1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system/signaling protein
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
3F5RA 3A8QA 1U5DA 2MKRA 4KHBB 5JLJB 4D0NB 4WVFB 2DHJA 1RJ2A 2LULA 1BTNA 4BBKA 5HE2A 2GJYA 4KHAA 2M14A 1P6SA 2UZSA 2FJLA 1Y5OA 1Q67A 2GS0A 1TXDA 1GC7A 2YF0A 2P0DA 2R0DA 5HE0A 1K5DB 1V5PA 5C5BB 3DXDA 2Y8GA 1H4RA 5DHFB 2HTHB 4DBBA 5D3XA 1GC6A 2D11A 5DH9B 4IOYX 3TFMA 1SGHA 2R09A 1UPQA 1FAOA 1Z87A 4A6HA 1P5TA 1DROA 2KGXB 4A6FA 4IAPA 2K2JA 2Z0OA 1I2HA 5JHGA 2DTCA 3VOQA 2D9WA 5J3QA 2PZ1A 1PFJA 2DLWA 3MDBC 4MT7A 3LJUX 3AU4A 1U29A 4GXBA 3ULCA 5C6RA 1NU2A 2CODA 3BINA 3PVWA 4GPTB 4A6FB 2KUPA 1LB1A 1ZC3B 1OQNA 3N7CA 3TVVA 1BAKA 3KZ1A 2H7DA 3HK0A 1PMSA 3PZDA 4HAUB 1PLSA 1FHXA 1U27A 1TJ6A 2Q13A 1H10A 1XCGA 2YRYA 1Y19B 2Y7BA 4WSFA 2ELBA 4TYZA 1U5EA 5C16A 3ODOA 1DBHA 3AJ4A 5J3TA 2DYQA 1X05A 1V89A 3FEHA 2LOZA 1X1FA 4KAXB 1KZGA 2ROZB 1AWEA 1OMWA 4HB0B 2UZRA 1AQCA 3VIAA 4GZUA 3SYXA 2G35A 2M38A 2OQBA 3SO6A 1UPRA 2N23A 3F0WA 4K17A 4PNKA 3U7DA 2HE7A 2LKOA 1B55A 2ELAA 2DN6A 1BY1A 4YL8A 2I1KA 2GCLA 2RLOA 3QWMA 4C0AA 1KZ7A 4F7GA 4NY0A 4XWXA 4K2PA 3TCAA 1W1GA 4HAZB 3KSYA 3WA0A 1MIXA 2AL6A 2COFA 2RVBB 3CIKA 3TO1A 3UZTA 2VSZA 5D3VA 5DIFB 2LYDA 1X86A 1EAZA 3ODXA 2Z0PA 1X11A 2COAA 4KHOA 2L1CA 2AEHA 4P7IA 5J3YA 1NTVA 1W1DA 1E5WA 1U2BA 3GYPA 4H8SA 1LW3A 1M7EA 3ML4A 4HAYB 2J59M 3HW2B 4MK0A 4IFSA 4Z2MB 1QC6A 1KI1B 1FGZA 1WI1A 4HB4B 2J0KA 2MFQA 4K81A 4PQ0A 3DXEA 1J0WA 2DX5A 5JHHA 1WGQA 1WGUA 2DX1A 4A5KA 2CY4A 1ZC4B 4ZRIA 4HDOA 3EO2A 3U8ZA 1NI2A 4GN1A 1WG7A 2RNRB 2BCJA 2VKIA 2VRWB 2D10A 2MWNB 5DI9B 4MY6A 2J0JA 1EVHA 1MAIA 3KY9A 2DFKA 1WJ1A 3WYFB 1MK7B 3QBVB 2W2WA 1EF1A 1XD4A 1V5UA 2N0YA 3SV1A 3DXCA 1MPHA 1UEFA 1UNRA 1W1HA 1EGXA 2D9VA 2RGNB 2MDXA 4TKNA 2P8VA 4L6EA 1ZVRA 5HE3A 3D8FA 2XQNM 2DYNA 4B6HA 3ZVRA 1XX0A 1M7RA 2EMTA 1FOEA 2D9XA 1GG3A 1MIZB 3ZDTA 2DHKA 2P0HA 2QKLA 5HE1A 2CRFA 4EJNA 2ROVA 3P6AA 2I5CA 2NZ8B 3AU5A 3M1IB 4ZRKA 4DX8A 5CLLB 1U5GA 3SUZA 4EKUA 1XODA 4D0OA 3ODWA 3PP2A 3V5WA 2IFSA 3PVUA 4F7HA 3MPXA 2JP2A 2DKPA 3G9WA 1J19A 2YS5A 5C5BA 5LOPB 4A6KA 2D4QA 2LOXA 3D8EA 3O96A 2Z0QA 3NSUA 2UVMA 1K5GB 1N3HA 3HQCA 1V88A 5DHAB 1DDVA 4HAXB 1V61A 4HHVA 5JP4A 2DKQA 1RRPB 3PVLA 4GYVA 2Y8FA 5CLQB 1ZSQA 2I1JA 3FSSA 3KRXA 1P3RA 2GCJA 2QKMA 2ZPYA 2D9ZA 2NMBA 2OTXA 2YS3A 3ULBA 1IRSA 4HAWB 1F5XA 3CXBB 4HDQA 4DXAB 3PSCA 5D27A 1DYNA 2LG1A 5KQ1A 2I5FA 4WJ7A 2IYBA 2H7EA 2CY5A 3RCPA 3PG7A 4KVGB 3BJIA 4HB3B 4Z2NA 5LONB 2D9YA 1FHOA 3P7ZA 1FGYA 3TW1A 2RSGA 5KCVA 1BTKA 1V5MA 3KRWA 2YT0A 2YS1A 5L81A 3A8PA 4CYEA 2RUKB 5FI1A 1ISNA 1DDMA 1NTYA 2E2XA 2X18A 3D8DA 1DDWA 5EFXA 1QQGA 1UNQA 1ZM0A 4HB2B 4NSWA 1WVHA 1TQZA 2EMSA 2EC1A 3GF9A 1XR0B 4GOUA 1MKEA 4CHMA 4DX90 4Y94A 2YVCA 3OANA 1UNPA 5GOWB 1SHCA 4HATB 1I7AA 1WJMA 1FB8A 4HAVB 5FI0A 2CAYA 3QIJA 1FHWA 1MK9B 3IVFA 2D2QA 2V76A 2EJ8A 2W2XD 4ZRJA 4EMOA 3T06A 2ADZA 4YONA 2DA0A 3FM8C 3PEGA 1XKEA 4GMXB 3GYOA 5D3WA 2KCJA 4GMVA 5KQ4A 2K2UA 2KR9A 1OY2A 2L2IA 2P0FA 5D3YA 5C79A 1X1GA 4F7UP 3X23A 2COCA 3A98B 2J0MA 3SNHA 2W2XC 2K00A 4K2OA 1U5FA 2YT1A 3JV3A 2YSZA 4CHJA 1BWNA 2DHIA
chains in the Genus database with same CATH superfamily
3F5RA 3A8QA 1U5DA 2MKRA 4KHBB 5JLJB 4D0NB 4WVFB 2DHJA 1RJ2A 2LULA 1BTNA 4BBKA 5HE2A 2GJYA 4KHAA 2M14A 1P6SA 2UZSA 2FJLA 1Y5OA 1Q67A 2GS0A 1TXDA 1GC7A 2YF0A 2P0DA 2R0DA 5HE0A 1K5DB 1V5PA 5C5BB 2K8EA 3DXDA 3DCXA 2Y8GA 2Z59A 1H4RA 5DHFB 2HTHB 4DBBA 5D3XA 1GC6A 2D11A 5DH9B 4IOYX 3TFMA 1SGHA 2R09A 1UPQA 1FAOA 1Z87A 4A6HA 1P5TA 1DROA 2KGXB 4A6FA 4IAPA 2KIGA 2K2JA 2Z0OA 1I2HA 5JHGA 2DTCA 3VOQA 2D9WA 5J3QA 2PZ1A 1PFJA 2DLWA 3MDBC 4MT7A 3LJUX 3AU4A 1U29A 4GXBA 3ULCA 5C6RA 1NU2A 2CODA 3BINA 3NWAA 3PVWA 4GPTB 4A6FB 2KUPA 1LB1A 1ZC3B 1OQNA 3N7CA 3TVVA 1BAKA 3KZ1A 2H7DA 2ZKMX 3HK0A 1PMSA 3PZDA 4HAUB 1PLSA 1FHXA 1U27A 1TJ6A 2Q13A 1H10A 1XCGA 2YRYA 1Y19B 2Y7BA 4WSFA 2ELBA 4TYZA 1U5EA 2FJUB 5C16A 3ODOA 1DBHA 3AJ4A 5J3TA 2DYQA 1X05A 1V89A 4CSQA 3FEHA 2LOZA 1X1FA 4KAXB 1KZGA 2ROZB 1AWEA 1OMWA 4HB0B 2UZRA 1AQCA 3VIAA 4GZUA 3SYXA 2G35A 2M38A 2OQBA 3SO6A 1UPRA 2N23A 3F0WA 4K17A 4PNKA 3U7DA 2HE7A 2LKOA 4HSIA 1B55A 2ELAA 2DN6A 1BY1A 4YL8A 2I1KA 2GCLA 2RLOA 3QWMA 3NW8A 4C0AA 4DIXA 1KZ7A 4F7GA 4NY0A 4XWXA 4K2PA 3TCAA 1W1GA 4HAZB 3KSYA 3B77A 3WA0A 5I2SA 1MIXA 2AL6A 2COFA 2RVBB 3CIKA 3TO1A 3UZTA 2VSZA 5D3VA 5DIFB 2GUMA 2LYDA 1X86A 1EAZA 3ODXA 2Z0PA 1X11A 2COAA 4KHOA 2L1CA 2AEHA 4P7IA 5J3YA 1NTVA 1W1DA 1E5WA 1U2BA 3GYPA 4H8SA 1LW3A 1M7EA 3FVCA 3ML4A 4HAYB 2J59M 3HW2B 4MK0A 4IFSA 4Z2MB 4QJ4B 1QC6A 1KI1B 1FGZA 5I2MA 1WI1A 4HB4B 2J0KA 2MFQA 4K81A 4PQ0A 3DXEA 1J0WA 2DX5A 5JHHA 1WGQA 1WGUA 3U12A 2DX1A 4A5KA 2CY4A 1ZC4B 2KR0A 4ZRIA 4HDOA 3EO2A 3U8ZA 1NI2A 3OHMB 4GN1A 1WG7A 2RNRB 2BCJA 2VKIA 2VRWB 2D10A 2MWNB 5DI9B 4MY6A 2J0JA 1EVHA 5M4YB 1MAIA 3KY9A 2DFKA 2KIEA 1WJ1A 3WYFB 1MK7B 3QBVB 2W2WA 1EF1A 1XD4A 1V5UA 2N0YA 3SV1A 3DXCA 1MPHA 1UEFA 1UNRA 1W1HA 1EGXA 2D9VA 2RGNB 2MDXA 4TKNA 2P8VA 4L6EA 1ZVRA 5HE3A 2R2YA 3D8FA 2XQNM 2DYNA 3NWFA 4B6HA 3ZVRA 1XX0A 1M7RA 2YT2A 2EMTA 1FOEA 2D9XA 1GG3A 1MIZB 3ZDTA 2DHKA 2P0HA 2QKLA 5HE1A 2Z14A 2CRFA 4QJ5B 4EJNA 2ROVA 3P6AA 2I5CA 2NZ8B 3AU5A 2KUQA 3M1IB 4ZRKA 4DX8A 5CLLB 2Z4DA 1U5GA 3SUZA 3A58A 4EKUA 1XODA 4D0OA 3ODWA 3PP2A 3V5WA 2IFSA 3PVUA 4F7HA 3MPXA 2JP2A 2DKPA 3G9WA 1J19A 2YS5A 5C5BA 5LOPB 4A6KA 2D4QA 2LOXA 3D8EA 3O96A 2Z0QA 3NSUA 2UVMA 1K5GB 1N3HA 2NBVA 3HQCA 1V88A 3HSAA 5DHAB 1DDVA 4HAXB 1MI1A 1V61A 4HHVA 5JP4A 2DKQA 1RRPB 3PVLA 4GYVA 2Y8FA 5CLQB 1ZSQA 2I1JA 3FSSA 3KRXA 1T77A 1P3RA 2GCJA 2QKMA 2ZPYA 2D9ZA 2NMBA 2OTXA 2YS3A 3ULBA 1IRSA 4HAWB 4QJ3B 1F5XA 3CXBB 4HDQA 4DXAB 3PSCA 5D27A 1DYNA 2Z13A 2LG1A 5KQ1A 2I5FA 4WJ7A 2IYBA 2H7EA 2CY5A 1ZYIA 3RCPA 3PG7A 4KVGB 3BJIA 4HB3B 4Z2NA 5LONB 2D9YA 1FHOA 3P7ZA 4QXAB 1FGYA 3TW1A 2RSGA 5KCVA 1BTKA 4GNKB 1V5MA 3KRWA 2YT0A 2YS1A 5L81A 4OT1A 3A8PA 4OSNA 4CYEA 2RUKB 5FI1A 1ISNA 1DDMA 1NTYA 2E2XA 2X18A 3D8DA 3HIEA 1DDWA 5EFXA 1QQGA 1UNQA 1ZM0A 4HB2B 4NSWA 1WVHA 1TQZA 2EMSA 2EC1A 3NWDA 3GF9A 1XR0B 4GOUA 1MKEA 4CHMA 4DX90 4Y94A 2YVCA 3OANA 1UNPA 5GOWB 1SHCA 4HATB 1I7AA 4L1RA 1WJMA 1FB8A 4HAVB 5FI0A 2CAYA 3QIJA 1FHWA 1MK9B 2K49A 3IVFA 2D2QA 2V76A 2EJ8A 2W2XD 4ZRJA 4EMOA 3T06A 2RRFA 4KHBA 2ADZA 4YONA 2DA0A 3FM8C 3PEGA 1XKEA 4GMXB 3GYOA 5D3WA 2KCJA 4GMVA 5KQ4A 2K2UA 2KR9A 1OY2A 2L2IA 2P0FA 5D3YA 5C79A 1X1GA 4F7UP 3X23A 2COCA 3A98B 4D6WA 5LG4B 2J0MA 3SNHA 2W2XC 2K00A 4K2OA 1U5FA 5IRSA 2YT1A 3JV3A 2YSZA 4CHJA 1BWNA 2DHIA
chains in the Genus database with same CATH topology
3F5RA 3A8QA 1U5DA 2MKRA 4KHBB 5JLJB 4D0NB 4WVFB 2DHJA 1RJ2A 2LULA 1BTNA 4BBKA 5HE2A 2GJYA 4KHAA 2M14A 1P6SA 2UZSA 2FJLA 1Y5OA 1Q67A 2GS0A 1TXDA 1GC7A 2YF0A 2P0DA 2R0DA 5HE0A 1K5DB 1V5PA 5C5BB 3DXDA 2Y8GA 1H4RA 5DHFB 2HTHB 4DBBA 5D3XA 1GC6A 2D11A 5DH9B 4IOYX 3TFMA 1SGHA 2R09A 1UPQA 1FAOA 1Z87A 4A6HA 1P5TA 1DROA 2KGXB 4A6FA 4IAPA 2K2JA 2Z0OA 1I2HA 5JHGA 2DTCA 3VOQA 2D9WA 5J3QA 2PZ1A 1PFJA 2DLWA 3MDBC 4MT7A 3LJUX 3AU4A 1U29A 4GXBA 3ULCA 5C6RA 1NU2A 2CODA 3BINA 3PVWA 4GPTB 4A6FB 2KUPA 1LB1A 1ZC3B 1OQNA 3N7CA 3TVVA 1BAKA 3KZ1A 2H7DA 3HK0A 1PMSA 3PZDA 4HAUB 1PLSA 1FHXA 1U27A 1TJ6A 2Q13A 1H10A 1XCGA 2YRYA 1Y19B 2Y7BA 4WSFA 2ELBA 4TYZA 1U5EA 5C16A 3ODOA 1DBHA 3AJ4A 5J3TA 2DYQA 1X05A 1V89A 3FEHA 2LOZA 1X1FA 4KAXB 1KZGA 2ROZB 1AWEA 1OMWA 4HB0B 2UZRA 1AQCA 3VIAA 4GZUA 3SYXA 2G35A 2M38A 2OQBA 3SO6A 1UPRA 2N23A 3F0WA 4K17A 4PNKA 3U7DA 2HE7A 2LKOA 1B55A 2ELAA 2DN6A 1BY1A 4YL8A 2I1KA 2GCLA 2RLOA 3QWMA 4C0AA 1KZ7A 4F7GA 4NY0A 4XWXA 4K2PA 3TCAA 1W1GA 4HAZB 3KSYA 3WA0A 1MIXA 2AL6A 2COFA 2RVBB 3CIKA 3TO1A 3UZTA 2VSZA 5D3VA 5DIFB 2LYDA 1X86A 1EAZA 3ODXA 2Z0PA 1X11A 2COAA 4KHOA 2L1CA 2AEHA 4P7IA 5J3YA 1NTVA 1W1DA 1E5WA 1U2BA 3GYPA 4H8SA 1LW3A 1M7EA 3ML4A 4HAYB 2J59M 3HW2B 4MK0A 4IFSA 4Z2MB 1QC6A 1KI1B 1FGZA 1WI1A 4HB4B 2J0KA 2MFQA 4K81A 4PQ0A 3DXEA 1J0WA 2DX5A 5JHHA 1WGQA 1WGUA 2DX1A 4A5KA 2CY4A 1ZC4B 4ZRIA 4HDOA 3EO2A 3U8ZA 1NI2A 4GN1A 1WG7A 2RNRB 2BCJA 2VKIA 2VRWB 2D10A 2MWNB 5DI9B 4MY6A 2J0JA 1EVHA 1MAIA 3KY9A 2DFKA 1WJ1A 3WYFB 1MK7B 3QBVB 2W2WA 1EF1A 1XD4A 1V5UA 2N0YA 3SV1A 3DXCA 1MPHA 1UEFA 1UNRA 1W1HA 1EGXA 2D9VA 2RGNB 2MDXA 4TKNA 2P8VA 4L6EA 1ZVRA 5HE3A 3D8FA 2XQNM 2DYNA 4B6HA 3ZVRA 1XX0A 1M7RA 2EMTA 1FOEA 2D9XA 1GG3A 1MIZB 3ZDTA 2DHKA 2P0HA 2QKLA 5HE1A 2CRFA 4EJNA 2ROVA 3P6AA 2I5CA 2NZ8B 3AU5A 3M1IB 4ZRKA 4DX8A 5CLLB 1U5GA 3SUZA 4EKUA 1XODA 4D0OA 3ODWA 3PP2A 3V5WA 2IFSA 3PVUA 4F7HA 3MPXA 2JP2A 2DKPA 3G9WA 1J19A 2YS5A 5C5BA 5LOPB 4A6KA 2D4QA 2LOXA 3D8EA 3O96A 2Z0QA 3NSUA 2UVMA 1K5GB 1N3HA 3HQCA 1V88A 5DHAB 1DDVA 4HAXB 1V61A 4HHVA 5JP4A 2DKQA 1RRPB 3PVLA 4GYVA 2Y8FA 5CLQB 1ZSQA 2I1JA 3FSSA 3KRXA 1P3RA 2GCJA 2QKMA 2ZPYA 2D9ZA 2NMBA 2OTXA 2YS3A 3ULBA 1IRSA 4HAWB 1F5XA 3CXBB 4HDQA 4DXAB 3PSCA 5D27A 1DYNA 2LG1A 5KQ1A 2I5FA 4WJ7A 2IYBA 2H7EA 2CY5A 3RCPA 3PG7A 4KVGB 3BJIA 4HB3B 4Z2NA 5LONB 2D9YA 1FHOA 3P7ZA 1FGYA 3TW1A 2RSGA 5KCVA 1BTKA 1V5MA 3KRWA 2YT0A 2YS1A 5L81A 3A8PA 4CYEA 2RUKB 5FI1A 1ISNA 1DDMA 1NTYA 2E2XA 2X18A 3D8DA 1DDWA 5EFXA 1QQGA 1UNQA 1ZM0A 4HB2B 4NSWA 1WVHA 1TQZA 2EMSA 2EC1A 3GF9A 1XR0B 4GOUA 1MKEA 4CHMA 4DX90 4Y94A 2YVCA 3OANA 1UNPA 5GOWB 1SHCA 4HATB 1I7AA 1WJMA 1FB8A 4HAVB 5FI0A 2CAYA 3QIJA 1FHWA 1MK9B 3IVFA 2D2QA 2V76A 2EJ8A 2W2XD 4ZRJA 4EMOA 3T06A 2ADZA 4YONA 2DA0A 3FM8C 3PEGA 1XKEA 4GMXB 3GYOA 5D3WA 2KCJA 4GMVA 5KQ4A 2K2UA 2KR9A 1OY2A 2L2IA 2P0FA 5D3YA 5C79A 1X1GA 4F7UP 3X23A 2COCA 3A98B 2J0MA 3SNHA 2W2XC 2K00A 4K2OA 1U5FA 2YT1A 3JV3A 2YSZA 4CHJA 1BWNA 2DHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5R A;  3A8Q A;  1U5D A;  2MKR A;  4KHB B;  5JLJ B;  4D0N B;  4WVF B;  2DHJ A;  1RJ2 A;  2LUL A;  1BTN A;  4BBK A;  5HE2 A;  2GJY A;  4KHA A;  2M14 A;  1P6S A;  2UZS A;  2FJL A;  1Y5O A;  1Q67 A;  2GS0 A;  1TXD A;  1GC7 A;  2YF0 A;  2P0D A;  2R0D A;  5HE0 A;  1K5D B;  1V5P A;  5C5B B;  3DXD A;  2Y8G A;  1H4R A;  5DHF B;  2HTH B;  4DBB A;  5D3X A;  1GC6 A;  2D11 A;  5DH9 B;  4IOY X;  3TFM A;  1SGH A;  2R09 A;  1UPQ A;  1FAO A;  1Z87 A;  4A6H A;  1P5T A;  1DRO A;  2KGX B;  4A6F A;  4IAP A;  2K2J A;  2Z0O A;  1I2H A;  5JHG A;  2DTC A;  3VOQ A;  2D9W A;  5J3Q A;  2PZ1 A;  1PFJ A;  2DLW A;  3MDB C;  4MT7 A;  3LJU X;  3AU4 A;  1U29 A;  4GXB A;  3ULC A;  5C6R A;  1NU2 A;  2COD A;  3BIN A;  3PVW A;  4GPT B;  4A6F B;  2KUP A;  1LB1 A;  1ZC3 B;  1OQN A;  3N7C A;  3TVV A;  1BAK A;  3KZ1 A;  2H7D A;  3HK0 A;  1PMS A;  3PZD A;  4HAU B;  1PLS A;  1FHX A;  1U27 A;  1TJ6 A;  2Q13 A;  1H10 A;  1XCG A;  2YRY A;  1Y19 B;  2Y7B A;  4WSF A;  2ELB A;  4TYZ A;  1U5E A;  5C16 A;  3ODO A;  1DBH A;  3AJ4 A;  5J3T A;  2DYQ A;  1X05 A;  1V89 A;  3FEH A;  2LOZ A;  1X1F A;  4KAX B;  1KZG A;  2ROZ B;  1AWE A;  1OMW A;  4HB0 B;  2UZR A;  1AQC A;  3VIA A;  4GZU A;  3SYX A;  2G35 A;  2M38 A;  2OQB A;  3SO6 A;  1UPR A;  2N23 A;  3F0W A;  4K17 A;  4PNK A;  3U7D A;  2HE7 A;  2LKO A;  1B55 A;  2ELA A;  2DN6 A;  1BY1 A;  4YL8 A;  2I1K A;  2GCL A;  2RLO A;  3QWM A;  4C0A A;  1KZ7 A;  4F7G A;  4NY0 A;  4XWX A;  4K2P A;  3TCA A;  1W1G A;  4HAZ B;  3KSY A;  3WA0 A;  1MIX A;  2AL6 A;  2COF A;  2RVB B;  3CIK A;  3TO1 A;  3UZT A;  2VSZ A;  5D3V A;  5DIF B;  2LYD A;  1X86 A;  1EAZ A;  3ODX A;  2Z0P A;  1X11 A;  2COA A;  4KHO A;  2L1C A;  2AEH A;  4P7I A;  5J3Y A;  1NTV A;  1W1D A;  1E5W A;  1U2B A;  3GYP A;  4H8S A;  1LW3 A;  1M7E A;  3ML4 A;  4HAY B;  2J59 M;  3HW2 B;  4MK0 A;  4IFS A;  4Z2M B;  1QC6 A;  1KI1 B;  1FGZ A;  1WI1 A;  4HB4 B;  2J0K A;  2MFQ A;  4K81 A;  4PQ0 A;  3DXE A;  1J0W A;  2DX5 A;  5JHH A;  1WGQ A;  1WGU A;  2DX1 A;  4A5K A;  2CY4 A;  1ZC4 B;  4ZRI A;  4HDO A;  3EO2 A;  3U8Z A;  1NI2 A;  4GN1 A;  1WG7 A;  2RNR B;  2BCJ A;  2VKI A;  2VRW B;  2D10 A;  2MWN B;  5DI9 B;  4MY6 A;  2J0J A;  1EVH A;  1MAI A;  3KY9 A;  2DFK A;  1WJ1 A;  3WYF B;  1MK7 B;  3QBV B;  2W2W A;  1EF1 A;  1XD4 A;  1V5U A;  2N0Y A;  3SV1 A;  3DXC A;  1MPH A;  1UEF A;  1UNR A;  1W1H A;  1EGX A;  2D9V A;  2RGN B;  2MDX A;  4TKN A;  2P8V A;  4L6E A;  1ZVR A;  5HE3 A;  3D8F A;  2XQN M;  2DYN A;  4B6H A;  3ZVR A;  1XX0 A;  1M7R A;  2EMT A;  1FOE A;  2D9X A;  1GG3 A;  1MIZ B;  3ZDT A;  2DHK A;  2P0H A;  2QKL A;  5HE1 A;  2CRF A;  4EJN A;  2ROV A;  3P6A A;  2I5C A;  2NZ8 B;  3AU5 A;  3M1I B;  4ZRK A;  4DX8 A;  5CLL B;  1U5G A;  3SUZ A;  4EKU A;  1XOD A;  4D0O A;  3ODW A;  3PP2 A;  3V5W A;  2IFS A;  3PVU A;  4F7H A;  3MPX A;  2JP2 A;  2DKP A;  3G9W A;  1J19 A;  2YS5 A;  5C5B A;  5LOP B;  4A6K A;  2D4Q A;  2LOX A;  3D8E A;  3O96 A;  2Z0Q A;  3NSU A;  2UVM A;  1K5G B;  1N3H A;  3HQC A;  1V88 A;  5DHA B;  1DDV A;  4HAX B;  1V61 A;  4HHV A;  5JP4 A;  2DKQ A;  1RRP B;  3PVL A;  4GYV A;  2Y8F A;  5CLQ B;  1ZSQ A;  2I1J A;  3FSS A;  3KRX A;  1P3R A;  2GCJ A;  2QKM A;  2ZPY A;  2D9Z A;  2NMB A;  2OTX A;  2YS3 A;  3ULB A;  1IRS A;  4HAW B;  1F5X A;  3CXB B;  4HDQ A;  4DXA B;  3PSC A;  5D27 A;  1DYN A;  2LG1 A;  5KQ1 A;  2I5F A;  4WJ7 A;  2IYB A;  2H7E A;  2CY5 A;  3RCP A;  3PG7 A;  4KVG B;  3BJI A;  4HB3 B;  4Z2N A;  5LON B;  2D9Y A;  1FHO A;  3P7Z A;  1FGY A;  3TW1 A;  2RSG A;  5KCV A;  1BTK A;  1V5M A;  3KRW A;  2YT0 A;  2YS1 A;  5L81 A;  3A8P A;  4CYE A;  2RUK B;  5FI1 A;  1ISN A;  1DDM A;  1NTY A;  2E2X A;  2X18 A;  3D8D A;  1DDW A;  5EFX A;  1QQG A;  1UNQ A;  1ZM0 A;  4HB2 B;  4NSW A;  1WVH A;  1TQZ A;  2EMS A;  2EC1 A;  3GF9 A;  1XR0 B;  4GOU A;  1MKE A;  4CHM A;  4DX9 0;  4Y94 A;  2YVC A;  3OAN A;  1UNP A;  5GOW B;  1SHC A;  4HAT B;  1I7A A;  1WJM A;  1FB8 A;  4HAV B;  5FI0 A;  2CAY A;  3QIJ A;  1FHW A;  1MK9 B;  3IVF A;  2D2Q A;  2V76 A;  2EJ8 A;  2W2X D;  4ZRJ A;  4EMO A;  3T06 A;  2ADZ A;  4YON A;  2DA0 A;  3FM8 C;  3PEG A;  1XKE A;  4GMX B;  3GYO A;  5D3W A;  2KCJ A;  4GMV A;  5KQ4 A;  2K2U A;  2KR9 A;  1OY2 A;  2L2I A;  2P0F A;  5D3Y A;  5C79 A;  1X1G A;  4F7U P;  3X23 A;  2COC A;  3A98 B;  2J0M A;  3SNH A;  2W2X C;  2K00 A;  4K2O A;  1U5F A;  2YT1 A;  3JV3 A;  2YSZ A;  4CHJ A;  1BWN A;  2DHI A; 
#chains in the Genus database with same CATH topology
 3F5R A;  3A8Q A;  1U5D A;  2MKR A;  4KHB B;  5JLJ B;  4D0N B;  4WVF B;  2DHJ A;  1RJ2 A;  2LUL A;  1BTN A;  4BBK A;  5HE2 A;  2GJY A;  4KHA A;  2M14 A;  1P6S A;  2UZS A;  2FJL A;  1Y5O A;  1Q67 A;  2GS0 A;  1TXD A;  1GC7 A;  2YF0 A;  2P0D A;  2R0D A;  5HE0 A;  1K5D B;  1V5P A;  5C5B B;  2K8E A;  3DXD A;  3DCX A;  2Y8G A;  2Z59 A;  1H4R A;  5DHF B;  2HTH B;  4DBB A;  5D3X A;  1GC6 A;  2D11 A;  5DH9 B;  4IOY X;  3TFM A;  1SGH A;  2R09 A;  1UPQ A;  1FAO A;  1Z87 A;  4A6H A;  1P5T A;  1DRO A;  2KGX B;  4A6F A;  4IAP A;  2KIG A;  2K2J A;  2Z0O A;  1I2H A;  5JHG A;  2DTC A;  3VOQ A;  2D9W A;  5J3Q A;  2PZ1 A;  1PFJ A;  2DLW A;  3MDB C;  4MT7 A;  3LJU X;  3AU4 A;  1U29 A;  4GXB A;  3ULC A;  5C6R A;  1NU2 A;  2COD A;  3BIN A;  3NWA A;  3PVW A;  4GPT B;  4A6F B;  2KUP A;  1LB1 A;  1ZC3 B;  1OQN A;  3N7C A;  3TVV A;  1BAK A;  3KZ1 A;  2H7D A;  2ZKM X;  3HK0 A;  1PMS A;  3PZD A;  4HAU B;  1PLS A;  1FHX A;  1U27 A;  1TJ6 A;  2Q13 A;  1H10 A;  1XCG A;  2YRY A;  1Y19 B;  2Y7B A;  4WSF A;  2ELB A;  4TYZ A;  1U5E A;  2FJU B;  5C16 A;  3ODO A;  1DBH A;  3AJ4 A;  5J3T A;  2DYQ A;  1X05 A;  1V89 A;  4CSQ A;  3FEH A;  2LOZ A;  1X1F A;  4KAX B;  1KZG A;  2ROZ B;  1AWE A;  1OMW A;  4HB0 B;  2UZR A;  1AQC A;  3VIA A;  4GZU A;  3SYX A;  2G35 A;  2M38 A;  2OQB A;  3SO6 A;  1UPR A;  2N23 A;  3F0W A;  4K17 A;  4PNK A;  3U7D A;  2HE7 A;  2LKO A;  4HSI A;  1B55 A;  2ELA A;  2DN6 A;  1BY1 A;  4YL8 A;  2I1K A;  2GCL A;  2RLO A;  3QWM A;  3NW8 A;  4C0A A;  4DIX A;  1KZ7 A;  4F7G A;  4NY0 A;  4XWX A;  4K2P A;  3TCA A;  1W1G A;  4HAZ B;  3KSY A;  3B77 A;  3WA0 A;  5I2S A;  1MIX A;  2AL6 A;  2COF A;  2RVB B;  3CIK A;  3TO1 A;  3UZT A;  2VSZ A;  5D3V A;  5DIF B;  2GUM A;  2LYD A;  1X86 A;  1EAZ A;  3ODX A;  2Z0P A;  1X11 A;  2COA A;  4KHO A;  2L1C A;  2AEH A;  4P7I A;  5J3Y A;  1NTV A;  1W1D A;  1E5W A;  1U2B A;  3GYP A;  4H8S A;  1LW3 A;  1M7E A;  3FVC A;  3ML4 A;  4HAY B;  2J59 M;  3HW2 B;  4MK0 A;  4IFS A;  4Z2M B;  4QJ4 B;  1QC6 A;  1KI1 B;  1FGZ A;  5I2M A;  1WI1 A;  4HB4 B;  2J0K A;  2MFQ A;  4K81 A;  4PQ0 A;  3DXE A;  1J0W A;  2DX5 A;  5JHH A;  1WGQ A;  1WGU A;  3U12 A;  2DX1 A;  4A5K A;  2CY4 A;  1ZC4 B;  2KR0 A;  4ZRI A;  4HDO A;  3EO2 A;  3U8Z A;  1NI2 A;  3OHM B;  4GN1 A;  1WG7 A;  2RNR B;  2BCJ A;  2VKI A;  2VRW B;  2D10 A;  2MWN B;  5DI9 B;  4MY6 A;  2J0J A;  1EVH A;  5M4Y B;  1MAI A;  3KY9 A;  2DFK A;  2KIE A;  1WJ1 A;  3WYF B;  1MK7 B;  3QBV B;  2W2W A;  1EF1 A;  1XD4 A;  1V5U A;  2N0Y A;  3SV1 A;  3DXC A;  1MPH A;  1UEF A;  1UNR A;  1W1H A;  1EGX A;  2D9V A;  2RGN B;  2MDX A;  4TKN A;  2P8V A;  4L6E A;  1ZVR A;  5HE3 A;  2R2Y A;  3D8F A;  2XQN M;  2DYN A;  3NWF A;  4B6H A;  3ZVR A;  1XX0 A;  1M7R A;  2YT2 A;  2EMT A;  1FOE A;  2D9X A;  1GG3 A;  1MIZ B;  3ZDT A;  2DHK A;  2P0H A;  2QKL A;  5HE1 A;  2Z14 A;  2CRF A;  4QJ5 B;  4EJN A;  2ROV A;  3P6A A;  2I5C A;  2NZ8 B;  3AU5 A;  2KUQ A;  3M1I B;  4ZRK A;  4DX8 A;  5CLL B;  2Z4D A;  1U5G A;  3SUZ A;  3A58 A;  4EKU A;  1XOD A;  4D0O A;  3ODW A;  3PP2 A;  3V5W A;  2IFS A;  3PVU A;  4F7H A;  3MPX A;  2JP2 A;  2DKP A;  3G9W A;  1J19 A;  2YS5 A;  5C5B A;  5LOP B;  4A6K A;  2D4Q A;  2LOX A;  3D8E A;  3O96 A;  2Z0Q A;  3NSU A;  2UVM A;  1K5G B;  1N3H A;  2NBV A;  3HQC A;  1V88 A;  3HSA A;  5DHA B;  1DDV A;  4HAX B;  1MI1 A;  1V61 A;  4HHV A;  5JP4 A;  2DKQ A;  1RRP B;  3PVL A;  4GYV A;  2Y8F A;  5CLQ B;  1ZSQ A;  2I1J A;  3FSS A;  3KRX A;  1T77 A;  1P3R A;  2GCJ A;  2QKM A;  2ZPY A;  2D9Z A;  2NMB A;  2OTX A;  2YS3 A;  3ULB A;  1IRS A;  4HAW B;  4QJ3 B;  1F5X A;  3CXB B;  4HDQ A;  4DXA B;  3PSC A;  5D27 A;  1DYN A;  2Z13 A;  2LG1 A;  5KQ1 A;  2I5F A;  4WJ7 A;  2IYB A;  2H7E A;  2CY5 A;  1ZYI A;  3RCP A;  3PG7 A;  4KVG B;  3BJI A;  4HB3 B;  4Z2N A;  5LON B;  2D9Y A;  1FHO A;  3P7Z A;  4QXA B;  1FGY A;  3TW1 A;  2RSG A;  5KCV A;  1BTK A;  4GNK B;  1V5M A;  3KRW A;  2YT0 A;  2YS1 A;  5L81 A;  4OT1 A;  3A8P A;  4OSN A;  4CYE A;  2RUK B;  5FI1 A;  1ISN A;  1DDM A;  1NTY A;  2E2X A;  2X18 A;  3D8D A;  3HIE A;  1DDW A;  5EFX A;  1QQG A;  1UNQ A;  1ZM0 A;  4HB2 B;  4NSW A;  1WVH A;  1TQZ A;  2EMS A;  2EC1 A;  3NWD A;  3GF9 A;  1XR0 B;  4GOU A;  1MKE A;  4CHM A;  4DX9 0;  4Y94 A;  2YVC A;  3OAN A;  1UNP A;  5GOW B;  1SHC A;  4HAT B;  1I7A A;  4L1R A;  1WJM A;  1FB8 A;  4HAV B;  5FI0 A;  2CAY A;  3QIJ A;  1FHW A;  1MK9 B;  2K49 A;  3IVF A;  2D2Q A;  2V76 A;  2EJ8 A;  2W2X D;  4ZRJ A;  4EMO A;  3T06 A;  2RRF A;  4KHB A;  2ADZ A;  4YON A;  2DA0 A;  3FM8 C;  3PEG A;  1XKE A;  4GMX B;  3GYO A;  5D3W A;  2KCJ A;  4GMV A;  5KQ4 A;  2K2U A;  2KR9 A;  1OY2 A;  2L2I A;  2P0F A;  5D3Y A;  5C79 A;  1X1G A;  4F7U P;  3X23 A;  2COC A;  3A98 B;  4D6W A;  5LG4 B;  2J0M A;  3SNH A;  2W2X C;  2K00 A;  4K2O A;  1U5F A;  5IRS A;  2YT1 A;  3JV3 A;  2YSZ A;  4CHJ A;  1BWN A;  2DHI A; 
#chains in the Genus database with same CATH homology
 3F5R A;  3A8Q A;  1U5D A;  2MKR A;  4KHB B;  5JLJ B;  4D0N B;  4WVF B;  2DHJ A;  1RJ2 A;  2LUL A;  1BTN A;  4BBK A;  5HE2 A;  2GJY A;  4KHA A;  2M14 A;  1P6S A;  2UZS A;  2FJL A;  1Y5O A;  1Q67 A;  2GS0 A;  1TXD A;  1GC7 A;  2YF0 A;  2P0D A;  2R0D A;  5HE0 A;  1K5D B;  1V5P A;  5C5B B;  3DXD A;  2Y8G A;  1H4R A;  5DHF B;  2HTH B;  4DBB A;  5D3X A;  1GC6 A;  2D11 A;  5DH9 B;  4IOY X;  3TFM A;  1SGH A;  2R09 A;  1UPQ A;  1FAO A;  1Z87 A;  4A6H A;  1P5T A;  1DRO A;  2KGX B;  4A6F A;  4IAP A;  2K2J A;  2Z0O A;  1I2H A;  5JHG A;  2DTC A;  3VOQ A;  2D9W A;  5J3Q A;  2PZ1 A;  1PFJ A;  2DLW A;  3MDB C;  4MT7 A;  3LJU X;  3AU4 A;  1U29 A;  4GXB A;  3ULC A;  5C6R A;  1NU2 A;  2COD A;  3BIN A;  3PVW A;  4GPT B;  4A6F B;  2KUP A;  1LB1 A;  1ZC3 B;  1OQN A;  3N7C A;  3TVV A;  1BAK A;  3KZ1 A;  2H7D A;  3HK0 A;  1PMS A;  3PZD A;  4HAU B;  1PLS A;  1FHX A;  1U27 A;  1TJ6 A;  2Q13 A;  1H10 A;  1XCG A;  2YRY A;  1Y19 B;  2Y7B A;  4WSF A;  2ELB A;  4TYZ A;  1U5E A;  5C16 A;  3ODO A;  1DBH A;  3AJ4 A;  5J3T A;  2DYQ A;  1X05 A;  1V89 A;  3FEH A;  2LOZ A;  1X1F A;  4KAX B;  1KZG A;  2ROZ B;  1AWE A;  1OMW A;  4HB0 B;  2UZR A;  1AQC A;  3VIA A;  4GZU A;  3SYX A;  2G35 A;  2M38 A;  2OQB A;  3SO6 A;  1UPR A;  2N23 A;  3F0W A;  4K17 A;  4PNK A;  3U7D A;  2HE7 A;  2LKO A;  1B55 A;  2ELA A;  2DN6 A;  1BY1 A;  4YL8 A;  2I1K A;  2GCL A;  2RLO A;  3QWM A;  4C0A A;  1KZ7 A;  4F7G A;  4NY0 A;  4XWX A;  4K2P A;  3TCA A;  1W1G A;  4HAZ B;  3KSY A;  3WA0 A;  1MIX A;  2AL6 A;  2COF A;  2RVB B;  3CIK A;  3TO1 A;  3UZT A;  2VSZ A;  5D3V A;  5DIF B;  2LYD A;  1X86 A;  1EAZ A;  3ODX A;  2Z0P A;  1X11 A;  2COA A;  4KHO A;  2L1C A;  2AEH A;  4P7I A;  5J3Y A;  1NTV A;  1W1D A;  1E5W A;  1U2B A;  3GYP A;  4H8S A;  1LW3 A;  1M7E A;  3ML4 A;  4HAY B;  2J59 M;  3HW2 B;  4MK0 A;  4IFS A;  4Z2M B;  1QC6 A;  1KI1 B;  1FGZ A;  1WI1 A;  4HB4 B;  2J0K A;  2MFQ A;  4K81 A;  4PQ0 A;  3DXE A;  1J0W A;  2DX5 A;  5JHH A;  1WGQ A;  1WGU A;  2DX1 A;  4A5K A;  2CY4 A;  1ZC4 B;  4ZRI A;  4HDO A;  3EO2 A;  3U8Z A;  1NI2 A;  4GN1 A;  1WG7 A;  2RNR B;  2BCJ A;  2VKI A;  2VRW B;  2D10 A;  2MWN B;  5DI9 B;  4MY6 A;  2J0J A;  1EVH A;  1MAI A;  3KY9 A;  2DFK A;  1WJ1 A;  3WYF B;  1MK7 B;  3QBV B;  2W2W A;  1EF1 A;  1XD4 A;  1V5U A;  2N0Y A;  3SV1 A;  3DXC A;  1MPH A;  1UEF A;  1UNR A;  1W1H A;  1EGX A;  2D9V A;  2RGN B;  2MDX A;  4TKN A;  2P8V A;  4L6E A;  1ZVR A;  5HE3 A;  3D8F A;  2XQN M;  2DYN A;  4B6H A;  3ZVR A;  1XX0 A;  1M7R A;  2EMT A;  1FOE A;  2D9X A;  1GG3 A;  1MIZ B;  3ZDT A;  2DHK A;  2P0H A;  2QKL A;  5HE1 A;  2CRF A;  4EJN A;  2ROV A;  3P6A A;  2I5C A;  2NZ8 B;  3AU5 A;  3M1I B;  4ZRK A;  4DX8 A;  5CLL B;  1U5G A;  3SUZ A;  4EKU A;  1XOD A;  4D0O A;  3ODW A;  3PP2 A;  3V5W A;  2IFS A;  3PVU A;  4F7H A;  3MPX A;  2JP2 A;  2DKP A;  3G9W A;  1J19 A;  2YS5 A;  5C5B A;  5LOP B;  4A6K A;  2D4Q A;  2LOX A;  3D8E A;  3O96 A;  2Z0Q A;  3NSU A;  2UVM A;  1K5G B;  1N3H A;  3HQC A;  1V88 A;  5DHA B;  1DDV A;  4HAX B;  1V61 A;  4HHV A;  5JP4 A;  2DKQ A;  1RRP B;  3PVL A;  4GYV A;  2Y8F A;  5CLQ B;  1ZSQ A;  2I1J A;  3FSS A;  3KRX A;  1P3R A;  2GCJ A;  2QKM A;  2ZPY A;  2D9Z A;  2NMB A;  2OTX A;  2YS3 A;  3ULB A;  1IRS A;  4HAW B;  1F5X A;  3CXB B;  4HDQ A;  4DXA B;  3PSC A;  5D27 A;  1DYN A;  2LG1 A;  5KQ1 A;  2I5F A;  4WJ7 A;  2IYB A;  2H7E A;  2CY5 A;  3RCP A;  3PG7 A;  4KVG B;  3BJI A;  4HB3 B;  4Z2N A;  5LON B;  2D9Y A;  1FHO A;  3P7Z A;  1FGY A;  3TW1 A;  2RSG A;  5KCV A;  1BTK A;  1V5M A;  3KRW A;  2YT0 A;  2YS1 A;  5L81 A;  3A8P A;  4CYE A;  2RUK B;  5FI1 A;  1ISN A;  1DDM A;  1NTY A;  2E2X A;  2X18 A;  3D8D A;  1DDW A;  5EFX A;  1QQG A;  1UNQ A;  1ZM0 A;  4HB2 B;  4NSW A;  1WVH A;  1TQZ A;  2EMS A;  2EC1 A;  3GF9 A;  1XR0 B;  4GOU A;  1MKE A;  4CHM A;  4DX9 0;  4Y94 A;  2YVC A;  3OAN A;  1UNP A;  5GOW B;  1SHC A;  4HAT B;  1I7A A;  1WJM A;  1FB8 A;  4HAV B;  5FI0 A;  2CAY A;  3QIJ A;  1FHW A;  1MK9 B;  3IVF A;  2D2Q A;  2V76 A;  2EJ8 A;  2W2X D;  4ZRJ A;  4EMO A;  3T06 A;  2ADZ A;  4YON A;  2DA0 A;  3FM8 C;  3PEG A;  1XKE A;  4GMX B;  3GYO A;  5D3W A;  2KCJ A;  4GMV A;  5KQ4 A;  2K2U A;  2KR9 A;  1OY2 A;  2L2I A;  2P0F A;  5D3Y A;  5C79 A;  1X1G A;  4F7U P;  3X23 A;  2COC A;  3A98 B;  2J0M A;  3SNH A;  2W2X C;  2K00 A;  4K2O A;  1U5F A;  2YT1 A;  3JV3 A;  2YSZ A;  4CHJ A;  1BWN A;  2DHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...