1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system/signaling protein
molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
4TYZA 1UPRA 1U5FA 2VKIA 2GS0A 3BJIA 2I1KA 4GOUA 1U29A 1H4RA 4Z2NA 2YT1A 5HE0A 1EGXA 1P5TA 4KAXB 3DXDA 1V88A 4Z2MB 1XODA 3HQCA 3KSYA 4K81A 4KHOA 2DKQA 1FHXA 1MIXA 1UPQA 2DLWA 4HB2B 1F5XA 5D3WA 2NZ8B 2I5FA 4EKUA 2K00A 4HAYB 4WVFB 2DFKA 4WSFA 1MKEA 3A8PA 2YVCA 1W1DA 5GOWB 3NSUA 3U7DA 2G35A 4YL8A 3PP2A 2I5CA 1GG3A 5J3YA 3HK0A 2D9ZA 3SV1A 4D0NB 1P3RA 1X1GA 3QIJA 2QKMA 3VIAA 2YRYA 1I7AA 3RCPA 4ZRJA 1X1FA 1ZVRA 2DA0A 3SNHA 1FHOA 1PFJA 2K2JA 2KR9A 4GZUA 3ULCA 3M1IB 4GYVA 1X05A 4A6HA 1UEFA 1Y19B 2ELAA 4K2OA 1SHCA 4GN1A 4MY6A 4A5KA 1U5EA 3AU5A 2DYQA 2ROZB 1WGUA 1DDVA 1LB1A 3TO1A 2DYNA 2M38A 2KUPA 3IVFA 2Y7BA 1QQGA 1GC6A 1B55A 5J3QA 1V5UA 3TVVA 1AQCA 1BAKA 4K2PA 2H7EA 3TCAA 3MDBC 1IRSA 2Z0PA 3F0WA 3LJUX 1FAOA 3WA0A 2DX5A 3PVUA 1GC7A 2RGNB 3SO6A 2D10A 2UZSA 2LOXA 4IAPA 1PLSA 2ADZA 2OQBA 1WG7A 3D8DA 3P7ZA 2J59M 3JV3A 4C0AA 1DDWA 3N7CA 1MIZB 4F7HA 2P0FA 2VRWB 4GXBA 4IOYX 2D11A 2R09A 2LKOA 1V5PA 3GYPA 2D9WA 5C6RA 2P0HA 2KCJA 4A6FA 4A6KA 1XKEA 2CODA 1Y5OA 2COCA 4P7IA 5D3VA 3F5RA 2J0MA 2YT0A 2H7DA 3T06A 4EJNA 1BY1A 1V5MA 2HTHB 4PNKA 2D2QA 2DHJA 4B6HA 1W1HA 1NU2A 2X18A 1TJ6A 3ODOA 1M7EA 1DROA 4NY0A 1DBHA 2ZPYA 2CRFA 2K2UA 4KHBB 2I1JA 1NI2A 5KQ1A 1KZ7A 1K5GB 5KCVA 1XX0A 3TW1A 1MPHA 4F7UP 2R0DA 2DX1A 5HE2A 1RRPB 2EMTA 1QC6A 1PMSA 4A6FB 4EMOA 4H8SA 1BTKA 2N23A 1XD4A 2UZRA 4DXAB 1P6SA 2GCLA 2DTCA 2ROVA 3FEHA 2EJ8A 3U8ZA 1DDMA 1MAIA 2PZ1A 1X86A 2COFA 2LULA 5FI1A 2LYDA 1UNQA 3ODXA 3ML4A 3X23A 4L6EA 1MK7B 4BBKA 2E2XA 4CYEA 2EC1A 2UVMA 3OANA 2OTXA 1LW3A 3HW2B 2CAYA 3BINA 3DXCA 3SYXA 5KQ4A 1DYNA 4CHMA 1U2BA 2Z0QA 2LG1A 1FGZA 2DHKA 1M7RA 5DI9B 1U5DA 1OY2A 1XR0B 5C79A 3PEGA 1ZC3B 1EF1A 2RVBB 2CY4A 4IFSA 4K17A 1TXDA 2MFQA 3QWMA 2EMSA 2RLOA 4NSWA 1KZGA 1J0WA 4ZRIA 2J0JA 5JHGA 5CLQB 3KY9A 4CHJA 1V61A 2Y8GA 1FHWA 2W2XD 4HAWB 2IYBA 4HAZB 4F7GA 4MT7A 2KGXB 1I2HA 3KRXA 2YS5A 5DH9B 2LOZA 2YF0A 3UZTA 5J3TA 3VOQA 4GPTB 3DXEA 3CIKA 3PVLA 3SUZA 4DX90 2Y8FA 3ODWA 3P6AA 1U5GA 1K5DB 1U27A 2V76A 5D3YA 1RJ2A 3EO2A 3TFMA 1H10A 1E5WA 2D4QA 4HAVB 2DN6A 1NTVA 1EVHA 1ISNA 2D9VA 3ULBA 2D9YA 5HE1A 3GYOA 2D9XA 3WYFB 3KRWA 5DIFB 1Q67A 2W2XC 3GF9A 5C5BA 1X11A 5D27A 5JHHA 2DHIA 2Q13A 3FM8C 1BWNA 2J0KA 5DHFB 1FGYA 3PVWA 1J19A 4KVGB 2RSGA 5JLJB 1FOEA 2P8VA 2GJYA 1ZM0A 3G9WA 2MDXA 2DKPA 4WJ7A 3PG7A 1Z87A 5CLLB 4HAXB 5LOPB 1UNRA 2HE7A 2YS1A 1AWEA 1UNPA 3ZDTA 3CXBB 2ELBA 2M14A 3A8QA 1MK9B 3D8EA 1ZC4B 2RNRB 3PZDA 4HDQA 1SGHA 5L81A 3QBVB 4HHVA 2YSZA 1WGQA 1V89A 4DBBA 2QKLA 2Z0OA 2JP2A 1TQZA 4HB4B 4KHAA 1WJ1A 4HATB 2BCJA 4GMVA 4YONA 1WJMA 1NTYA 1WVHA 1BTNA 3KZ1A 5HE3A 2L1CA 5C16A 2IFSA 5C5BB 4MK0A 5DHAB 1ZSQA 5LONB 4HAUB 4ZRKA 3V5WA 4PQ0A 2VSZA 4HDOA 1EAZA 5EFXA 2XQNM 3FSSA 4D0OA 3PSCA 1N3HA 4Y94A 4GMXB 3ZVRA 1W1GA 4TKNA 5FI0A 1FB8A 1OQNA 2L2IA 3AJ4A 2W2WA 3MPXA 2GCJA 4HB3B 1XCGA 2MKRA 4XWXA 1OMWA 2CY5A 3O96A 1WI1A 3A98B 3AU4A 2FJLA 2COAA 2RUKB 2N0YA 1KI1B 5JP4A 3D8FA 5D3XA 2YS3A 2MWNB 2P0DA 2NMBA 2AEHA 2AL6A 4DX8A 4HB0B
chains in the Genus database with same CATH superfamily
4TYZA 1UPRA 1U5FA 3DCXA 2VKIA 2GS0A 3BJIA 2I1KA 4GOUA 1U29A 1H4RA 4Z2NA 2YT1A 5HE0A 1EGXA 1P5TA 4KAXB 3DXDA 1V88A 4Z2MB 1XODA 3HQCA 3KSYA 4K81A 4KHOA 2DKQA 1FHXA 1MIXA 1MI1A 1UPQA 2DLWA 4HB2B 1F5XA 2K8EA 5D3WA 2NZ8B 2I5FA 4EKUA 2K00A 4HAYB 4WVFB 2DFKA 4WSFA 1MKEA 3A8PA 2YVCA 1W1DA 5GOWB 1T77A 4D6WA 3NSUA 3U7DA 2G35A 4YL8A 3PP2A 4DIXA 2I5CA 1GG3A 5J3YA 3HK0A 2D9ZA 3SV1A 4D0NB 1P3RA 1X1GA 3QIJA 2QKMA 3U12A 5I2MA 2KUQA 3VIAA 2YRYA 1I7AA 4QJ5B 3RCPA 4ZRJA 1X1FA 1ZVRA 2DA0A 3SNHA 1FHOA 2KIEA 4HSIA 1PFJA 3NW8A 2K2JA 2KR9A 4GZUA 3ULCA 3M1IB 2Z4DA 4GYVA 1X05A 4A6HA 1UEFA 1Y19B 2ELAA 4K2OA 1SHCA 4GN1A 4MY6A 4A5KA 1U5EA 3AU5A 2DYQA 2ROZB 1WGUA 1DDVA 1LB1A 2RRFA 3TO1A 2DYNA 2M38A 2KUPA 2YT2A 3IVFA 2Y7BA 1QQGA 1GC6A 3NWDA 1B55A 5J3QA 1V5UA 3TVVA 1AQCA 4L1RA 1BAKA 4K2PA 2H7EA 3TCAA 3MDBC 1IRSA 2Z0PA 3F0WA 3LJUX 1FAOA 3WA0A 2DX5A 3PVUA 1GC7A 4KHBA 2RGNB 3SO6A 2D10A 2UZSA 2LOXA 4IAPA 4OSNA 1PLSA 2ADZA 2OQBA 1WG7A 3D8DA 3P7ZA 3NWFA 2J59M 3JV3A 4C0AA 1DDWA 3N7CA 1MIZB 4F7HA 2P0FA 2VRWB 4GXBA 4IOYX 2D11A 2R09A 2LKOA 1V5PA 3GYPA 2D9WA 5C6RA 2P0HA 2KCJA 4A6FA 3HIEA 4A6KA 1XKEA 2CODA 1Y5OA 2COCA 5M4YB 4P7IA 5D3VA 3F5RA 2J0MA 2YT0A 2H7DA 3T06A 4EJNA 1BY1A 2Z14A 1V5MA 2HTHB 4PNKA 2D2QA 2DHJA 4B6HA 4GNKB 1W1HA 1NU2A 2X18A 1TJ6A 3ODOA 1M7EA 1DROA 4NY0A 1DBHA 2ZPYA 2CRFA 2K2UA 4KHBB 2I1JA 1NI2A 5KQ1A 1KZ7A 1K5GB 5KCVA 1XX0A 3TW1A 1MPHA 4F7UP 2R0DA 2DX1A 5HE2A 1RRPB 2EMTA 1QC6A 1PMSA 4A6FB 4EMOA 4H8SA 1BTKA 2N23A 1XD4A 2UZRA 4DXAB 1P6SA 2GCLA 2DTCA 2ROVA 3FEHA 2EJ8A 3U8ZA 1DDMA 1MAIA 2PZ1A 1X86A 2COFA 2R2YA 2LULA 5FI1A 2LYDA 1UNQA 3ODXA 3ML4A 3X23A 4L6EA 1MK7B 4BBKA 3FVCA 2E2XA 2EC1A 2UVMA 4CYEA 3OANA 2OTXA 1LW3A 3HW2B 2CAYA 3BINA 3DXCA 3SYXA 5KQ4A 1DYNA 4CHMA 1U2BA 2Z0QA 2LG1A 2KR0A 1FGZA 2DHKA 1M7RA 5DI9B 1U5DA 1OY2A 1XR0B 5C79A 3PEGA 1ZC3B 1EF1A 2RVBB 2CY4A 4IFSA 4K17A 1TXDA 2MFQA 3QWMA 2EMSA 2RLOA 4NSWA 1KZGA 1J0WA 4ZRIA 2J0JA 5JHGA 5CLQB 3KY9A 4CHJA 1V61A 2Y8GA 1FHWA 5LG4B 2W2XD 4HAWB 2IYBA 4HAZB 4QJ3B 4F7GA 4MT7A 2KGXB 1I2HA 3KRXA 2YS5A 5DH9B 2LOZA 2YF0A 3UZTA 5J3TA 3VOQA 4GPTB 3DXEA 3CIKA 3PVLA 3SUZA 2GUMA 4DX90 2Y8FA 3ODWA 3P6AA 1U5GA 1K5DB 1U27A 2V76A 5D3YA 1RJ2A 3EO2A 3TFMA 1H10A 1E5WA 2D4QA 4HAVB 2DN6A 1NTVA 1EVHA 1ISNA 2D9VA 3ULBA 2D9YA 5HE1A 1ZYIA 3GYOA 2D9XA 3WYFB 3KRWA 5DIFB 1Q67A 2W2XC 3GF9A 5C5BA 1X11A 5D27A 5JHHA 2DHIA 2Q13A 3FM8C 1BWNA 2J0KA 5DHFB 1FGYA 4CSQA 3PVWA 1J19A 5IRSA 3OHMB 4KVGB 2RSGA 5JLJB 2Z13A 1FOEA 2P8VA 2GJYA 1ZM0A 3G9WA 2MDXA 2DKPA 4WJ7A 3PG7A 1Z87A 5CLLB 4HAXB 5LOPB 1UNRA 3B77A 2HE7A 2YS1A 1AWEA 1UNPA 3ZDTA 3CXBB 2ELBA 2M14A 3A8QA 1MK9B 3D8EA 2NBVA 4QXAB 1ZC4B 2RNRB 3PZDA 4HDQA 2FJUB 2ZKMX 1SGHA 5L81A 3HSAA 3QBVB 4HHVA 2YSZA 1WGQA 1V89A 5I2SA 4DBBA 2QKLA 2Z0OA 2JP2A 1TQZA 4HB4B 4KHAA 1WJ1A 4HATB 2BCJA 3A58A 4YONA 4GMVA 1WJMA 1NTYA 1WVHA 1BTNA 3KZ1A 5HE3A 2L1CA 4OT1A 5C16A 2IFSA 5C5BB 4MK0A 3NWAA 5DHAB 1ZSQA 5LONB 4HAUB 4ZRKA 3V5WA 4PQ0A 2VSZA 4HDOA 2Z59A 1EAZA 2K49A 5EFXA 2XQNM 3FSSA 4D0OA 3PSCA 1N3HA 4Y94A 4GMXB 3ZVRA 1W1GA 4TKNA 5FI0A 1FB8A 1OQNA 2L2IA 3AJ4A 2W2WA 3MPXA 2GCJA 4HB3B 1XCGA 2MKRA 4XWXA 1OMWA 2CY5A 3O96A 1WI1A 3A98B 3AU4A 2FJLA 2COAA 2RUKB 2N0YA 1KI1B 5JP4A 3D8FA 5D3XA 2YS3A 2MWNB 2P0DA 2NMBA 2AEHA 2AL6A 2KIGA 4DX8A 4QJ4B 4HB0B
chains in the Genus database with same CATH topology
4TYZA 1UPRA 1U5FA 2VKIA 2GS0A 3BJIA 2I1KA 4GOUA 1U29A 1H4RA 4Z2NA 2YT1A 5HE0A 1EGXA 1P5TA 4KAXB 3DXDA 1V88A 4Z2MB 1XODA 3HQCA 3KSYA 4K81A 4KHOA 2DKQA 1FHXA 1MIXA 1UPQA 2DLWA 4HB2B 1F5XA 5D3WA 2NZ8B 2I5FA 4EKUA 2K00A 4HAYB 4WVFB 2DFKA 4WSFA 1MKEA 3A8PA 2YVCA 1W1DA 5GOWB 3NSUA 3U7DA 2G35A 4YL8A 3PP2A 2I5CA 1GG3A 5J3YA 3HK0A 2D9ZA 3SV1A 4D0NB 1P3RA 1X1GA 3QIJA 2QKMA 3VIAA 2YRYA 1I7AA 3RCPA 4ZRJA 1X1FA 1ZVRA 2DA0A 3SNHA 1FHOA 1PFJA 2K2JA 2KR9A 4GZUA 3ULCA 3M1IB 4GYVA 1X05A 4A6HA 1UEFA 1Y19B 2ELAA 4K2OA 1SHCA 4GN1A 4MY6A 4A5KA 1U5EA 3AU5A 2DYQA 2ROZB 1WGUA 1DDVA 1LB1A 3TO1A 2DYNA 2M38A 2KUPA 3IVFA 2Y7BA 1QQGA 1GC6A 1B55A 5J3QA 1V5UA 3TVVA 1AQCA 1BAKA 4K2PA 2H7EA 3TCAA 3MDBC 1IRSA 2Z0PA 3F0WA 3LJUX 1FAOA 3WA0A 2DX5A 3PVUA 1GC7A 2RGNB 3SO6A 2D10A 2UZSA 2LOXA 4IAPA 1PLSA 2ADZA 2OQBA 1WG7A 3D8DA 3P7ZA 2J59M 3JV3A 4C0AA 1DDWA 3N7CA 1MIZB 4F7HA 2P0FA 2VRWB 4GXBA 4IOYX 2D11A 2R09A 2LKOA 1V5PA 3GYPA 2D9WA 5C6RA 2P0HA 2KCJA 4A6FA 4A6KA 1XKEA 2CODA 1Y5OA 2COCA 4P7IA 5D3VA 3F5RA 2J0MA 2YT0A 2H7DA 3T06A 4EJNA 1BY1A 1V5MA 2HTHB 4PNKA 2D2QA 2DHJA 4B6HA 1W1HA 1NU2A 2X18A 1TJ6A 3ODOA 1M7EA 1DROA 4NY0A 1DBHA 2ZPYA 2CRFA 2K2UA 4KHBB 2I1JA 1NI2A 5KQ1A 1KZ7A 1K5GB 5KCVA 1XX0A 3TW1A 1MPHA 4F7UP 2R0DA 2DX1A 5HE2A 1RRPB 2EMTA 1QC6A 1PMSA 4A6FB 4EMOA 4H8SA 1BTKA 2N23A 1XD4A 2UZRA 4DXAB 1P6SA 2GCLA 2DTCA 2ROVA 3FEHA 2EJ8A 3U8ZA 1DDMA 1MAIA 2PZ1A 1X86A 2COFA 2LULA 5FI1A 2LYDA 1UNQA 3ODXA 3ML4A 3X23A 4L6EA 1MK7B 4BBKA 2E2XA 4CYEA 2EC1A 2UVMA 3OANA 2OTXA 1LW3A 3HW2B 2CAYA 3BINA 3DXCA 3SYXA 5KQ4A 1DYNA 4CHMA 1U2BA 2Z0QA 2LG1A 1FGZA 2DHKA 1M7RA 5DI9B 1U5DA 1OY2A 1XR0B 5C79A 3PEGA 1ZC3B 1EF1A 2RVBB 2CY4A 4IFSA 4K17A 1TXDA 2MFQA 3QWMA 2EMSA 2RLOA 4NSWA 1KZGA 1J0WA 4ZRIA 2J0JA 5JHGA 5CLQB 3KY9A 4CHJA 1V61A 2Y8GA 1FHWA 2W2XD 4HAWB 2IYBA 4HAZB 4F7GA 4MT7A 2KGXB 1I2HA 3KRXA 2YS5A 5DH9B 2LOZA 2YF0A 3UZTA 5J3TA 3VOQA 4GPTB 3DXEA 3CIKA 3PVLA 3SUZA 4DX90 2Y8FA 3ODWA 3P6AA 1U5GA 1K5DB 1U27A 2V76A 5D3YA 1RJ2A 3EO2A 3TFMA 1H10A 1E5WA 2D4QA 4HAVB 2DN6A 1NTVA 1EVHA 1ISNA 2D9VA 3ULBA 2D9YA 5HE1A 3GYOA 2D9XA 3WYFB 3KRWA 5DIFB 1Q67A 2W2XC 3GF9A 5C5BA 1X11A 5D27A 5JHHA 2DHIA 2Q13A 3FM8C 1BWNA 2J0KA 5DHFB 1FGYA 3PVWA 1J19A 4KVGB 2RSGA 5JLJB 1FOEA 2P8VA 2GJYA 1ZM0A 3G9WA 2MDXA 2DKPA 4WJ7A 3PG7A 1Z87A 5CLLB 4HAXB 5LOPB 1UNRA 2HE7A 2YS1A 1AWEA 1UNPA 3ZDTA 3CXBB 2ELBA 2M14A 3A8QA 1MK9B 3D8EA 1ZC4B 2RNRB 3PZDA 4HDQA 1SGHA 5L81A 3QBVB 4HHVA 2YSZA 1WGQA 1V89A 4DBBA 2QKLA 2Z0OA 2JP2A 1TQZA 4HB4B 4KHAA 1WJ1A 4HATB 2BCJA 4GMVA 4YONA 1WJMA 1NTYA 1WVHA 1BTNA 3KZ1A 5HE3A 2L1CA 5C16A 2IFSA 5C5BB 4MK0A 5DHAB 1ZSQA 5LONB 4HAUB 4ZRKA 3V5WA 4PQ0A 2VSZA 4HDOA 1EAZA 5EFXA 2XQNM 3FSSA 4D0OA 3PSCA 1N3HA 4Y94A 4GMXB 3ZVRA 1W1GA 4TKNA 5FI0A 1FB8A 1OQNA 2L2IA 3AJ4A 2W2WA 3MPXA 2GCJA 4HB3B 1XCGA 2MKRA 4XWXA 1OMWA 2CY5A 3O96A 1WI1A 3A98B 3AU4A 2FJLA 2COAA 2RUKB 2N0YA 1KI1B 5JP4A 3D8FA 5D3XA 2YS3A 2MWNB 2P0DA 2NMBA 2AEHA 2AL6A 4DX8A 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYZ A;  1UPR A;  1U5F A;  2VKI A;  2GS0 A;  3BJI A;  2I1K A;  4GOU A;  1U29 A;  1H4R A;  4Z2N A;  2YT1 A;  5HE0 A;  1EGX A;  1P5T A;  4KAX B;  3DXD A;  1V88 A;  4Z2M B;  1XOD A;  3HQC A;  3KSY A;  4K81 A;  4KHO A;  2DKQ A;  1FHX A;  1MIX A;  1UPQ A;  2DLW A;  4HB2 B;  1F5X A;  5D3W A;  2NZ8 B;  2I5F A;  4EKU A;  2K00 A;  4HAY B;  4WVF B;  2DFK A;  4WSF A;  1MKE A;  3A8P A;  2YVC A;  1W1D A;  5GOW B;  3NSU A;  3U7D A;  2G35 A;  4YL8 A;  3PP2 A;  2I5C A;  1GG3 A;  5J3Y A;  3HK0 A;  2D9Z A;  3SV1 A;  4D0N B;  1P3R A;  1X1G A;  3QIJ A;  2QKM A;  3VIA A;  2YRY A;  1I7A A;  3RCP A;  4ZRJ A;  1X1F A;  1ZVR A;  2DA0 A;  3SNH A;  1FHO A;  1PFJ A;  2K2J A;  2KR9 A;  4GZU A;  3ULC A;  3M1I B;  4GYV A;  1X05 A;  4A6H A;  1UEF A;  1Y19 B;  2ELA A;  4K2O A;  1SHC A;  4GN1 A;  4MY6 A;  4A5K A;  1U5E A;  3AU5 A;  2DYQ A;  2ROZ B;  1WGU A;  1DDV A;  1LB1 A;  3TO1 A;  2DYN A;  2M38 A;  2KUP A;  3IVF A;  2Y7B A;  1QQG A;  1GC6 A;  1B55 A;  5J3Q A;  1V5U A;  3TVV A;  1AQC A;  1BAK A;  4K2P A;  2H7E A;  3TCA A;  3MDB C;  1IRS A;  2Z0P A;  3F0W A;  3LJU X;  1FAO A;  3WA0 A;  2DX5 A;  3PVU A;  1GC7 A;  2RGN B;  3SO6 A;  2D10 A;  2UZS A;  2LOX A;  4IAP A;  1PLS A;  2ADZ A;  2OQB A;  1WG7 A;  3D8D A;  3P7Z A;  2J59 M;  3JV3 A;  4C0A A;  1DDW A;  3N7C A;  1MIZ B;  4F7H A;  2P0F A;  2VRW B;  4GXB A;  4IOY X;  2D11 A;  2R09 A;  2LKO A;  1V5P A;  3GYP A;  2D9W A;  5C6R A;  2P0H A;  2KCJ A;  4A6F A;  4A6K A;  1XKE A;  2COD A;  1Y5O A;  2COC A;  4P7I A;  5D3V A;  3F5R A;  2J0M A;  2YT0 A;  2H7D A;  3T06 A;  4EJN A;  1BY1 A;  1V5M A;  2HTH B;  4PNK A;  2D2Q A;  2DHJ A;  4B6H A;  1W1H A;  1NU2 A;  2X18 A;  1TJ6 A;  3ODO A;  1M7E A;  1DRO A;  4NY0 A;  1DBH A;  2ZPY A;  2CRF A;  2K2U A;  4KHB B;  2I1J A;  1NI2 A;  5KQ1 A;  1KZ7 A;  1K5G B;  5KCV A;  1XX0 A;  3TW1 A;  1MPH A;  4F7U P;  2R0D A;  2DX1 A;  5HE2 A;  1RRP B;  2EMT A;  1QC6 A;  1PMS A;  4A6F B;  4EMO A;  4H8S A;  1BTK A;  2N23 A;  1XD4 A;  2UZR A;  4DXA B;  1P6S A;  2GCL A;  2DTC A;  2ROV A;  3FEH A;  2EJ8 A;  3U8Z A;  1DDM A;  1MAI A;  2PZ1 A;  1X86 A;  2COF A;  2LUL A;  5FI1 A;  2LYD A;  1UNQ A;  3ODX A;  3ML4 A;  3X23 A;  4L6E A;  1MK7 B;  4BBK A;  2E2X A;  4CYE A;  2EC1 A;  2UVM A;  3OAN A;  2OTX A;  1LW3 A;  3HW2 B;  2CAY A;  3BIN A;  3DXC A;  3SYX A;  5KQ4 A;  1DYN A;  4CHM A;  1U2B A;  2Z0Q A;  2LG1 A;  1FGZ A;  2DHK A;  1M7R A;  5DI9 B;  1U5D A;  1OY2 A;  1XR0 B;  5C79 A;  3PEG A;  1ZC3 B;  1EF1 A;  2RVB B;  2CY4 A;  4IFS A;  4K17 A;  1TXD A;  2MFQ A;  3QWM A;  2EMS A;  2RLO A;  4NSW A;  1KZG A;  1J0W A;  4ZRI A;  2J0J A;  5JHG A;  5CLQ B;  3KY9 A;  4CHJ A;  1V61 A;  2Y8G A;  1FHW A;  2W2X D;  4HAW B;  2IYB A;  4HAZ B;  4F7G A;  4MT7 A;  2KGX B;  1I2H A;  3KRX A;  2YS5 A;  5DH9 B;  2LOZ A;  2YF0 A;  3UZT A;  5J3T A;  3VOQ A;  4GPT B;  3DXE A;  3CIK A;  3PVL A;  3SUZ A;  4DX9 0;  2Y8F A;  3ODW A;  3P6A A;  1U5G A;  1K5D B;  1U27 A;  2V76 A;  5D3Y A;  1RJ2 A;  3EO2 A;  3TFM A;  1H10 A;  1E5W A;  2D4Q A;  4HAV B;  2DN6 A;  1NTV A;  1EVH A;  1ISN A;  2D9V A;  3ULB A;  2D9Y A;  5HE1 A;  3GYO A;  2D9X A;  3WYF B;  3KRW A;  5DIF B;  1Q67 A;  2W2X C;  3GF9 A;  5C5B A;  1X11 A;  5D27 A;  5JHH A;  2DHI A;  2Q13 A;  3FM8 C;  1BWN A;  2J0K A;  5DHF B;  1FGY A;  3PVW A;  1J19 A;  4KVG B;  2RSG A;  5JLJ B;  1FOE A;  2P8V A;  2GJY A;  1ZM0 A;  3G9W A;  2MDX A;  2DKP A;  4WJ7 A;  3PG7 A;  1Z87 A;  5CLL B;  4HAX B;  5LOP B;  1UNR A;  2HE7 A;  2YS1 A;  1AWE A;  1UNP A;  3ZDT A;  3CXB B;  2ELB A;  2M14 A;  3A8Q A;  1MK9 B;  3D8E A;  1ZC4 B;  2RNR B;  3PZD A;  4HDQ A;  1SGH A;  5L81 A;  3QBV B;  4HHV A;  2YSZ A;  1WGQ A;  1V89 A;  4DBB A;  2QKL A;  2Z0O A;  2JP2 A;  1TQZ A;  4HB4 B;  4KHA A;  1WJ1 A;  4HAT B;  2BCJ A;  4GMV A;  4YON A;  1WJM A;  1NTY A;  1WVH A;  1BTN A;  3KZ1 A;  5HE3 A;  2L1C A;  5C16 A;  2IFS A;  5C5B B;  4MK0 A;  5DHA B;  1ZSQ A;  5LON B;  4HAU B;  4ZRK A;  3V5W A;  4PQ0 A;  2VSZ A;  4HDO A;  1EAZ A;  5EFX A;  2XQN M;  3FSS A;  4D0O A;  3PSC A;  1N3H A;  4Y94 A;  4GMX B;  3ZVR A;  1W1G A;  4TKN A;  5FI0 A;  1FB8 A;  1OQN A;  2L2I A;  3AJ4 A;  2W2W A;  3MPX A;  2GCJ A;  4HB3 B;  1XCG A;  2MKR A;  4XWX A;  1OMW A;  2CY5 A;  3O96 A;  1WI1 A;  3A98 B;  3AU4 A;  2FJL A;  2COA A;  2RUK B;  2N0Y A;  1KI1 B;  5JP4 A;  3D8F A;  5D3X A;  2YS3 A;  2MWN B;  2P0D A;  2NMB A;  2AEH A;  2AL6 A;  4DX8 A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 4TYZ A;  1UPR A;  1U5F A;  3DCX A;  2VKI A;  2GS0 A;  3BJI A;  2I1K A;  4GOU A;  1U29 A;  1H4R A;  4Z2N A;  2YT1 A;  5HE0 A;  1EGX A;  1P5T A;  4KAX B;  3DXD A;  1V88 A;  4Z2M B;  1XOD A;  3HQC A;  3KSY A;  4K81 A;  4KHO A;  2DKQ A;  1FHX A;  1MIX A;  1MI1 A;  1UPQ A;  2DLW A;  4HB2 B;  1F5X A;  2K8E A;  5D3W A;  2NZ8 B;  2I5F A;  4EKU A;  2K00 A;  4HAY B;  4WVF B;  2DFK A;  4WSF A;  1MKE A;  3A8P A;  2YVC A;  1W1D A;  5GOW B;  1T77 A;  4D6W A;  3NSU A;  3U7D A;  2G35 A;  4YL8 A;  3PP2 A;  4DIX A;  2I5C A;  1GG3 A;  5J3Y A;  3HK0 A;  2D9Z A;  3SV1 A;  4D0N B;  1P3R A;  1X1G A;  3QIJ A;  2QKM A;  3U12 A;  5I2M A;  2KUQ A;  3VIA A;  2YRY A;  1I7A A;  4QJ5 B;  3RCP A;  4ZRJ A;  1X1F A;  1ZVR A;  2DA0 A;  3SNH A;  1FHO A;  2KIE A;  4HSI A;  1PFJ A;  3NW8 A;  2K2J A;  2KR9 A;  4GZU A;  3ULC A;  3M1I B;  2Z4D A;  4GYV A;  1X05 A;  4A6H A;  1UEF A;  1Y19 B;  2ELA A;  4K2O A;  1SHC A;  4GN1 A;  4MY6 A;  4A5K A;  1U5E A;  3AU5 A;  2DYQ A;  2ROZ B;  1WGU A;  1DDV A;  1LB1 A;  2RRF A;  3TO1 A;  2DYN A;  2M38 A;  2KUP A;  2YT2 A;  3IVF A;  2Y7B A;  1QQG A;  1GC6 A;  3NWD A;  1B55 A;  5J3Q A;  1V5U A;  3TVV A;  1AQC A;  4L1R A;  1BAK A;  4K2P A;  2H7E A;  3TCA A;  3MDB C;  1IRS A;  2Z0P A;  3F0W A;  3LJU X;  1FAO A;  3WA0 A;  2DX5 A;  3PVU A;  1GC7 A;  4KHB A;  2RGN B;  3SO6 A;  2D10 A;  2UZS A;  2LOX A;  4IAP A;  4OSN A;  1PLS A;  2ADZ A;  2OQB A;  1WG7 A;  3D8D A;  3P7Z A;  3NWF A;  2J59 M;  3JV3 A;  4C0A A;  1DDW A;  3N7C A;  1MIZ B;  4F7H A;  2P0F A;  2VRW B;  4GXB A;  4IOY X;  2D11 A;  2R09 A;  2LKO A;  1V5P A;  3GYP A;  2D9W A;  5C6R A;  2P0H A;  2KCJ A;  4A6F A;  3HIE A;  4A6K A;  1XKE A;  2COD A;  1Y5O A;  2COC A;  5M4Y B;  4P7I A;  5D3V A;  3F5R A;  2J0M A;  2YT0 A;  2H7D A;  3T06 A;  4EJN A;  1BY1 A;  2Z14 A;  1V5M A;  2HTH B;  4PNK A;  2D2Q A;  2DHJ A;  4B6H A;  4GNK B;  1W1H A;  1NU2 A;  2X18 A;  1TJ6 A;  3ODO A;  1M7E A;  1DRO A;  4NY0 A;  1DBH A;  2ZPY A;  2CRF A;  2K2U A;  4KHB B;  2I1J A;  1NI2 A;  5KQ1 A;  1KZ7 A;  1K5G B;  5KCV A;  1XX0 A;  3TW1 A;  1MPH A;  4F7U P;  2R0D A;  2DX1 A;  5HE2 A;  1RRP B;  2EMT A;  1QC6 A;  1PMS A;  4A6F B;  4EMO A;  4H8S A;  1BTK A;  2N23 A;  1XD4 A;  2UZR A;  4DXA B;  1P6S A;  2GCL A;  2DTC A;  2ROV A;  3FEH A;  2EJ8 A;  3U8Z A;  1DDM A;  1MAI A;  2PZ1 A;  1X86 A;  2COF A;  2R2Y A;  2LUL A;  5FI1 A;  2LYD A;  1UNQ A;  3ODX A;  3ML4 A;  3X23 A;  4L6E A;  1MK7 B;  4BBK A;  3FVC A;  2E2X A;  2EC1 A;  2UVM A;  4CYE A;  3OAN A;  2OTX A;  1LW3 A;  3HW2 B;  2CAY A;  3BIN A;  3DXC A;  3SYX A;  5KQ4 A;  1DYN A;  4CHM A;  1U2B A;  2Z0Q A;  2LG1 A;  2KR0 A;  1FGZ A;  2DHK A;  1M7R A;  5DI9 B;  1U5D A;  1OY2 A;  1XR0 B;  5C79 A;  3PEG A;  1ZC3 B;  1EF1 A;  2RVB B;  2CY4 A;  4IFS A;  4K17 A;  1TXD A;  2MFQ A;  3QWM A;  2EMS A;  2RLO A;  4NSW A;  1KZG A;  1J0W A;  4ZRI A;  2J0J A;  5JHG A;  5CLQ B;  3KY9 A;  4CHJ A;  1V61 A;  2Y8G A;  1FHW A;  5LG4 B;  2W2X D;  4HAW B;  2IYB A;  4HAZ B;  4QJ3 B;  4F7G A;  4MT7 A;  2KGX B;  1I2H A;  3KRX A;  2YS5 A;  5DH9 B;  2LOZ A;  2YF0 A;  3UZT A;  5J3T A;  3VOQ A;  4GPT B;  3DXE A;  3CIK A;  3PVL A;  3SUZ A;  2GUM A;  4DX9 0;  2Y8F A;  3ODW A;  3P6A A;  1U5G A;  1K5D B;  1U27 A;  2V76 A;  5D3Y A;  1RJ2 A;  3EO2 A;  3TFM A;  1H10 A;  1E5W A;  2D4Q A;  4HAV B;  2DN6 A;  1NTV A;  1EVH A;  1ISN A;  2D9V A;  3ULB A;  2D9Y A;  5HE1 A;  1ZYI A;  3GYO A;  2D9X A;  3WYF B;  3KRW A;  5DIF B;  1Q67 A;  2W2X C;  3GF9 A;  5C5B A;  1X11 A;  5D27 A;  5JHH A;  2DHI A;  2Q13 A;  3FM8 C;  1BWN A;  2J0K A;  5DHF B;  1FGY A;  4CSQ A;  3PVW A;  1J19 A;  5IRS A;  3OHM B;  4KVG B;  2RSG A;  5JLJ B;  2Z13 A;  1FOE A;  2P8V A;  2GJY A;  1ZM0 A;  3G9W A;  2MDX A;  2DKP A;  4WJ7 A;  3PG7 A;  1Z87 A;  5CLL B;  4HAX B;  5LOP B;  1UNR A;  3B77 A;  2HE7 A;  2YS1 A;  1AWE A;  1UNP A;  3ZDT A;  3CXB B;  2ELB A;  2M14 A;  3A8Q A;  1MK9 B;  3D8E A;  2NBV A;  4QXA B;  1ZC4 B;  2RNR B;  3PZD A;  4HDQ A;  2FJU B;  2ZKM X;  1SGH A;  5L81 A;  3HSA A;  3QBV B;  4HHV A;  2YSZ A;  1WGQ A;  1V89 A;  5I2S A;  4DBB A;  2QKL A;  2Z0O A;  2JP2 A;  1TQZ A;  4HB4 B;  4KHA A;  1WJ1 A;  4HAT B;  2BCJ A;  3A58 A;  4YON A;  4GMV A;  1WJM A;  1NTY A;  1WVH A;  1BTN A;  3KZ1 A;  5HE3 A;  2L1C A;  4OT1 A;  5C16 A;  2IFS A;  5C5B B;  4MK0 A;  3NWA A;  5DHA B;  1ZSQ A;  5LON B;  4HAU B;  4ZRK A;  3V5W A;  4PQ0 A;  2VSZ A;  4HDO A;  2Z59 A;  1EAZ A;  2K49 A;  5EFX A;  2XQN M;  3FSS A;  4D0O A;  3PSC A;  1N3H A;  4Y94 A;  4GMX B;  3ZVR A;  1W1G A;  4TKN A;  5FI0 A;  1FB8 A;  1OQN A;  2L2I A;  3AJ4 A;  2W2W A;  3MPX A;  2GCJ A;  4HB3 B;  1XCG A;  2MKR A;  4XWX A;  1OMW A;  2CY5 A;  3O96 A;  1WI1 A;  3A98 B;  3AU4 A;  2FJL A;  2COA A;  2RUK B;  2N0Y A;  1KI1 B;  5JP4 A;  3D8F A;  5D3X A;  2YS3 A;  2MWN B;  2P0D A;  2NMB A;  2AEH A;  2AL6 A;  2KIG A;  4DX8 A;  4QJ4 B;  4HB0 B; 
#chains in the Genus database with same CATH homology
 4TYZ A;  1UPR A;  1U5F A;  2VKI A;  2GS0 A;  3BJI A;  2I1K A;  4GOU A;  1U29 A;  1H4R A;  4Z2N A;  2YT1 A;  5HE0 A;  1EGX A;  1P5T A;  4KAX B;  3DXD A;  1V88 A;  4Z2M B;  1XOD A;  3HQC A;  3KSY A;  4K81 A;  4KHO A;  2DKQ A;  1FHX A;  1MIX A;  1UPQ A;  2DLW A;  4HB2 B;  1F5X A;  5D3W A;  2NZ8 B;  2I5F A;  4EKU A;  2K00 A;  4HAY B;  4WVF B;  2DFK A;  4WSF A;  1MKE A;  3A8P A;  2YVC A;  1W1D A;  5GOW B;  3NSU A;  3U7D A;  2G35 A;  4YL8 A;  3PP2 A;  2I5C A;  1GG3 A;  5J3Y A;  3HK0 A;  2D9Z A;  3SV1 A;  4D0N B;  1P3R A;  1X1G A;  3QIJ A;  2QKM A;  3VIA A;  2YRY A;  1I7A A;  3RCP A;  4ZRJ A;  1X1F A;  1ZVR A;  2DA0 A;  3SNH A;  1FHO A;  1PFJ A;  2K2J A;  2KR9 A;  4GZU A;  3ULC A;  3M1I B;  4GYV A;  1X05 A;  4A6H A;  1UEF A;  1Y19 B;  2ELA A;  4K2O A;  1SHC A;  4GN1 A;  4MY6 A;  4A5K A;  1U5E A;  3AU5 A;  2DYQ A;  2ROZ B;  1WGU A;  1DDV A;  1LB1 A;  3TO1 A;  2DYN A;  2M38 A;  2KUP A;  3IVF A;  2Y7B A;  1QQG A;  1GC6 A;  1B55 A;  5J3Q A;  1V5U A;  3TVV A;  1AQC A;  1BAK A;  4K2P A;  2H7E A;  3TCA A;  3MDB C;  1IRS A;  2Z0P A;  3F0W A;  3LJU X;  1FAO A;  3WA0 A;  2DX5 A;  3PVU A;  1GC7 A;  2RGN B;  3SO6 A;  2D10 A;  2UZS A;  2LOX A;  4IAP A;  1PLS A;  2ADZ A;  2OQB A;  1WG7 A;  3D8D A;  3P7Z A;  2J59 M;  3JV3 A;  4C0A A;  1DDW A;  3N7C A;  1MIZ B;  4F7H A;  2P0F A;  2VRW B;  4GXB A;  4IOY X;  2D11 A;  2R09 A;  2LKO A;  1V5P A;  3GYP A;  2D9W A;  5C6R A;  2P0H A;  2KCJ A;  4A6F A;  4A6K A;  1XKE A;  2COD A;  1Y5O A;  2COC A;  4P7I A;  5D3V A;  3F5R A;  2J0M A;  2YT0 A;  2H7D A;  3T06 A;  4EJN A;  1BY1 A;  1V5M A;  2HTH B;  4PNK A;  2D2Q A;  2DHJ A;  4B6H A;  1W1H A;  1NU2 A;  2X18 A;  1TJ6 A;  3ODO A;  1M7E A;  1DRO A;  4NY0 A;  1DBH A;  2ZPY A;  2CRF A;  2K2U A;  4KHB B;  2I1J A;  1NI2 A;  5KQ1 A;  1KZ7 A;  1K5G B;  5KCV A;  1XX0 A;  3TW1 A;  1MPH A;  4F7U P;  2R0D A;  2DX1 A;  5HE2 A;  1RRP B;  2EMT A;  1QC6 A;  1PMS A;  4A6F B;  4EMO A;  4H8S A;  1BTK A;  2N23 A;  1XD4 A;  2UZR A;  4DXA B;  1P6S A;  2GCL A;  2DTC A;  2ROV A;  3FEH A;  2EJ8 A;  3U8Z A;  1DDM A;  1MAI A;  2PZ1 A;  1X86 A;  2COF A;  2LUL A;  5FI1 A;  2LYD A;  1UNQ A;  3ODX A;  3ML4 A;  3X23 A;  4L6E A;  1MK7 B;  4BBK A;  2E2X A;  4CYE A;  2EC1 A;  2UVM A;  3OAN A;  2OTX A;  1LW3 A;  3HW2 B;  2CAY A;  3BIN A;  3DXC A;  3SYX A;  5KQ4 A;  1DYN A;  4CHM A;  1U2B A;  2Z0Q A;  2LG1 A;  1FGZ A;  2DHK A;  1M7R A;  5DI9 B;  1U5D A;  1OY2 A;  1XR0 B;  5C79 A;  3PEG A;  1ZC3 B;  1EF1 A;  2RVB B;  2CY4 A;  4IFS A;  4K17 A;  1TXD A;  2MFQ A;  3QWM A;  2EMS A;  2RLO A;  4NSW A;  1KZG A;  1J0W A;  4ZRI A;  2J0J A;  5JHG A;  5CLQ B;  3KY9 A;  4CHJ A;  1V61 A;  2Y8G A;  1FHW A;  2W2X D;  4HAW B;  2IYB A;  4HAZ B;  4F7G A;  4MT7 A;  2KGX B;  1I2H A;  3KRX A;  2YS5 A;  5DH9 B;  2LOZ A;  2YF0 A;  3UZT A;  5J3T A;  3VOQ A;  4GPT B;  3DXE A;  3CIK A;  3PVL A;  3SUZ A;  4DX9 0;  2Y8F A;  3ODW A;  3P6A A;  1U5G A;  1K5D B;  1U27 A;  2V76 A;  5D3Y A;  1RJ2 A;  3EO2 A;  3TFM A;  1H10 A;  1E5W A;  2D4Q A;  4HAV B;  2DN6 A;  1NTV A;  1EVH A;  1ISN A;  2D9V A;  3ULB A;  2D9Y A;  5HE1 A;  3GYO A;  2D9X A;  3WYF B;  3KRW A;  5DIF B;  1Q67 A;  2W2X C;  3GF9 A;  5C5B A;  1X11 A;  5D27 A;  5JHH A;  2DHI A;  2Q13 A;  3FM8 C;  1BWN A;  2J0K A;  5DHF B;  1FGY A;  3PVW A;  1J19 A;  4KVG B;  2RSG A;  5JLJ B;  1FOE A;  2P8V A;  2GJY A;  1ZM0 A;  3G9W A;  2MDX A;  2DKP A;  4WJ7 A;  3PG7 A;  1Z87 A;  5CLL B;  4HAX B;  5LOP B;  1UNR A;  2HE7 A;  2YS1 A;  1AWE A;  1UNP A;  3ZDT A;  3CXB B;  2ELB A;  2M14 A;  3A8Q A;  1MK9 B;  3D8E A;  1ZC4 B;  2RNR B;  3PZD A;  4HDQ A;  1SGH A;  5L81 A;  3QBV B;  4HHV A;  2YSZ A;  1WGQ A;  1V89 A;  4DBB A;  2QKL A;  2Z0O A;  2JP2 A;  1TQZ A;  4HB4 B;  4KHA A;  1WJ1 A;  4HAT B;  2BCJ A;  4GMV A;  4YON A;  1WJM A;  1NTY A;  1WVH A;  1BTN A;  3KZ1 A;  5HE3 A;  2L1C A;  5C16 A;  2IFS A;  5C5B B;  4MK0 A;  5DHA B;  1ZSQ A;  5LON B;  4HAU B;  4ZRK A;  3V5W A;  4PQ0 A;  2VSZ A;  4HDO A;  1EAZ A;  5EFX A;  2XQN M;  3FSS A;  4D0O A;  3PSC A;  1N3H A;  4Y94 A;  4GMX B;  3ZVR A;  1W1G A;  4TKN A;  5FI0 A;  1FB8 A;  1OQN A;  2L2I A;  3AJ4 A;  2W2W A;  3MPX A;  2GCJ A;  4HB3 B;  1XCG A;  2MKR A;  4XWX A;  1OMW A;  2CY5 A;  3O96 A;  1WI1 A;  3A98 B;  3AU4 A;  2FJL A;  2COA A;  2RUK B;  2N0Y A;  1KI1 B;  5JP4 A;  3D8F A;  5D3X A;  2YS3 A;  2MWN B;  2P0D A;  2NMB A;  2AEH A;  2AL6 A;  4DX8 A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...