3RCPA

Crystal structure of the fapp1 pleckstrin homology domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
100
Chain Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Molecular Basis of Phosphatidylinositol 4-Phosphate and ARF1 GTPase Recognition by the FAPP1 Pleckstrin Homology (PH) Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 15
structure length 100
sequence length 103
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3rcpA00
2I1JA 1BAKA 3QBVB 2DFKA 1W1GA 1UPRA 3ZVRA 2DA0A 4A5KA 2PZ1A 1AQCA 2Y8GA 5DH9B 4XWXA 4Y94A 4BBKA 4K2OA 3WYFB 3MPXA 5KQ4A 2D2QA 2P0HA 1X1FA 5JP4A 2M38A 3KRWA 3ULCA 4WVFB 1ZM0A 5GOWB 1FHWA 2AEHA 3MDBC 1XD4A 3PVUA 2QKLA 4GMXB 4HAUB 5D3YA 2Y8FA 2UVMA 4WJ7A 3GYOA 1FHXA 5DHFB 2CODA 4B6HA 4P7IA 2DTCA 2CRFA 3GYPA 4WSFA 1AWEA 4GPTB 3TFMA 3DXDA 4F7GA 2VKIA 1BWNA 1TJ6A 1NTYA 1EGXA 1NTVA 2D11A 4HDOA 2HTHB 3M1IB 4KVGB 2OTXA 2Z0PA 3ULBA 1I2HA 4IAPA 2ELAA 3AU4A 3BJIA 2D9WA 1Y5OA 3SNHA 1XODA 1RJ2A 1FGZA 4KHBB 1WVHA 4HB0B 2CY4A 2DHJA 2J59M 3D8DA 2Z0OA 2ELBA 2J0MA 3ML4A 3WA0A 2DKQA 1U27A 1Y19B 2J0JA 3TW1A 4PQ0A 1WJMA 2CAYA 2RSGA 4HAWB 5J3YA 3F0WA 4ZRJA 3QIJA 1N3HA 1DDMA 2QKMA 2L2IA 2MKRA 1SHCA 1UNPA 1ZC3B 2KCJA 5KCVA 2E2XA 3F5RA 4EMOA 4CYEA 2LULA 2K2JA 2YT1A 1KZGA 2DHKA 5JHGA 2I1KA 5LOPB 5J3TA 2UZSA 1ZC4B 2YVCA 2MFQA 1IRSA 1MKEA 3HW2B 4KAXB 3T06A 2P0FA 2DX5A 4DX8A 5J3QA 3OANA 2AL6A 3BINA 1KZ7A 2YSZA 2LOZA 1DROA 1W1DA 4TYZA 3N7CA 1V88A 4HB3B 5D3XA 1V5PA 2KUPA 1X1GA 2RLOA 3NSUA 4HHVA 4NY0A 4GN1A 1GC7A 4YL8A 1W1HA 5LONB 5DI9B 3TCAA 1WGUA 2G35A 2V76A 3CIKA 4CHJA 1DBHA 1FOEA 4ZRIA 3IVFA 4HAZB 1U5EA 2X18A 4K17A 4TKNA 3KY9A 1WG7A 2J0KA 1P5TA 1V5UA 3U7DA 3DXCA 2DN6A 1K5DB 1H10A 2DLWA 2W2XC 1Q67A 2DHIA 2W2WA 3ODXA 1V61A 1QC6A 2BCJA 2RGNB 2NZ8B 1DYNA 1WJ1A 1FB8A 4K2PA 3VIAA 2IFSA 3PP2A 5HE1A 1MPHA 3UZTA 2COAA 4PNKA 4Z2MB 2ZPYA 4HAYB 2P0DA 4D0NB 2RVBB 2D9VA 5D3VA 5HE2A 3P6AA 3PG7A 1QQGA 4GZUA 2I5CA 2LKOA 4L6EA 3D8EA 2CY5A 2H7DA 3A8QA 5HE0A 2Z0QA 5CLQB 3PSCA 3TO1A 4GMVA 1WI1A 2JP2A 2D9YA 2LOXA 2OQBA 5JHHA 2YS3A 1U5FA 2COCA 3HQCA 1M7RA 3CXBB 2KGXB 5JLJB 1MIXA 2W2XD 3A98B 4DBBA 1KI1B 3HK0A 4A6KA 1PMSA 1UNRA 3SO6A 4EKUA 1B55A 4EJNA 2NMBA 4HB4B 1BTNA 1OMWA 2YT0A 1PLSA 1J19A 2DX1A 3KSYA 2N23A 5C5BB 1TXDA 3O96A 4KHOA 3V5WA 1UPQA 1PFJA 3AU5A 3PZDA 1Z87A 3PVWA 1H4RA 1WGQA 1MIZB 5FI0A 4HATB 1EAZA 2Y7BA 2RUKB 3ODWA 1U2BA 4K81A 1P6SA 1XCGA 2DKPA 2D9XA 1FAOA 3AJ4A 1EF1A 5DIFB 2ROVA 2P8VA 3FM8C 4MK0A 1ZVRA 2GCLA 2GJYA 1LW3A 2H7EA 4IFSA 3ZDTA 1XR0B 3A8PA 3RCPA 4A6FB 3LJUX 4HDQA 1UEFA 2M14A 2DYNA 2D9ZA 5C5BA 2ADZA 3G9WA 2LG1A 2RNRB 1LB1A 3SV1A 4HB2B 2EMSA 4KHAA 2GS0A 4MY6A 5DHAB 3PVLA 2YF0A 3SUZA 1DDVA 3DXEA 1XKEA 5C6RA 1XX0A 1MK9B 4IOYX 2GCJA 2D10A 3SYXA 2D4QA 3FEHA 4F7HA 4DX90 1UNQA 5C79A 1FGYA 1GG3A 1ZSQA 2ROZB 1U5GA 2MWNB 2EC1A 2FJLA 1RRPB 5D3WA 4F7UP 3PEGA 2R0DA 3FSSA 2K2UA 1E5WA 4A6FA 1U5DA 3KZ1A 3TVVA 2IYBA 1P3RA 3X23A 4Z2NA 2YS1A 2Q13A 3VOQA 2EMTA 1X86A 1U29A 1I7AA 5CLLB 5D27A 1V89A 5L81A 1M7EA 1OQNA 4YONA 4C0AA 2VRWB 1NI2A 4CHMA 1J0WA 1MAIA 3QWMA 4H8SA 2HE7A 1NU2A 2DYQA 3U8ZA 4HAVB 2UZRA 1X05A 5HE3A 2K00A 1X11A 2LYDA 2YRYA 3P7ZA 1SGHA 3KRXA 1FHOA 2I5FA 4ZRKA 2L1CA 2N0YA 5C16A 1DDWA 4NSWA 2EJ8A 4HAXB 2VSZA 2YS5A 5FI1A 1TQZA 5EFXA 1BTKA 5KQ1A 1EVHA 3ODOA 1OY2A 4MT7A 4A6HA 1K5GB 3D8FA 1GC6A 1MK7B 2COFA 2XQNM 4GXBA 2MDXA 4DXAB 1V5MA 1ISNA 2R09A
chains in the Genus database with same CATH superfamily
2I1JA 3NWAA 1BAKA 3QBVB 2DFKA 1W1GA 1UPRA 3ZVRA 2DA0A 4A5KA 2PZ1A 1AQCA 2Y8GA 5DH9B 4XWXA 4Y94A 4BBKA 4K2OA 3WYFB 3MPXA 5KQ4A 1ZYIA 5I2SA 2D2QA 2P0HA 3U12A 1X1FA 5JP4A 2M38A 3KRWA 3ULCA 4WVFB 1ZM0A 5GOWB 1FHWA 2AEHA 3MDBC 1XD4A 3PVUA 2QKLA 4GMXB 4HAUB 5D3YA 2FJUB 2Y8FA 2UVMA 4WJ7A 1T77A 3GYOA 1FHXA 5DHFB 2CODA 4B6HA 4P7IA 2DTCA 2CRFA 3GYPA 4WSFA 2KIEA 1AWEA 4GPTB 3TFMA 4HSIA 3DXDA 4F7GA 2VKIA 2GUMA 1BWNA 3NWDA 1TJ6A 1NTYA 1EGXA 1NTVA 2D11A 4HDOA 2HTHB 3M1IB 4KVGB 2OTXA 2Z0PA 3ULBA 1I2HA 4IAPA 2YT2A 2ELAA 3AU4A 3BJIA 2D9WA 1Y5OA 3SNHA 1XODA 1RJ2A 1FGZA 4KHBB 1WVHA 4HB0B 2CY4A 2DHJA 2J59M 3D8DA 2Z0OA 2ELBA 2J0MA 3ML4A 3WA0A 5LG4B 2DKQA 4GOUA 1U27A 1Y19B 2J0JA 3TW1A 4PQ0A 1WJMA 2CAYA 2RSGA 4HAWB 2R2YA 5J3YA 3F0WA 4ZRJA 3QIJA 1N3HA 1DDMA 2Z14A 2QKMA 2L2IA 2MKRA 1SHCA 1UNPA 1ZC3B 2KCJA 5KCVA 2E2XA 3F5RA 4EMOA 4CYEA 2LULA 2K2JA 2YT1A 1KZGA 2DHKA 5JHGA 2I1KA 5LOPB 5J3TA 2NBVA 2UZSA 1ZC4B 2Z4DA 2YVCA 2MFQA 1IRSA 1MKEA 4KHBA 3HW2B 4KAXB 3T06A 4D6WA 2P0FA 2DX5A 4DX8A 5J3QA 3OANA 2AL6A 3BINA 1KZ7A 2YSZA 2LOZA 4OT1A 1DROA 1W1DA 4TYZA 3N7CA 1V88A 4HB3B 5D3XA 1V5PA 2K8EA 2KUPA 1X1GA 2RLOA 3NSUA 4HHVA 4NY0A 4GN1A 1GC7A 4YL8A 1W1HA 5LONB 5DI9B 3TCAA 1WGUA 2G35A 2V76A 3CIKA 4CHJA 1DBHA 1FOEA 3HSAA 2RRFA 4ZRIA 3IVFA 4HAZB 1U5EA 2X18A 4K17A 4TKNA 3KY9A 1WG7A 2J0KA 4QJ4B 1P5TA 1V5UA 3U7DA 3DXCA 2DN6A 1K5DB 1H10A 2DLWA 2W2XC 1Q67A 2DHIA 2W2WA 3ODXA 1V61A 1QC6A 2BCJA 2RGNB 2NZ8B 5I2MA 1DYNA 3FVCA 1WJ1A 1FB8A 4K2PA 3VIAA 2IFSA 3A58A 3PP2A 5HE1A 1MPHA 3UZTA 2COAA 4PNKA 4Z2MB 2ZPYA 4HAYB 2P0DA 3NW8A 4D0NB 2RVBB 2D9VA 5D3VA 5HE2A 3P6AA 3PG7A 1QQGA 4GZUA 2I5CA 2LKOA 4L6EA 3D8EA 2CY5A 2H7DA 3A8QA 5HE0A 2Z0QA 5CLQB 3PSCA 3TO1A 4GMVA 1WI1A 2JP2A 2D9YA 2K49A 2LOXA 2OQBA 2KIGA 5JHHA 2YS3A 1U5FA 2COCA 3HQCA 1M7RA 3CXBB 2KGXB 5JLJB 2Z59A 3B77A 1MIXA 2W2XD 3A98B 4DBBA 1KI1B 3HK0A 4A6KA 1PMSA 4L1RA 1UNRA 3SO6A 4EKUA 1B55A 4EJNA 2NMBA 4HB4B 3NWFA 1BTNA 1OMWA 2YT0A 1PLSA 1J19A 2DX1A 5M4YB 3KSYA 2N23A 5C5BB 1TXDA 3O96A 4KHOA 3V5WA 1UPQA 1PFJA 3AU5A 3PZDA 1Z87A 3PVWA 1H4RA 1WGQA 1MIZB 4QJ5B 5FI0A 4HATB 1EAZA 2Y7BA 2RUKB 3ODWA 2ZKMX 1U2BA 4K81A 1P6SA 1XCGA 2DKPA 1MI1A 2D9XA 1FAOA 3AJ4A 5IRSA 1EF1A 4DIXA 5DIFB 2ROVA 2P8VA 3FM8C 4MK0A 1ZVRA 2Z13A 2GCLA 2GJYA 1LW3A 2H7EA 4OSNA 4IFSA 3ZDTA 1XR0B 3A8PA 3RCPA 4A6FB 3LJUX 4HDQA 4QJ3B 1UEFA 2M14A 2DYNA 2D9ZA 5C5BA 2ADZA 3G9WA 2LG1A 2RNRB 1LB1A 3SV1A 4HB2B 2EMSA 4KHAA 2GS0A 4MY6A 5DHAB 3PVLA 2YF0A 3SUZA 1DDVA 3DXEA 1XKEA 5C6RA 1XX0A 1MK9B 4IOYX 2GCJA 2D10A 3SYXA 2D4QA 3FEHA 4F7HA 4DX90 1UNQA 5C79A 1FGYA 1GG3A 1ZSQA 2ROZB 3OHMB 1U5GA 2MWNB 2EC1A 4GNKB 2FJLA 1RRPB 5D3WA 4F7UP 3PEGA 2R0DA 4QXAB 3FSSA 2K2UA 1E5WA 4A6FA 1U5DA 3KZ1A 3TVVA 2IYBA 1P3RA 3X23A 4Z2NA 2YS1A 2Q13A 3VOQA 2EMTA 1X86A 1U29A 1I7AA 3HIEA 5CLLB 5D27A 1V89A 5L81A 1M7EA 1OQNA 2KUQA 4YONA 4C0AA 2VRWB 1NI2A 4CHMA 1J0WA 1MAIA 3QWMA 4H8SA 2HE7A 1NU2A 2DYQA 3U8ZA 4HAVB 2UZRA 4CSQA 1X05A 5HE3A 2K00A 1X11A 2LYDA 2YRYA 3P7ZA 1SGHA 3KRXA 3DCXA 1FHOA 2I5FA 4ZRKA 2L1CA 2N0YA 5C16A 1DDWA 4NSWA 2EJ8A 4HAXB 2VSZA 2YS5A 5FI1A 1TQZA 5EFXA 1BTKA 2KR0A 5KQ1A 1EVHA 3ODOA 1OY2A 4MT7A 4A6HA 1K5GB 3D8FA 1GC6A 1MK7B 2COFA 2XQNM 4GXBA 2MDXA 4DXAB 1V5MA 1ISNA 2R09A
chains in the Genus database with same CATH topology
2I1JA 1BAKA 3QBVB 2DFKA 1W1GA 1UPRA 3ZVRA 2DA0A 4A5KA 2PZ1A 1AQCA 2Y8GA 5DH9B 4XWXA 4Y94A 4BBKA 4K2OA 3WYFB 3MPXA 5KQ4A 2D2QA 2P0HA 1X1FA 5JP4A 2M38A 3KRWA 3ULCA 4WVFB 1ZM0A 5GOWB 1FHWA 2AEHA 3MDBC 1XD4A 3PVUA 2QKLA 4GMXB 4HAUB 5D3YA 2Y8FA 2UVMA 4WJ7A 3GYOA 1FHXA 5DHFB 2CODA 4B6HA 4P7IA 2DTCA 2CRFA 3GYPA 4WSFA 1AWEA 4GPTB 3TFMA 3DXDA 4F7GA 2VKIA 1BWNA 1TJ6A 1NTYA 1EGXA 1NTVA 2D11A 4HDOA 2HTHB 3M1IB 4KVGB 2OTXA 2Z0PA 3ULBA 1I2HA 4IAPA 2ELAA 3AU4A 3BJIA 2D9WA 1Y5OA 3SNHA 1XODA 1RJ2A 1FGZA 4KHBB 1WVHA 4HB0B 2CY4A 2DHJA 2J59M 3D8DA 2Z0OA 2ELBA 2J0MA 3ML4A 3WA0A 2DKQA 1U27A 1Y19B 2J0JA 3TW1A 4PQ0A 1WJMA 2CAYA 2RSGA 4HAWB 5J3YA 3F0WA 4ZRJA 3QIJA 1N3HA 1DDMA 2QKMA 2L2IA 2MKRA 1SHCA 1UNPA 1ZC3B 2KCJA 5KCVA 2E2XA 3F5RA 4EMOA 4CYEA 2LULA 2K2JA 2YT1A 1KZGA 2DHKA 5JHGA 2I1KA 5LOPB 5J3TA 2UZSA 1ZC4B 2YVCA 2MFQA 1IRSA 1MKEA 3HW2B 4KAXB 3T06A 2P0FA 2DX5A 4DX8A 5J3QA 3OANA 2AL6A 3BINA 1KZ7A 2YSZA 2LOZA 1DROA 1W1DA 4TYZA 3N7CA 1V88A 4HB3B 5D3XA 1V5PA 2KUPA 1X1GA 2RLOA 3NSUA 4HHVA 4NY0A 4GN1A 1GC7A 4YL8A 1W1HA 5LONB 5DI9B 3TCAA 1WGUA 2G35A 2V76A 3CIKA 4CHJA 1DBHA 1FOEA 4ZRIA 3IVFA 4HAZB 1U5EA 2X18A 4K17A 4TKNA 3KY9A 1WG7A 2J0KA 1P5TA 1V5UA 3U7DA 3DXCA 2DN6A 1K5DB 1H10A 2DLWA 2W2XC 1Q67A 2DHIA 2W2WA 3ODXA 1V61A 1QC6A 2BCJA 2RGNB 2NZ8B 1DYNA 1WJ1A 1FB8A 4K2PA 3VIAA 2IFSA 3PP2A 5HE1A 1MPHA 3UZTA 2COAA 4PNKA 4Z2MB 2ZPYA 4HAYB 2P0DA 4D0NB 2RVBB 2D9VA 5D3VA 5HE2A 3P6AA 3PG7A 1QQGA 4GZUA 2I5CA 2LKOA 4L6EA 3D8EA 2CY5A 2H7DA 3A8QA 5HE0A 2Z0QA 5CLQB 3PSCA 3TO1A 4GMVA 1WI1A 2JP2A 2D9YA 2LOXA 2OQBA 5JHHA 2YS3A 1U5FA 2COCA 3HQCA 1M7RA 3CXBB 2KGXB 5JLJB 1MIXA 2W2XD 3A98B 4DBBA 1KI1B 3HK0A 4A6KA 1PMSA 1UNRA 3SO6A 4EKUA 1B55A 4EJNA 2NMBA 4HB4B 1BTNA 1OMWA 2YT0A 1PLSA 1J19A 2DX1A 3KSYA 2N23A 5C5BB 1TXDA 3O96A 4KHOA 3V5WA 1UPQA 1PFJA 3AU5A 3PZDA 1Z87A 3PVWA 1H4RA 1WGQA 1MIZB 5FI0A 4HATB 1EAZA 2Y7BA 2RUKB 3ODWA 1U2BA 4K81A 1P6SA 1XCGA 2DKPA 2D9XA 1FAOA 3AJ4A 1EF1A 5DIFB 2ROVA 2P8VA 3FM8C 4MK0A 1ZVRA 2GCLA 2GJYA 1LW3A 2H7EA 4IFSA 3ZDTA 1XR0B 3A8PA 3RCPA 4A6FB 3LJUX 4HDQA 1UEFA 2M14A 2DYNA 2D9ZA 5C5BA 2ADZA 3G9WA 2LG1A 2RNRB 1LB1A 3SV1A 4HB2B 2EMSA 4KHAA 2GS0A 4MY6A 5DHAB 3PVLA 2YF0A 3SUZA 1DDVA 3DXEA 1XKEA 5C6RA 1XX0A 1MK9B 4IOYX 2GCJA 2D10A 3SYXA 2D4QA 3FEHA 4F7HA 4DX90 1UNQA 5C79A 1FGYA 1GG3A 1ZSQA 2ROZB 1U5GA 2MWNB 2EC1A 2FJLA 1RRPB 5D3WA 4F7UP 3PEGA 2R0DA 3FSSA 2K2UA 1E5WA 4A6FA 1U5DA 3KZ1A 3TVVA 2IYBA 1P3RA 3X23A 4Z2NA 2YS1A 2Q13A 3VOQA 2EMTA 1X86A 1U29A 1I7AA 5CLLB 5D27A 1V89A 5L81A 1M7EA 1OQNA 4YONA 4C0AA 2VRWB 1NI2A 4CHMA 1J0WA 1MAIA 3QWMA 4H8SA 2HE7A 1NU2A 2DYQA 3U8ZA 4HAVB 2UZRA 1X05A 5HE3A 2K00A 1X11A 2LYDA 2YRYA 3P7ZA 1SGHA 3KRXA 1FHOA 2I5FA 4ZRKA 2L1CA 2N0YA 5C16A 1DDWA 4NSWA 2EJ8A 4HAXB 2VSZA 2YS5A 5FI1A 1TQZA 5EFXA 1BTKA 5KQ1A 1EVHA 3ODOA 1OY2A 4MT7A 4A6HA 1K5GB 3D8FA 1GC6A 1MK7B 2COFA 2XQNM 4GXBA 2MDXA 4DXAB 1V5MA 1ISNA 2R09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  1BAK A;  3QBV B;  2DFK A;  1W1G A;  1UPR A;  3ZVR A;  2DA0 A;  4A5K A;  2PZ1 A;  1AQC A;  2Y8G A;  5DH9 B;  4XWX A;  4Y94 A;  4BBK A;  4K2O A;  3WYF B;  3MPX A;  5KQ4 A;  2D2Q A;  2P0H A;  1X1F A;  5JP4 A;  2M38 A;  3KRW A;  3ULC A;  4WVF B;  1ZM0 A;  5GOW B;  1FHW A;  2AEH A;  3MDB C;  1XD4 A;  3PVU A;  2QKL A;  4GMX B;  4HAU B;  5D3Y A;  2Y8F A;  2UVM A;  4WJ7 A;  3GYO A;  1FHX A;  5DHF B;  2COD A;  4B6H A;  4P7I A;  2DTC A;  2CRF A;  3GYP A;  4WSF A;  1AWE A;  4GPT B;  3TFM A;  3DXD A;  4F7G A;  2VKI A;  1BWN A;  1TJ6 A;  1NTY A;  1EGX A;  1NTV A;  2D11 A;  4HDO A;  2HTH B;  3M1I B;  4KVG B;  2OTX A;  2Z0P A;  3ULB A;  1I2H A;  4IAP A;  2ELA A;  3AU4 A;  3BJI A;  2D9W A;  1Y5O A;  3SNH A;  1XOD A;  1RJ2 A;  1FGZ A;  4KHB B;  1WVH A;  4HB0 B;  2CY4 A;  2DHJ A;  2J59 M;  3D8D A;  2Z0O A;  2ELB A;  2J0M A;  3ML4 A;  3WA0 A;  2DKQ A;  1U27 A;  1Y19 B;  2J0J A;  3TW1 A;  4PQ0 A;  1WJM A;  2CAY A;  2RSG A;  4HAW B;  5J3Y A;  3F0W A;  4ZRJ A;  3QIJ A;  1N3H A;  1DDM A;  2QKM A;  2L2I A;  2MKR A;  1SHC A;  1UNP A;  1ZC3 B;  2KCJ A;  5KCV A;  2E2X A;  3F5R A;  4EMO A;  4CYE A;  2LUL A;  2K2J A;  2YT1 A;  1KZG A;  2DHK A;  5JHG A;  2I1K A;  5LOP B;  5J3T A;  2UZS A;  1ZC4 B;  2YVC A;  2MFQ A;  1IRS A;  1MKE A;  3HW2 B;  4KAX B;  3T06 A;  2P0F A;  2DX5 A;  4DX8 A;  5J3Q A;  3OAN A;  2AL6 A;  3BIN A;  1KZ7 A;  2YSZ A;  2LOZ A;  1DRO A;  1W1D A;  4TYZ A;  3N7C A;  1V88 A;  4HB3 B;  5D3X A;  1V5P A;  2KUP A;  1X1G A;  2RLO A;  3NSU A;  4HHV A;  4NY0 A;  4GN1 A;  1GC7 A;  4YL8 A;  1W1H A;  5LON B;  5DI9 B;  3TCA A;  1WGU A;  2G35 A;  2V76 A;  3CIK A;  4CHJ A;  1DBH A;  1FOE A;  4ZRI A;  3IVF A;  4HAZ B;  1U5E A;  2X18 A;  4K17 A;  4TKN A;  3KY9 A;  1WG7 A;  2J0K A;  1P5T A;  1V5U A;  3U7D A;  3DXC A;  2DN6 A;  1K5D B;  1H10 A;  2DLW A;  2W2X C;  1Q67 A;  2DHI A;  2W2W A;  3ODX A;  1V61 A;  1QC6 A;  2BCJ A;  2RGN B;  2NZ8 B;  1DYN A;  1WJ1 A;  1FB8 A;  4K2P A;  3VIA A;  2IFS A;  3PP2 A;  5HE1 A;  1MPH A;  3UZT A;  2COA A;  4PNK A;  4Z2M B;  2ZPY A;  4HAY B;  2P0D A;  4D0N B;  2RVB B;  2D9V A;  5D3V A;  5HE2 A;  3P6A A;  3PG7 A;  1QQG A;  4GZU A;  2I5C A;  2LKO A;  4L6E A;  3D8E A;  2CY5 A;  2H7D A;  3A8Q A;  5HE0 A;  2Z0Q A;  5CLQ B;  3PSC A;  3TO1 A;  4GMV A;  1WI1 A;  2JP2 A;  2D9Y A;  2LOX A;  2OQB A;  5JHH A;  2YS3 A;  1U5F A;  2COC A;  3HQC A;  1M7R A;  3CXB B;  2KGX B;  5JLJ B;  1MIX A;  2W2X D;  3A98 B;  4DBB A;  1KI1 B;  3HK0 A;  4A6K A;  1PMS A;  1UNR A;  3SO6 A;  4EKU A;  1B55 A;  4EJN A;  2NMB A;  4HB4 B;  1BTN A;  1OMW A;  2YT0 A;  1PLS A;  1J19 A;  2DX1 A;  3KSY A;  2N23 A;  5C5B B;  1TXD A;  3O96 A;  4KHO A;  3V5W A;  1UPQ A;  1PFJ A;  3AU5 A;  3PZD A;  1Z87 A;  3PVW A;  1H4R A;  1WGQ A;  1MIZ B;  5FI0 A;  4HAT B;  1EAZ A;  2Y7B A;  2RUK B;  3ODW A;  1U2B A;  4K81 A;  1P6S A;  1XCG A;  2DKP A;  2D9X A;  1FAO A;  3AJ4 A;  1EF1 A;  5DIF B;  2ROV A;  2P8V A;  3FM8 C;  4MK0 A;  1ZVR A;  2GCL A;  2GJY A;  1LW3 A;  2H7E A;  4IFS A;  3ZDT A;  1XR0 B;  3A8P A;  3RCP A;  4A6F B;  3LJU X;  4HDQ A;  1UEF A;  2M14 A;  2DYN A;  2D9Z A;  5C5B A;  2ADZ A;  3G9W A;  2LG1 A;  2RNR B;  1LB1 A;  3SV1 A;  4HB2 B;  2EMS A;  4KHA A;  2GS0 A;  4MY6 A;  5DHA B;  3PVL A;  2YF0 A;  3SUZ A;  1DDV A;  3DXE A;  1XKE A;  5C6R A;  1XX0 A;  1MK9 B;  4IOY X;  2GCJ A;  2D10 A;  3SYX A;  2D4Q A;  3FEH A;  4F7H A;  4DX9 0;  1UNQ A;  5C79 A;  1FGY A;  1GG3 A;  1ZSQ A;  2ROZ B;  1U5G A;  2MWN B;  2EC1 A;  2FJL A;  1RRP B;  5D3W A;  4F7U P;  3PEG A;  2R0D A;  3FSS A;  2K2U A;  1E5W A;  4A6F A;  1U5D A;  3KZ1 A;  3TVV A;  2IYB A;  1P3R A;  3X23 A;  4Z2N A;  2YS1 A;  2Q13 A;  3VOQ A;  2EMT A;  1X86 A;  1U29 A;  1I7A A;  5CLL B;  5D27 A;  1V89 A;  5L81 A;  1M7E A;  1OQN A;  4YON A;  4C0A A;  2VRW B;  1NI2 A;  4CHM A;  1J0W A;  1MAI A;  3QWM A;  4H8S A;  2HE7 A;  1NU2 A;  2DYQ A;  3U8Z A;  4HAV B;  2UZR A;  1X05 A;  5HE3 A;  2K00 A;  1X11 A;  2LYD A;  2YRY A;  3P7Z A;  1SGH A;  3KRX A;  1FHO A;  2I5F A;  4ZRK A;  2L1C A;  2N0Y A;  5C16 A;  1DDW A;  4NSW A;  2EJ8 A;  4HAX B;  2VSZ A;  2YS5 A;  5FI1 A;  1TQZ A;  5EFX A;  1BTK A;  5KQ1 A;  1EVH A;  3ODO A;  1OY2 A;  4MT7 A;  4A6H A;  1K5G B;  3D8F A;  1GC6 A;  1MK7 B;  2COF A;  2XQN M;  4GXB A;  2MDX A;  4DXA B;  1V5M A;  1ISN A;  2R09 A; 
#chains in the Genus database with same CATH topology
 2I1J A;  3NWA A;  1BAK A;  3QBV B;  2DFK A;  1W1G A;  1UPR A;  3ZVR A;  2DA0 A;  4A5K A;  2PZ1 A;  1AQC A;  2Y8G A;  5DH9 B;  4XWX A;  4Y94 A;  4BBK A;  4K2O A;  3WYF B;  3MPX A;  5KQ4 A;  1ZYI A;  5I2S A;  2D2Q A;  2P0H A;  3U12 A;  1X1F A;  5JP4 A;  2M38 A;  3KRW A;  3ULC A;  4WVF B;  1ZM0 A;  5GOW B;  1FHW A;  2AEH A;  3MDB C;  1XD4 A;  3PVU A;  2QKL A;  4GMX B;  4HAU B;  5D3Y A;  2FJU B;  2Y8F A;  2UVM A;  4WJ7 A;  1T77 A;  3GYO A;  1FHX A;  5DHF B;  2COD A;  4B6H A;  4P7I A;  2DTC A;  2CRF A;  3GYP A;  4WSF A;  2KIE A;  1AWE A;  4GPT B;  3TFM A;  4HSI A;  3DXD A;  4F7G A;  2VKI A;  2GUM A;  1BWN A;  3NWD A;  1TJ6 A;  1NTY A;  1EGX A;  1NTV A;  2D11 A;  4HDO A;  2HTH B;  3M1I B;  4KVG B;  2OTX A;  2Z0P A;  3ULB A;  1I2H A;  4IAP A;  2YT2 A;  2ELA A;  3AU4 A;  3BJI A;  2D9W A;  1Y5O A;  3SNH A;  1XOD A;  1RJ2 A;  1FGZ A;  4KHB B;  1WVH A;  4HB0 B;  2CY4 A;  2DHJ A;  2J59 M;  3D8D A;  2Z0O A;  2ELB A;  2J0M A;  3ML4 A;  3WA0 A;  5LG4 B;  2DKQ A;  4GOU A;  1U27 A;  1Y19 B;  2J0J A;  3TW1 A;  4PQ0 A;  1WJM A;  2CAY A;  2RSG A;  4HAW B;  2R2Y A;  5J3Y A;  3F0W A;  4ZRJ A;  3QIJ A;  1N3H A;  1DDM A;  2Z14 A;  2QKM A;  2L2I A;  2MKR A;  1SHC A;  1UNP A;  1ZC3 B;  2KCJ A;  5KCV A;  2E2X A;  3F5R A;  4EMO A;  4CYE A;  2LUL A;  2K2J A;  2YT1 A;  1KZG A;  2DHK A;  5JHG A;  2I1K A;  5LOP B;  5J3T A;  2NBV A;  2UZS A;  1ZC4 B;  2Z4D A;  2YVC A;  2MFQ A;  1IRS A;  1MKE A;  4KHB A;  3HW2 B;  4KAX B;  3T06 A;  4D6W A;  2P0F A;  2DX5 A;  4DX8 A;  5J3Q A;  3OAN A;  2AL6 A;  3BIN A;  1KZ7 A;  2YSZ A;  2LOZ A;  4OT1 A;  1DRO A;  1W1D A;  4TYZ A;  3N7C A;  1V88 A;  4HB3 B;  5D3X A;  1V5P A;  2K8E A;  2KUP A;  1X1G A;  2RLO A;  3NSU A;  4HHV A;  4NY0 A;  4GN1 A;  1GC7 A;  4YL8 A;  1W1H A;  5LON B;  5DI9 B;  3TCA A;  1WGU A;  2G35 A;  2V76 A;  3CIK A;  4CHJ A;  1DBH A;  1FOE A;  3HSA A;  2RRF A;  4ZRI A;  3IVF A;  4HAZ B;  1U5E A;  2X18 A;  4K17 A;  4TKN A;  3KY9 A;  1WG7 A;  2J0K A;  4QJ4 B;  1P5T A;  1V5U A;  3U7D A;  3DXC A;  2DN6 A;  1K5D B;  1H10 A;  2DLW A;  2W2X C;  1Q67 A;  2DHI A;  2W2W A;  3ODX A;  1V61 A;  1QC6 A;  2BCJ A;  2RGN B;  2NZ8 B;  5I2M A;  1DYN A;  3FVC A;  1WJ1 A;  1FB8 A;  4K2P A;  3VIA A;  2IFS A;  3A58 A;  3PP2 A;  5HE1 A;  1MPH A;  3UZT A;  2COA A;  4PNK A;  4Z2M B;  2ZPY A;  4HAY B;  2P0D A;  3NW8 A;  4D0N B;  2RVB B;  2D9V A;  5D3V A;  5HE2 A;  3P6A A;  3PG7 A;  1QQG A;  4GZU A;  2I5C A;  2LKO A;  4L6E A;  3D8E A;  2CY5 A;  2H7D A;  3A8Q A;  5HE0 A;  2Z0Q A;  5CLQ B;  3PSC A;  3TO1 A;  4GMV A;  1WI1 A;  2JP2 A;  2D9Y A;  2K49 A;  2LOX A;  2OQB A;  2KIG A;  5JHH A;  2YS3 A;  1U5F A;  2COC A;  3HQC A;  1M7R A;  3CXB B;  2KGX B;  5JLJ B;  2Z59 A;  3B77 A;  1MIX A;  2W2X D;  3A98 B;  4DBB A;  1KI1 B;  3HK0 A;  4A6K A;  1PMS A;  4L1R A;  1UNR A;  3SO6 A;  4EKU A;  1B55 A;  4EJN A;  2NMB A;  4HB4 B;  3NWF A;  1BTN A;  1OMW A;  2YT0 A;  1PLS A;  1J19 A;  2DX1 A;  5M4Y B;  3KSY A;  2N23 A;  5C5B B;  1TXD A;  3O96 A;  4KHO A;  3V5W A;  1UPQ A;  1PFJ A;  3AU5 A;  3PZD A;  1Z87 A;  3PVW A;  1H4R A;  1WGQ A;  1MIZ B;  4QJ5 B;  5FI0 A;  4HAT B;  1EAZ A;  2Y7B A;  2RUK B;  3ODW A;  2ZKM X;  1U2B A;  4K81 A;  1P6S A;  1XCG A;  2DKP A;  1MI1 A;  2D9X A;  1FAO A;  3AJ4 A;  5IRS A;  1EF1 A;  4DIX A;  5DIF B;  2ROV A;  2P8V A;  3FM8 C;  4MK0 A;  1ZVR A;  2Z13 A;  2GCL A;  2GJY A;  1LW3 A;  2H7E A;  4OSN A;  4IFS A;  3ZDT A;  1XR0 B;  3A8P A;  3RCP A;  4A6F B;  3LJU X;  4HDQ A;  4QJ3 B;  1UEF A;  2M14 A;  2DYN A;  2D9Z A;  5C5B A;  2ADZ A;  3G9W A;  2LG1 A;  2RNR B;  1LB1 A;  3SV1 A;  4HB2 B;  2EMS A;  4KHA A;  2GS0 A;  4MY6 A;  5DHA B;  3PVL A;  2YF0 A;  3SUZ A;  1DDV A;  3DXE A;  1XKE A;  5C6R A;  1XX0 A;  1MK9 B;  4IOY X;  2GCJ A;  2D10 A;  3SYX A;  2D4Q A;  3FEH A;  4F7H A;  4DX9 0;  1UNQ A;  5C79 A;  1FGY A;  1GG3 A;  1ZSQ A;  2ROZ B;  3OHM B;  1U5G A;  2MWN B;  2EC1 A;  4GNK B;  2FJL A;  1RRP B;  5D3W A;  4F7U P;  3PEG A;  2R0D A;  4QXA B;  3FSS A;  2K2U A;  1E5W A;  4A6F A;  1U5D A;  3KZ1 A;  3TVV A;  2IYB A;  1P3R A;  3X23 A;  4Z2N A;  2YS1 A;  2Q13 A;  3VOQ A;  2EMT A;  1X86 A;  1U29 A;  1I7A A;  3HIE A;  5CLL B;  5D27 A;  1V89 A;  5L81 A;  1M7E A;  1OQN A;  2KUQ A;  4YON A;  4C0A A;  2VRW B;  1NI2 A;  4CHM A;  1J0W A;  1MAI A;  3QWM A;  4H8S A;  2HE7 A;  1NU2 A;  2DYQ A;  3U8Z A;  4HAV B;  2UZR A;  4CSQ A;  1X05 A;  5HE3 A;  2K00 A;  1X11 A;  2LYD A;  2YRY A;  3P7Z A;  1SGH A;  3KRX A;  3DCX A;  1FHO A;  2I5F A;  4ZRK A;  2L1C A;  2N0Y A;  5C16 A;  1DDW A;  4NSW A;  2EJ8 A;  4HAX B;  2VSZ A;  2YS5 A;  5FI1 A;  1TQZ A;  5EFX A;  1BTK A;  2KR0 A;  5KQ1 A;  1EVH A;  3ODO A;  1OY2 A;  4MT7 A;  4A6H A;  1K5G B;  3D8F A;  1GC6 A;  1MK7 B;  2COF A;  2XQN M;  4GXB A;  2MDX A;  4DXA B;  1V5M A;  1ISN A;  2R09 A; 
#chains in the Genus database with same CATH homology
 2I1J A;  1BAK A;  3QBV B;  2DFK A;  1W1G A;  1UPR A;  3ZVR A;  2DA0 A;  4A5K A;  2PZ1 A;  1AQC A;  2Y8G A;  5DH9 B;  4XWX A;  4Y94 A;  4BBK A;  4K2O A;  3WYF B;  3MPX A;  5KQ4 A;  2D2Q A;  2P0H A;  1X1F A;  5JP4 A;  2M38 A;  3KRW A;  3ULC A;  4WVF B;  1ZM0 A;  5GOW B;  1FHW A;  2AEH A;  3MDB C;  1XD4 A;  3PVU A;  2QKL A;  4GMX B;  4HAU B;  5D3Y A;  2Y8F A;  2UVM A;  4WJ7 A;  3GYO A;  1FHX A;  5DHF B;  2COD A;  4B6H A;  4P7I A;  2DTC A;  2CRF A;  3GYP A;  4WSF A;  1AWE A;  4GPT B;  3TFM A;  3DXD A;  4F7G A;  2VKI A;  1BWN A;  1TJ6 A;  1NTY A;  1EGX A;  1NTV A;  2D11 A;  4HDO A;  2HTH B;  3M1I B;  4KVG B;  2OTX A;  2Z0P A;  3ULB A;  1I2H A;  4IAP A;  2ELA A;  3AU4 A;  3BJI A;  2D9W A;  1Y5O A;  3SNH A;  1XOD A;  1RJ2 A;  1FGZ A;  4KHB B;  1WVH A;  4HB0 B;  2CY4 A;  2DHJ A;  2J59 M;  3D8D A;  2Z0O A;  2ELB A;  2J0M A;  3ML4 A;  3WA0 A;  2DKQ A;  1U27 A;  1Y19 B;  2J0J A;  3TW1 A;  4PQ0 A;  1WJM A;  2CAY A;  2RSG A;  4HAW B;  5J3Y A;  3F0W A;  4ZRJ A;  3QIJ A;  1N3H A;  1DDM A;  2QKM A;  2L2I A;  2MKR A;  1SHC A;  1UNP A;  1ZC3 B;  2KCJ A;  5KCV A;  2E2X A;  3F5R A;  4EMO A;  4CYE A;  2LUL A;  2K2J A;  2YT1 A;  1KZG A;  2DHK A;  5JHG A;  2I1K A;  5LOP B;  5J3T A;  2UZS A;  1ZC4 B;  2YVC A;  2MFQ A;  1IRS A;  1MKE A;  3HW2 B;  4KAX B;  3T06 A;  2P0F A;  2DX5 A;  4DX8 A;  5J3Q A;  3OAN A;  2AL6 A;  3BIN A;  1KZ7 A;  2YSZ A;  2LOZ A;  1DRO A;  1W1D A;  4TYZ A;  3N7C A;  1V88 A;  4HB3 B;  5D3X A;  1V5P A;  2KUP A;  1X1G A;  2RLO A;  3NSU A;  4HHV A;  4NY0 A;  4GN1 A;  1GC7 A;  4YL8 A;  1W1H A;  5LON B;  5DI9 B;  3TCA A;  1WGU A;  2G35 A;  2V76 A;  3CIK A;  4CHJ A;  1DBH A;  1FOE A;  4ZRI A;  3IVF A;  4HAZ B;  1U5E A;  2X18 A;  4K17 A;  4TKN A;  3KY9 A;  1WG7 A;  2J0K A;  1P5T A;  1V5U A;  3U7D A;  3DXC A;  2DN6 A;  1K5D B;  1H10 A;  2DLW A;  2W2X C;  1Q67 A;  2DHI A;  2W2W A;  3ODX A;  1V61 A;  1QC6 A;  2BCJ A;  2RGN B;  2NZ8 B;  1DYN A;  1WJ1 A;  1FB8 A;  4K2P A;  3VIA A;  2IFS A;  3PP2 A;  5HE1 A;  1MPH A;  3UZT A;  2COA A;  4PNK A;  4Z2M B;  2ZPY A;  4HAY B;  2P0D A;  4D0N B;  2RVB B;  2D9V A;  5D3V A;  5HE2 A;  3P6A A;  3PG7 A;  1QQG A;  4GZU A;  2I5C A;  2LKO A;  4L6E A;  3D8E A;  2CY5 A;  2H7D A;  3A8Q A;  5HE0 A;  2Z0Q A;  5CLQ B;  3PSC A;  3TO1 A;  4GMV A;  1WI1 A;  2JP2 A;  2D9Y A;  2LOX A;  2OQB A;  5JHH A;  2YS3 A;  1U5F A;  2COC A;  3HQC A;  1M7R A;  3CXB B;  2KGX B;  5JLJ B;  1MIX A;  2W2X D;  3A98 B;  4DBB A;  1KI1 B;  3HK0 A;  4A6K A;  1PMS A;  1UNR A;  3SO6 A;  4EKU A;  1B55 A;  4EJN A;  2NMB A;  4HB4 B;  1BTN A;  1OMW A;  2YT0 A;  1PLS A;  1J19 A;  2DX1 A;  3KSY A;  2N23 A;  5C5B B;  1TXD A;  3O96 A;  4KHO A;  3V5W A;  1UPQ A;  1PFJ A;  3AU5 A;  3PZD A;  1Z87 A;  3PVW A;  1H4R A;  1WGQ A;  1MIZ B;  5FI0 A;  4HAT B;  1EAZ A;  2Y7B A;  2RUK B;  3ODW A;  1U2B A;  4K81 A;  1P6S A;  1XCG A;  2DKP A;  2D9X A;  1FAO A;  3AJ4 A;  1EF1 A;  5DIF B;  2ROV A;  2P8V A;  3FM8 C;  4MK0 A;  1ZVR A;  2GCL A;  2GJY A;  1LW3 A;  2H7E A;  4IFS A;  3ZDT A;  1XR0 B;  3A8P A;  3RCP A;  4A6F B;  3LJU X;  4HDQ A;  1UEF A;  2M14 A;  2DYN A;  2D9Z A;  5C5B A;  2ADZ A;  3G9W A;  2LG1 A;  2RNR B;  1LB1 A;  3SV1 A;  4HB2 B;  2EMS A;  4KHA A;  2GS0 A;  4MY6 A;  5DHA B;  3PVL A;  2YF0 A;  3SUZ A;  1DDV A;  3DXE A;  1XKE A;  5C6R A;  1XX0 A;  1MK9 B;  4IOY X;  2GCJ A;  2D10 A;  3SYX A;  2D4Q A;  3FEH A;  4F7H A;  4DX9 0;  1UNQ A;  5C79 A;  1FGY A;  1GG3 A;  1ZSQ A;  2ROZ B;  1U5G A;  2MWN B;  2EC1 A;  2FJL A;  1RRP B;  5D3W A;  4F7U P;  3PEG A;  2R0D A;  3FSS A;  2K2U A;  1E5W A;  4A6F A;  1U5D A;  3KZ1 A;  3TVV A;  2IYB A;  1P3R A;  3X23 A;  4Z2N A;  2YS1 A;  2Q13 A;  3VOQ A;  2EMT A;  1X86 A;  1U29 A;  1I7A A;  5CLL B;  5D27 A;  1V89 A;  5L81 A;  1M7E A;  1OQN A;  4YON A;  4C0A A;  2VRW B;  1NI2 A;  4CHM A;  1J0W A;  1MAI A;  3QWM A;  4H8S A;  2HE7 A;  1NU2 A;  2DYQ A;  3U8Z A;  4HAV B;  2UZR A;  1X05 A;  5HE3 A;  2K00 A;  1X11 A;  2LYD A;  2YRY A;  3P7Z A;  1SGH A;  3KRX A;  1FHO A;  2I5F A;  4ZRK A;  2L1C A;  2N0Y A;  5C16 A;  1DDW A;  4NSW A;  2EJ8 A;  4HAX B;  2VSZ A;  2YS5 A;  5FI1 A;  1TQZ A;  5EFX A;  1BTK A;  5KQ1 A;  1EVH A;  3ODO A;  1OY2 A;  4MT7 A;  4A6H A;  1K5G B;  3D8F A;  1GC6 A;  1MK7 B;  2COF A;  2XQN M;  4GXB A;  2MDX A;  4DXA B;  1V5M A;  1ISN A;  2R09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...