2COFA 1PFJA 4CHMA 4D0NB 3SUZA 1OY2A 4WVFB 2CODA 2IYBA 1E5WA 2W2WA 2XQNM 2YS3A 3MDBC 4P7IA 3QIJA 3AU4A 5M4YB 5EFXA 4TKNA 1U29A 3GYOA 5I2MA 4IAPA 5CLLB 3ZVRA 4HSIA 2LULA 3MPXA 4K2PA 1U5EA 2J0KA 3TW1A 4MT7A 4BBKA 1NU2A 2CRFA 2KR9A 1WJMA 2Z0PA 1J19A 2DYQA 1K5DB 3HW2B 3PZDA 2Y8GA 4HDQA 3QBVB 2P0DA 3DXDA 3IVFA 3ULCA 2LOXA 2YT2A 3JV3A 4Z2NA 1U2BA 3PP2A 2K00A 2LYDA 1LW3A 3A8PA 2KUQA 1ISNA 2Y8FA 4GN1A 2VSZA 2JP2A 4L6EA 1J0WA 1AQCA 3M1IB 4GZUA 1W1HA 1KZ7A 5DHFB 2R0DA 4ZRJA 4EJNA 2RGNB 1W1DA 3WYFB 1U27A 2CAYA 4A6FB 2D9ZA 2Z0QA 2R09A 2I5FA 1FHXA 4HAWB 2Z14A 4WSFA 4DXAB 3SNHA 2H7DA 2W2XD 2D4QA 2RUKB 2QKMA 5C16A 3F0WA 5D3XA 3B77A 3NWFA 5LOPB 2ADZA 3PVLA 5C5BB 3HK0A 3AJ4A 3P6AA 2K2JA 3SO6A 1NI2A 1X1GA 4GMVA 3F5RA 4OT1A 1UPQA 2KIEA 3KRWA 4Z2MB 3ODWA 3PG7A 5DIFB 3UZTA 4HB4B 1W1GA 2CY5A 1V5UA 4QJ3B 2HE7A 1GC6A 1U5GA 2FJLA 1XODA 2AEHA 2DA0A 1MI1A 3U8ZA 1P5TA 5JLJB 3BINA 5LG4B 3HIEA 1ZC4B 2Z0OA 3ULBA 4HB3B 1LB1A 2GCLA 4Y94A
chains in the Genus database with same CATH topology
1SGHA 1MKEA 3SV1A 1P6SA 1BTKA 2RLOA 5KQ1A 1FGYA 1DBHA 2GS0A 3D8FA 2QKLA 1I2HA 4HDOA 1V89A 2DYNA 4HAYB 4A6FA 5DHAB 3N7CA 1MPHA 1WI1A 1BY1A 3DXEA 2DX1A 5J3YA 3WA0A 1P3RA 3EO2A 2MKRA 4IOYX 3D8DA 1XKEA 2J0JA 3AU5A 4MK0A 2AL6A 5C5BA 3HQCA 3PEGA 4KVGB 2L2IA 1Y5OA 1X86A 2CY4A 2EMTA 2M14A 1DDVA 2D11A 2KUPA 3A8QA 2UZRA 2M38A 2IFSA 2N0YA 4CHJA 2DFKA 1K5GB 4HAZB 1XR0B 2I1KA 1KZGA 1FHOA 3VOQA 2HTHB 2EC1A 1V61A 4YONA 1WG7A 2W2XC 2YRYA 4A6HA 4GMXB 1U5DA 2YS5A 5KQ4A 3CXBB 2EJ8A 2Q13A 1MK9B 2YT1A 3FSSA 4EMOA 4YL8A 3DXCA 1XX0A 1RRPB 1ZM0A 1OQNA 3GF9A 3P7ZA 1ZVRA 2RNRB 2DN6A 5L81A 3NSUA 1DDWA 5J3TA 4HATB 5HE2A 1V5PA 2DLWA 1BAKA 1N3HA 1M7EA 1M7RA 2H7EA 3KZ1A 2YVCA 1XCGA 3A98B 3KRXA 4KAXB 3GYPA 4MY6A 2GCJA 5KCVA 2E2XA 1FOEA 1FAOA 2VRWB 1MIZB 2P0HA 1PMSA 1FGZA 1U5FA 4GOUA 2NZ8B 4ZRKA 3LJUX 2ROVA 5D3WA 3PSCA 4D0OA 2I1JA 1UNPA 4PQ0A 5JHHA 4F7UP 1DROA 4KHBB 5JHGA 4DBBA 4GYVA 2COCA 3RCPA 3PVUA 1UNRA 2D9VA 1KI1B 4KHOA 2K2UA 3TO1A 2COAA 2ELBA 5LONB 1Y19B 4ZRIA 3X23A 1WVHA 1DDMA 4KHAA 1MIXA 1BTNA 2NMBA 3U7DA 5D3YA 3KSYA 5C79A 2DHJA 4H8SA 1Q67A 2GJYA 3D8EA 4B6HA 5FI1A 1WGUA 2MFQA 3TVVA 3TFMA 1B55A 4K17A 1TQZA 2LKOA 2D9XA 2YS1A 3ODOA 1EAZA 4XWXA 5DI9B 2LOZA 5DH9B 1QQGA 2I5CA 2KCJA 2PZ1A 1TJ6A 2ZPYA 5HE0A 2D9WA 4WJ7A 2MWNB 4GPTB 4NSWA 3SYXA 1ZC3B 2DKPA 4CYEA 4DX8A 4NY0A 3PVWA 4A5KA 1X1FA 3BJIA 4HB0B 1GG3A 2N23A 3ODXA 4K81A 4TYZA 3T06A 4PNKA 1BWNA 4HAVB 5D3VA 2DTCA 2D10A 2YSZA 2D9YA 4HAXB 3V5WA 1XD4A 1PLSA 1OMWA 4HHVA 2P0FA 1FHWA 1WJ1A 3CIKA 1NTVA 3FEHA 3ZDTA 1IRSA 2YF0A 4HB2B 1MAIA 3G9WA 3FM8C 3TCAA 1EGXA 5D27A 1V5MA 4DX90 2DHIA 2J59M 3KY9A 4IFSA 1SHCA 1UEFA 2EMSA 2RVBB 2J0MA 1V88A 2LG1A 2RSGA 1EF1A 2MDXA 4GXBA 2V76A 5HE3A 2ROZB 2YT0A 2DKQA 4EKUA 1X05A 2UVMA 1Z87A 5JP4A 5J3QA 1FB8A 2OQBA 1MK7B 1H4RA 5HE1A 1DYNA 4K2OA 1AWEA 2G35A 1QC6A 1TXDA 2Y7BA 4C0AA 1NTYA 1RJ2A 3VIAA 2UZSA 3OANA 5CLQB 1EVHA 2L1CA 3QWMA 2DHKA 2KGXB 4F7GA 1UPRA 1ZSQA 1UNQA 3O96A 3ML4A 4A6KA 2VKIA 5FI0A 2X18A 1X11A 1GC7A 1WGQA 2OTXA 2P8VA 2D2QA 1I7AA 5C6RA 2DX5A 4HAUB 2ELAA 5GOWB 2BCJA 1H10A 4F7HA 1F5XA 2COFA 1PFJA 4CHMA 4D0NB 3SUZA 1OY2A 4WVFB 2CODA 2IYBA 1E5WA 2W2WA 2XQNM 2YS3A 3MDBC 4P7IA 3QIJA 3AU4A 5EFXA 4TKNA 1U29A 3GYOA 4IAPA 5CLLB 3ZVRA 2LULA 3MPXA 4K2PA 1U5EA 2J0KA 3TW1A 4MT7A 4BBKA 1NU2A 2CRFA 2KR9A 1WJMA 2Z0PA 1J19A 2DYQA 1K5DB 3HW2B 3PZDA 2Y8GA 4HDQA 3QBVB 2P0DA 3DXDA 3IVFA 3ULCA 2LOXA 3JV3A 4Z2NA 1U2BA 3PP2A 2K00A 2LYDA 1LW3A 3A8PA 1ISNA 2Y8FA 4GN1A 2VSZA 2JP2A 4L6EA 1J0WA 1AQCA 3M1IB 4GZUA 1W1HA 1KZ7A 5DHFB 2R0DA 4ZRJA 4EJNA 2RGNB 1W1DA 3WYFB 1U27A 2CAYA 4A6FB 2D9ZA 2Z0QA 2R09A 2I5FA 1FHXA 4HAWB 4WSFA 4DXAB 3SNHA 2H7DA 2W2XD 2D4QA 2RUKB 2QKMA 5C16A 3F0WA 5D3XA 5LOPB 2ADZA 3PVLA 5C5BB 3HK0A 3AJ4A 3P6AA 2K2JA 3SO6A 1NI2A 1X1GA 4GMVA 3F5RA 1UPQA 3KRWA 4Z2MB 3ODWA 3PG7A 5DIFB 3UZTA 4HB4B 1W1GA 2CY5A 1V5UA 2HE7A 1GC6A 1U5GA 2FJLA 1XODA 2AEHA 2DA0A 3U8ZA 1P5TA 5JLJB 3BINA 1ZC4B 2Z0OA 3ULBA 4HB3B 1LB1A 2GCLA 4Y94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGH A;  1MKE A;  3SV1 A;  1P6S A;  1BTK A;  2RLO A;  5KQ1 A;  1FGY A;  1DBH A;  2GS0 A;  3D8F A;  2QKL A;  1I2H A;  4HDO A;  1V89 A;  2DYN A;  4HAY B;  4A6F A;  5DHA B;  3N7C A;  1MPH A;  1WI1 A;  1BY1 A;  3DXE A;  2DX1 A;  5J3Y A;  3WA0 A;  1P3R A;  3EO2 A;  2MKR A;  4IOY X;  3D8D A;  1XKE A;  2J0J A;  3AU5 A;  4MK0 A;  2AL6 A;  5C5B A;  3HQC A;  3PEG A;  4KVG B;  2L2I A;  1Y5O A;  1X86 A;  2CY4 A;  2EMT A;  2M14 A;  1DDV A;  2D11 A;  2KUP A;  3A8Q A;  2UZR A;  2M38 A;  2IFS A;  2N0Y A;  4CHJ A;  2DFK A;  1K5G B;  4HAZ B;  1XR0 B;  2I1K A;  1KZG A;  1FHO A;  3VOQ A;  2HTH B;  2EC1 A;  1V61 A;  4YON A;  1WG7 A;  2W2X C;  2YRY A;  4A6H A;  4GMX B;  1U5D A;  2YS5 A;  5KQ4 A;  3CXB B;  2EJ8 A;  2Q13 A;  1MK9 B;  2YT1 A;  3FSS A;  4EMO A;  4YL8 A;  3DXC A;  1XX0 A;  1RRP B;  1ZM0 A;  1OQN A;  3GF9 A;  3P7Z A;  1ZVR A;  2RNR B;  2DN6 A;  5L81 A;  3NSU A;  1DDW A;  5J3T A;  4HAT B;  5HE2 A;  1V5P A;  2DLW A;  1BAK A;  1N3H A;  1M7E A;  1M7R A;  2H7E A;  3KZ1 A;  2YVC A;  1XCG A;  3A98 B;  3KRX A;  4KAX B;  3GYP A;  4MY6 A;  2GCJ A;  5KCV A;  2E2X A;  1FOE A;  1FAO A;  2VRW B;  1MIZ B;  2P0H A;  1PMS A;  1FGZ A;  1U5F A;  4GOU A;  2NZ8 B;  4ZRK A;  3LJU X;  2ROV A;  5D3W A;  3PSC A;  4D0O A;  2I1J A;  1UNP A;  4PQ0 A;  5JHH A;  4F7U P;  1DRO A;  4KHB B;  5JHG A;  4DBB A;  4GYV A;  2COC A;  3RCP A;  3PVU A;  1UNR A;  2D9V A;  1KI1 B;  4KHO A;  2K2U A;  3TO1 A;  2COA A;  2ELB A;  5LON B;  1Y19 B;  4ZRI A;  3X23 A;  1WVH A;  1DDM A;  4KHA A;  1MIX A;  1BTN A;  2NMB A;  3U7D A;  5D3Y A;  3KSY A;  5C79 A;  2DHJ A;  4H8S A;  1Q67 A;  2GJY A;  3D8E A;  4B6H A;  5FI1 A;  1WGU A;  2MFQ A;  3TVV A;  3TFM A;  1B55 A;  4K17 A;  1TQZ A;  2LKO A;  2D9X A;  2YS1 A;  3ODO A;  1EAZ A;  4XWX A;  5DI9 B;  2LOZ A;  5DH9 B;  1QQG A;  2I5C A;  2KCJ A;  2PZ1 A;  1TJ6 A;  2ZPY A;  5HE0 A;  2D9W A;  4WJ7 A;  2MWN B;  4GPT B;  4NSW A;  3SYX A;  1ZC3 B;  2DKP A;  4CYE A;  4DX8 A;  4NY0 A;  3PVW A;  4A5K A;  1X1F A;  3BJI A;  4HB0 B;  1GG3 A;  2N23 A;  3ODX A;  4K81 A;  4TYZ A;  3T06 A;  4PNK A;  1BWN A;  4HAV B;  5D3V A;  2DTC A;  2D10 A;  2YSZ A;  2D9Y A;  4HAX B;  3V5W A;  1XD4 A;  1PLS A;  1OMW A;  4HHV A;  2P0F A;  1FHW A;  1WJ1 A;  3CIK A;  1NTV A;  3FEH A;  3ZDT A;  1IRS A;  2YF0 A;  4HB2 B;  1MAI A;  3G9W A;  3FM8 C;  3TCA A;  1EGX A;  5D27 A;  1V5M A;  4DX9 0;  2DHI A;  2J59 M;  3KY9 A;  4IFS A;  1SHC A;  1UEF A;  2EMS A;  2RVB B;  2J0M A;  1V88 A;  2LG1 A;  2RSG A;  1EF1 A;  2MDX A;  4GXB A;  2V76 A;  5HE3 A;  2ROZ B;  2YT0 A;  2DKQ A;  4EKU A;  1X05 A;  2UVM A;  1Z87 A;  5JP4 A;  5J3Q A;  1FB8 A;  2OQB A;  1MK7 B;  1H4R A;  5HE1 A;  1DYN A;  4K2O A;  1AWE A;  2G35 A;  1QC6 A;  1TXD A;  2Y7B A;  4C0A A;  1NTY A;  1RJ2 A;  3VIA A;  2UZS A;  3OAN A;  5CLQ B;  1EVH A;  2L1C A;  3QWM A;  2DHK A;  2KGX B;  4F7G A;  1UPR A;  1ZSQ A;  1UNQ A;  3O96 A;  3ML4 A;  4A6K A;  2VKI A;  5FI0 A;  2X18 A;  1X11 A;  1GC7 A;  1WGQ A;  2OTX A;  2P8V A;  2D2Q A;  1I7A A;  5C6R A;  2DX5 A;  4HAU B;  2ELA A;  5GOW B;  2BCJ A;  1H10 A;  4F7H A;  1F5X A;  2COF A;  1PFJ A;  4CHM A;  4D0N B;  3SUZ A;  1OY2 A;  4WVF B;  2COD A;  2IYB A;  1E5W A;  2W2W A;  2XQN M;  2YS3 A;  3MDB C;  4P7I A;  3QIJ A;  3AU4 A;  5EFX A;  4TKN A;  1U29 A;  3GYO A;  4IAP A;  5CLL B;  3ZVR A;  2LUL A;  3MPX A;  4K2P A;  1U5E A;  2J0K A;  3TW1 A;  4MT7 A;  4BBK A;  1NU2 A;  2CRF A;  2KR9 A;  1WJM A;  2Z0P A;  1J19 A;  2DYQ A;  1K5D B;  3HW2 B;  3PZD A;  2Y8G A;  4HDQ A;  3QBV B;  2P0D A;  3DXD A;  3IVF A;  3ULC A;  2LOX A;  3JV3 A;  4Z2N A;  1U2B A;  3PP2 A;  2K00 A;  2LYD A;  1LW3 A;  3A8P A;  1ISN A;  2Y8F A;  4GN1 A;  2VSZ A;  2JP2 A;  4L6E A;  1J0W A;  1AQC A;  3M1I B;  4GZU A;  1W1H A;  1KZ7 A;  5DHF B;  2R0D A;  4ZRJ A;  4EJN A;  2RGN B;  1W1D A;  3WYF B;  1U27 A;  2CAY A;  4A6F B;  2D9Z A;  2Z0Q A;  2R09 A;  2I5F A;  1FHX A;  4HAW B;  4WSF A;  4DXA B;  3SNH A;  2H7D A;  2W2X D;  2D4Q A;  2RUK B;  2QKM A;  5C16 A;  3F0W A;  5D3X A;  5LOP B;  2ADZ A;  3PVL A;  5C5B B;  3HK0 A;  3AJ4 A;  3P6A A;  2K2J A;  3SO6 A;  1NI2 A;  1X1G A;  4GMV A;  3F5R A;  1UPQ A;  3KRW A;  4Z2M B;  3ODW A;  3PG7 A;  5DIF B;  3UZT A;  4HB4 B;  1W1G A;  2CY5 A;  1V5U A;  2HE7 A;  1GC6 A;  1U5G A;  2FJL A;  1XOD A;  2AEH A;  2DA0 A;  3U8Z A;  1P5T A;  5JLJ B;  3BIN A;  1ZC4 B;  2Z0O A;  3ULB A;  4HB3 B;  1LB1 A;  2GCL A;  4Y94 A; 
#chains in the Genus database with same CATH topology
 1SGH A;  1MKE A;  3SV1 A;  1P6S A;  1BTK A;  2RLO A;  5KQ1 A;  1FGY A;  1DBH A;  2GS0 A;  3D8F A;  3FVC A;  2QKL A;  1I2H A;  4HDO A;  1V89 A;  2DYN A;  4HAY B;  4A6F A;  5DHA B;  3N7C A;  4QXA B;  1MPH A;  2KIG A;  2FJU B;  1WI1 A;  1BY1 A;  3DXE A;  2DX1 A;  5J3Y A;  5IRS A;  3WA0 A;  1P3R A;  3EO2 A;  2MKR A;  4IOY X;  2Z4D A;  3D8D A;  1XKE A;  2J0J A;  3AU5 A;  4MK0 A;  2AL6 A;  5C5B A;  2GUM A;  3HQC A;  3PEG A;  4KVG B;  2L2I A;  1Y5O A;  1X86 A;  2CY4 A;  2EMT A;  2M14 A;  1DDV A;  2D11 A;  2KUP A;  3U12 A;  3A8Q A;  2UZR A;  2M38 A;  2IFS A;  2N0Y A;  4CHJ A;  3OHM B;  2DFK A;  1K5G B;  4KHB A;  4HAZ B;  1XR0 B;  2I1K A;  1KZG A;  1FHO A;  3VOQ A;  2HTH B;  2EC1 A;  1V61 A;  4YON A;  1WG7 A;  5I2S A;  2W2X C;  2YRY A;  4A6H A;  4GMX B;  1U5D A;  4QJ5 B;  2YS5 A;  5KQ4 A;  3CXB B;  2EJ8 A;  2Q13 A;  1MK9 B;  2YT1 A;  3FSS A;  4EMO A;  4YL8 A;  3DXC A;  1XX0 A;  1RRP B;  1ZM0 A;  2NBV A;  1OQN A;  3GF9 A;  3P7Z A;  1ZVR A;  2RNR B;  2DN6 A;  5L81 A;  3NSU A;  1DDW A;  5J3T A;  3A58 A;  4HAT B;  1V5P A;  2DLW A;  5HE2 A;  1BAK A;  1N3H A;  1M7E A;  1M7R A;  2H7E A;  3KZ1 A;  2YVC A;  1XCG A;  3A98 B;  3KRX A;  4KAX B;  3GYP A;  4MY6 A;  2GCJ A;  5KCV A;  2E2X A;  1FOE A;  1FAO A;  2VRW B;  1MIZ B;  2P0H A;  2K49 A;  1PMS A;  1FGZ A;  1U5F A;  4GOU A;  2NZ8 B;  4ZRK A;  3LJU X;  2ROV A;  5D3W A;  3PSC A;  4D0O A;  2I1J A;  1UNP A;  4PQ0 A;  5JHH A;  4F7U P;  1DRO A;  4KHB B;  5JHG A;  4DBB A;  4GYV A;  2COC A;  3HSA A;  3RCP A;  3NWA A;  3PVU A;  1UNR A;  2D9V A;  1KI1 B;  4KHO A;  2K2U A;  3TO1 A;  2COA A;  2ELB A;  3NWD A;  5LON B;  1Y19 B;  4QJ4 B;  4ZRI A;  3X23 A;  1WVH A;  1DDM A;  4KHA A;  1MIX A;  1BTN A;  2NMB A;  3U7D A;  5D3Y A;  3KSY A;  5C79 A;  2DHJ A;  2RRF A;  4H8S A;  1Q67 A;  2GJY A;  3D8E A;  4B6H A;  5FI1 A;  1WGU A;  2ZKM X;  2MFQ A;  3TVV A;  3TFM A;  1B55 A;  4K17 A;  1TQZ A;  2LKO A;  2D9X A;  2YS1 A;  3ODO A;  1EAZ A;  4XWX A;  5DI9 B;  2LOZ A;  2R2Y A;  4D6W A;  5DH9 B;  3DCX A;  1QQG A;  2I5C A;  2KCJ A;  2K8E A;  2PZ1 A;  1TJ6 A;  2ZPY A;  5HE0 A;  2D9W A;  4WJ7 A;  2MWN B;  4GPT B;  2Z13 A;  4NSW A;  4OSN A;  3SYX A;  1ZC3 B;  2DKP A;  4CYE A;  4DX8 A;  4NY0 A;  3PVW A;  4A5K A;  1X1F A;  3BJI A;  4HB0 B;  1GG3 A;  2N23 A;  3ODX A;  4K81 A;  4TYZ A;  3T06 A;  4PNK A;  1BWN A;  4HAV B;  5D3V A;  3NW8 A;  2DTC A;  2D10 A;  2YSZ A;  2D9Y A;  4HAX B;  3V5W A;  1XD4 A;  1PLS A;  1OMW A;  4DIX A;  4HHV A;  2P0F A;  1FHW A;  1WJ1 A;  3CIK A;  1NTV A;  2KR0 A;  3FEH A;  3ZDT A;  1IRS A;  2YF0 A;  4HB2 B;  1MAI A;  3G9W A;  3FM8 C;  1T77 A;  3TCA A;  1EGX A;  5D27 A;  1V5M A;  4CSQ A;  4DX9 0;  2DHI A;  2J59 M;  3KY9 A;  4IFS A;  1SHC A;  1UEF A;  2EMS A;  2RVB B;  2J0M A;  1V88 A;  2LG1 A;  2RSG A;  4GNK B;  1EF1 A;  2MDX A;  4GXB A;  2V76 A;  5HE3 A;  2ROZ B;  2YT0 A;  2DKQ A;  4EKU A;  2Z59 A;  1X05 A;  2UVM A;  1Z87 A;  5JP4 A;  5J3Q A;  1FB8 A;  2OQB A;  1MK7 B;  1H4R A;  5HE1 A;  1DYN A;  4K2O A;  1AWE A;  2G35 A;  1QC6 A;  1TXD A;  2Y7B A;  4C0A A;  1NTY A;  1RJ2 A;  3VIA A;  2UZS A;  4L1R A;  3OAN A;  5CLQ B;  1EVH A;  2L1C A;  3QWM A;  2DHK A;  2KGX B;  4F7G A;  1UPR A;  1ZSQ A;  1UNQ A;  3O96 A;  3ML4 A;  4A6K A;  2VKI A;  5FI0 A;  2X18 A;  1X11 A;  1GC7 A;  1WGQ A;  2OTX A;  2P8V A;  2D2Q A;  1I7A A;  5C6R A;  2DX5 A;  4HAU B;  2ELA A;  5GOW B;  2BCJ A;  1H10 A;  4F7H A;  1F5X A;  1ZYI A;  2COF A;  1PFJ A;  4CHM A;  4D0N B;  3SUZ A;  1OY2 A;  4WVF B;  2COD A;  2IYB A;  1E5W A;  2W2W A;  2XQN M;  2YS3 A;  3MDB C;  4P7I A;  3QIJ A;  3AU4 A;  5M4Y B;  5EFX A;  4TKN A;  1U29 A;  3GYO A;  5I2M A;  4IAP A;  5CLL B;  3ZVR A;  4HSI A;  2LUL A;  3MPX A;  4K2P A;  1U5E A;  2J0K A;  3TW1 A;  4MT7 A;  4BBK A;  1NU2 A;  2CRF A;  2KR9 A;  1WJM A;  2Z0P A;  1J19 A;  2DYQ A;  1K5D B;  3HW2 B;  3PZD A;  2Y8G A;  4HDQ A;  3QBV B;  2P0D A;  3DXD A;  3IVF A;  3ULC A;  2LOX A;  2YT2 A;  3JV3 A;  4Z2N A;  1U2B A;  3PP2 A;  2K00 A;  2LYD A;  1LW3 A;  3A8P A;  2KUQ A;  1ISN A;  2Y8F A;  4GN1 A;  2VSZ A;  2JP2 A;  4L6E A;  1J0W A;  1AQC A;  3M1I B;  4GZU A;  1W1H A;  1KZ7 A;  5DHF B;  2R0D A;  4ZRJ A;  4EJN A;  2RGN B;  1W1D A;  3WYF B;  1U27 A;  2CAY A;  4A6F B;  2D9Z A;  2Z0Q A;  2R09 A;  2I5F A;  1FHX A;  4HAW B;  2Z14 A;  4WSF A;  4DXA B;  3SNH A;  2H7D A;  2W2X D;  2D4Q A;  2RUK B;  2QKM A;  5C16 A;  3F0W A;  5D3X A;  3B77 A;  3NWF A;  5LOP B;  2ADZ A;  3PVL A;  5C5B B;  3HK0 A;  3AJ4 A;  3P6A A;  2K2J A;  3SO6 A;  1NI2 A;  1X1G A;  4GMV A;  3F5R A;  4OT1 A;  1UPQ A;  2KIE A;  3KRW A;  4Z2M B;  3ODW A;  3PG7 A;  5DIF B;  3UZT A;  4HB4 B;  1W1G A;  2CY5 A;  1V5U A;  4QJ3 B;  2HE7 A;  1GC6 A;  1U5G A;  2FJL A;  1XOD A;  2AEH A;  2DA0 A;  1MI1 A;  3U8Z A;  1P5T A;  5JLJ B;  3BIN A;  5LG4 B;  3HIE A;  1ZC4 B;  2Z0O A;  3ULB A;  4HB3 B;  1LB1 A;  2GCL A;  4Y94 A; 
#chains in the Genus database with same CATH homology
 1SGH A;  1MKE A;  3SV1 A;  1P6S A;  1BTK A;  2RLO A;  5KQ1 A;  1FGY A;  1DBH A;  2GS0 A;  3D8F A;  2QKL A;  1I2H A;  4HDO A;  1V89 A;  2DYN A;  4HAY B;  4A6F A;  5DHA B;  3N7C A;  1MPH A;  1WI1 A;  1BY1 A;  3DXE A;  2DX1 A;  5J3Y A;  3WA0 A;  1P3R A;  3EO2 A;  2MKR A;  4IOY X;  3D8D A;  1XKE A;  2J0J A;  3AU5 A;  4MK0 A;  2AL6 A;  5C5B A;  3HQC A;  3PEG A;  4KVG B;  2L2I A;  1Y5O A;  1X86 A;  2CY4 A;  2EMT A;  2M14 A;  1DDV A;  2D11 A;  2KUP A;  3A8Q A;  2UZR A;  2M38 A;  2IFS A;  2N0Y A;  4CHJ A;  2DFK A;  1K5G B;  4HAZ B;  1XR0 B;  2I1K A;  1KZG A;  1FHO A;  3VOQ A;  2HTH B;  2EC1 A;  1V61 A;  4YON A;  1WG7 A;  2W2X C;  2YRY A;  4A6H A;  4GMX B;  1U5D A;  2YS5 A;  5KQ4 A;  3CXB B;  2EJ8 A;  2Q13 A;  1MK9 B;  2YT1 A;  3FSS A;  4EMO A;  4YL8 A;  3DXC A;  1XX0 A;  1RRP B;  1ZM0 A;  1OQN A;  3GF9 A;  3P7Z A;  1ZVR A;  2RNR B;  2DN6 A;  5L81 A;  3NSU A;  1DDW A;  5J3T A;  4HAT B;  5HE2 A;  1V5P A;  2DLW A;  1BAK A;  1N3H A;  1M7E A;  1M7R A;  2H7E A;  3KZ1 A;  2YVC A;  1XCG A;  3A98 B;  3KRX A;  4KAX B;  3GYP A;  4MY6 A;  2GCJ A;  5KCV A;  2E2X A;  1FOE A;  1FAO A;  2VRW B;  1MIZ B;  2P0H A;  1PMS A;  1FGZ A;  1U5F A;  4GOU A;  2NZ8 B;  4ZRK A;  3LJU X;  2ROV A;  5D3W A;  3PSC A;  4D0O A;  2I1J A;  1UNP A;  4PQ0 A;  5JHH A;  4F7U P;  1DRO A;  4KHB B;  5JHG A;  4DBB A;  4GYV A;  2COC A;  3RCP A;  3PVU A;  1UNR A;  2D9V A;  1KI1 B;  4KHO A;  2K2U A;  3TO1 A;  2COA A;  2ELB A;  5LON B;  1Y19 B;  4ZRI A;  3X23 A;  1WVH A;  1DDM A;  4KHA A;  1MIX A;  1BTN A;  2NMB A;  3U7D A;  5D3Y A;  3KSY A;  5C79 A;  2DHJ A;  4H8S A;  1Q67 A;  2GJY A;  3D8E A;  4B6H A;  5FI1 A;  1WGU A;  2MFQ A;  3TVV A;  3TFM A;  1B55 A;  4K17 A;  1TQZ A;  2LKO A;  2D9X A;  2YS1 A;  3ODO A;  1EAZ A;  4XWX A;  5DI9 B;  2LOZ A;  5DH9 B;  1QQG A;  2I5C A;  2KCJ A;  2PZ1 A;  1TJ6 A;  2ZPY A;  5HE0 A;  2D9W A;  4WJ7 A;  2MWN B;  4GPT B;  4NSW A;  3SYX A;  1ZC3 B;  2DKP A;  4CYE A;  4DX8 A;  4NY0 A;  3PVW A;  4A5K A;  1X1F A;  3BJI A;  4HB0 B;  1GG3 A;  2N23 A;  3ODX A;  4K81 A;  4TYZ A;  3T06 A;  4PNK A;  1BWN A;  4HAV B;  5D3V A;  2DTC A;  2D10 A;  2YSZ A;  2D9Y A;  4HAX B;  3V5W A;  1XD4 A;  1PLS A;  1OMW A;  4HHV A;  2P0F A;  1FHW A;  1WJ1 A;  3CIK A;  1NTV A;  3FEH A;  3ZDT A;  1IRS A;  2YF0 A;  4HB2 B;  1MAI A;  3G9W A;  3FM8 C;  3TCA A;  1EGX A;  5D27 A;  1V5M A;  4DX9 0;  2DHI A;  2J59 M;  3KY9 A;  4IFS A;  1SHC A;  1UEF A;  2EMS A;  2RVB B;  2J0M A;  1V88 A;  2LG1 A;  2RSG A;  1EF1 A;  2MDX A;  4GXB A;  2V76 A;  5HE3 A;  2ROZ B;  2YT0 A;  2DKQ A;  4EKU A;  1X05 A;  2UVM A;  1Z87 A;  5JP4 A;  5J3Q A;  1FB8 A;  2OQB A;  1MK7 B;  1H4R A;  5HE1 A;  1DYN A;  4K2O A;  1AWE A;  2G35 A;  1QC6 A;  1TXD A;  2Y7B A;  4C0A A;  1NTY A;  1RJ2 A;  3VIA A;  2UZS A;  3OAN A;  5CLQ B;  1EVH A;  2L1C A;  3QWM A;  2DHK A;  2KGX B;  4F7G A;  1UPR A;  1ZSQ A;  1UNQ A;  3O96 A;  3ML4 A;  4A6K A;  2VKI A;  5FI0 A;  2X18 A;  1X11 A;  1GC7 A;  1WGQ A;  2OTX A;  2P8V A;  2D2Q A;  1I7A A;  5C6R A;  2DX5 A;  4HAU B;  2ELA A;  5GOW B;  2BCJ A;  1H10 A;  4F7H A;  1F5X A;  2COF A;  1PFJ A;  4CHM A;  4D0N B;  3SUZ A;  1OY2 A;  4WVF B;  2COD A;  2IYB A;  1E5W A;  2W2W A;  2XQN M;  2YS3 A;  3MDB C;  4P7I A;  3QIJ A;  3AU4 A;  5EFX A;  4TKN A;  1U29 A;  3GYO A;  4IAP A;  5CLL B;  3ZVR A;  2LUL A;  3MPX A;  4K2P A;  1U5E A;  2J0K A;  3TW1 A;  4MT7 A;  4BBK A;  1NU2 A;  2CRF A;  2KR9 A;  1WJM A;  2Z0P A;  1J19 A;  2DYQ A;  1K5D B;  3HW2 B;  3PZD A;  2Y8G A;  4HDQ A;  3QBV B;  2P0D A;  3DXD A;  3IVF A;  3ULC A;  2LOX A;  3JV3 A;  4Z2N A;  1U2B A;  3PP2 A;  2K00 A;  2LYD A;  1LW3 A;  3A8P A;  1ISN A;  2Y8F A;  4GN1 A;  2VSZ A;  2JP2 A;  4L6E A;  1J0W A;  1AQC A;  3M1I B;  4GZU A;  1W1H A;  1KZ7 A;  5DHF B;  2R0D A;  4ZRJ A;  4EJN A;  2RGN B;  1W1D A;  3WYF B;  1U27 A;  2CAY A;  4A6F B;  2D9Z A;  2Z0Q A;  2R09 A;  2I5F A;  1FHX A;  4HAW B;  4WSF A;  4DXA B;  3SNH A;  2H7D A;  2W2X D;  2D4Q A;  2RUK B;  2QKM A;  5C16 A;  3F0W A;  5D3X A;  5LOP B;  2ADZ A;  3PVL A;  5C5B B;  3HK0 A;  3AJ4 A;  3P6A A;  2K2J A;  3SO6 A;  1NI2 A;  1X1G A;  4GMV A;  3F5R A;  1UPQ A;  3KRW A;  4Z2M B;  3ODW A;  3PG7 A;  5DIF B;  3UZT A;  4HB4 B;  1W1G A;  2CY5 A;  1V5U A;  2HE7 A;  1GC6 A;  1U5G A;  2FJL A;  1XOD A;  2AEH A;  2DA0 A;  3U8Z A;  1P5T A;  5JLJ B;  3BIN A;  1ZC4 B;  2Z0O A;  3ULB A;  4HB3 B;  1LB1 A;  2GCL A;  4Y94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...