1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system/signaling protein
molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
3RCPA 2D4QA 2RSGA 5KQ4A 5J3YA 3IVFA 1WI1A 2GS0A 1K5DB 1MAIA 2D9XA 3KSYA 2ROZB 4HAWB 3KZ1A 4EKUA 1V5PA 2HTHB 3A8PA 1U5GA 1WGQA 2LULA 2ELAA 2EMTA 1OQNA 2ELBA 1ZSQA 1ZC4B 1LW3A 3X23A 2LYDA 5HE3A 1X1GA 2I5FA 1TQZA 2PZ1A 1M7EA 5KQ1A 1WJMA 1W1GA 1WVHA 3HW2B 5C16A 4BBKA 1GC7A 2GJYA 3HQCA 4NSWA 2P0DA 4HAVB 1XCGA 4EMOA 2AEHA 4KVGB 3VOQA 1XODA 2YRYA 1MK9B 2R09A 3BJIA 5HE2A 2DLWA 1IRSA 3FSSA 2KCJA 3TW1A 3A8QA 2EC1A 4DX8A 1EAZA 5DI9B 5D27A 1BY1A 2LOZA 3U7DA 1E5WA 2N0YA 2J59M 2UZSA 1WG7A 1XX0A 4PNKA 3SO6A 4HAXB 2DYNA 1FGYA 1UNPA 4GMXB 2M38A 2L2IA 3ODXA 1X05A 3GYPA 2MKRA 5FI0A 2YF0A 4HB2B 1BTKA 2D9YA 3ZVRA 2IYBA 3FEHA 2RLOA 3PZDA 3EO2A 4K2PA 3DXEA 2J0KA 5J3QA 3DXDA 4B6HA 2HE7A 1KI1B 4WVFB 1UNRA 5CLLB 2YS3A 3VIAA 5J3TA 2L1CA 3PP2A 2W2XD 2DHIA 2CY5A 2MDXA 3PVUA 2R0DA 5HE0A 2P0FA 4WJ7A 2UZRA 5KCVA 1FHWA 4ZRKA 2VSZA 4H8SA 1U5FA 1RJ2A 2D9VA 5JLJB 1MPHA 2CY4A 1MKEA 3PVWA 4CHJA 4TYZA 2RVBB 3ULBA 1ZVRA 3F5RA 1FHXA 3WA0A 1P6SA 1ZC3B 2YSZA 4ZRJA 1U2BA 2DKPA 4DXAB 2EMSA 3MDBC 5FI1A 1J0WA 2M14A 2RGNB 5C79A 2UVMA 4L6EA 4YONA 1EGXA 3P7ZA 4GOUA 4KAXB 4HAYB 3ODOA 5CLQB 5JHHA 3ULCA 1ISNA 1V61A 1SHCA 4KHOA 2YT0A 2ZPYA 1J19A 2QKLA 3PVLA 2DTCA 1OMWA 1ZM0A 2DHJA 1DBHA 2Y7BA 1DDMA 3SV1A 4GPTB 2G35A 2VKIA 1V88A 2DYQA 3HK0A 5EFXA 5JP4A 4K2OA 5JHGA 1KZ7A 3ODWA 2K00A 2Y8GA 2LG1A 2DX1A 3ML4A 4A6FA 3PSCA 1PMSA 4HATB 4DBBA 2N23A 2MWNB 1BAKA 1NU2A 3WYFB 1MIZB 2EJ8A 3A98B 2AL6A 2D2QA 4ZRIA 4Y94A 2KUPA 2H7DA 2W2WA 1F5XA 1DDVA 2D9WA 4KHAA 1W1DA 2BCJA 2LOXA 5D3WA 3TO1A 2QKMA 2YVCA 5D3XA 1UPQA 1UEFA 3QIJA 3BINA 1U5DA 5LONB 3GYOA 4F7GA 3T06A 5C5BB 1GG3A 3FM8C 3V5WA 2ADZA 1UPRA 4K81A 5DHAB 4K17A 2Z0PA 4A6FB 1BTNA 3OANA 5GOWB 1K5GB 2ROVA 3AU5A 2XQNM 5D3VA 3TCAA 3LJUX 1SGHA 4IOYX 1N3HA 5DHFB 1TXDA 4GXBA 2GCJA 1X86A 1DDWA 4HDOA 3KY9A 3PG7A 4A6HA 4HHVA 4NY0A 1LB1A 1NTYA 1I7AA 1KZGA 2RNRB 3CIKA 3D8FA 1XR0B 4A5KA 1GC6A 3D8EA 1Y5OA 1OY2A 1DROA 3KRWA 1XD4A 2VRWB 1MK7B 1X1FA 3AU4A 2I5CA 2DHKA 1Z87A 2DFKA 1M7RA 4Z2MB 3M1IB 2NMBA 2YS1A 1AQCA 2DA0A 3U8ZA 2H7EA 4HDQA 1PLSA 3O96A 5C5BA 3AJ4A 4GMVA 4P7IA 2GCLA 2D9ZA 2Q13A 2OQBA 3TFMA 4GYVA 1U29A 4DX90 2YS5A 1EVHA 2CODA 5D3YA 2K2UA 5DIFB 3JV3A 1QQGA 2I1KA 4D0NB 1Q67A 1TJ6A 5C6RA 3GF9A 1Y19B 5LOPB 1MIXA 4IFSA 4MK0A 1FB8A 4F7UP 2COAA 2OTXA 1H10A 4MT7A 2I1JA 1V5UA 2P8VA 4TKNA 1EF1A 4HB3B 1B55A 1FAOA 1QC6A 2DKQA 3ZDTA 3D8DA 2Z0OA 4KHBB 2DX5A 1PFJA 1NTVA 5DH9B 4Z2NA 3SNHA 4CHMA 4EJNA 4HB0B 3SUZA 2J0MA 4YL8A 1V89A 1FOEA 4A6KA 1DYNA 1FGZA 2Y8FA 3KRXA 1X11A 1U5EA 4HAZB 1W1HA 1U27A 1WJ1A 2COCA 2J0JA 1I2HA 5HE1A 2KR9A 2CAYA 2LKOA 1P5TA 4F7HA 3PEGA 4WSFA 3CXBB 3TVVA 3SYXA 2K2JA 2COFA 4CYEA 4C0AA 3QBVB 4GN1A 2Z0QA 1NI2A 2E2XA 3N7CA 2KGXB 2JP2A 4GZUA 3F0WA 4IAPA 2IFSA 2NZ8B 2D11A 3QWMA 1WGUA 3DXCA 2CRFA 1RRPB 3NSUA 2YT1A 4HAUB 1BWNA 2V76A 1H4RA 3G9WA 2RUKB 1AWEA 2D10A 1UNQA 4D0OA 4MY6A 2DN6A 4XWXA 2P0HA 2W2XC 4HB4B 1V5MA 1XKEA 4PQ0A 1P3RA 2MFQA 3UZTA 1FHOA 2X18A 5L81A 2FJLA 3MPXA 3P6AA
chains in the Genus database with same CATH superfamily
3RCPA 2D4QA 2RSGA 5KQ4A 5J3YA 3IVFA 1WI1A 2GS0A 1K5DB 1MAIA 2D9XA 3KSYA 2ROZB 4HAWB 3KZ1A 4EKUA 1V5PA 2HTHB 3A8PA 1U5GA 1WGQA 2LULA 2ELAA 2EMTA 1OQNA 2ELBA 1ZSQA 1ZC4B 1LW3A 3X23A 2LYDA 5HE3A 1X1GA 4DIXA 2I5FA 1TQZA 2PZ1A 4HSIA 1M7EA 2K8EA 5KQ1A 1WJMA 1W1GA 1WVHA 3HW2B 5C16A 4BBKA 1GC7A 2GJYA 3HQCA 4NSWA 2P0DA 4HAVB 1XCGA 4EMOA 2AEHA 4KVGB 3VOQA 1XODA 2YRYA 1MK9B 2NBVA 2R09A 3BJIA 5HE2A 2DLWA 1IRSA 3FSSA 2KCJA 3TW1A 3A8QA 4QJ4B 2EC1A 4DX8A 1EAZA 3NWDA 5DI9B 5D27A 1BY1A 2LOZA 3U7DA 1E5WA 2N0YA 2J59M 2UZSA 1WG7A 1XX0A 4PNKA 3SO6A 4HAXB 3HSAA 2DYNA 1FGYA 1UNPA 4GMXB 2M38A 2L2IA 3ODXA 1X05A 3GYPA 2MKRA 5FI0A 2YF0A 4HB2B 1BTKA 2D9YA 3ZVRA 2IYBA 3FEHA 2RLOA 3PZDA 3EO2A 4K2PA 3DXEA 2J0KA 5J3QA 3DXDA 2ZKMX 4B6HA 2HE7A 1KI1B 4WVFB 1UNRA 5CLLB 2YS3A 2R2YA 3VIAA 5J3TA 3FVCA 2L1CA 3PP2A 2W2XD 2DHIA 2CY5A 2MDXA 3PVUA 2R0DA 5HE0A 2P0FA 4WJ7A 2UZRA 5KCVA 1FHWA 4ZRKA 2VSZA 4H8SA 1U5FA 1RJ2A 2D9VA 5JLJB 1MPHA 2CY4A 1MKEA 3PVWA 4CHJA 4TYZA 2RVBB 3ULBA 1ZVRA 3F5RA 1FHXA 3WA0A 1P6SA 1ZC3B 2YSZA 4ZRJA 1U2BA 2DKPA 4DXAB 2EMSA 3MDBC 5FI1A 1J0WA 2M14A 2RGNB 5C79A 2UVMA 4L6EA 4YONA 1EGXA 3P7ZA 4GOUA 2YT2A 4KAXB 4HAYB 4OSNA 3ODOA 2Z59A 5CLQB 5JHHA 3ULCA 1ISNA 1V61A 1SHCA 4KHOA 2YT0A 2ZPYA 1J19A 2QKLA 3PVLA 2DTCA 1OMWA 1ZM0A 2DHJA 1DBHA 2KIEA 2Y7BA 1DDMA 2Z14A 3SV1A 4GPTB 3U12A 2G35A 2VKIA 1V88A 2DYQA 3HK0A 5EFXA 5JP4A 4K2OA 5JHGA 1KZ7A 3ODWA 2K00A 2Y8GA 2LG1A 2DX1A 3ML4A 4A6FA 3PSCA 1PMSA 3DCXA 4HATB 4DBBA 2N23A 2MWNB 1BAKA 1NU2A 3WYFB 1MIZB 2EJ8A 1ZYIA 3A98B 2AL6A 2D2QA 4ZRIA 4Y94A 2KUPA 2H7DA 2KIGA 2W2WA 1F5XA 1DDVA 5M4YB 2D9WA 4KHAA 1W1DA 2BCJA 2LOXA 5D3WA 3TO1A 2QKMA 2YVCA 5D3XA 1UPQA 1UEFA 3QIJA 3BINA 2Z4DA 1U5DA 5LONB 3GYOA 4F7GA 3T06A 5C5BB 1GG3A 3FM8C 3V5WA 2ADZA 1UPRA 4K81A 5DHAB 4K17A 2Z0PA 2FJUB 4A6FB 1BTNA 3OANA 5GOWB 1K5GB 2ROVA 3AU5A 4D6WA 2XQNM 5D3VA 3TCAA 3LJUX 1SGHA 4IOYX 1N3HA 5DHFB 1TXDA 4GXBA 2GCJA 1X86A 1DDWA 4HDOA 3KY9A 3PG7A 4A6HA 4HHVA 4NY0A 1LB1A 1NTYA 1I7AA 3A58A 1KZGA 2RNRB 3CIKA 5LG4B 3D8FA 1XR0B 4A5KA 1GC6A 3D8EA 1Y5OA 1OY2A 1DROA 3KRWA 1XD4A 2VRWB 1MK7B 2Z13A 1X1FA 3AU4A 2I5CA 2KR0A 2DHKA 1Z87A 2DFKA 1M7RA 4Z2MB 3M1IB 5I2SA 5IRSA 2NMBA 2YS1A 1AQCA 2DA0A 4QJ3B 3U8ZA 2H7EA 4HDQA 1PLSA 4KHBA 3O96A 5C5BA 3NWAA 3AJ4A 4GMVA 4P7IA 1T77A 2GCLA 2D9ZA 2Q13A 2OQBA 3TFMA 4GYVA 1U29A 4DX90 2YS5A 1EVHA 4L1RA 2CODA 5D3YA 2K2UA 5DIFB 3JV3A 1QQGA 2I1KA 3HIEA 4D0NB 1Q67A 1TJ6A 5C6RA 3GF9A 1Y19B 5LOPB 1MIXA 4IFSA 4MK0A 1FB8A 4F7UP 4CSQA 2COAA 2OTXA 1H10A 4MT7A 2I1JA 1V5UA 2P8VA 4TKNA 1EF1A 4HB3B 4QJ5B 1B55A 1FAOA 1QC6A 2DKQA 3ZDTA 3D8DA 2Z0OA 4KHBB 2DX5A 1PFJA 1NTVA 5DH9B 4Z2NA 3SNHA 4CHMA 4EJNA 2K49A 4HB0B 3SUZA 2GUMA 2J0MA 4YL8A 1V89A 1FOEA 4A6KA 1DYNA 1FGZA 2Y8FA 3KRXA 1X11A 1U5EA 4HAZB 5I2MA 1W1HA 1U27A 1WJ1A 2COCA 2J0JA 1I2HA 5HE1A 2RRFA 2KR9A 2CAYA 2LKOA 1P5TA 4F7HA 3PEGA 4WSFA 3CXBB 3TVVA 3SYXA 2K2JA 2COFA 3NW8A 4CYEA 4C0AA 3QBVB 4GN1A 2Z0QA 1NI2A 2E2XA 3N7CA 2KGXB 2JP2A 4GZUA 3F0WA 4IAPA 2IFSA 2NZ8B 2KUQA 2D11A 3QWMA 1WGUA 3DXCA 2CRFA 1RRPB 3NSUA 2YT1A 4HAUB 1BWNA 4OT1A 2V76A 1H4RA 3B77A 4QXAB 3G9WA 2RUKB 1AWEA 2D10A 1UNQA 4D0OA 4MY6A 2DN6A 4XWXA 2P0HA 2W2XC 1MI1A 4HB4B 1V5MA 1XKEA 4PQ0A 4GNKB 1P3RA 2MFQA 3UZTA 1FHOA 2X18A 3NWFA 5L81A 2FJLA 3OHMB 3MPXA 3P6AA
chains in the Genus database with same CATH topology
3RCPA 2D4QA 2RSGA 5KQ4A 5J3YA 3IVFA 1WI1A 2GS0A 1K5DB 1MAIA 2D9XA 3KSYA 2ROZB 4HAWB 3KZ1A 4EKUA 1V5PA 2HTHB 3A8PA 1U5GA 1WGQA 2LULA 2ELAA 2EMTA 1OQNA 2ELBA 1ZSQA 1ZC4B 1LW3A 3X23A 2LYDA 5HE3A 1X1GA 2I5FA 1TQZA 2PZ1A 1M7EA 5KQ1A 1WJMA 1W1GA 1WVHA 3HW2B 5C16A 4BBKA 1GC7A 2GJYA 3HQCA 4NSWA 2P0DA 4HAVB 1XCGA 4EMOA 2AEHA 4KVGB 3VOQA 1XODA 2YRYA 1MK9B 2R09A 3BJIA 5HE2A 2DLWA 1IRSA 3FSSA 2KCJA 3TW1A 3A8QA 2EC1A 4DX8A 1EAZA 5DI9B 5D27A 1BY1A 2LOZA 3U7DA 1E5WA 2N0YA 2J59M 2UZSA 1WG7A 1XX0A 4PNKA 3SO6A 4HAXB 2DYNA 1FGYA 1UNPA 4GMXB 2M38A 2L2IA 3ODXA 1X05A 3GYPA 2MKRA 5FI0A 2YF0A 4HB2B 1BTKA 2D9YA 3ZVRA 2IYBA 3FEHA 2RLOA 3PZDA 3EO2A 4K2PA 3DXEA 2J0KA 5J3QA 3DXDA 4B6HA 2HE7A 1KI1B 4WVFB 1UNRA 5CLLB 2YS3A 3VIAA 5J3TA 2L1CA 3PP2A 2W2XD 2DHIA 2CY5A 2MDXA 3PVUA 2R0DA 5HE0A 2P0FA 4WJ7A 2UZRA 5KCVA 1FHWA 4ZRKA 2VSZA 4H8SA 1U5FA 1RJ2A 2D9VA 5JLJB 1MPHA 2CY4A 1MKEA 3PVWA 4CHJA 4TYZA 2RVBB 3ULBA 1ZVRA 3F5RA 1FHXA 3WA0A 1P6SA 1ZC3B 2YSZA 4ZRJA 1U2BA 2DKPA 4DXAB 2EMSA 3MDBC 5FI1A 1J0WA 2M14A 2RGNB 5C79A 2UVMA 4L6EA 4YONA 1EGXA 3P7ZA 4GOUA 4KAXB 4HAYB 3ODOA 5CLQB 5JHHA 3ULCA 1ISNA 1V61A 1SHCA 4KHOA 2YT0A 2ZPYA 1J19A 2QKLA 3PVLA 2DTCA 1OMWA 1ZM0A 2DHJA 1DBHA 2Y7BA 1DDMA 3SV1A 4GPTB 2G35A 2VKIA 1V88A 2DYQA 3HK0A 5EFXA 5JP4A 4K2OA 5JHGA 1KZ7A 3ODWA 2K00A 2Y8GA 2LG1A 2DX1A 3ML4A 4A6FA 3PSCA 1PMSA 4HATB 4DBBA 2N23A 2MWNB 1BAKA 1NU2A 3WYFB 1MIZB 2EJ8A 3A98B 2AL6A 2D2QA 4ZRIA 4Y94A 2KUPA 2H7DA 2W2WA 1F5XA 1DDVA 2D9WA 4KHAA 1W1DA 2BCJA 2LOXA 5D3WA 3TO1A 2QKMA 2YVCA 5D3XA 1UPQA 1UEFA 3QIJA 3BINA 1U5DA 5LONB 3GYOA 4F7GA 3T06A 5C5BB 1GG3A 3FM8C 3V5WA 2ADZA 1UPRA 4K81A 5DHAB 4K17A 2Z0PA 4A6FB 1BTNA 3OANA 5GOWB 1K5GB 2ROVA 3AU5A 2XQNM 5D3VA 3TCAA 3LJUX 1SGHA 4IOYX 1N3HA 5DHFB 1TXDA 4GXBA 2GCJA 1X86A 1DDWA 4HDOA 3KY9A 3PG7A 4A6HA 4HHVA 4NY0A 1LB1A 1NTYA 1I7AA 1KZGA 2RNRB 3CIKA 3D8FA 1XR0B 4A5KA 1GC6A 3D8EA 1Y5OA 1OY2A 1DROA 3KRWA 1XD4A 2VRWB 1MK7B 1X1FA 3AU4A 2I5CA 2DHKA 1Z87A 2DFKA 1M7RA 4Z2MB 3M1IB 2NMBA 2YS1A 1AQCA 2DA0A 3U8ZA 2H7EA 4HDQA 1PLSA 3O96A 5C5BA 3AJ4A 4GMVA 4P7IA 2GCLA 2D9ZA 2Q13A 2OQBA 3TFMA 4GYVA 1U29A 4DX90 2YS5A 1EVHA 2CODA 5D3YA 2K2UA 5DIFB 3JV3A 1QQGA 2I1KA 4D0NB 1Q67A 1TJ6A 5C6RA 3GF9A 1Y19B 5LOPB 1MIXA 4IFSA 4MK0A 1FB8A 4F7UP 2COAA 2OTXA 1H10A 4MT7A 2I1JA 1V5UA 2P8VA 4TKNA 1EF1A 4HB3B 1B55A 1FAOA 1QC6A 2DKQA 3ZDTA 3D8DA 2Z0OA 4KHBB 2DX5A 1PFJA 1NTVA 5DH9B 4Z2NA 3SNHA 4CHMA 4EJNA 4HB0B 3SUZA 2J0MA 4YL8A 1V89A 1FOEA 4A6KA 1DYNA 1FGZA 2Y8FA 3KRXA 1X11A 1U5EA 4HAZB 1W1HA 1U27A 1WJ1A 2COCA 2J0JA 1I2HA 5HE1A 2KR9A 2CAYA 2LKOA 1P5TA 4F7HA 3PEGA 4WSFA 3CXBB 3TVVA 3SYXA 2K2JA 2COFA 4CYEA 4C0AA 3QBVB 4GN1A 2Z0QA 1NI2A 2E2XA 3N7CA 2KGXB 2JP2A 4GZUA 3F0WA 4IAPA 2IFSA 2NZ8B 2D11A 3QWMA 1WGUA 3DXCA 2CRFA 1RRPB 3NSUA 2YT1A 4HAUB 1BWNA 2V76A 1H4RA 3G9WA 2RUKB 1AWEA 2D10A 1UNQA 4D0OA 4MY6A 2DN6A 4XWXA 2P0HA 2W2XC 4HB4B 1V5MA 1XKEA 4PQ0A 1P3RA 2MFQA 3UZTA 1FHOA 2X18A 5L81A 2FJLA 3MPXA 3P6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCP A;  2D4Q A;  2RSG A;  5KQ4 A;  5J3Y A;  3IVF A;  1WI1 A;  2GS0 A;  1K5D B;  1MAI A;  2D9X A;  3KSY A;  2ROZ B;  4HAW B;  3KZ1 A;  4EKU A;  1V5P A;  2HTH B;  3A8P A;  1U5G A;  1WGQ A;  2LUL A;  2ELA A;  2EMT A;  1OQN A;  2ELB A;  1ZSQ A;  1ZC4 B;  1LW3 A;  3X23 A;  2LYD A;  5HE3 A;  1X1G A;  2I5F A;  1TQZ A;  2PZ1 A;  1M7E A;  5KQ1 A;  1WJM A;  1W1G A;  1WVH A;  3HW2 B;  5C16 A;  4BBK A;  1GC7 A;  2GJY A;  3HQC A;  4NSW A;  2P0D A;  4HAV B;  1XCG A;  4EMO A;  2AEH A;  4KVG B;  3VOQ A;  1XOD A;  2YRY A;  1MK9 B;  2R09 A;  3BJI A;  5HE2 A;  2DLW A;  1IRS A;  3FSS A;  2KCJ A;  3TW1 A;  3A8Q A;  2EC1 A;  4DX8 A;  1EAZ A;  5DI9 B;  5D27 A;  1BY1 A;  2LOZ A;  3U7D A;  1E5W A;  2N0Y A;  2J59 M;  2UZS A;  1WG7 A;  1XX0 A;  4PNK A;  3SO6 A;  4HAX B;  2DYN A;  1FGY A;  1UNP A;  4GMX B;  2M38 A;  2L2I A;  3ODX A;  1X05 A;  3GYP A;  2MKR A;  5FI0 A;  2YF0 A;  4HB2 B;  1BTK A;  2D9Y A;  3ZVR A;  2IYB A;  3FEH A;  2RLO A;  3PZD A;  3EO2 A;  4K2P A;  3DXE A;  2J0K A;  5J3Q A;  3DXD A;  4B6H A;  2HE7 A;  1KI1 B;  4WVF B;  1UNR A;  5CLL B;  2YS3 A;  3VIA A;  5J3T A;  2L1C A;  3PP2 A;  2W2X D;  2DHI A;  2CY5 A;  2MDX A;  3PVU A;  2R0D A;  5HE0 A;  2P0F A;  4WJ7 A;  2UZR A;  5KCV A;  1FHW A;  4ZRK A;  2VSZ A;  4H8S A;  1U5F A;  1RJ2 A;  2D9V A;  5JLJ B;  1MPH A;  2CY4 A;  1MKE A;  3PVW A;  4CHJ A;  4TYZ A;  2RVB B;  3ULB A;  1ZVR A;  3F5R A;  1FHX A;  3WA0 A;  1P6S A;  1ZC3 B;  2YSZ A;  4ZRJ A;  1U2B A;  2DKP A;  4DXA B;  2EMS A;  3MDB C;  5FI1 A;  1J0W A;  2M14 A;  2RGN B;  5C79 A;  2UVM A;  4L6E A;  4YON A;  1EGX A;  3P7Z A;  4GOU A;  4KAX B;  4HAY B;  3ODO A;  5CLQ B;  5JHH A;  3ULC A;  1ISN A;  1V61 A;  1SHC A;  4KHO A;  2YT0 A;  2ZPY A;  1J19 A;  2QKL A;  3PVL A;  2DTC A;  1OMW A;  1ZM0 A;  2DHJ A;  1DBH A;  2Y7B A;  1DDM A;  3SV1 A;  4GPT B;  2G35 A;  2VKI A;  1V88 A;  2DYQ A;  3HK0 A;  5EFX A;  5JP4 A;  4K2O A;  5JHG A;  1KZ7 A;  3ODW A;  2K00 A;  2Y8G A;  2LG1 A;  2DX1 A;  3ML4 A;  4A6F A;  3PSC A;  1PMS A;  4HAT B;  4DBB A;  2N23 A;  2MWN B;  1BAK A;  1NU2 A;  3WYF B;  1MIZ B;  2EJ8 A;  3A98 B;  2AL6 A;  2D2Q A;  4ZRI A;  4Y94 A;  2KUP A;  2H7D A;  2W2W A;  1F5X A;  1DDV A;  2D9W A;  4KHA A;  1W1D A;  2BCJ A;  2LOX A;  5D3W A;  3TO1 A;  2QKM A;  2YVC A;  5D3X A;  1UPQ A;  1UEF A;  3QIJ A;  3BIN A;  1U5D A;  5LON B;  3GYO A;  4F7G A;  3T06 A;  5C5B B;  1GG3 A;  3FM8 C;  3V5W A;  2ADZ A;  1UPR A;  4K81 A;  5DHA B;  4K17 A;  2Z0P A;  4A6F B;  1BTN A;  3OAN A;  5GOW B;  1K5G B;  2ROV A;  3AU5 A;  2XQN M;  5D3V A;  3TCA A;  3LJU X;  1SGH A;  4IOY X;  1N3H A;  5DHF B;  1TXD A;  4GXB A;  2GCJ A;  1X86 A;  1DDW A;  4HDO A;  3KY9 A;  3PG7 A;  4A6H A;  4HHV A;  4NY0 A;  1LB1 A;  1NTY A;  1I7A A;  1KZG A;  2RNR B;  3CIK A;  3D8F A;  1XR0 B;  4A5K A;  1GC6 A;  3D8E A;  1Y5O A;  1OY2 A;  1DRO A;  3KRW A;  1XD4 A;  2VRW B;  1MK7 B;  1X1F A;  3AU4 A;  2I5C A;  2DHK A;  1Z87 A;  2DFK A;  1M7R A;  4Z2M B;  3M1I B;  2NMB A;  2YS1 A;  1AQC A;  2DA0 A;  3U8Z A;  2H7E A;  4HDQ A;  1PLS A;  3O96 A;  5C5B A;  3AJ4 A;  4GMV A;  4P7I A;  2GCL A;  2D9Z A;  2Q13 A;  2OQB A;  3TFM A;  4GYV A;  1U29 A;  4DX9 0;  2YS5 A;  1EVH A;  2COD A;  5D3Y A;  2K2U A;  5DIF B;  3JV3 A;  1QQG A;  2I1K A;  4D0N B;  1Q67 A;  1TJ6 A;  5C6R A;  3GF9 A;  1Y19 B;  5LOP B;  1MIX A;  4IFS A;  4MK0 A;  1FB8 A;  4F7U P;  2COA A;  2OTX A;  1H10 A;  4MT7 A;  2I1J A;  1V5U A;  2P8V A;  4TKN A;  1EF1 A;  4HB3 B;  1B55 A;  1FAO A;  1QC6 A;  2DKQ A;  3ZDT A;  3D8D A;  2Z0O A;  4KHB B;  2DX5 A;  1PFJ A;  1NTV A;  5DH9 B;  4Z2N A;  3SNH A;  4CHM A;  4EJN A;  4HB0 B;  3SUZ A;  2J0M A;  4YL8 A;  1V89 A;  1FOE A;  4A6K A;  1DYN A;  1FGZ A;  2Y8F A;  3KRX A;  1X11 A;  1U5E A;  4HAZ B;  1W1H A;  1U27 A;  1WJ1 A;  2COC A;  2J0J A;  1I2H A;  5HE1 A;  2KR9 A;  2CAY A;  2LKO A;  1P5T A;  4F7H A;  3PEG A;  4WSF A;  3CXB B;  3TVV A;  3SYX A;  2K2J A;  2COF A;  4CYE A;  4C0A A;  3QBV B;  4GN1 A;  2Z0Q A;  1NI2 A;  2E2X A;  3N7C A;  2KGX B;  2JP2 A;  4GZU A;  3F0W A;  4IAP A;  2IFS A;  2NZ8 B;  2D11 A;  3QWM A;  1WGU A;  3DXC A;  2CRF A;  1RRP B;  3NSU A;  2YT1 A;  4HAU B;  1BWN A;  2V76 A;  1H4R A;  3G9W A;  2RUK B;  1AWE A;  2D10 A;  1UNQ A;  4D0O A;  4MY6 A;  2DN6 A;  4XWX A;  2P0H A;  2W2X C;  4HB4 B;  1V5M A;  1XKE A;  4PQ0 A;  1P3R A;  2MFQ A;  3UZT A;  1FHO A;  2X18 A;  5L81 A;  2FJL A;  3MPX A;  3P6A A; 
#chains in the Genus database with same CATH topology
 3RCP A;  2D4Q A;  2RSG A;  5KQ4 A;  5J3Y A;  3IVF A;  1WI1 A;  2GS0 A;  1K5D B;  1MAI A;  2D9X A;  3KSY A;  2ROZ B;  4HAW B;  3KZ1 A;  4EKU A;  1V5P A;  2HTH B;  3A8P A;  1U5G A;  1WGQ A;  2LUL A;  2ELA A;  2EMT A;  1OQN A;  2ELB A;  1ZSQ A;  1ZC4 B;  1LW3 A;  3X23 A;  2LYD A;  5HE3 A;  1X1G A;  4DIX A;  2I5F A;  1TQZ A;  2PZ1 A;  4HSI A;  1M7E A;  2K8E A;  5KQ1 A;  1WJM A;  1W1G A;  1WVH A;  3HW2 B;  5C16 A;  4BBK A;  1GC7 A;  2GJY A;  3HQC A;  4NSW A;  2P0D A;  4HAV B;  1XCG A;  4EMO A;  2AEH A;  4KVG B;  3VOQ A;  1XOD A;  2YRY A;  1MK9 B;  2NBV A;  2R09 A;  3BJI A;  5HE2 A;  2DLW A;  1IRS A;  3FSS A;  2KCJ A;  3TW1 A;  3A8Q A;  4QJ4 B;  2EC1 A;  4DX8 A;  1EAZ A;  3NWD A;  5DI9 B;  5D27 A;  1BY1 A;  2LOZ A;  3U7D A;  1E5W A;  2N0Y A;  2J59 M;  2UZS A;  1WG7 A;  1XX0 A;  4PNK A;  3SO6 A;  4HAX B;  3HSA A;  2DYN A;  1FGY A;  1UNP A;  4GMX B;  2M38 A;  2L2I A;  3ODX A;  1X05 A;  3GYP A;  2MKR A;  5FI0 A;  2YF0 A;  4HB2 B;  1BTK A;  2D9Y A;  3ZVR A;  2IYB A;  3FEH A;  2RLO A;  3PZD A;  3EO2 A;  4K2P A;  3DXE A;  2J0K A;  5J3Q A;  3DXD A;  2ZKM X;  4B6H A;  2HE7 A;  1KI1 B;  4WVF B;  1UNR A;  5CLL B;  2YS3 A;  2R2Y A;  3VIA A;  5J3T A;  3FVC A;  2L1C A;  3PP2 A;  2W2X D;  2DHI A;  2CY5 A;  2MDX A;  3PVU A;  2R0D A;  5HE0 A;  2P0F A;  4WJ7 A;  2UZR A;  5KCV A;  1FHW A;  4ZRK A;  2VSZ A;  4H8S A;  1U5F A;  1RJ2 A;  2D9V A;  5JLJ B;  1MPH A;  2CY4 A;  1MKE A;  3PVW A;  4CHJ A;  4TYZ A;  2RVB B;  3ULB A;  1ZVR A;  3F5R A;  1FHX A;  3WA0 A;  1P6S A;  1ZC3 B;  2YSZ A;  4ZRJ A;  1U2B A;  2DKP A;  4DXA B;  2EMS A;  3MDB C;  5FI1 A;  1J0W A;  2M14 A;  2RGN B;  5C79 A;  2UVM A;  4L6E A;  4YON A;  1EGX A;  3P7Z A;  4GOU A;  2YT2 A;  4KAX B;  4HAY B;  4OSN A;  3ODO A;  2Z59 A;  5CLQ B;  5JHH A;  3ULC A;  1ISN A;  1V61 A;  1SHC A;  4KHO A;  2YT0 A;  2ZPY A;  1J19 A;  2QKL A;  3PVL A;  2DTC A;  1OMW A;  1ZM0 A;  2DHJ A;  1DBH A;  2KIE A;  2Y7B A;  1DDM A;  2Z14 A;  3SV1 A;  4GPT B;  3U12 A;  2G35 A;  2VKI A;  1V88 A;  2DYQ A;  3HK0 A;  5EFX A;  5JP4 A;  4K2O A;  5JHG A;  1KZ7 A;  3ODW A;  2K00 A;  2Y8G A;  2LG1 A;  2DX1 A;  3ML4 A;  4A6F A;  3PSC A;  1PMS A;  3DCX A;  4HAT B;  4DBB A;  2N23 A;  2MWN B;  1BAK A;  1NU2 A;  3WYF B;  1MIZ B;  2EJ8 A;  1ZYI A;  3A98 B;  2AL6 A;  2D2Q A;  4ZRI A;  4Y94 A;  2KUP A;  2H7D A;  2KIG A;  2W2W A;  1F5X A;  1DDV A;  5M4Y B;  2D9W A;  4KHA A;  1W1D A;  2BCJ A;  2LOX A;  5D3W A;  3TO1 A;  2QKM A;  2YVC A;  5D3X A;  1UPQ A;  1UEF A;  3QIJ A;  3BIN A;  2Z4D A;  1U5D A;  5LON B;  3GYO A;  4F7G A;  3T06 A;  5C5B B;  1GG3 A;  3FM8 C;  3V5W A;  2ADZ A;  1UPR A;  4K81 A;  5DHA B;  4K17 A;  2Z0P A;  2FJU B;  4A6F B;  1BTN A;  3OAN A;  5GOW B;  1K5G B;  2ROV A;  3AU5 A;  4D6W A;  2XQN M;  5D3V A;  3TCA A;  3LJU X;  1SGH A;  4IOY X;  1N3H A;  5DHF B;  1TXD A;  4GXB A;  2GCJ A;  1X86 A;  1DDW A;  4HDO A;  3KY9 A;  3PG7 A;  4A6H A;  4HHV A;  4NY0 A;  1LB1 A;  1NTY A;  1I7A A;  3A58 A;  1KZG A;  2RNR B;  3CIK A;  5LG4 B;  3D8F A;  1XR0 B;  4A5K A;  1GC6 A;  3D8E A;  1Y5O A;  1OY2 A;  1DRO A;  3KRW A;  1XD4 A;  2VRW B;  1MK7 B;  2Z13 A;  1X1F A;  3AU4 A;  2I5C A;  2KR0 A;  2DHK A;  1Z87 A;  2DFK A;  1M7R A;  4Z2M B;  3M1I B;  5I2S A;  5IRS A;  2NMB A;  2YS1 A;  1AQC A;  2DA0 A;  4QJ3 B;  3U8Z A;  2H7E A;  4HDQ A;  1PLS A;  4KHB A;  3O96 A;  5C5B A;  3NWA A;  3AJ4 A;  4GMV A;  4P7I A;  1T77 A;  2GCL A;  2D9Z A;  2Q13 A;  2OQB A;  3TFM A;  4GYV A;  1U29 A;  4DX9 0;  2YS5 A;  1EVH A;  4L1R A;  2COD A;  5D3Y A;  2K2U A;  5DIF B;  3JV3 A;  1QQG A;  2I1K A;  3HIE A;  4D0N B;  1Q67 A;  1TJ6 A;  5C6R A;  3GF9 A;  1Y19 B;  5LOP B;  1MIX A;  4IFS A;  4MK0 A;  1FB8 A;  4F7U P;  4CSQ A;  2COA A;  2OTX A;  1H10 A;  4MT7 A;  2I1J A;  1V5U A;  2P8V A;  4TKN A;  1EF1 A;  4HB3 B;  4QJ5 B;  1B55 A;  1FAO A;  1QC6 A;  2DKQ A;  3ZDT A;  3D8D A;  2Z0O A;  4KHB B;  2DX5 A;  1PFJ A;  1NTV A;  5DH9 B;  4Z2N A;  3SNH A;  4CHM A;  4EJN A;  2K49 A;  4HB0 B;  3SUZ A;  2GUM A;  2J0M A;  4YL8 A;  1V89 A;  1FOE A;  4A6K A;  1DYN A;  1FGZ A;  2Y8F A;  3KRX A;  1X11 A;  1U5E A;  4HAZ B;  5I2M A;  1W1H A;  1U27 A;  1WJ1 A;  2COC A;  2J0J A;  1I2H A;  5HE1 A;  2RRF A;  2KR9 A;  2CAY A;  2LKO A;  1P5T A;  4F7H A;  3PEG A;  4WSF A;  3CXB B;  3TVV A;  3SYX A;  2K2J A;  2COF A;  3NW8 A;  4CYE A;  4C0A A;  3QBV B;  4GN1 A;  2Z0Q A;  1NI2 A;  2E2X A;  3N7C A;  2KGX B;  2JP2 A;  4GZU A;  3F0W A;  4IAP A;  2IFS A;  2NZ8 B;  2KUQ A;  2D11 A;  3QWM A;  1WGU A;  3DXC A;  2CRF A;  1RRP B;  3NSU A;  2YT1 A;  4HAU B;  1BWN A;  4OT1 A;  2V76 A;  1H4R A;  3B77 A;  4QXA B;  3G9W A;  2RUK B;  1AWE A;  2D10 A;  1UNQ A;  4D0O A;  4MY6 A;  2DN6 A;  4XWX A;  2P0H A;  2W2X C;  1MI1 A;  4HB4 B;  1V5M A;  1XKE A;  4PQ0 A;  4GNK B;  1P3R A;  2MFQ A;  3UZT A;  1FHO A;  2X18 A;  3NWF A;  5L81 A;  2FJL A;  3OHM B;  3MPX A;  3P6A A; 
#chains in the Genus database with same CATH homology
 3RCP A;  2D4Q A;  2RSG A;  5KQ4 A;  5J3Y A;  3IVF A;  1WI1 A;  2GS0 A;  1K5D B;  1MAI A;  2D9X A;  3KSY A;  2ROZ B;  4HAW B;  3KZ1 A;  4EKU A;  1V5P A;  2HTH B;  3A8P A;  1U5G A;  1WGQ A;  2LUL A;  2ELA A;  2EMT A;  1OQN A;  2ELB A;  1ZSQ A;  1ZC4 B;  1LW3 A;  3X23 A;  2LYD A;  5HE3 A;  1X1G A;  2I5F A;  1TQZ A;  2PZ1 A;  1M7E A;  5KQ1 A;  1WJM A;  1W1G A;  1WVH A;  3HW2 B;  5C16 A;  4BBK A;  1GC7 A;  2GJY A;  3HQC A;  4NSW A;  2P0D A;  4HAV B;  1XCG A;  4EMO A;  2AEH A;  4KVG B;  3VOQ A;  1XOD A;  2YRY A;  1MK9 B;  2R09 A;  3BJI A;  5HE2 A;  2DLW A;  1IRS A;  3FSS A;  2KCJ A;  3TW1 A;  3A8Q A;  2EC1 A;  4DX8 A;  1EAZ A;  5DI9 B;  5D27 A;  1BY1 A;  2LOZ A;  3U7D A;  1E5W A;  2N0Y A;  2J59 M;  2UZS A;  1WG7 A;  1XX0 A;  4PNK A;  3SO6 A;  4HAX B;  2DYN A;  1FGY A;  1UNP A;  4GMX B;  2M38 A;  2L2I A;  3ODX A;  1X05 A;  3GYP A;  2MKR A;  5FI0 A;  2YF0 A;  4HB2 B;  1BTK A;  2D9Y A;  3ZVR A;  2IYB A;  3FEH A;  2RLO A;  3PZD A;  3EO2 A;  4K2P A;  3DXE A;  2J0K A;  5J3Q A;  3DXD A;  4B6H A;  2HE7 A;  1KI1 B;  4WVF B;  1UNR A;  5CLL B;  2YS3 A;  3VIA A;  5J3T A;  2L1C A;  3PP2 A;  2W2X D;  2DHI A;  2CY5 A;  2MDX A;  3PVU A;  2R0D A;  5HE0 A;  2P0F A;  4WJ7 A;  2UZR A;  5KCV A;  1FHW A;  4ZRK A;  2VSZ A;  4H8S A;  1U5F A;  1RJ2 A;  2D9V A;  5JLJ B;  1MPH A;  2CY4 A;  1MKE A;  3PVW A;  4CHJ A;  4TYZ A;  2RVB B;  3ULB A;  1ZVR A;  3F5R A;  1FHX A;  3WA0 A;  1P6S A;  1ZC3 B;  2YSZ A;  4ZRJ A;  1U2B A;  2DKP A;  4DXA B;  2EMS A;  3MDB C;  5FI1 A;  1J0W A;  2M14 A;  2RGN B;  5C79 A;  2UVM A;  4L6E A;  4YON A;  1EGX A;  3P7Z A;  4GOU A;  4KAX B;  4HAY B;  3ODO A;  5CLQ B;  5JHH A;  3ULC A;  1ISN A;  1V61 A;  1SHC A;  4KHO A;  2YT0 A;  2ZPY A;  1J19 A;  2QKL A;  3PVL A;  2DTC A;  1OMW A;  1ZM0 A;  2DHJ A;  1DBH A;  2Y7B A;  1DDM A;  3SV1 A;  4GPT B;  2G35 A;  2VKI A;  1V88 A;  2DYQ A;  3HK0 A;  5EFX A;  5JP4 A;  4K2O A;  5JHG A;  1KZ7 A;  3ODW A;  2K00 A;  2Y8G A;  2LG1 A;  2DX1 A;  3ML4 A;  4A6F A;  3PSC A;  1PMS A;  4HAT B;  4DBB A;  2N23 A;  2MWN B;  1BAK A;  1NU2 A;  3WYF B;  1MIZ B;  2EJ8 A;  3A98 B;  2AL6 A;  2D2Q A;  4ZRI A;  4Y94 A;  2KUP A;  2H7D A;  2W2W A;  1F5X A;  1DDV A;  2D9W A;  4KHA A;  1W1D A;  2BCJ A;  2LOX A;  5D3W A;  3TO1 A;  2QKM A;  2YVC A;  5D3X A;  1UPQ A;  1UEF A;  3QIJ A;  3BIN A;  1U5D A;  5LON B;  3GYO A;  4F7G A;  3T06 A;  5C5B B;  1GG3 A;  3FM8 C;  3V5W A;  2ADZ A;  1UPR A;  4K81 A;  5DHA B;  4K17 A;  2Z0P A;  4A6F B;  1BTN A;  3OAN A;  5GOW B;  1K5G B;  2ROV A;  3AU5 A;  2XQN M;  5D3V A;  3TCA A;  3LJU X;  1SGH A;  4IOY X;  1N3H A;  5DHF B;  1TXD A;  4GXB A;  2GCJ A;  1X86 A;  1DDW A;  4HDO A;  3KY9 A;  3PG7 A;  4A6H A;  4HHV A;  4NY0 A;  1LB1 A;  1NTY A;  1I7A A;  1KZG A;  2RNR B;  3CIK A;  3D8F A;  1XR0 B;  4A5K A;  1GC6 A;  3D8E A;  1Y5O A;  1OY2 A;  1DRO A;  3KRW A;  1XD4 A;  2VRW B;  1MK7 B;  1X1F A;  3AU4 A;  2I5C A;  2DHK A;  1Z87 A;  2DFK A;  1M7R A;  4Z2M B;  3M1I B;  2NMB A;  2YS1 A;  1AQC A;  2DA0 A;  3U8Z A;  2H7E A;  4HDQ A;  1PLS A;  3O96 A;  5C5B A;  3AJ4 A;  4GMV A;  4P7I A;  2GCL A;  2D9Z A;  2Q13 A;  2OQB A;  3TFM A;  4GYV A;  1U29 A;  4DX9 0;  2YS5 A;  1EVH A;  2COD A;  5D3Y A;  2K2U A;  5DIF B;  3JV3 A;  1QQG A;  2I1K A;  4D0N B;  1Q67 A;  1TJ6 A;  5C6R A;  3GF9 A;  1Y19 B;  5LOP B;  1MIX A;  4IFS A;  4MK0 A;  1FB8 A;  4F7U P;  2COA A;  2OTX A;  1H10 A;  4MT7 A;  2I1J A;  1V5U A;  2P8V A;  4TKN A;  1EF1 A;  4HB3 B;  1B55 A;  1FAO A;  1QC6 A;  2DKQ A;  3ZDT A;  3D8D A;  2Z0O A;  4KHB B;  2DX5 A;  1PFJ A;  1NTV A;  5DH9 B;  4Z2N A;  3SNH A;  4CHM A;  4EJN A;  4HB0 B;  3SUZ A;  2J0M A;  4YL8 A;  1V89 A;  1FOE A;  4A6K A;  1DYN A;  1FGZ A;  2Y8F A;  3KRX A;  1X11 A;  1U5E A;  4HAZ B;  1W1H A;  1U27 A;  1WJ1 A;  2COC A;  2J0J A;  1I2H A;  5HE1 A;  2KR9 A;  2CAY A;  2LKO A;  1P5T A;  4F7H A;  3PEG A;  4WSF A;  3CXB B;  3TVV A;  3SYX A;  2K2J A;  2COF A;  4CYE A;  4C0A A;  3QBV B;  4GN1 A;  2Z0Q A;  1NI2 A;  2E2X A;  3N7C A;  2KGX B;  2JP2 A;  4GZU A;  3F0W A;  4IAP A;  2IFS A;  2NZ8 B;  2D11 A;  3QWM A;  1WGU A;  3DXC A;  2CRF A;  1RRP B;  3NSU A;  2YT1 A;  4HAU B;  1BWN A;  2V76 A;  1H4R A;  3G9W A;  2RUK B;  1AWE A;  2D10 A;  1UNQ A;  4D0O A;  4MY6 A;  2DN6 A;  4XWX A;  2P0H A;  2W2X C;  4HB4 B;  1V5M A;  1XKE A;  4PQ0 A;  1P3R A;  2MFQ A;  3UZT A;  1FHO A;  2X18 A;  5L81 A;  2FJL A;  3MPX A;  3P6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...