1FOEA

Crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
QLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, immune system/signaling protein
molecule keywords T-LYMPHOMA INVASION AND METASTASIS INDUCING PROTEIN 1
publication title Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
pubmed doi rcsb
source organism Mus musculus
total genus 106
structure length 368
sequence length 368
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2000-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1foeA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1foeA02
4KVGB 1Z87A 4HAVB 1EVHA 1KI1B 4K17A 3VIAA 5KCVA 1DDMA 1NTYA 3DXCA 4HDOA 2Q13A 2IFSA 2JP2A 1BWNA 4GMXB 4HB0B 1U5GA 4EJNA 2W2XC 3IVFA 1P6SA 5D3XA 1IRSA 2P8VA 2H7DA 3SV1A 4F7HA 1TQZA 1PLSA 2I5FA 3BJIA 2GS0A 1BTNA 2ADZA 2R09A 2VKIA 1WGQA 2CRFA 3A8QA 3QBVB 1FHWA 4HB2B 1MIZB 2J0JA 4TKNA 2Y8FA 1X1FA 5DHAB 2DHIA 3U8ZA 5LOPB 1MIXA 1XD4A 3D8FA 1WG7A 3D8EA 2R0DA 4K2PA 2AEHA 2D4QA 1WGUA 1F5XA 4IAPA 1OQNA 1UEFA 1K5GB 2H7EA 1DROA 2OQBA 5D3YA 2HE7A 2UVMA 5DHFB 4HDQA 2HTHB 3PVLA 2DHKA 4HATB 3CIKA 1X1GA 3AJ4A 4HAZB 1H4RA 2XQNM 1UNRA 1ZC4B 2YSZA 3QIJA 3ML4A 3CXBB 2DHJA 3AU5A 2DN6A 1XODA 4A6HA 2ROZB 5C5BB 1NTVA 5LONB 2LOZA 3PZDA 2ZPYA 2CAYA 3GYOA 1MK7B 1U5DA 4GYVA 1WJMA 2YT1A 1J19A 1N3HA 2YS1A 3PVUA 2UZRA 5EFXA 4H8SA 1UPRA 3ULBA 5J3QA 1UPQA 2Z0QA 2P0DA 1WJ1A 2K2UA 2Z0PA 2W2XD 4HAXB 5KQ4A 2LG1A 2I1KA 2PZ1A 2G35A 3GYPA 3KRWA 3U7DA 1FGYA 4GPTB 2YF0A 2D9XA 1Q67A 2ROVA 1V5UA 1FGZA 2EC1A 2YRYA 2ELBA 1FB8A 1ZSQA 3ULCA 4GN1A 2ELAA 4EMOA 2D9VA 2J59M 2K2JA 2CODA 4HAUB 2DKPA 4KAXB 4A6KA 1AQCA 1RJ2A 1V5PA 2N23A 3SUZA 4CYEA 3V5WA 2J0KA 4D0NB 4WVFB 2YS5A 1SGHA 4IFSA 4YL8A 1AWEA 2J0MA 3GF9A 5DIFB 2FJLA 1XR0B 2MWNB 4CHJA 1GG3A 1FHXA 4TYZA 2N0YA 3OANA 4MK0A 1U27A 1V5MA 3HK0A 2V76A 2DA0A 4F7UP 2LKOA 1W1HA 2MKRA 1U5FA 2CY4A 3PEGA 2LULA 1X11A 4ZRJA 3RCPA 2LYDA 2DX5A 5DH9B 1BTKA 4KHOA 3AU4A 2DFKA 2D11A 2CY5A 1K5DB 2GCJA 3LJUX 1B55A 3M1IB 2RVBB 1X86A 1V88A 2COCA 4Z2MB 5J3YA 2RUKB 1ZM0A 2E2XA 4B6HA 4PQ0A 2DYNA 2X18A 3MPXA 2D9ZA 2KGXB 5J3TA 3ODOA 3TO1A 4L6EA 2D9WA 4YONA 4Z2NA 5D27A 2YS3A 4IOYX 4BBKA 5C16A 3WYFB 2M14A 3KRXA 3PVWA 2COAA 5JHGA 2DLWA 3TFMA 1P5TA 5KQ1A 3UZTA 5L81A 1H10A 1TJ6A 4GMVA 5JP4A 1ISNA 1UNQA 2GCLA 4KHBB 1XX0A 4C0AA 4DBBA 2KUPA 5HE2A 3BINA 4MY6A 4NSWA 1BAKA 1MPHA 3ODXA 1SHCA 2RLOA 4HAWB 2AL6A 2P0HA 3F5RA 3FSSA 1MK9B 2UZSA 4D0OA 4A6FA 2OTXA 5HE1A 1NU2A 3VOQA 3ODWA 4HAYB 2MDXA 5C6RA 2VSZA 4HB3B 2W2WA 3TVVA 3HW2B 5D3WA 3QWMA 1PMSA 1U5EA 4GOUA 1V89A 1PFJA 2Z0OA 1W1GA 2D9YA 3A98B 3PG7A 3P6AA 1Y19B 5JLJB 2LOXA 4WJ7A 1UNPA 5FI0A 2I1JA 4F7GA 2EMTA 1BY1A 3PP2A 3G9WA 4NY0A 3D8DA 2RSGA 1KZ7A 5D3VA 2QKLA 1FHOA 5CLQB 3KSYA 1LB1A 2DKQA 1QQGA 2DYQA 4A5KA 5C5BA 1WVHA 2GJYA 1X05A 3DXDA 1M7RA 4GZUA 1P3RA 2BCJA 1DYNA 4ZRIA 2NMBA 3HQCA 4EKUA 1EAZA 5GOWB 1I2HA 1TXDA 4DX8A 4GXBA 2D10A 1QC6A 3EO2A 1U29A 3SNHA 5CLLB 2L2IA 5HE3A 2COFA 2RGNB 1FOEA 1WI1A 2I5CA 2Y7BA 3A8PA 3SO6A 2NZ8B 5HE0A 2P0FA 1GC7A 2D2QA 3KY9A 1M7EA 1DDVA 1I7AA 4K81A 5JHHA 3P7ZA 4A6FB 1EGXA 3TCAA 2RNRB 1E5WA 2QKMA 3TW1A 3JV3A 2Y8GA 3FM8C 1EF1A 3T06A 2K00A 3FEHA 4MT7A 1RRPB 2KR9A 3ZDTA 3O96A 4Y94A 4ZRKA 1FAOA 4DXAB 4PNKA 2VRWB 1GC6A 1MKEA 2DX1A 1ZC3B 2M38A 5C79A 5FI1A 1V61A 3MDBC 1XCGA 2KCJA 4HB4B 5DI9B 2IYBA 3WA0A 4XWXA 1OMWA 3KZ1A 2DTCA 1OY2A 4HHVA 3ZVRA 4P7IA 4CHMA 1ZVRA 3PSCA 3F0WA 4WSFA 1U2BA 1W1DA 1J0WA 1LW3A 3NSUA 3X23A 2MFQA 3SYXA 1MAIA 1DDWA 2YVCA 1XKEA 1KZGA 1DBHA 1NI2A 4KHAA 3DXEA 2L1CA 2EMSA 4DX90 4K2OA 2YT0A 2EJ8A 1Y5OA 3N7CA
chains in the Genus database with same CATH superfamily
4KVGB 1Z87A 4HAVB 1EVHA 1KI1B 4K17A 3VIAA 5KCVA 1DDMA 1NTYA 3DXCA 4HDOA 2Q13A 2IFSA 2JP2A 1BWNA 4GMXB 4HB0B 1U5GA 4EJNA 2W2XC 3IVFA 1P6SA 5IRSA 5D3XA 1IRSA 2P8VA 2H7DA 3SV1A 4F7HA 1TQZA 1PLSA 5I2MA 3OHMB 2I5FA 3BJIA 2GS0A 1BTNA 2ADZA 2R09A 2VKIA 1WGQA 4QJ5B 2CRFA 3A8QA 3NWAA 3QBVB 1FHWA 4HB2B 1MIZB 3B77A 2J0JA 4TKNA 2Y8FA 1X1FA 5DHAB 2DHIA 3U8ZA 5LOPB 1MIXA 1XD4A 3D8FA 1WG7A 3D8EA 2R0DA 4K2PA 2AEHA 2D4QA 1WGUA 1F5XA 4IAPA 1OQNA 4DIXA 1UEFA 1K5GB 2H7EA 1DROA 2OQBA 5D3YA 2HE7A 2UVMA 5DHFB 4HDQA 2HTHB 3PVLA 2DHKA 4HATB 3CIKA 1X1GA 3AJ4A 2NBVA 4HAZB 1H4RA 2XQNM 1UNRA 1ZC4B 2YSZA 3QIJA 3ML4A 2DHJA 3CXBB 3AU5A 2DN6A 1XODA 4A6HA 2ROZB 5C5BB 1NTVA 4QJ4B 5LONB 2LOZA 3PZDA 2ZPYA 2CAYA 3GYOA 1MK7B 1U5DA 4GYVA 1WJMA 2YT1A 1J19A 1N3HA 2YS1A 3PVUA 2UZRA 5EFXA 2ZKMX 4H8SA 1UPRA 3ULBA 5J3QA 1UPQA 2Z0QA 2KIEA 2P0DA 1WJ1A 2K2UA 2Z0PA 2W2XD 4HAXB 5KQ4A 2LG1A 2I1KA 2PZ1A 2G35A 3GYPA 3KRWA 3U7DA 1FGYA 4GPTB 2YF0A 2D9XA 1Q67A 2ROVA 1V5UA 1FGZA 2EC1A 2YRYA 2ELBA 2RRFA 1FB8A 1ZSQA 3ULCA 4GN1A 2ELAA 4EMOA 2D9VA 2J59M 2K2JA 2CODA 4HAUB 2DKPA 4KAXB 4A6KA 1AQCA 1RJ2A 1V5PA 2N23A 3SUZA 4CYEA 3V5WA 4KHBA 2J0KA 4D0NB 4WVFB 2YS5A 1SGHA 1T77A 4IFSA 4YL8A 1AWEA 2J0MA 3GF9A 5DIFB 2FJLA 1XR0B 2MWNB 4CHJA 1GG3A 1FHXA 4TYZA 2N0YA 3OANA 4MK0A 2Z13A 1U27A 1V5MA 3HK0A 2V76A 2DA0A 4F7UP 2LKOA 1W1HA 2MKRA 1U5FA 2CY4A 3PEGA 2LULA 1X11A 4ZRJA 3RCPA 2LYDA 2DX5A 5DH9B 1BTKA 4KHOA 3AU4A 2DFKA 2D11A 2YT2A 2CY5A 1K5DB 2GCJA 3LJUX 1B55A 3M1IB 2RVBB 1X86A 3NW8A 1V88A 2COCA 4Z2MB 5J3YA 2RUKB 1ZM0A 2E2XA 4B6HA 4PQ0A 2DYNA 2X18A 3MPXA 2D9ZA 2KGXB 5J3TA 3ODOA 3TO1A 4L6EA 2D9WA 4YONA 4Z2NA 4GNKB 5D27A 2YS3A 2FJUB 4IOYX 4BBKA 5C16A 3WYFB 2K8EA 2M14A 3KRXA 3PVWA 2COAA 5JHGA 2DLWA 3TFMA 1P5TA 5KQ1A 2Z4DA 3UZTA 5L81A 1H10A 1TJ6A 4GMVA 5JP4A 1ISNA 1UNQA 2GCLA 5M4YB 4KHBB 4QXAB 1XX0A 2Z59A 4C0AA 4DBBA 2KUPA 5HE2A 3BINA 4MY6A 4NSWA 1BAKA 1MPHA 3ODXA 1SHCA 2RLOA 4HAWB 2AL6A 2P0HA 3F5RA 3FSSA 1MK9B 2UZSA 4D0OA 4A6FA 2OTXA 5HE1A 1NU2A 3VOQA 3ODWA 4HAYB 2MDXA 5C6RA 2VSZA 4HB3B 2W2WA 3TVVA 3HW2B 5D3WA 3QWMA 4OT1A 2KR0A 1PMSA 5I2SA 1U5EA 4GOUA 1V89A 1PFJA 2Z0OA 1W1GA 2D9YA 3A98B 3PG7A 3P6AA 1Y19B 5JLJB 4D6WA 2LOXA 4WJ7A 1UNPA 3NWDA 5FI0A 2I1JA 4F7GA 2EMTA 1BY1A 2KIGA 4L1RA 3PP2A 3G9WA 4NY0A 3DCXA 3D8DA 2RSGA 1KZ7A 1ZYIA 5D3VA 2QKLA 1FHOA 5CLQB 3KSYA 1LB1A 2DKQA 3A58A 1QQGA 2DYQA 2Z14A 3FVCA 4A5KA 5C5BA 1WVHA 4QJ3B 2GJYA 1X05A 1M7RA 4GZUA 1P3RA 2BCJA 3DXDA 1DYNA 4ZRIA 2NMBA 3HQCA 4EKUA 1EAZA 5GOWB 1I2HA 1TXDA 4DX8A 4GXBA 2D10A 1QC6A 3EO2A 1U29A 3SNHA 5CLLB 2L2IA 5HE3A 2COFA 2RGNB 1FOEA 1WI1A 2I5CA 2Y7BA 3A8PA 3SO6A 2NZ8B 2R2YA 5HE0A 2P0FA 5LG4B 1GC7A 2D2QA 3KY9A 1M7EA 1DDVA 1I7AA 4K81A 4OSNA 5JHHA 3P7ZA 4A6FB 1EGXA 2KUQA 3TCAA 2RNRB 1E5WA 2QKMA 3TW1A 3NWFA 3JV3A 2Y8GA 3FM8C 1EF1A 3T06A 2K49A 4HSIA 2K00A 3FEHA 4MT7A 1RRPB 2KR9A 3ZDTA 3O96A 4Y94A 4ZRKA 1FAOA 4DXAB 4PNKA 2VRWB 1GC6A 1MKEA 2DX1A 1ZC3B 2M38A 5C79A 5FI1A 1V61A 3MDBC 1XCGA 2KCJA 4HB4B 5DI9B 2IYBA 3WA0A 4XWXA 4CSQA 1OMWA 2GUMA 3KZ1A 2DTCA 3HIEA 3U12A 1OY2A 4HHVA 3ZVRA 4P7IA 4CHMA 3HSAA 1ZVRA 3PSCA 3F0WA 4WSFA 1U2BA 1W1DA 1J0WA 1LW3A 3NSUA 3X23A 2MFQA 3SYXA 1MAIA 1DDWA 2YVCA 1XKEA 1KZGA 1DBHA 1NI2A 4KHAA 3DXEA 2L1CA 2EMSA 4DX90 1MI1A 4K2OA 2YT0A 2EJ8A 1Y5OA 3N7CA
chains in the Genus database with same CATH topology
4KVGB 1Z87A 4HAVB 1EVHA 1KI1B 4K17A 3VIAA 5KCVA 1DDMA 1NTYA 3DXCA 4HDOA 2Q13A 2IFSA 2JP2A 1BWNA 4GMXB 4HB0B 1U5GA 4EJNA 2W2XC 3IVFA 1P6SA 5D3XA 1IRSA 2P8VA 2H7DA 3SV1A 4F7HA 1TQZA 1PLSA 2I5FA 3BJIA 2GS0A 1BTNA 2ADZA 2R09A 2VKIA 1WGQA 2CRFA 3A8QA 3QBVB 1FHWA 4HB2B 1MIZB 2J0JA 4TKNA 2Y8FA 1X1FA 5DHAB 2DHIA 3U8ZA 5LOPB 1MIXA 1XD4A 3D8FA 1WG7A 3D8EA 2R0DA 4K2PA 2AEHA 2D4QA 1WGUA 1F5XA 4IAPA 1OQNA 1UEFA 1K5GB 2H7EA 1DROA 2OQBA 5D3YA 2HE7A 2UVMA 5DHFB 4HDQA 2HTHB 3PVLA 2DHKA 4HATB 3CIKA 1X1GA 3AJ4A 4HAZB 1H4RA 2XQNM 1UNRA 1ZC4B 2YSZA 3QIJA 3ML4A 3CXBB 2DHJA 3AU5A 2DN6A 1XODA 4A6HA 2ROZB 5C5BB 1NTVA 5LONB 2LOZA 3PZDA 2ZPYA 2CAYA 3GYOA 1MK7B 1U5DA 4GYVA 1WJMA 2YT1A 1J19A 1N3HA 2YS1A 3PVUA 2UZRA 5EFXA 4H8SA 1UPRA 3ULBA 5J3QA 1UPQA 2Z0QA 2P0DA 1WJ1A 2K2UA 2Z0PA 2W2XD 4HAXB 5KQ4A 2LG1A 2I1KA 2PZ1A 2G35A 3GYPA 3KRWA 3U7DA 1FGYA 4GPTB 2YF0A 2D9XA 1Q67A 2ROVA 1V5UA 1FGZA 2EC1A 2YRYA 2ELBA 1FB8A 1ZSQA 3ULCA 4GN1A 2ELAA 4EMOA 2D9VA 2J59M 2K2JA 2CODA 4HAUB 2DKPA 4KAXB 4A6KA 1AQCA 1RJ2A 1V5PA 2N23A 3SUZA 4CYEA 3V5WA 2J0KA 4D0NB 4WVFB 2YS5A 1SGHA 4IFSA 4YL8A 1AWEA 2J0MA 3GF9A 5DIFB 2FJLA 1XR0B 2MWNB 4CHJA 1GG3A 1FHXA 4TYZA 2N0YA 3OANA 4MK0A 1U27A 1V5MA 3HK0A 2V76A 2DA0A 4F7UP 2LKOA 1W1HA 2MKRA 1U5FA 2CY4A 3PEGA 2LULA 1X11A 4ZRJA 3RCPA 2LYDA 2DX5A 5DH9B 1BTKA 4KHOA 3AU4A 2DFKA 2D11A 2CY5A 1K5DB 2GCJA 3LJUX 1B55A 3M1IB 2RVBB 1X86A 1V88A 2COCA 4Z2MB 5J3YA 2RUKB 1ZM0A 2E2XA 4B6HA 4PQ0A 2DYNA 2X18A 3MPXA 2D9ZA 2KGXB 5J3TA 3ODOA 3TO1A 4L6EA 2D9WA 4YONA 4Z2NA 5D27A 2YS3A 4IOYX 4BBKA 5C16A 3WYFB 2M14A 3KRXA 3PVWA 2COAA 5JHGA 2DLWA 3TFMA 1P5TA 5KQ1A 3UZTA 5L81A 1H10A 1TJ6A 4GMVA 5JP4A 1ISNA 1UNQA 2GCLA 4KHBB 1XX0A 4C0AA 4DBBA 2KUPA 5HE2A 3BINA 4MY6A 4NSWA 1BAKA 1MPHA 3ODXA 1SHCA 2RLOA 4HAWB 2AL6A 2P0HA 3F5RA 3FSSA 1MK9B 2UZSA 4D0OA 4A6FA 2OTXA 5HE1A 1NU2A 3VOQA 3ODWA 4HAYB 2MDXA 5C6RA 2VSZA 4HB3B 2W2WA 3TVVA 3HW2B 5D3WA 3QWMA 1PMSA 1U5EA 4GOUA 1V89A 1PFJA 2Z0OA 1W1GA 2D9YA 3A98B 3PG7A 3P6AA 1Y19B 5JLJB 2LOXA 4WJ7A 1UNPA 5FI0A 2I1JA 4F7GA 2EMTA 1BY1A 3PP2A 3G9WA 4NY0A 3D8DA 2RSGA 1KZ7A 5D3VA 2QKLA 1FHOA 5CLQB 3KSYA 1LB1A 2DKQA 1QQGA 2DYQA 4A5KA 5C5BA 1WVHA 2GJYA 1X05A 3DXDA 1M7RA 4GZUA 1P3RA 2BCJA 1DYNA 4ZRIA 2NMBA 3HQCA 4EKUA 1EAZA 5GOWB 1I2HA 1TXDA 4DX8A 4GXBA 2D10A 1QC6A 3EO2A 1U29A 3SNHA 5CLLB 2L2IA 5HE3A 2COFA 2RGNB 1FOEA 1WI1A 2I5CA 2Y7BA 3A8PA 3SO6A 2NZ8B 5HE0A 2P0FA 1GC7A 2D2QA 3KY9A 1M7EA 1DDVA 1I7AA 4K81A 5JHHA 3P7ZA 4A6FB 1EGXA 3TCAA 2RNRB 1E5WA 2QKMA 3TW1A 3JV3A 2Y8GA 3FM8C 1EF1A 3T06A 2K00A 3FEHA 4MT7A 1RRPB 2KR9A 3ZDTA 3O96A 4Y94A 4ZRKA 1FAOA 4DXAB 4PNKA 2VRWB 1GC6A 1MKEA 2DX1A 1ZC3B 2M38A 5C79A 5FI1A 1V61A 3MDBC 1XCGA 2KCJA 4HB4B 5DI9B 2IYBA 3WA0A 4XWXA 1OMWA 3KZ1A 2DTCA 1OY2A 4HHVA 3ZVRA 4P7IA 4CHMA 1ZVRA 3PSCA 3F0WA 4WSFA 1U2BA 1W1DA 1J0WA 1LW3A 3NSUA 3X23A 2MFQA 3SYXA 1MAIA 1DDWA 2YVCA 1XKEA 1KZGA 1DBHA 1NI2A 4KHAA 3DXEA 2L1CA 2EMSA 4DX90 4K2OA 2YT0A 2EJ8A 1Y5OA 3N7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVG B;  1Z87 A;  4HAV B;  1EVH A;  1KI1 B;  4K17 A;  3VIA A;  5KCV A;  1DDM A;  1NTY A;  3DXC A;  4HDO A;  2Q13 A;  2IFS A;  2JP2 A;  1BWN A;  4GMX B;  4HB0 B;  1U5G A;  4EJN A;  2W2X C;  3IVF A;  1P6S A;  5D3X A;  1IRS A;  2P8V A;  2H7D A;  3SV1 A;  4F7H A;  1TQZ A;  1PLS A;  2I5F A;  3BJI A;  2GS0 A;  1BTN A;  2ADZ A;  2R09 A;  2VKI A;  1WGQ A;  2CRF A;  3A8Q A;  3QBV B;  1FHW A;  4HB2 B;  1MIZ B;  2J0J A;  4TKN A;  2Y8F A;  1X1F A;  5DHA B;  2DHI A;  3U8Z A;  5LOP B;  1MIX A;  1XD4 A;  3D8F A;  1WG7 A;  3D8E A;  2R0D A;  4K2P A;  2AEH A;  2D4Q A;  1WGU A;  1F5X A;  4IAP A;  1OQN A;  1UEF A;  1K5G B;  2H7E A;  1DRO A;  2OQB A;  5D3Y A;  2HE7 A;  2UVM A;  5DHF B;  4HDQ A;  2HTH B;  3PVL A;  2DHK A;  4HAT B;  3CIK A;  1X1G A;  3AJ4 A;  4HAZ B;  1H4R A;  2XQN M;  1UNR A;  1ZC4 B;  2YSZ A;  3QIJ A;  3ML4 A;  3CXB B;  2DHJ A;  3AU5 A;  2DN6 A;  1XOD A;  4A6H A;  2ROZ B;  5C5B B;  1NTV A;  5LON B;  2LOZ A;  3PZD A;  2ZPY A;  2CAY A;  3GYO A;  1MK7 B;  1U5D A;  4GYV A;  1WJM A;  2YT1 A;  1J19 A;  1N3H A;  2YS1 A;  3PVU A;  2UZR A;  5EFX A;  4H8S A;  1UPR A;  3ULB A;  5J3Q A;  1UPQ A;  2Z0Q A;  2P0D A;  1WJ1 A;  2K2U A;  2Z0P A;  2W2X D;  4HAX B;  5KQ4 A;  2LG1 A;  2I1K A;  2PZ1 A;  2G35 A;  3GYP A;  3KRW A;  3U7D A;  1FGY A;  4GPT B;  2YF0 A;  2D9X A;  1Q67 A;  2ROV A;  1V5U A;  1FGZ A;  2EC1 A;  2YRY A;  2ELB A;  1FB8 A;  1ZSQ A;  3ULC A;  4GN1 A;  2ELA A;  4EMO A;  2D9V A;  2J59 M;  2K2J A;  2COD A;  4HAU B;  2DKP A;  4KAX B;  4A6K A;  1AQC A;  1RJ2 A;  1V5P A;  2N23 A;  3SUZ A;  4CYE A;  3V5W A;  2J0K A;  4D0N B;  4WVF B;  2YS5 A;  1SGH A;  4IFS A;  4YL8 A;  1AWE A;  2J0M A;  3GF9 A;  5DIF B;  2FJL A;  1XR0 B;  2MWN B;  4CHJ A;  1GG3 A;  1FHX A;  4TYZ A;  2N0Y A;  3OAN A;  4MK0 A;  1U27 A;  1V5M A;  3HK0 A;  2V76 A;  2DA0 A;  4F7U P;  2LKO A;  1W1H A;  2MKR A;  1U5F A;  2CY4 A;  3PEG A;  2LUL A;  1X11 A;  4ZRJ A;  3RCP A;  2LYD A;  2DX5 A;  5DH9 B;  1BTK A;  4KHO A;  3AU4 A;  2DFK A;  2D11 A;  2CY5 A;  1K5D B;  2GCJ A;  3LJU X;  1B55 A;  3M1I B;  2RVB B;  1X86 A;  1V88 A;  2COC A;  4Z2M B;  5J3Y A;  2RUK B;  1ZM0 A;  2E2X A;  4B6H A;  4PQ0 A;  2DYN A;  2X18 A;  3MPX A;  2D9Z A;  2KGX B;  5J3T A;  3ODO A;  3TO1 A;  4L6E A;  2D9W A;  4YON A;  4Z2N A;  5D27 A;  2YS3 A;  4IOY X;  4BBK A;  5C16 A;  3WYF B;  2M14 A;  3KRX A;  3PVW A;  2COA A;  5JHG A;  2DLW A;  3TFM A;  1P5T A;  5KQ1 A;  3UZT A;  5L81 A;  1H10 A;  1TJ6 A;  4GMV A;  5JP4 A;  1ISN A;  1UNQ A;  2GCL A;  4KHB B;  1XX0 A;  4C0A A;  4DBB A;  2KUP A;  5HE2 A;  3BIN A;  4MY6 A;  4NSW A;  1BAK A;  1MPH A;  3ODX A;  1SHC A;  2RLO A;  4HAW B;  2AL6 A;  2P0H A;  3F5R A;  3FSS A;  1MK9 B;  2UZS A;  4D0O A;  4A6F A;  2OTX A;  5HE1 A;  1NU2 A;  3VOQ A;  3ODW A;  4HAY B;  2MDX A;  5C6R A;  2VSZ A;  4HB3 B;  2W2W A;  3TVV A;  3HW2 B;  5D3W A;  3QWM A;  1PMS A;  1U5E A;  4GOU A;  1V89 A;  1PFJ A;  2Z0O A;  1W1G A;  2D9Y A;  3A98 B;  3PG7 A;  3P6A A;  1Y19 B;  5JLJ B;  2LOX A;  4WJ7 A;  1UNP A;  5FI0 A;  2I1J A;  4F7G A;  2EMT A;  1BY1 A;  3PP2 A;  3G9W A;  4NY0 A;  3D8D A;  2RSG A;  1KZ7 A;  5D3V A;  2QKL A;  1FHO A;  5CLQ B;  3KSY A;  1LB1 A;  2DKQ A;  1QQG A;  2DYQ A;  4A5K A;  5C5B A;  1WVH A;  2GJY A;  1X05 A;  3DXD A;  1M7R A;  4GZU A;  1P3R A;  2BCJ A;  1DYN A;  4ZRI A;  2NMB A;  3HQC A;  4EKU A;  1EAZ A;  5GOW B;  1I2H A;  1TXD A;  4DX8 A;  4GXB A;  2D10 A;  1QC6 A;  3EO2 A;  1U29 A;  3SNH A;  5CLL B;  2L2I A;  5HE3 A;  2COF A;  2RGN B;  1FOE A;  1WI1 A;  2I5C A;  2Y7B A;  3A8P A;  3SO6 A;  2NZ8 B;  5HE0 A;  2P0F A;  1GC7 A;  2D2Q A;  3KY9 A;  1M7E A;  1DDV A;  1I7A A;  4K81 A;  5JHH A;  3P7Z A;  4A6F B;  1EGX A;  3TCA A;  2RNR B;  1E5W A;  2QKM A;  3TW1 A;  3JV3 A;  2Y8G A;  3FM8 C;  1EF1 A;  3T06 A;  2K00 A;  3FEH A;  4MT7 A;  1RRP B;  2KR9 A;  3ZDT A;  3O96 A;  4Y94 A;  4ZRK A;  1FAO A;  4DXA B;  4PNK A;  2VRW B;  1GC6 A;  1MKE A;  2DX1 A;  1ZC3 B;  2M38 A;  5C79 A;  5FI1 A;  1V61 A;  3MDB C;  1XCG A;  2KCJ A;  4HB4 B;  5DI9 B;  2IYB A;  3WA0 A;  4XWX A;  1OMW A;  3KZ1 A;  2DTC A;  1OY2 A;  4HHV A;  3ZVR A;  4P7I A;  4CHM A;  1ZVR A;  3PSC A;  3F0W A;  4WSF A;  1U2B A;  1W1D A;  1J0W A;  1LW3 A;  3NSU A;  3X23 A;  2MFQ A;  3SYX A;  1MAI A;  1DDW A;  2YVC A;  1XKE A;  1KZG A;  1DBH A;  1NI2 A;  4KHA A;  3DXE A;  2L1C A;  2EMS A;  4DX9 0;  4K2O A;  2YT0 A;  2EJ8 A;  1Y5O A;  3N7C A; 
#chains in the Genus database with same CATH topology
 4KVG B;  1Z87 A;  4HAV B;  1EVH A;  1KI1 B;  4K17 A;  3VIA A;  5KCV A;  1DDM A;  1NTY A;  3DXC A;  4HDO A;  2Q13 A;  2IFS A;  2JP2 A;  1BWN A;  4GMX B;  4HB0 B;  1U5G A;  4EJN A;  2W2X C;  3IVF A;  1P6S A;  5IRS A;  5D3X A;  1IRS A;  2P8V A;  2H7D A;  3SV1 A;  4F7H A;  1TQZ A;  1PLS A;  5I2M A;  3OHM B;  2I5F A;  3BJI A;  2GS0 A;  1BTN A;  2ADZ A;  2R09 A;  2VKI A;  1WGQ A;  4QJ5 B;  2CRF A;  3A8Q A;  3NWA A;  3QBV B;  1FHW A;  4HB2 B;  1MIZ B;  3B77 A;  2J0J A;  4TKN A;  2Y8F A;  1X1F A;  5DHA B;  2DHI A;  3U8Z A;  5LOP B;  1MIX A;  1XD4 A;  3D8F A;  1WG7 A;  3D8E A;  2R0D A;  4K2P A;  2AEH A;  2D4Q A;  1WGU A;  1F5X A;  4IAP A;  1OQN A;  4DIX A;  1UEF A;  1K5G B;  2H7E A;  1DRO A;  2OQB A;  5D3Y A;  2HE7 A;  2UVM A;  5DHF B;  4HDQ A;  2HTH B;  3PVL A;  2DHK A;  4HAT B;  3CIK A;  1X1G A;  3AJ4 A;  2NBV A;  4HAZ B;  1H4R A;  2XQN M;  1UNR A;  1ZC4 B;  2YSZ A;  3QIJ A;  3ML4 A;  2DHJ A;  3CXB B;  3AU5 A;  2DN6 A;  1XOD A;  4A6H A;  2ROZ B;  5C5B B;  1NTV A;  4QJ4 B;  5LON B;  2LOZ A;  3PZD A;  2ZPY A;  2CAY A;  3GYO A;  1MK7 B;  1U5D A;  4GYV A;  1WJM A;  2YT1 A;  1J19 A;  1N3H A;  2YS1 A;  3PVU A;  2UZR A;  5EFX A;  2ZKM X;  4H8S A;  1UPR A;  3ULB A;  5J3Q A;  1UPQ A;  2Z0Q A;  2KIE A;  2P0D A;  1WJ1 A;  2K2U A;  2Z0P A;  2W2X D;  4HAX B;  5KQ4 A;  2LG1 A;  2I1K A;  2PZ1 A;  2G35 A;  3GYP A;  3KRW A;  3U7D A;  1FGY A;  4GPT B;  2YF0 A;  2D9X A;  1Q67 A;  2ROV A;  1V5U A;  1FGZ A;  2EC1 A;  2YRY A;  2ELB A;  2RRF A;  1FB8 A;  1ZSQ A;  3ULC A;  4GN1 A;  2ELA A;  4EMO A;  2D9V A;  2J59 M;  2K2J A;  2COD A;  4HAU B;  2DKP A;  4KAX B;  4A6K A;  1AQC A;  1RJ2 A;  1V5P A;  2N23 A;  3SUZ A;  4CYE A;  3V5W A;  4KHB A;  2J0K A;  4D0N B;  4WVF B;  2YS5 A;  1SGH A;  1T77 A;  4IFS A;  4YL8 A;  1AWE A;  2J0M A;  3GF9 A;  5DIF B;  2FJL A;  1XR0 B;  2MWN B;  4CHJ A;  1GG3 A;  1FHX A;  4TYZ A;  2N0Y A;  3OAN A;  4MK0 A;  2Z13 A;  1U27 A;  1V5M A;  3HK0 A;  2V76 A;  2DA0 A;  4F7U P;  2LKO A;  1W1H A;  2MKR A;  1U5F A;  2CY4 A;  3PEG A;  2LUL A;  1X11 A;  4ZRJ A;  3RCP A;  2LYD A;  2DX5 A;  5DH9 B;  1BTK A;  4KHO A;  3AU4 A;  2DFK A;  2D11 A;  2YT2 A;  2CY5 A;  1K5D B;  2GCJ A;  3LJU X;  1B55 A;  3M1I B;  2RVB B;  1X86 A;  3NW8 A;  1V88 A;  2COC A;  4Z2M B;  5J3Y A;  2RUK B;  1ZM0 A;  2E2X A;  4B6H A;  4PQ0 A;  2DYN A;  2X18 A;  3MPX A;  2D9Z A;  2KGX B;  5J3T A;  3ODO A;  3TO1 A;  4L6E A;  2D9W A;  4YON A;  4Z2N A;  4GNK B;  5D27 A;  2YS3 A;  2FJU B;  4IOY X;  4BBK A;  5C16 A;  3WYF B;  2K8E A;  2M14 A;  3KRX A;  3PVW A;  2COA A;  5JHG A;  2DLW A;  3TFM A;  1P5T A;  5KQ1 A;  2Z4D A;  3UZT A;  5L81 A;  1H10 A;  1TJ6 A;  4GMV A;  5JP4 A;  1ISN A;  1UNQ A;  2GCL A;  5M4Y B;  4KHB B;  4QXA B;  1XX0 A;  2Z59 A;  4C0A A;  4DBB A;  2KUP A;  5HE2 A;  3BIN A;  4MY6 A;  4NSW A;  1BAK A;  1MPH A;  3ODX A;  1SHC A;  2RLO A;  4HAW B;  2AL6 A;  2P0H A;  3F5R A;  3FSS A;  1MK9 B;  2UZS A;  4D0O A;  4A6F A;  2OTX A;  5HE1 A;  1NU2 A;  3VOQ A;  3ODW A;  4HAY B;  2MDX A;  5C6R A;  2VSZ A;  4HB3 B;  2W2W A;  3TVV A;  3HW2 B;  5D3W A;  3QWM A;  4OT1 A;  2KR0 A;  1PMS A;  5I2S A;  1U5E A;  4GOU A;  1V89 A;  1PFJ A;  2Z0O A;  1W1G A;  2D9Y A;  3A98 B;  3PG7 A;  3P6A A;  1Y19 B;  5JLJ B;  4D6W A;  2LOX A;  4WJ7 A;  1UNP A;  3NWD A;  5FI0 A;  2I1J A;  4F7G A;  2EMT A;  1BY1 A;  2KIG A;  4L1R A;  3PP2 A;  3G9W A;  4NY0 A;  3DCX A;  3D8D A;  2RSG A;  1KZ7 A;  1ZYI A;  5D3V A;  2QKL A;  1FHO A;  5CLQ B;  3KSY A;  1LB1 A;  2DKQ A;  3A58 A;  1QQG A;  2DYQ A;  2Z14 A;  3FVC A;  4A5K A;  5C5B A;  1WVH A;  4QJ3 B;  2GJY A;  1X05 A;  1M7R A;  4GZU A;  1P3R A;  2BCJ A;  3DXD A;  1DYN A;  4ZRI A;  2NMB A;  3HQC A;  4EKU A;  1EAZ A;  5GOW B;  1I2H A;  1TXD A;  4DX8 A;  4GXB A;  2D10 A;  1QC6 A;  3EO2 A;  1U29 A;  3SNH A;  5CLL B;  2L2I A;  5HE3 A;  2COF A;  2RGN B;  1FOE A;  1WI1 A;  2I5C A;  2Y7B A;  3A8P A;  3SO6 A;  2NZ8 B;  2R2Y A;  5HE0 A;  2P0F A;  5LG4 B;  1GC7 A;  2D2Q A;  3KY9 A;  1M7E A;  1DDV A;  1I7A A;  4K81 A;  4OSN A;  5JHH A;  3P7Z A;  4A6F B;  1EGX A;  2KUQ A;  3TCA A;  2RNR B;  1E5W A;  2QKM A;  3TW1 A;  3NWF A;  3JV3 A;  2Y8G A;  3FM8 C;  1EF1 A;  3T06 A;  2K49 A;  4HSI A;  2K00 A;  3FEH A;  4MT7 A;  1RRP B;  2KR9 A;  3ZDT A;  3O96 A;  4Y94 A;  4ZRK A;  1FAO A;  4DXA B;  4PNK A;  2VRW B;  1GC6 A;  1MKE A;  2DX1 A;  1ZC3 B;  2M38 A;  5C79 A;  5FI1 A;  1V61 A;  3MDB C;  1XCG A;  2KCJ A;  4HB4 B;  5DI9 B;  2IYB A;  3WA0 A;  4XWX A;  4CSQ A;  1OMW A;  2GUM A;  3KZ1 A;  2DTC A;  3HIE A;  3U12 A;  1OY2 A;  4HHV A;  3ZVR A;  4P7I A;  4CHM A;  3HSA A;  1ZVR A;  3PSC A;  3F0W A;  4WSF A;  1U2B A;  1W1D A;  1J0W A;  1LW3 A;  3NSU A;  3X23 A;  2MFQ A;  3SYX A;  1MAI A;  1DDW A;  2YVC A;  1XKE A;  1KZG A;  1DBH A;  1NI2 A;  4KHA A;  3DXE A;  2L1C A;  2EMS A;  4DX9 0;  1MI1 A;  4K2O A;  2YT0 A;  2EJ8 A;  1Y5O A;  3N7C A; 
#chains in the Genus database with same CATH homology
 4KVG B;  1Z87 A;  4HAV B;  1EVH A;  1KI1 B;  4K17 A;  3VIA A;  5KCV A;  1DDM A;  1NTY A;  3DXC A;  4HDO A;  2Q13 A;  2IFS A;  2JP2 A;  1BWN A;  4GMX B;  4HB0 B;  1U5G A;  4EJN A;  2W2X C;  3IVF A;  1P6S A;  5D3X A;  1IRS A;  2P8V A;  2H7D A;  3SV1 A;  4F7H A;  1TQZ A;  1PLS A;  2I5F A;  3BJI A;  2GS0 A;  1BTN A;  2ADZ A;  2R09 A;  2VKI A;  1WGQ A;  2CRF A;  3A8Q A;  3QBV B;  1FHW A;  4HB2 B;  1MIZ B;  2J0J A;  4TKN A;  2Y8F A;  1X1F A;  5DHA B;  2DHI A;  3U8Z A;  5LOP B;  1MIX A;  1XD4 A;  3D8F A;  1WG7 A;  3D8E A;  2R0D A;  4K2P A;  2AEH A;  2D4Q A;  1WGU A;  1F5X A;  4IAP A;  1OQN A;  1UEF A;  1K5G B;  2H7E A;  1DRO A;  2OQB A;  5D3Y A;  2HE7 A;  2UVM A;  5DHF B;  4HDQ A;  2HTH B;  3PVL A;  2DHK A;  4HAT B;  3CIK A;  1X1G A;  3AJ4 A;  4HAZ B;  1H4R A;  2XQN M;  1UNR A;  1ZC4 B;  2YSZ A;  3QIJ A;  3ML4 A;  3CXB B;  2DHJ A;  3AU5 A;  2DN6 A;  1XOD A;  4A6H A;  2ROZ B;  5C5B B;  1NTV A;  5LON B;  2LOZ A;  3PZD A;  2ZPY A;  2CAY A;  3GYO A;  1MK7 B;  1U5D A;  4GYV A;  1WJM A;  2YT1 A;  1J19 A;  1N3H A;  2YS1 A;  3PVU A;  2UZR A;  5EFX A;  4H8S A;  1UPR A;  3ULB A;  5J3Q A;  1UPQ A;  2Z0Q A;  2P0D A;  1WJ1 A;  2K2U A;  2Z0P A;  2W2X D;  4HAX B;  5KQ4 A;  2LG1 A;  2I1K A;  2PZ1 A;  2G35 A;  3GYP A;  3KRW A;  3U7D A;  1FGY A;  4GPT B;  2YF0 A;  2D9X A;  1Q67 A;  2ROV A;  1V5U A;  1FGZ A;  2EC1 A;  2YRY A;  2ELB A;  1FB8 A;  1ZSQ A;  3ULC A;  4GN1 A;  2ELA A;  4EMO A;  2D9V A;  2J59 M;  2K2J A;  2COD A;  4HAU B;  2DKP A;  4KAX B;  4A6K A;  1AQC A;  1RJ2 A;  1V5P A;  2N23 A;  3SUZ A;  4CYE A;  3V5W A;  2J0K A;  4D0N B;  4WVF B;  2YS5 A;  1SGH A;  4IFS A;  4YL8 A;  1AWE A;  2J0M A;  3GF9 A;  5DIF B;  2FJL A;  1XR0 B;  2MWN B;  4CHJ A;  1GG3 A;  1FHX A;  4TYZ A;  2N0Y A;  3OAN A;  4MK0 A;  1U27 A;  1V5M A;  3HK0 A;  2V76 A;  2DA0 A;  4F7U P;  2LKO A;  1W1H A;  2MKR A;  1U5F A;  2CY4 A;  3PEG A;  2LUL A;  1X11 A;  4ZRJ A;  3RCP A;  2LYD A;  2DX5 A;  5DH9 B;  1BTK A;  4KHO A;  3AU4 A;  2DFK A;  2D11 A;  2CY5 A;  1K5D B;  2GCJ A;  3LJU X;  1B55 A;  3M1I B;  2RVB B;  1X86 A;  1V88 A;  2COC A;  4Z2M B;  5J3Y A;  2RUK B;  1ZM0 A;  2E2X A;  4B6H A;  4PQ0 A;  2DYN A;  2X18 A;  3MPX A;  2D9Z A;  2KGX B;  5J3T A;  3ODO A;  3TO1 A;  4L6E A;  2D9W A;  4YON A;  4Z2N A;  5D27 A;  2YS3 A;  4IOY X;  4BBK A;  5C16 A;  3WYF B;  2M14 A;  3KRX A;  3PVW A;  2COA A;  5JHG A;  2DLW A;  3TFM A;  1P5T A;  5KQ1 A;  3UZT A;  5L81 A;  1H10 A;  1TJ6 A;  4GMV A;  5JP4 A;  1ISN A;  1UNQ A;  2GCL A;  4KHB B;  1XX0 A;  4C0A A;  4DBB A;  2KUP A;  5HE2 A;  3BIN A;  4MY6 A;  4NSW A;  1BAK A;  1MPH A;  3ODX A;  1SHC A;  2RLO A;  4HAW B;  2AL6 A;  2P0H A;  3F5R A;  3FSS A;  1MK9 B;  2UZS A;  4D0O A;  4A6F A;  2OTX A;  5HE1 A;  1NU2 A;  3VOQ A;  3ODW A;  4HAY B;  2MDX A;  5C6R A;  2VSZ A;  4HB3 B;  2W2W A;  3TVV A;  3HW2 B;  5D3W A;  3QWM A;  1PMS A;  1U5E A;  4GOU A;  1V89 A;  1PFJ A;  2Z0O A;  1W1G A;  2D9Y A;  3A98 B;  3PG7 A;  3P6A A;  1Y19 B;  5JLJ B;  2LOX A;  4WJ7 A;  1UNP A;  5FI0 A;  2I1J A;  4F7G A;  2EMT A;  1BY1 A;  3PP2 A;  3G9W A;  4NY0 A;  3D8D A;  2RSG A;  1KZ7 A;  5D3V A;  2QKL A;  1FHO A;  5CLQ B;  3KSY A;  1LB1 A;  2DKQ A;  1QQG A;  2DYQ A;  4A5K A;  5C5B A;  1WVH A;  2GJY A;  1X05 A;  3DXD A;  1M7R A;  4GZU A;  1P3R A;  2BCJ A;  1DYN A;  4ZRI A;  2NMB A;  3HQC A;  4EKU A;  1EAZ A;  5GOW B;  1I2H A;  1TXD A;  4DX8 A;  4GXB A;  2D10 A;  1QC6 A;  3EO2 A;  1U29 A;  3SNH A;  5CLL B;  2L2I A;  5HE3 A;  2COF A;  2RGN B;  1FOE A;  1WI1 A;  2I5C A;  2Y7B A;  3A8P A;  3SO6 A;  2NZ8 B;  5HE0 A;  2P0F A;  1GC7 A;  2D2Q A;  3KY9 A;  1M7E A;  1DDV A;  1I7A A;  4K81 A;  5JHH A;  3P7Z A;  4A6F B;  1EGX A;  3TCA A;  2RNR B;  1E5W A;  2QKM A;  3TW1 A;  3JV3 A;  2Y8G A;  3FM8 C;  1EF1 A;  3T06 A;  2K00 A;  3FEH A;  4MT7 A;  1RRP B;  2KR9 A;  3ZDT A;  3O96 A;  4Y94 A;  4ZRK A;  1FAO A;  4DXA B;  4PNK A;  2VRW B;  1GC6 A;  1MKE A;  2DX1 A;  1ZC3 B;  2M38 A;  5C79 A;  5FI1 A;  1V61 A;  3MDB C;  1XCG A;  2KCJ A;  4HB4 B;  5DI9 B;  2IYB A;  3WA0 A;  4XWX A;  1OMW A;  3KZ1 A;  2DTC A;  1OY2 A;  4HHV A;  3ZVR A;  4P7I A;  4CHM A;  1ZVR A;  3PSC A;  3F0W A;  4WSF A;  1U2B A;  1W1D A;  1J0W A;  1LW3 A;  3NSU A;  3X23 A;  2MFQ A;  3SYX A;  1MAI A;  1DDW A;  2YVC A;  1XKE A;  1KZG A;  1DBH A;  1NI2 A;  4KHA A;  3DXE A;  2L1C A;  2EMS A;  4DX9 0;  4K2O A;  2YT0 A;  2EJ8 A;  1Y5O A;  3N7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...