1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system/signaling protein
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
3TCAA 5J3TA 1ZM0A 5FI0A 3D8EA 3SNHA 2EMTA 1GC7A 2PZ1A 5LOPB 2RNRB 2P0FA 2EJ8A 3SYXA 2Y7BA 3F0WA 2NMBA 2YSZA 3VIAA 2N23A 4ZRKA 4CHMA 5D3YA 2J0JA 2P0HA 5KCVA 3T06A 3KSYA 4K2OA 1BWNA 2ROVA 1OY2A 3SV1A 1MPHA 3D8DA 3HW2B 1XCGA 1PLSA 5KQ4A 3UZTA 2XQNM 3QIJA 2M14A 1DDVA 2GCLA 2R0DA 3DXDA 1K5GB 2YRYA 1NTVA 1MIZB 2W2XC 1U5DA 3F5RA 2DX5A 1MIXA 4GZUA 2V76A 1XODA 1NTYA 2UVMA 1UNPA 2GJYA 2J59M 3X23A 1DROA 4KHAA 3KZ1A 2YS5A 2COAA 5C79A 1MAIA 1X11A 4MT7A 2CY5A 2LKOA 2D11A 4MK0A 2I1JA 1MK7B 3QWMA 2P8VA 4IFSA 3ULCA 1FHWA 1M7EA 3O96A 1BTKA 2DYQA 4YL8A 3CXBB 2RSGA 1E5WA 1V5PA 3P6AA 4GPTB 4Y94A 1P5TA 2JP2A 3V5WA 1PMSA 2D10A 3DXEA 4HAZB 5D3WA 4B6HA 1TXDA 5JHGA 2LG1A 4EMOA 2DA0A 1DBHA 1X86A 2CRFA 1N3HA 3TVVA 4F7GA 1V5MA 4MY6A 2KGXB 4HB0B 4GMXB 4D0NB 1TJ6A 2LOXA 2IYBA 1LB1A 5C5BB 1V61A 2YT0A 3PZDA 1U5EA 1KZ7A 1MK9B 4GN1A 4HDQA 3KY9A 4F7UP 2GS0A 4WVFB 1V88A 1X1GA 2L1CA 1UPRA 4PQ0A 1U5GA 3ZDTA 5CLLB 4BBKA 3KRWA 4HAUB 2AEHA 1OMWA 2MDXA 1WI1A 1BTNA 2ZPYA 3CIKA 3HQCA 1W1HA 1ISNA 1J19A 1XD4A 1SHCA 4CYEA 2J0MA 3P7ZA 2DX1A 2VKIA 4YONA 2K2UA 4D0OA 2D9XA 3GYPA 2UZRA 2H7EA 4PNKA 3ULBA 1UEFA 1X1FA 2RLOA 5GOWB 4K81A 4EKUA 2LULA 1FGZA 3TFMA 1J0WA 2D2QA 5JHHA 1MKEA 2YT1A 2DHKA 1XKEA 2DKPA 3A8QA 3PG7A 1H10A 1QQGA 1BY1A 4A6HA 3PVWA 2Z0OA 2ADZA 2RGNB 2K2JA 1UPQA 3ODXA 3G9WA 1WG7A 4HB4B 2KUPA 5JLJB 1Z87A 2DFKA 2Q13A 4WJ7A 2P0DA 4IAPA 1UNQA 5J3QA 1FB8A 4KAXB 1WGUA 2RVBB 2KCJA 4HAYB 1U5FA 4A6FA 2ELBA 4HATB 4GYVA 1FOEA 1W1GA 1NU2A 4HB2B 2MKRA 4KHBB 3AU4A 1F5XA 5DHAB 3RCPA 2M38A 3VOQA 2YVCA 3SO6A 2K00A 3PSCA 1OQNA 2QKMA 1XR0B 2H7DA 4HAXB 2FJLA 4P7IA 3GF9A 2YS3A 1B55A 3EO2A 1FHXA 2HTHB 4HHVA 3FM8C 2BCJA 3SUZA 1ZC3B 2EC1A 2LYDA 1AQCA 3ML4A 4GXBA 2CODA 3MPXA 2YF0A 1RRPB 5DHFB 4K2PA 3WA0A 3FSSA 5DH9B 3TW1A 1NI2A 3D8FA 2EMSA 2D9VA 1Q67A 2D9ZA 3NSUA 4HAVB 2Y8FA 3ODOA 2D9YA 4TKNA 2ELAA 1DYNA 4XWXA 1QC6A 5EFXA 5LONB 5DI9B 3JV3A 2I5CA 1V5UA 3U7DA 5HE2A 3ZVRA 4GMVA 1V89A 5C16A 3WYFB 4Z2NA 4KHOA 1WVHA 5D3VA 1FHOA 2AL6A 2HE7A 2IFSA 4NSWA 5HE1A 1GC6A 1GG3A 2DHIA 5KQ1A 2I1KA 4DBBA 4WSFA 4CHJA 4F7HA 1M7RA 1LW3A 4K17A 3N7CA 2DLWA 2CY4A 5HE3A 1WGQA 5CLQB 2W2WA 1ZSQA 4ZRIA 2UZSA 5D27A 1BAKA 1DDMA 1EAZA 2RUKB 1I7AA 2NZ8B 1P6SA 3FEHA 2KR9A 4A6KA 2VRWB 1XX0A 5HE0A 3PVLA 4NY0A 1Y19B 2COFA 4DX8A 5FI1A 2ROZB 2OQBA 1WJMA 4ZRJA 2G35A 1I2HA 2Z0QA 1FGYA 2I5FA 3QBVB 5D3XA 3TO1A 3BINA 4A6FB 4HDOA 1U27A 1U29A 4H8SA 1Y5OA 2YS1A 2D4QA 2COCA 2GCJA 1X05A 2R09A 2DN6A 1H4RA 2CAYA 3U8ZA 1U2BA 1KI1B 2DYNA 1P3RA 3AJ4A 1SGHA 3LJUX 3PP2A 1DDWA 1IRSA 5DIFB 3OANA 4A5KA 2L2IA 4HAWB 1ZVRA 2E2XA 2N0YA 1EF1A 2MWNB 1FAOA 3DXCA 3ODWA 5J3YA 3A98B 3PEGA 1EGXA 5C5BA 1AWEA 1TQZA 2D9WA 3MDBC 2VSZA 4EJNA 3PVUA 2W2XD 3KRXA 1K5DB 4DXAB 2QKLA 4KVGB 5C6RA 3A8PA 2DHJA 4DX90 4HB3B 2J0KA 3IVFA 1UNRA 3BJIA 2LOZA 3GYOA 4C0AA 4IOYX 3M1IB 5JP4A 2Y8GA 2X18A 1W1DA 2OTXA 1WJ1A 4TYZA 1KZGA 4GOUA 3HK0A 3AU5A 1PFJA 4Z2MB 2MFQA 2Z0PA 2DTCA 1ZC4B 4L6EA 1RJ2A 2DKQA 1EVHA 5L81A
chains in the Genus database with same CATH superfamily
3TCAA 5J3TA 1ZM0A 5FI0A 3D8EA 2Z14A 3SNHA 2EMTA 1GC7A 2Z13A 2PZ1A 5LOPB 2RNRB 2P0FA 2EJ8A 3SYXA 4QXAB 2Y7BA 3F0WA 2NMBA 2YSZA 3VIAA 2N23A 4ZRKA 4CHMA 5LG4B 5D3YA 2J0JA 2P0HA 2Z59A 5KCVA 3T06A 3KSYA 4K2OA 1BWNA 2ROVA 1OY2A 3SV1A 1MPHA 3D8DA 3HW2B 1XCGA 1PLSA 5KQ4A 3UZTA 2XQNM 3QIJA 2M14A 1DDVA 2GCLA 2R0DA 3DXDA 1K5GB 2YRYA 4CSQA 1NTVA 1MIZB 2W2XC 1U5DA 3F5RA 2GUMA 2DX5A 1MIXA 4GZUA 2V76A 1XODA 2YT2A 1NTYA 2UVMA 1UNPA 2GJYA 4D6WA 2J59M 3X23A 1DROA 4KHAA 1MI1A 3KZ1A 2YS5A 2COAA 5C79A 1MAIA 1X11A 4MT7A 2CY5A 2LKOA 2D11A 4MK0A 2I1JA 3U12A 1MK7B 3QWMA 2P8VA 4OSNA 4IFSA 4DIXA 3ULCA 5M4YB 1FHWA 1M7EA 3O96A 1BTKA 2DYQA 4YL8A 3CXBB 2RSGA 1E5WA 1V5PA 3P6AA 4GPTB 4Y94A 1P5TA 2JP2A 3V5WA 1PMSA 2D10A 3DXEA 4HAZB 5D3WA 4B6HA 1TXDA 5JHGA 2LG1A 4EMOA 2DA0A 1DBHA 1X86A 2CRFA 1N3HA 3TVVA 4F7GA 1V5MA 4MY6A 2KGXB 4HB0B 4GMXB 4D0NB 1TJ6A 2LOXA 2IYBA 1LB1A 5C5BB 1V61A 2YT0A 2K49A 1U5EA 1KZ7A 1MK9B 3PZDA 4GN1A 4HDQA 3KY9A 4F7UP 2GS0A 4WVFB 1V88A 1X1GA 2L1CA 1UPRA 4PQ0A 1U5GA 2NBVA 3ZDTA 5CLLB 4BBKA 3KRWA 4HAUB 2AEHA 1OMWA 2MDXA 1WI1A 4OT1A 1BTNA 2ZPYA 1W1HA 1ISNA 1J19A 3CIKA 3HQCA 1XD4A 1SHCA 4CYEA 2J0MA 3P7ZA 2DX1A 2VKIA 4YONA 2K2UA 4D0OA 2D9XA 3GYPA 2UZRA 2H7EA 4PNKA 4QJ4B 3ULBA 1UEFA 1X1FA 3OHMB 2RLOA 5GOWB 4K81A 4EKUA 2LULA 1FGZA 3TFMA 1J0WA 2D2QA 5JHHA 1MKEA 2YT1A 2DHKA 1XKEA 2DKPA 3A8QA 3PG7A 1H10A 1QQGA 3B77A 3NWFA 1BY1A 4A6HA 3PVWA 2Z0OA 2ADZA 2RGNB 2K2JA 1UPQA 3ODXA 3G9WA 1WG7A 4HB4B 2KUPA 3NW8A 5JLJB 1Z87A 2KUQA 3DCXA 2DFKA 2Q13A 4WJ7A 2P0DA 4IAPA 1UNQA 5J3QA 1FB8A 4KAXB 1WGUA 2RVBB 2KCJA 4HAYB 4KHBA 1U5FA 4A6FA 2ELBA 4HATB 4GYVA 1FOEA 1W1GA 1NU2A 4HB2B 2MKRA 4KHBB 3AU4A 1F5XA 5DHAB 3RCPA 2M38A 3VOQA 2YVCA 3SO6A 2K00A 3PSCA 1OQNA 2QKMA 1XR0B 2H7DA 4HAXB 2FJLA 4P7IA 4L1RA 4GNKB 3GF9A 4QJ3B 2YS3A 1B55A 3EO2A 1FHXA 2HTHB 4HHVA 3FM8C 5I2SA 2KR0A 2BCJA 3SUZA 1ZC3B 3A58A 4HSIA 2EC1A 2LYDA 1AQCA 3ML4A 4GXBA 2CODA 3MPXA 2YF0A 5I2MA 1RRPB 5DHFB 4K2PA 3WA0A 3FSSA 5DH9B 3TW1A 1NI2A 3D8FA 2EMSA 1ZYIA 2D9VA 1Q67A 2D9ZA 3NSUA 4HAVB 2KIGA 2Y8FA 3ODOA 2D9YA 4TKNA 2ELAA 1DYNA 4XWXA 1QC6A 5EFXA 5LONB 5DI9B 3JV3A 2I5CA 1V5UA 3U7DA 5HE2A 3ZVRA 4GMVA 1V89A 5C16A 3WYFB 4Z2NA 4KHOA 1WVHA 5D3VA 1FHOA 2AL6A 2HE7A 2IFSA 4NSWA 5HE1A 1GC6A 1GG3A 2RRFA 2DHIA 5KQ1A 2I1KA 2FJUB 4DBBA 4WSFA 2K8EA 4CHJA 4QJ5B 4F7HA 1M7RA 1LW3A 4K17A 3N7CA 2DLWA 2CY4A 3HIEA 5HE3A 1WGQA 5CLQB 2W2WA 1ZSQA 4ZRIA 2UZSA 5D27A 1BAKA 1DDMA 1EAZA 2RUKB 1I7AA 3HSAA 2NZ8B 2KIEA 1P6SA 1T77A 3FEHA 2KR9A 2R2YA 4A6KA 2VRWB 1XX0A 5HE0A 3PVLA 4NY0A 1Y19B 2COFA 4DX8A 5FI1A 2ROZB 2OQBA 1WJMA 4ZRJA 2G35A 1I2HA 2Z0QA 1FGYA 2I5FA 3QBVB 5D3XA 3TO1A 2Z4DA 3BINA 4A6FB 4HDOA 1U27A 1U29A 2ZKMX 3FVCA 4H8SA 1Y5OA 2YS1A 2D4QA 2COCA 2GCJA 1X05A 2R09A 2DN6A 1H4RA 2CAYA 3U8ZA 1U2BA 3NWAA 1KI1B 2DYNA 1P3RA 3AJ4A 1SGHA 3LJUX 3PP2A 1DDWA 1IRSA 3NWDA 5DIFB 3OANA 4A5KA 2L2IA 4HAWB 1ZVRA 2E2XA 2N0YA 1EF1A 2MWNB 1FAOA 3DXCA 3ODWA 5J3YA 3A98B 3PEGA 1EGXA 5C5BA 1AWEA 1TQZA 2D9WA 3MDBC 2VSZA 4EJNA 3PVUA 2W2XD 3KRXA 1K5DB 4DXAB 2QKLA 4KVGB 5C6RA 3A8PA 2DHJA 4DX90 4HB3B 2J0KA 3IVFA 1UNRA 3BJIA 2LOZA 3GYOA 4C0AA 4IOYX 3M1IB 5JP4A 2Y8GA 2X18A 1W1DA 2OTXA 1WJ1A 4TYZA 1KZGA 4GOUA 3HK0A 3AU5A 1PFJA 4Z2MB 2MFQA 2Z0PA 2DTCA 1ZC4B 4L6EA 1RJ2A 2DKQA 1EVHA 5L81A 5IRSA
chains in the Genus database with same CATH topology
3TCAA 5J3TA 1ZM0A 5FI0A 3D8EA 3SNHA 2EMTA 1GC7A 2PZ1A 5LOPB 2RNRB 2P0FA 2EJ8A 3SYXA 2Y7BA 3F0WA 2NMBA 2YSZA 3VIAA 2N23A 4ZRKA 4CHMA 5D3YA 2J0JA 2P0HA 5KCVA 3T06A 3KSYA 4K2OA 1BWNA 2ROVA 1OY2A 3SV1A 1MPHA 3D8DA 3HW2B 1XCGA 1PLSA 5KQ4A 3UZTA 2XQNM 3QIJA 2M14A 1DDVA 2GCLA 2R0DA 3DXDA 1K5GB 2YRYA 1NTVA 1MIZB 2W2XC 1U5DA 3F5RA 2DX5A 1MIXA 4GZUA 2V76A 1XODA 1NTYA 2UVMA 1UNPA 2GJYA 2J59M 3X23A 1DROA 4KHAA 3KZ1A 2YS5A 2COAA 5C79A 1MAIA 1X11A 4MT7A 2CY5A 2LKOA 2D11A 4MK0A 2I1JA 1MK7B 3QWMA 2P8VA 4IFSA 3ULCA 1FHWA 1M7EA 3O96A 1BTKA 2DYQA 4YL8A 3CXBB 2RSGA 1E5WA 1V5PA 3P6AA 4GPTB 4Y94A 1P5TA 2JP2A 3V5WA 1PMSA 2D10A 3DXEA 4HAZB 5D3WA 4B6HA 1TXDA 5JHGA 2LG1A 4EMOA 2DA0A 1DBHA 1X86A 2CRFA 1N3HA 3TVVA 4F7GA 1V5MA 4MY6A 2KGXB 4HB0B 4GMXB 4D0NB 1TJ6A 2LOXA 2IYBA 1LB1A 5C5BB 1V61A 2YT0A 3PZDA 1U5EA 1KZ7A 1MK9B 4GN1A 4HDQA 3KY9A 4F7UP 2GS0A 4WVFB 1V88A 1X1GA 2L1CA 1UPRA 4PQ0A 1U5GA 3ZDTA 5CLLB 4BBKA 3KRWA 4HAUB 2AEHA 1OMWA 2MDXA 1WI1A 1BTNA 2ZPYA 3CIKA 3HQCA 1W1HA 1ISNA 1J19A 1XD4A 1SHCA 4CYEA 2J0MA 3P7ZA 2DX1A 2VKIA 4YONA 2K2UA 4D0OA 2D9XA 3GYPA 2UZRA 2H7EA 4PNKA 3ULBA 1UEFA 1X1FA 2RLOA 5GOWB 4K81A 4EKUA 2LULA 1FGZA 3TFMA 1J0WA 2D2QA 5JHHA 1MKEA 2YT1A 2DHKA 1XKEA 2DKPA 3A8QA 3PG7A 1H10A 1QQGA 1BY1A 4A6HA 3PVWA 2Z0OA 2ADZA 2RGNB 2K2JA 1UPQA 3ODXA 3G9WA 1WG7A 4HB4B 2KUPA 5JLJB 1Z87A 2DFKA 2Q13A 4WJ7A 2P0DA 4IAPA 1UNQA 5J3QA 1FB8A 4KAXB 1WGUA 2RVBB 2KCJA 4HAYB 1U5FA 4A6FA 2ELBA 4HATB 4GYVA 1FOEA 1W1GA 1NU2A 4HB2B 2MKRA 4KHBB 3AU4A 1F5XA 5DHAB 3RCPA 2M38A 3VOQA 2YVCA 3SO6A 2K00A 3PSCA 1OQNA 2QKMA 1XR0B 2H7DA 4HAXB 2FJLA 4P7IA 3GF9A 2YS3A 1B55A 3EO2A 1FHXA 2HTHB 4HHVA 3FM8C 2BCJA 3SUZA 1ZC3B 2EC1A 2LYDA 1AQCA 3ML4A 4GXBA 2CODA 3MPXA 2YF0A 1RRPB 5DHFB 4K2PA 3WA0A 3FSSA 5DH9B 3TW1A 1NI2A 3D8FA 2EMSA 2D9VA 1Q67A 2D9ZA 3NSUA 4HAVB 2Y8FA 3ODOA 2D9YA 4TKNA 2ELAA 1DYNA 4XWXA 1QC6A 5EFXA 5LONB 5DI9B 3JV3A 2I5CA 1V5UA 3U7DA 5HE2A 3ZVRA 4GMVA 1V89A 5C16A 3WYFB 4Z2NA 4KHOA 1WVHA 5D3VA 1FHOA 2AL6A 2HE7A 2IFSA 4NSWA 5HE1A 1GC6A 1GG3A 2DHIA 5KQ1A 2I1KA 4DBBA 4WSFA 4CHJA 4F7HA 1M7RA 1LW3A 4K17A 3N7CA 2DLWA 2CY4A 5HE3A 1WGQA 5CLQB 2W2WA 1ZSQA 4ZRIA 2UZSA 5D27A 1BAKA 1DDMA 1EAZA 2RUKB 1I7AA 2NZ8B 1P6SA 3FEHA 2KR9A 4A6KA 2VRWB 1XX0A 5HE0A 3PVLA 4NY0A 1Y19B 2COFA 4DX8A 5FI1A 2ROZB 2OQBA 1WJMA 4ZRJA 2G35A 1I2HA 2Z0QA 1FGYA 2I5FA 3QBVB 5D3XA 3TO1A 3BINA 4A6FB 4HDOA 1U27A 1U29A 4H8SA 1Y5OA 2YS1A 2D4QA 2COCA 2GCJA 1X05A 2R09A 2DN6A 1H4RA 2CAYA 3U8ZA 1U2BA 1KI1B 2DYNA 1P3RA 3AJ4A 1SGHA 3LJUX 3PP2A 1DDWA 1IRSA 5DIFB 3OANA 4A5KA 2L2IA 4HAWB 1ZVRA 2E2XA 2N0YA 1EF1A 2MWNB 1FAOA 3DXCA 3ODWA 5J3YA 3A98B 3PEGA 1EGXA 5C5BA 1AWEA 1TQZA 2D9WA 3MDBC 2VSZA 4EJNA 3PVUA 2W2XD 3KRXA 1K5DB 4DXAB 2QKLA 4KVGB 5C6RA 3A8PA 2DHJA 4DX90 4HB3B 2J0KA 3IVFA 1UNRA 3BJIA 2LOZA 3GYOA 4C0AA 4IOYX 3M1IB 5JP4A 2Y8GA 2X18A 1W1DA 2OTXA 1WJ1A 4TYZA 1KZGA 4GOUA 3HK0A 3AU5A 1PFJA 4Z2MB 2MFQA 2Z0PA 2DTCA 1ZC4B 4L6EA 1RJ2A 2DKQA 1EVHA 5L81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  5J3T A;  1ZM0 A;  5FI0 A;  3D8E A;  3SNH A;  2EMT A;  1GC7 A;  2PZ1 A;  5LOP B;  2RNR B;  2P0F A;  2EJ8 A;  3SYX A;  2Y7B A;  3F0W A;  2NMB A;  2YSZ A;  3VIA A;  2N23 A;  4ZRK A;  4CHM A;  5D3Y A;  2J0J A;  2P0H A;  5KCV A;  3T06 A;  3KSY A;  4K2O A;  1BWN A;  2ROV A;  1OY2 A;  3SV1 A;  1MPH A;  3D8D A;  3HW2 B;  1XCG A;  1PLS A;  5KQ4 A;  3UZT A;  2XQN M;  3QIJ A;  2M14 A;  1DDV A;  2GCL A;  2R0D A;  3DXD A;  1K5G B;  2YRY A;  1NTV A;  1MIZ B;  2W2X C;  1U5D A;  3F5R A;  2DX5 A;  1MIX A;  4GZU A;  2V76 A;  1XOD A;  1NTY A;  2UVM A;  1UNP A;  2GJY A;  2J59 M;  3X23 A;  1DRO A;  4KHA A;  3KZ1 A;  2YS5 A;  2COA A;  5C79 A;  1MAI A;  1X11 A;  4MT7 A;  2CY5 A;  2LKO A;  2D11 A;  4MK0 A;  2I1J A;  1MK7 B;  3QWM A;  2P8V A;  4IFS A;  3ULC A;  1FHW A;  1M7E A;  3O96 A;  1BTK A;  2DYQ A;  4YL8 A;  3CXB B;  2RSG A;  1E5W A;  1V5P A;  3P6A A;  4GPT B;  4Y94 A;  1P5T A;  2JP2 A;  3V5W A;  1PMS A;  2D10 A;  3DXE A;  4HAZ B;  5D3W A;  4B6H A;  1TXD A;  5JHG A;  2LG1 A;  4EMO A;  2DA0 A;  1DBH A;  1X86 A;  2CRF A;  1N3H A;  3TVV A;  4F7G A;  1V5M A;  4MY6 A;  2KGX B;  4HB0 B;  4GMX B;  4D0N B;  1TJ6 A;  2LOX A;  2IYB A;  1LB1 A;  5C5B B;  1V61 A;  2YT0 A;  3PZD A;  1U5E A;  1KZ7 A;  1MK9 B;  4GN1 A;  4HDQ A;  3KY9 A;  4F7U P;  2GS0 A;  4WVF B;  1V88 A;  1X1G A;  2L1C A;  1UPR A;  4PQ0 A;  1U5G A;  3ZDT A;  5CLL B;  4BBK A;  3KRW A;  4HAU B;  2AEH A;  1OMW A;  2MDX A;  1WI1 A;  1BTN A;  2ZPY A;  3CIK A;  3HQC A;  1W1H A;  1ISN A;  1J19 A;  1XD4 A;  1SHC A;  4CYE A;  2J0M A;  3P7Z A;  2DX1 A;  2VKI A;  4YON A;  2K2U A;  4D0O A;  2D9X A;  3GYP A;  2UZR A;  2H7E A;  4PNK A;  3ULB A;  1UEF A;  1X1F A;  2RLO A;  5GOW B;  4K81 A;  4EKU A;  2LUL A;  1FGZ A;  3TFM A;  1J0W A;  2D2Q A;  5JHH A;  1MKE A;  2YT1 A;  2DHK A;  1XKE A;  2DKP A;  3A8Q A;  3PG7 A;  1H10 A;  1QQG A;  1BY1 A;  4A6H A;  3PVW A;  2Z0O A;  2ADZ A;  2RGN B;  2K2J A;  1UPQ A;  3ODX A;  3G9W A;  1WG7 A;  4HB4 B;  2KUP A;  5JLJ B;  1Z87 A;  2DFK A;  2Q13 A;  4WJ7 A;  2P0D A;  4IAP A;  1UNQ A;  5J3Q A;  1FB8 A;  4KAX B;  1WGU A;  2RVB B;  2KCJ A;  4HAY B;  1U5F A;  4A6F A;  2ELB A;  4HAT B;  4GYV A;  1FOE A;  1W1G A;  1NU2 A;  4HB2 B;  2MKR A;  4KHB B;  3AU4 A;  1F5X A;  5DHA B;  3RCP A;  2M38 A;  3VOQ A;  2YVC A;  3SO6 A;  2K00 A;  3PSC A;  1OQN A;  2QKM A;  1XR0 B;  2H7D A;  4HAX B;  2FJL A;  4P7I A;  3GF9 A;  2YS3 A;  1B55 A;  3EO2 A;  1FHX A;  2HTH B;  4HHV A;  3FM8 C;  2BCJ A;  3SUZ A;  1ZC3 B;  2EC1 A;  2LYD A;  1AQC A;  3ML4 A;  4GXB A;  2COD A;  3MPX A;  2YF0 A;  1RRP B;  5DHF B;  4K2P A;  3WA0 A;  3FSS A;  5DH9 B;  3TW1 A;  1NI2 A;  3D8F A;  2EMS A;  2D9V A;  1Q67 A;  2D9Z A;  3NSU A;  4HAV B;  2Y8F A;  3ODO A;  2D9Y A;  4TKN A;  2ELA A;  1DYN A;  4XWX A;  1QC6 A;  5EFX A;  5LON B;  5DI9 B;  3JV3 A;  2I5C A;  1V5U A;  3U7D A;  5HE2 A;  3ZVR A;  4GMV A;  1V89 A;  5C16 A;  3WYF B;  4Z2N A;  4KHO A;  1WVH A;  5D3V A;  1FHO A;  2AL6 A;  2HE7 A;  2IFS A;  4NSW A;  5HE1 A;  1GC6 A;  1GG3 A;  2DHI A;  5KQ1 A;  2I1K A;  4DBB A;  4WSF A;  4CHJ A;  4F7H A;  1M7R A;  1LW3 A;  4K17 A;  3N7C A;  2DLW A;  2CY4 A;  5HE3 A;  1WGQ A;  5CLQ B;  2W2W A;  1ZSQ A;  4ZRI A;  2UZS A;  5D27 A;  1BAK A;  1DDM A;  1EAZ A;  2RUK B;  1I7A A;  2NZ8 B;  1P6S A;  3FEH A;  2KR9 A;  4A6K A;  2VRW B;  1XX0 A;  5HE0 A;  3PVL A;  4NY0 A;  1Y19 B;  2COF A;  4DX8 A;  5FI1 A;  2ROZ B;  2OQB A;  1WJM A;  4ZRJ A;  2G35 A;  1I2H A;  2Z0Q A;  1FGY A;  2I5F A;  3QBV B;  5D3X A;  3TO1 A;  3BIN A;  4A6F B;  4HDO A;  1U27 A;  1U29 A;  4H8S A;  1Y5O A;  2YS1 A;  2D4Q A;  2COC A;  2GCJ A;  1X05 A;  2R09 A;  2DN6 A;  1H4R A;  2CAY A;  3U8Z A;  1U2B A;  1KI1 B;  2DYN A;  1P3R A;  3AJ4 A;  1SGH A;  3LJU X;  3PP2 A;  1DDW A;  1IRS A;  5DIF B;  3OAN A;  4A5K A;  2L2I A;  4HAW B;  1ZVR A;  2E2X A;  2N0Y A;  1EF1 A;  2MWN B;  1FAO A;  3DXC A;  3ODW A;  5J3Y A;  3A98 B;  3PEG A;  1EGX A;  5C5B A;  1AWE A;  1TQZ A;  2D9W A;  3MDB C;  2VSZ A;  4EJN A;  3PVU A;  2W2X D;  3KRX A;  1K5D B;  4DXA B;  2QKL A;  4KVG B;  5C6R A;  3A8P A;  2DHJ A;  4DX9 0;  4HB3 B;  2J0K A;  3IVF A;  1UNR A;  3BJI A;  2LOZ A;  3GYO A;  4C0A A;  4IOY X;  3M1I B;  5JP4 A;  2Y8G A;  2X18 A;  1W1D A;  2OTX A;  1WJ1 A;  4TYZ A;  1KZG A;  4GOU A;  3HK0 A;  3AU5 A;  1PFJ A;  4Z2M B;  2MFQ A;  2Z0P A;  2DTC A;  1ZC4 B;  4L6E A;  1RJ2 A;  2DKQ A;  1EVH A;  5L81 A; 
#chains in the Genus database with same CATH topology
 3TCA A;  5J3T A;  1ZM0 A;  5FI0 A;  3D8E A;  2Z14 A;  3SNH A;  2EMT A;  1GC7 A;  2Z13 A;  2PZ1 A;  5LOP B;  2RNR B;  2P0F A;  2EJ8 A;  3SYX A;  4QXA B;  2Y7B A;  3F0W A;  2NMB A;  2YSZ A;  3VIA A;  2N23 A;  4ZRK A;  4CHM A;  5LG4 B;  5D3Y A;  2J0J A;  2P0H A;  2Z59 A;  5KCV A;  3T06 A;  3KSY A;  4K2O A;  1BWN A;  2ROV A;  1OY2 A;  3SV1 A;  1MPH A;  3D8D A;  3HW2 B;  1XCG A;  1PLS A;  5KQ4 A;  3UZT A;  2XQN M;  3QIJ A;  2M14 A;  1DDV A;  2GCL A;  2R0D A;  3DXD A;  1K5G B;  2YRY A;  4CSQ A;  1NTV A;  1MIZ B;  2W2X C;  1U5D A;  3F5R A;  2GUM A;  2DX5 A;  1MIX A;  4GZU A;  2V76 A;  1XOD A;  2YT2 A;  1NTY A;  2UVM A;  1UNP A;  2GJY A;  4D6W A;  2J59 M;  3X23 A;  1DRO A;  4KHA A;  1MI1 A;  3KZ1 A;  2YS5 A;  2COA A;  5C79 A;  1MAI A;  1X11 A;  4MT7 A;  2CY5 A;  2LKO A;  2D11 A;  4MK0 A;  2I1J A;  3U12 A;  1MK7 B;  3QWM A;  2P8V A;  4OSN A;  4IFS A;  4DIX A;  3ULC A;  5M4Y B;  1FHW A;  1M7E A;  3O96 A;  1BTK A;  2DYQ A;  4YL8 A;  3CXB B;  2RSG A;  1E5W A;  1V5P A;  3P6A A;  4GPT B;  4Y94 A;  1P5T A;  2JP2 A;  3V5W A;  1PMS A;  2D10 A;  3DXE A;  4HAZ B;  5D3W A;  4B6H A;  1TXD A;  5JHG A;  2LG1 A;  4EMO A;  2DA0 A;  1DBH A;  1X86 A;  2CRF A;  1N3H A;  3TVV A;  4F7G A;  1V5M A;  4MY6 A;  2KGX B;  4HB0 B;  4GMX B;  4D0N B;  1TJ6 A;  2LOX A;  2IYB A;  1LB1 A;  5C5B B;  1V61 A;  2YT0 A;  2K49 A;  1U5E A;  1KZ7 A;  1MK9 B;  3PZD A;  4GN1 A;  4HDQ A;  3KY9 A;  4F7U P;  2GS0 A;  4WVF B;  1V88 A;  1X1G A;  2L1C A;  1UPR A;  4PQ0 A;  1U5G A;  2NBV A;  3ZDT A;  5CLL B;  4BBK A;  3KRW A;  4HAU B;  2AEH A;  1OMW A;  2MDX A;  1WI1 A;  4OT1 A;  1BTN A;  2ZPY A;  1W1H A;  1ISN A;  1J19 A;  3CIK A;  3HQC A;  1XD4 A;  1SHC A;  4CYE A;  2J0M A;  3P7Z A;  2DX1 A;  2VKI A;  4YON A;  2K2U A;  4D0O A;  2D9X A;  3GYP A;  2UZR A;  2H7E A;  4PNK A;  4QJ4 B;  3ULB A;  1UEF A;  1X1F A;  3OHM B;  2RLO A;  5GOW B;  4K81 A;  4EKU A;  2LUL A;  1FGZ A;  3TFM A;  1J0W A;  2D2Q A;  5JHH A;  1MKE A;  2YT1 A;  2DHK A;  1XKE A;  2DKP A;  3A8Q A;  3PG7 A;  1H10 A;  1QQG A;  3B77 A;  3NWF A;  1BY1 A;  4A6H A;  3PVW A;  2Z0O A;  2ADZ A;  2RGN B;  2K2J A;  1UPQ A;  3ODX A;  3G9W A;  1WG7 A;  4HB4 B;  2KUP A;  3NW8 A;  5JLJ B;  1Z87 A;  2KUQ A;  3DCX A;  2DFK A;  2Q13 A;  4WJ7 A;  2P0D A;  4IAP A;  1UNQ A;  5J3Q A;  1FB8 A;  4KAX B;  1WGU A;  2RVB B;  2KCJ A;  4HAY B;  4KHB A;  1U5F A;  4A6F A;  2ELB A;  4HAT B;  4GYV A;  1FOE A;  1W1G A;  1NU2 A;  4HB2 B;  2MKR A;  4KHB B;  3AU4 A;  1F5X A;  5DHA B;  3RCP A;  2M38 A;  3VOQ A;  2YVC A;  3SO6 A;  2K00 A;  3PSC A;  1OQN A;  2QKM A;  1XR0 B;  2H7D A;  4HAX B;  2FJL A;  4P7I A;  4L1R A;  4GNK B;  3GF9 A;  4QJ3 B;  2YS3 A;  1B55 A;  3EO2 A;  1FHX A;  2HTH B;  4HHV A;  3FM8 C;  5I2S A;  2KR0 A;  2BCJ A;  3SUZ A;  1ZC3 B;  3A58 A;  4HSI A;  2EC1 A;  2LYD A;  1AQC A;  3ML4 A;  4GXB A;  2COD A;  3MPX A;  2YF0 A;  5I2M A;  1RRP B;  5DHF B;  4K2P A;  3WA0 A;  3FSS A;  5DH9 B;  3TW1 A;  1NI2 A;  3D8F A;  2EMS A;  1ZYI A;  2D9V A;  1Q67 A;  2D9Z A;  3NSU A;  4HAV B;  2KIG A;  2Y8F A;  3ODO A;  2D9Y A;  4TKN A;  2ELA A;  1DYN A;  4XWX A;  1QC6 A;  5EFX A;  5LON B;  5DI9 B;  3JV3 A;  2I5C A;  1V5U A;  3U7D A;  5HE2 A;  3ZVR A;  4GMV A;  1V89 A;  5C16 A;  3WYF B;  4Z2N A;  4KHO A;  1WVH A;  5D3V A;  1FHO A;  2AL6 A;  2HE7 A;  2IFS A;  4NSW A;  5HE1 A;  1GC6 A;  1GG3 A;  2RRF A;  2DHI A;  5KQ1 A;  2I1K A;  2FJU B;  4DBB A;  4WSF A;  2K8E A;  4CHJ A;  4QJ5 B;  4F7H A;  1M7R A;  1LW3 A;  4K17 A;  3N7C A;  2DLW A;  2CY4 A;  3HIE A;  5HE3 A;  1WGQ A;  5CLQ B;  2W2W A;  1ZSQ A;  4ZRI A;  2UZS A;  5D27 A;  1BAK A;  1DDM A;  1EAZ A;  2RUK B;  1I7A A;  3HSA A;  2NZ8 B;  2KIE A;  1P6S A;  1T77 A;  3FEH A;  2KR9 A;  2R2Y A;  4A6K A;  2VRW B;  1XX0 A;  5HE0 A;  3PVL A;  4NY0 A;  1Y19 B;  2COF A;  4DX8 A;  5FI1 A;  2ROZ B;  2OQB A;  1WJM A;  4ZRJ A;  2G35 A;  1I2H A;  2Z0Q A;  1FGY A;  2I5F A;  3QBV B;  5D3X A;  3TO1 A;  2Z4D A;  3BIN A;  4A6F B;  4HDO A;  1U27 A;  1U29 A;  2ZKM X;  3FVC A;  4H8S A;  1Y5O A;  2YS1 A;  2D4Q A;  2COC A;  2GCJ A;  1X05 A;  2R09 A;  2DN6 A;  1H4R A;  2CAY A;  3U8Z A;  1U2B A;  3NWA A;  1KI1 B;  2DYN A;  1P3R A;  3AJ4 A;  1SGH A;  3LJU X;  3PP2 A;  1DDW A;  1IRS A;  3NWD A;  5DIF B;  3OAN A;  4A5K A;  2L2I A;  4HAW B;  1ZVR A;  2E2X A;  2N0Y A;  1EF1 A;  2MWN B;  1FAO A;  3DXC A;  3ODW A;  5J3Y A;  3A98 B;  3PEG A;  1EGX A;  5C5B A;  1AWE A;  1TQZ A;  2D9W A;  3MDB C;  2VSZ A;  4EJN A;  3PVU A;  2W2X D;  3KRX A;  1K5D B;  4DXA B;  2QKL A;  4KVG B;  5C6R A;  3A8P A;  2DHJ A;  4DX9 0;  4HB3 B;  2J0K A;  3IVF A;  1UNR A;  3BJI A;  2LOZ A;  3GYO A;  4C0A A;  4IOY X;  3M1I B;  5JP4 A;  2Y8G A;  2X18 A;  1W1D A;  2OTX A;  1WJ1 A;  4TYZ A;  1KZG A;  4GOU A;  3HK0 A;  3AU5 A;  1PFJ A;  4Z2M B;  2MFQ A;  2Z0P A;  2DTC A;  1ZC4 B;  4L6E A;  1RJ2 A;  2DKQ A;  1EVH A;  5L81 A;  5IRS A; 
#chains in the Genus database with same CATH homology
 3TCA A;  5J3T A;  1ZM0 A;  5FI0 A;  3D8E A;  3SNH A;  2EMT A;  1GC7 A;  2PZ1 A;  5LOP B;  2RNR B;  2P0F A;  2EJ8 A;  3SYX A;  2Y7B A;  3F0W A;  2NMB A;  2YSZ A;  3VIA A;  2N23 A;  4ZRK A;  4CHM A;  5D3Y A;  2J0J A;  2P0H A;  5KCV A;  3T06 A;  3KSY A;  4K2O A;  1BWN A;  2ROV A;  1OY2 A;  3SV1 A;  1MPH A;  3D8D A;  3HW2 B;  1XCG A;  1PLS A;  5KQ4 A;  3UZT A;  2XQN M;  3QIJ A;  2M14 A;  1DDV A;  2GCL A;  2R0D A;  3DXD A;  1K5G B;  2YRY A;  1NTV A;  1MIZ B;  2W2X C;  1U5D A;  3F5R A;  2DX5 A;  1MIX A;  4GZU A;  2V76 A;  1XOD A;  1NTY A;  2UVM A;  1UNP A;  2GJY A;  2J59 M;  3X23 A;  1DRO A;  4KHA A;  3KZ1 A;  2YS5 A;  2COA A;  5C79 A;  1MAI A;  1X11 A;  4MT7 A;  2CY5 A;  2LKO A;  2D11 A;  4MK0 A;  2I1J A;  1MK7 B;  3QWM A;  2P8V A;  4IFS A;  3ULC A;  1FHW A;  1M7E A;  3O96 A;  1BTK A;  2DYQ A;  4YL8 A;  3CXB B;  2RSG A;  1E5W A;  1V5P A;  3P6A A;  4GPT B;  4Y94 A;  1P5T A;  2JP2 A;  3V5W A;  1PMS A;  2D10 A;  3DXE A;  4HAZ B;  5D3W A;  4B6H A;  1TXD A;  5JHG A;  2LG1 A;  4EMO A;  2DA0 A;  1DBH A;  1X86 A;  2CRF A;  1N3H A;  3TVV A;  4F7G A;  1V5M A;  4MY6 A;  2KGX B;  4HB0 B;  4GMX B;  4D0N B;  1TJ6 A;  2LOX A;  2IYB A;  1LB1 A;  5C5B B;  1V61 A;  2YT0 A;  3PZD A;  1U5E A;  1KZ7 A;  1MK9 B;  4GN1 A;  4HDQ A;  3KY9 A;  4F7U P;  2GS0 A;  4WVF B;  1V88 A;  1X1G A;  2L1C A;  1UPR A;  4PQ0 A;  1U5G A;  3ZDT A;  5CLL B;  4BBK A;  3KRW A;  4HAU B;  2AEH A;  1OMW A;  2MDX A;  1WI1 A;  1BTN A;  2ZPY A;  3CIK A;  3HQC A;  1W1H A;  1ISN A;  1J19 A;  1XD4 A;  1SHC A;  4CYE A;  2J0M A;  3P7Z A;  2DX1 A;  2VKI A;  4YON A;  2K2U A;  4D0O A;  2D9X A;  3GYP A;  2UZR A;  2H7E A;  4PNK A;  3ULB A;  1UEF A;  1X1F A;  2RLO A;  5GOW B;  4K81 A;  4EKU A;  2LUL A;  1FGZ A;  3TFM A;  1J0W A;  2D2Q A;  5JHH A;  1MKE A;  2YT1 A;  2DHK A;  1XKE A;  2DKP A;  3A8Q A;  3PG7 A;  1H10 A;  1QQG A;  1BY1 A;  4A6H A;  3PVW A;  2Z0O A;  2ADZ A;  2RGN B;  2K2J A;  1UPQ A;  3ODX A;  3G9W A;  1WG7 A;  4HB4 B;  2KUP A;  5JLJ B;  1Z87 A;  2DFK A;  2Q13 A;  4WJ7 A;  2P0D A;  4IAP A;  1UNQ A;  5J3Q A;  1FB8 A;  4KAX B;  1WGU A;  2RVB B;  2KCJ A;  4HAY B;  1U5F A;  4A6F A;  2ELB A;  4HAT B;  4GYV A;  1FOE A;  1W1G A;  1NU2 A;  4HB2 B;  2MKR A;  4KHB B;  3AU4 A;  1F5X A;  5DHA B;  3RCP A;  2M38 A;  3VOQ A;  2YVC A;  3SO6 A;  2K00 A;  3PSC A;  1OQN A;  2QKM A;  1XR0 B;  2H7D A;  4HAX B;  2FJL A;  4P7I A;  3GF9 A;  2YS3 A;  1B55 A;  3EO2 A;  1FHX A;  2HTH B;  4HHV A;  3FM8 C;  2BCJ A;  3SUZ A;  1ZC3 B;  2EC1 A;  2LYD A;  1AQC A;  3ML4 A;  4GXB A;  2COD A;  3MPX A;  2YF0 A;  1RRP B;  5DHF B;  4K2P A;  3WA0 A;  3FSS A;  5DH9 B;  3TW1 A;  1NI2 A;  3D8F A;  2EMS A;  2D9V A;  1Q67 A;  2D9Z A;  3NSU A;  4HAV B;  2Y8F A;  3ODO A;  2D9Y A;  4TKN A;  2ELA A;  1DYN A;  4XWX A;  1QC6 A;  5EFX A;  5LON B;  5DI9 B;  3JV3 A;  2I5C A;  1V5U A;  3U7D A;  5HE2 A;  3ZVR A;  4GMV A;  1V89 A;  5C16 A;  3WYF B;  4Z2N A;  4KHO A;  1WVH A;  5D3V A;  1FHO A;  2AL6 A;  2HE7 A;  2IFS A;  4NSW A;  5HE1 A;  1GC6 A;  1GG3 A;  2DHI A;  5KQ1 A;  2I1K A;  4DBB A;  4WSF A;  4CHJ A;  4F7H A;  1M7R A;  1LW3 A;  4K17 A;  3N7C A;  2DLW A;  2CY4 A;  5HE3 A;  1WGQ A;  5CLQ B;  2W2W A;  1ZSQ A;  4ZRI A;  2UZS A;  5D27 A;  1BAK A;  1DDM A;  1EAZ A;  2RUK B;  1I7A A;  2NZ8 B;  1P6S A;  3FEH A;  2KR9 A;  4A6K A;  2VRW B;  1XX0 A;  5HE0 A;  3PVL A;  4NY0 A;  1Y19 B;  2COF A;  4DX8 A;  5FI1 A;  2ROZ B;  2OQB A;  1WJM A;  4ZRJ A;  2G35 A;  1I2H A;  2Z0Q A;  1FGY A;  2I5F A;  3QBV B;  5D3X A;  3TO1 A;  3BIN A;  4A6F B;  4HDO A;  1U27 A;  1U29 A;  4H8S A;  1Y5O A;  2YS1 A;  2D4Q A;  2COC A;  2GCJ A;  1X05 A;  2R09 A;  2DN6 A;  1H4R A;  2CAY A;  3U8Z A;  1U2B A;  1KI1 B;  2DYN A;  1P3R A;  3AJ4 A;  1SGH A;  3LJU X;  3PP2 A;  1DDW A;  1IRS A;  5DIF B;  3OAN A;  4A5K A;  2L2I A;  4HAW B;  1ZVR A;  2E2X A;  2N0Y A;  1EF1 A;  2MWN B;  1FAO A;  3DXC A;  3ODW A;  5J3Y A;  3A98 B;  3PEG A;  1EGX A;  5C5B A;  1AWE A;  1TQZ A;  2D9W A;  3MDB C;  2VSZ A;  4EJN A;  3PVU A;  2W2X D;  3KRX A;  1K5D B;  4DXA B;  2QKL A;  4KVG B;  5C6R A;  3A8P A;  2DHJ A;  4DX9 0;  4HB3 B;  2J0K A;  3IVF A;  1UNR A;  3BJI A;  2LOZ A;  3GYO A;  4C0A A;  4IOY X;  3M1I B;  5JP4 A;  2Y8G A;  2X18 A;  1W1D A;  2OTX A;  1WJ1 A;  4TYZ A;  1KZG A;  4GOU A;  3HK0 A;  3AU5 A;  1PFJ A;  4Z2M B;  2MFQ A;  2Z0P A;  2DTC A;  1ZC4 B;  4L6E A;  1RJ2 A;  2DKQ A;  1EVH A;  5L81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...