3RCPA

Crystal structure of the fapp1 pleckstrin homology domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
100
Chain Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Molecular Basis of Phosphatidylinositol 4-Phosphate and ARF1 GTPase Recognition by the FAPP1 Pleckstrin Homology (PH) Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 15
structure length 100
sequence length 103
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3rcpA00
1NTYA 4HATB 4K17A 1UNPA 3MDBC 2MFQA 1XR0B 1Y19B 3VIAA 2ELBA 2ROZB 2LOZA 1IRSA 4HAWB 3F5RA 2YSZA 3SYXA 1UPQA 4EKUA 5CLLB 1BTKA 3NSUA 5KCVA 1PFJA 2I1KA 4GPTB 3FEHA 2DX5A 1U5DA 1FGYA 4PNKA 2EC1A 1FAOA 1N3HA 2V76A 4Y94A 4A5KA 1NI2A 2K00A 2RLOA 4EMOA 5D3YA 2UZRA 1TJ6A 2AEHA 1X05A 4ZRKA 1ISNA 2GCJA 3A98B 4WVFB 3TVVA 1P3RA 1KZGA 4KHBB 3OANA 2RSGA 3RCPA 3PG7A 4F7HA 4EJNA 1J19A 1SGHA 1OMWA 3ODWA 1EF1A 1NU2A 2D9YA 3D8FA 3GYPA 3FSSA 2Q13A 3BINA 3AU4A 3SUZA 2R0DA 2EMSA 2DLWA 3DXEA 4WSFA 5FI0A 5JHHA 1ZVRA 1NTVA 2I5CA 3UZTA 1QQGA 2YT1A 1DYNA 3QBVB 4NSWA 2IFSA 4IFSA 1XKEA 2L2IA 2OQBA 2W2WA 2DTCA 1DDMA 2J0KA 1W1DA 2Z0PA 2L1CA 2D4QA 2COAA 2VSZA 4HB0B 1BTNA 1U5EA 1M7EA 3ULCA 1AWEA 4H8SA 4HB3B 1UNRA 3X23A 4KHAA 1WI1A 5D3VA 2VRWB 1K5GB 2ZPYA 2DHJA 4NY0A 1P6SA 2N23A 3CXBB 3ZDTA 2MDXA 3DXDA 1V5MA 4HHVA 3TFMA 4ZRIA 1Y5OA 5KQ4A 1H10A 2JP2A 3AU5A 4MY6A 4CHMA 1OQNA 2J0MA 1WG7A 1MKEA 4K81A 2P0DA 1X1FA 1ZC4B 5GOWB 3FM8C 4IOYX 1XX0A 1MIZB 1LW3A 1MK7B 2D9VA 2R09A 2NMBA 2NZ8B 3CIKA 2CY4A 2E2XA 4GN1A 5J3YA 5C16A 2G35A 5C79A 1DDWA 2H7DA 2IYBA 1B55A 3SV1A 3KY9A 5DH9B 4K2OA 2YS3A 2M14A 2QKLA 3HW2B 3PP2A 1UEFA 3D8DA 2LULA 1X1GA 4HDOA 4D0NB 4Z2NA 2CAYA 2RGNB 5DHAB 4P7IA 1E5WA 2YRYA 5C5BA 5JP4A 1XD4A 2DKQA 2GCLA 5HE2A 3SO6A 1WGUA 5LOPB 1V5UA 5DIFB 2Z0OA 5L81A 2M38A 4PQ0A 2J59M 2GJYA 5DI9B 4DXAB 1W1GA 1QC6A 1XODA 3PEGA 1FOEA 3PVLA 1U2BA 2YS1A 3KZ1A 4L6EA 1FHXA 4CHJA 4A6FB 2P8VA 2EJ8A 2LYDA 2MKRA 3QIJA 1M7RA 4HAYB 2DYNA 4HB2B 4HAXB 4DBBA 3TO1A 3V5WA 1PLSA 3HQCA 1RRPB 4CYEA 5JLJB 3KSYA 2H7EA 2COCA 1I2HA 5FI1A 5CLQB 3T06A 3ULBA 1PMSA 4WJ7A 5LONB 2W2XC 2DX1A 4K2PA 2ELAA 2DKPA 1GC6A 3ML4A 1V89A 2X18A 1I7AA 3U7DA 1U5GA 2RVBB 1V88A 2D10A 4KAXB 1BAKA 2CRFA 2P0HA 1X86A 3WYFB 5DHFB 4C0AA 1Q67A 2COFA 1U27A 1KZ7A 2D9ZA 2ROVA 5HE3A 2KCJA 1WVHA 4XWXA 1ZM0A 2I1JA 1SHCA 5HE0A 3VOQA 4TKNA 3HK0A 2K2JA 3BJIA 1AQCA 1MAIA 2DN6A 2YT0A 3PSCA 1FHOA 2KGXB 2AL6A 4GZUA 4F7UP 2QKMA 3U8ZA 2LG1A 2CODA 4Z2MB 3PZDA 1WJMA 4KVGB 3G9WA 2Z0QA 2HTHB 5JHGA 1P5TA 4DX90 1UNQA 2YVCA 2DYQA 1K5DB 2GS0A 3DXCA 1MPHA 2DA0A 4HAZB 3F0WA 1XCGA 1EAZA 2J0JA 1GC7A 1FB8A 2MWNB 4HB4B 2LKOA 1LB1A 2XQNM 2EMTA 3QWMA 4F7GA 4GMVA 2I5FA 3TW1A 5D3WA 5D3XA 2PZ1A 4ZRJA 1H4RA 1EGXA 4MK0A 4MT7A 5J3TA 2Y8GA 3IVFA 2KUPA 4GMXB 4B6HA 2D2QA 2FJLA 1ZC3B 1W1HA 3P7ZA 1BWNA 4BBKA 1FHWA 1GG3A 3N7CA 4A6KA 2DFKA 1V61A 4A6HA 5EFXA 3M1IB 4YL8A 2RNRB 1U5FA 3KRXA 5J3QA 1WGQA 2VKIA 1V5PA 3TCAA 2CY5A 2HE7A 3SNHA 2P0FA 2ADZA 2RUKB 2YF0A 3KRWA 3PVWA 1FGZA 1TQZA 1X11A 3AJ4A 2W2XD 1MK9B 1Z87A 1DROA 1UPRA 3WA0A 2D9WA 3LJUX 1RJ2A 1WJ1A 5C5BB 1DBHA 3ODOA 3MPXA 4IAPA 1ZSQA 3P6AA 2UZSA 3GYOA 3D8EA 1J0WA 1KI1B 3ZVRA 5D27A 4DX8A 2DHKA 4HAVB 2OTXA 1OY2A 3O96A 4HDQA 3ODXA 4GXBA 5C6RA 5KQ1A 2UVMA 2Y7BA 4KHOA 3A8PA 4YONA 2BCJA 3A8QA 2LOXA 1EVHA 2N0YA 1DDVA 1TXDA 4HAUB 2D11A 2K2UA 3PVUA 4A6FA 1U29A 2Y8FA 2YS5A 2D9XA 4TYZA 2DHIA 1MIXA 5HE1A
chains in the Genus database with same CATH superfamily
1NTYA 4HATB 4K17A 4L1RA 1UNPA 3MDBC 3B77A 2MFQA 1XR0B 1Y19B 3VIAA 2ELBA 2ROZB 2LOZA 1IRSA 4HAWB 3FVCA 3F5RA 2YSZA 3SYXA 1UPQA 4D6WA 4EKUA 5CLLB 1BTKA 3NSUA 5KCVA 1PFJA 2I1KA 4GPTB 3FEHA 2DX5A 1U5DA 1FGYA 4PNKA 2EC1A 1FAOA 1N3HA 2V76A 3NW8A 4Y94A 4A5KA 1NI2A 2K00A 2RLOA 4EMOA 5D3YA 2UZRA 1TJ6A 2AEHA 1X05A 4ZRKA 1ISNA 2GCJA 4HSIA 3A98B 4QJ5B 4WVFB 3TVVA 1P3RA 1KZGA 4KHBB 4CSQA 1T77A 3OANA 2RSGA 3RCPA 3PG7A 4F7HA 4EJNA 1J19A 1SGHA 1OMWA 3ODWA 1EF1A 1NU2A 2D9YA 3D8FA 3GYPA 3FSSA 2Q13A 3BINA 3AU4A 3SUZA 2R0DA 2EMSA 2DLWA 3DXEA 4WSFA 5FI0A 5JHHA 1ZVRA 1NTVA 2I5CA 3HSAA 3UZTA 1QQGA 2YT1A 1DYNA 3QBVB 4NSWA 5I2MA 2IFSA 4IFSA 1XKEA 2L2IA 2OQBA 2W2WA 2DTCA 1DDMA 2J0KA 1W1DA 3A58A 2Z0PA 2L1CA 2D4QA 2COAA 2VSZA 4HB0B 1BTNA 1U5EA 1M7EA 3ULCA 1AWEA 4H8SA 4HB3B 1UNRA 3X23A 4KHAA 1WI1A 5D3VA 2VRWB 1K5GB 2ZPYA 2DHJA 4NY0A 1P6SA 2N23A 3CXBB 3NWAA 3ZDTA 2MDXA 3DXDA 1V5MA 4OT1A 4HHVA 3TFMA 4OSNA 4ZRIA 1Y5OA 2ZKMX 5KQ4A 1H10A 2JP2A 3AU5A 4MY6A 4CHMA 1OQNA 2J0MA 1WG7A 1MKEA 4K81A 2P0DA 1X1FA 1ZC4B 5GOWB 3FM8C 4IOYX 2KUQA 1XX0A 1MIZB 1LW3A 1MK7B 3OHMB 2D9VA 2R09A 2NMBA 2NZ8B 3CIKA 2CY4A 2E2XA 4GN1A 5J3YA 5C16A 2G35A 5C79A 1DDWA 2H7DA 2IYBA 1B55A 3SV1A 3KY9A 3NWFA 5DH9B 4K2OA 2YS3A 2FJUB 2M14A 2QKLA 3HW2B 3PP2A 1UEFA 3D8DA 2LULA 1X1GA 4HDOA 4D0NB 4Z2NA 2CAYA 2RGNB 5DHAB 4P7IA 1E5WA 2YRYA 5C5BA 5JP4A 1XD4A 2DKQA 2GCLA 5HE2A 3SO6A 1WGUA 5LOPB 1V5UA 5DIFB 2Z0OA 5L81A 2M38A 4PQ0A 2J59M 2GJYA 5DI9B 4DXAB 1W1GA 1QC6A 1XODA 3PEGA 1FOEA 3PVLA 1U2BA 2YS1A 3KZ1A 4L6EA 1FHXA 1MI1A 4CHJA 4A6FB 2P8VA 2EJ8A 2LYDA 2MKRA 3QIJA 1M7RA 4HAYB 2DYNA 4HB2B 4HAXB 4QJ3B 4DBBA 3TO1A 3V5WA 4GOUA 1PLSA 3HQCA 1RRPB 4CYEA 5M4YB 5JLJB 3KSYA 2H7EA 2COCA 1I2HA 2KR0A 5FI1A 5CLQB 3T06A 3ULBA 1PMSA 4WJ7A 3DCXA 5LONB 2W2XC 2DX1A 4K2PA 2ELAA 2DKPA 1GC6A 3ML4A 1V89A 2X18A 1I7AA 3U7DA 1U5GA 2RVBB 1V88A 2Z14A 2D10A 4KAXB 1BAKA 2CRFA 2P0HA 1X86A 3WYFB 4QXAB 5DHFB 2KIGA 4C0AA 1Q67A 2COFA 1U27A 5I2SA 1KZ7A 2D9ZA 2ROVA 5HE3A 2KCJA 1WVHA 4XWXA 1ZM0A 2I1JA 2R2YA 1SHCA 5HE0A 1ZYIA 3VOQA 2K8EA 4TKNA 4GNKB 2GUMA 3HK0A 2K2JA 4KHBA 3BJIA 1AQCA 3NWDA 5IRSA 3U12A 1MAIA 2DN6A 2YT0A 3PSCA 1FHOA 2KGXB 2AL6A 4GZUA 4F7UP 2QKMA 3U8ZA 2LG1A 2CODA 4Z2MB 3PZDA 1WJMA 4KVGB 3G9WA 2Z0QA 2HTHB 5JHGA 1P5TA 4DX90 1UNQA 2YVCA 2DYQA 1K5DB 2GS0A 3DXCA 1MPHA 2DA0A 4HAZB 3F0WA 1XCGA 1EAZA 2J0JA 1GC7A 1FB8A 2MWNB 4HB4B 2LKOA 1LB1A 2XQNM 2EMTA 3QWMA 4F7GA 4GMVA 2I5FA 3TW1A 5D3WA 5D3XA 2PZ1A 4ZRJA 1H4RA 1EGXA 4MK0A 4MT7A 5J3TA 2Y8GA 3IVFA 2KUPA 4GMXB 4B6HA 2D2QA 2FJLA 1ZC3B 1W1HA 3P7ZA 1BWNA 4BBKA 1FHWA 1GG3A 2Z13A 3N7CA 4A6KA 2DFKA 1V61A 4A6HA 5EFXA 3M1IB 4YL8A 2RNRB 1U5FA 2Z59A 3KRXA 5J3QA 5LG4B 1WGQA 2VKIA 1V5PA 3TCAA 2CY5A 2HE7A 3SNHA 2P0FA 2ADZA 3HIEA 2RUKB 2YF0A 3KRWA 3PVWA 1FGZA 1TQZA 1X11A 3AJ4A 2W2XD 2RRFA 2KIEA 1MK9B 1Z87A 1DROA 1UPRA 3WA0A 4QJ4B 2D9WA 3LJUX 1RJ2A 1WJ1A 5C5BB 1DBHA 3ODOA 3MPXA 4IAPA 1ZSQA 3P6AA 2UZSA 3GYOA 3D8EA 1J0WA 2Z4DA 1KI1B 3ZVRA 2YT2A 5D27A 4DX8A 2DHKA 4HAVB 2OTXA 1OY2A 3O96A 4HDQA 3ODXA 4GXBA 5C6RA 5KQ1A 2UVMA 2Y7BA 4KHOA 3A8PA 2NBVA 4YONA 2BCJA 3A8QA 4DIXA 2LOXA 1EVHA 2N0YA 1DDVA 1TXDA 4HAUB 2D11A 2K2UA 3PVUA 2K49A 4A6FA 1U29A 2Y8FA 2YS5A 2D9XA 4TYZA 2DHIA 1MIXA 5HE1A
chains in the Genus database with same CATH topology
1NTYA 4HATB 4K17A 1UNPA 3MDBC 2MFQA 1XR0B 1Y19B 3VIAA 2ELBA 2ROZB 2LOZA 1IRSA 4HAWB 3F5RA 2YSZA 3SYXA 1UPQA 4EKUA 5CLLB 1BTKA 3NSUA 5KCVA 1PFJA 2I1KA 4GPTB 3FEHA 2DX5A 1U5DA 1FGYA 4PNKA 2EC1A 1FAOA 1N3HA 2V76A 4Y94A 4A5KA 1NI2A 2K00A 2RLOA 4EMOA 5D3YA 2UZRA 1TJ6A 2AEHA 1X05A 4ZRKA 1ISNA 2GCJA 3A98B 4WVFB 3TVVA 1P3RA 1KZGA 4KHBB 3OANA 2RSGA 3RCPA 3PG7A 4F7HA 4EJNA 1J19A 1SGHA 1OMWA 3ODWA 1EF1A 1NU2A 2D9YA 3D8FA 3GYPA 3FSSA 2Q13A 3BINA 3AU4A 3SUZA 2R0DA 2EMSA 2DLWA 3DXEA 4WSFA 5FI0A 5JHHA 1ZVRA 1NTVA 2I5CA 3UZTA 1QQGA 2YT1A 1DYNA 3QBVB 4NSWA 2IFSA 4IFSA 1XKEA 2L2IA 2OQBA 2W2WA 2DTCA 1DDMA 2J0KA 1W1DA 2Z0PA 2L1CA 2D4QA 2COAA 2VSZA 4HB0B 1BTNA 1U5EA 1M7EA 3ULCA 1AWEA 4H8SA 4HB3B 1UNRA 3X23A 4KHAA 1WI1A 5D3VA 2VRWB 1K5GB 2ZPYA 2DHJA 4NY0A 1P6SA 2N23A 3CXBB 3ZDTA 2MDXA 3DXDA 1V5MA 4HHVA 3TFMA 4ZRIA 1Y5OA 5KQ4A 1H10A 2JP2A 3AU5A 4MY6A 4CHMA 1OQNA 2J0MA 1WG7A 1MKEA 4K81A 2P0DA 1X1FA 1ZC4B 5GOWB 3FM8C 4IOYX 1XX0A 1MIZB 1LW3A 1MK7B 2D9VA 2R09A 2NMBA 2NZ8B 3CIKA 2CY4A 2E2XA 4GN1A 5J3YA 5C16A 2G35A 5C79A 1DDWA 2H7DA 2IYBA 1B55A 3SV1A 3KY9A 5DH9B 4K2OA 2YS3A 2M14A 2QKLA 3HW2B 3PP2A 1UEFA 3D8DA 2LULA 1X1GA 4HDOA 4D0NB 4Z2NA 2CAYA 2RGNB 5DHAB 4P7IA 1E5WA 2YRYA 5C5BA 5JP4A 1XD4A 2DKQA 2GCLA 5HE2A 3SO6A 1WGUA 5LOPB 1V5UA 5DIFB 2Z0OA 5L81A 2M38A 4PQ0A 2J59M 2GJYA 5DI9B 4DXAB 1W1GA 1QC6A 1XODA 3PEGA 1FOEA 3PVLA 1U2BA 2YS1A 3KZ1A 4L6EA 1FHXA 4CHJA 4A6FB 2P8VA 2EJ8A 2LYDA 2MKRA 3QIJA 1M7RA 4HAYB 2DYNA 4HB2B 4HAXB 4DBBA 3TO1A 3V5WA 1PLSA 3HQCA 1RRPB 4CYEA 5JLJB 3KSYA 2H7EA 2COCA 1I2HA 5FI1A 5CLQB 3T06A 3ULBA 1PMSA 4WJ7A 5LONB 2W2XC 2DX1A 4K2PA 2ELAA 2DKPA 1GC6A 3ML4A 1V89A 2X18A 1I7AA 3U7DA 1U5GA 2RVBB 1V88A 2D10A 4KAXB 1BAKA 2CRFA 2P0HA 1X86A 3WYFB 5DHFB 4C0AA 1Q67A 2COFA 1U27A 1KZ7A 2D9ZA 2ROVA 5HE3A 2KCJA 1WVHA 4XWXA 1ZM0A 2I1JA 1SHCA 5HE0A 3VOQA 4TKNA 3HK0A 2K2JA 3BJIA 1AQCA 1MAIA 2DN6A 2YT0A 3PSCA 1FHOA 2KGXB 2AL6A 4GZUA 4F7UP 2QKMA 3U8ZA 2LG1A 2CODA 4Z2MB 3PZDA 1WJMA 4KVGB 3G9WA 2Z0QA 2HTHB 5JHGA 1P5TA 4DX90 1UNQA 2YVCA 2DYQA 1K5DB 2GS0A 3DXCA 1MPHA 2DA0A 4HAZB 3F0WA 1XCGA 1EAZA 2J0JA 1GC7A 1FB8A 2MWNB 4HB4B 2LKOA 1LB1A 2XQNM 2EMTA 3QWMA 4F7GA 4GMVA 2I5FA 3TW1A 5D3WA 5D3XA 2PZ1A 4ZRJA 1H4RA 1EGXA 4MK0A 4MT7A 5J3TA 2Y8GA 3IVFA 2KUPA 4GMXB 4B6HA 2D2QA 2FJLA 1ZC3B 1W1HA 3P7ZA 1BWNA 4BBKA 1FHWA 1GG3A 3N7CA 4A6KA 2DFKA 1V61A 4A6HA 5EFXA 3M1IB 4YL8A 2RNRB 1U5FA 3KRXA 5J3QA 1WGQA 2VKIA 1V5PA 3TCAA 2CY5A 2HE7A 3SNHA 2P0FA 2ADZA 2RUKB 2YF0A 3KRWA 3PVWA 1FGZA 1TQZA 1X11A 3AJ4A 2W2XD 1MK9B 1Z87A 1DROA 1UPRA 3WA0A 2D9WA 3LJUX 1RJ2A 1WJ1A 5C5BB 1DBHA 3ODOA 3MPXA 4IAPA 1ZSQA 3P6AA 2UZSA 3GYOA 3D8EA 1J0WA 1KI1B 3ZVRA 5D27A 4DX8A 2DHKA 4HAVB 2OTXA 1OY2A 3O96A 4HDQA 3ODXA 4GXBA 5C6RA 5KQ1A 2UVMA 2Y7BA 4KHOA 3A8PA 4YONA 2BCJA 3A8QA 2LOXA 1EVHA 2N0YA 1DDVA 1TXDA 4HAUB 2D11A 2K2UA 3PVUA 4A6FA 1U29A 2Y8FA 2YS5A 2D9XA 4TYZA 2DHIA 1MIXA 5HE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTY A;  4HAT B;  4K17 A;  1UNP A;  3MDB C;  2MFQ A;  1XR0 B;  1Y19 B;  3VIA A;  2ELB A;  2ROZ B;  2LOZ A;  1IRS A;  4HAW B;  3F5R A;  2YSZ A;  3SYX A;  1UPQ A;  4EKU A;  5CLL B;  1BTK A;  3NSU A;  5KCV A;  1PFJ A;  2I1K A;  4GPT B;  3FEH A;  2DX5 A;  1U5D A;  1FGY A;  4PNK A;  2EC1 A;  1FAO A;  1N3H A;  2V76 A;  4Y94 A;  4A5K A;  1NI2 A;  2K00 A;  2RLO A;  4EMO A;  5D3Y A;  2UZR A;  1TJ6 A;  2AEH A;  1X05 A;  4ZRK A;  1ISN A;  2GCJ A;  3A98 B;  4WVF B;  3TVV A;  1P3R A;  1KZG A;  4KHB B;  3OAN A;  2RSG A;  3RCP A;  3PG7 A;  4F7H A;  4EJN A;  1J19 A;  1SGH A;  1OMW A;  3ODW A;  1EF1 A;  1NU2 A;  2D9Y A;  3D8F A;  3GYP A;  3FSS A;  2Q13 A;  3BIN A;  3AU4 A;  3SUZ A;  2R0D A;  2EMS A;  2DLW A;  3DXE A;  4WSF A;  5FI0 A;  5JHH A;  1ZVR A;  1NTV A;  2I5C A;  3UZT A;  1QQG A;  2YT1 A;  1DYN A;  3QBV B;  4NSW A;  2IFS A;  4IFS A;  1XKE A;  2L2I A;  2OQB A;  2W2W A;  2DTC A;  1DDM A;  2J0K A;  1W1D A;  2Z0P A;  2L1C A;  2D4Q A;  2COA A;  2VSZ A;  4HB0 B;  1BTN A;  1U5E A;  1M7E A;  3ULC A;  1AWE A;  4H8S A;  4HB3 B;  1UNR A;  3X23 A;  4KHA A;  1WI1 A;  5D3V A;  2VRW B;  1K5G B;  2ZPY A;  2DHJ A;  4NY0 A;  1P6S A;  2N23 A;  3CXB B;  3ZDT A;  2MDX A;  3DXD A;  1V5M A;  4HHV A;  3TFM A;  4ZRI A;  1Y5O A;  5KQ4 A;  1H10 A;  2JP2 A;  3AU5 A;  4MY6 A;  4CHM A;  1OQN A;  2J0M A;  1WG7 A;  1MKE A;  4K81 A;  2P0D A;  1X1F A;  1ZC4 B;  5GOW B;  3FM8 C;  4IOY X;  1XX0 A;  1MIZ B;  1LW3 A;  1MK7 B;  2D9V A;  2R09 A;  2NMB A;  2NZ8 B;  3CIK A;  2CY4 A;  2E2X A;  4GN1 A;  5J3Y A;  5C16 A;  2G35 A;  5C79 A;  1DDW A;  2H7D A;  2IYB A;  1B55 A;  3SV1 A;  3KY9 A;  5DH9 B;  4K2O A;  2YS3 A;  2M14 A;  2QKL A;  3HW2 B;  3PP2 A;  1UEF A;  3D8D A;  2LUL A;  1X1G A;  4HDO A;  4D0N B;  4Z2N A;  2CAY A;  2RGN B;  5DHA B;  4P7I A;  1E5W A;  2YRY A;  5C5B A;  5JP4 A;  1XD4 A;  2DKQ A;  2GCL A;  5HE2 A;  3SO6 A;  1WGU A;  5LOP B;  1V5U A;  5DIF B;  2Z0O A;  5L81 A;  2M38 A;  4PQ0 A;  2J59 M;  2GJY A;  5DI9 B;  4DXA B;  1W1G A;  1QC6 A;  1XOD A;  3PEG A;  1FOE A;  3PVL A;  1U2B A;  2YS1 A;  3KZ1 A;  4L6E A;  1FHX A;  4CHJ A;  4A6F B;  2P8V A;  2EJ8 A;  2LYD A;  2MKR A;  3QIJ A;  1M7R A;  4HAY B;  2DYN A;  4HB2 B;  4HAX B;  4DBB A;  3TO1 A;  3V5W A;  1PLS A;  3HQC A;  1RRP B;  4CYE A;  5JLJ B;  3KSY A;  2H7E A;  2COC A;  1I2H A;  5FI1 A;  5CLQ B;  3T06 A;  3ULB A;  1PMS A;  4WJ7 A;  5LON B;  2W2X C;  2DX1 A;  4K2P A;  2ELA A;  2DKP A;  1GC6 A;  3ML4 A;  1V89 A;  2X18 A;  1I7A A;  3U7D A;  1U5G A;  2RVB B;  1V88 A;  2D10 A;  4KAX B;  1BAK A;  2CRF A;  2P0H A;  1X86 A;  3WYF B;  5DHF B;  4C0A A;  1Q67 A;  2COF A;  1U27 A;  1KZ7 A;  2D9Z A;  2ROV A;  5HE3 A;  2KCJ A;  1WVH A;  4XWX A;  1ZM0 A;  2I1J A;  1SHC A;  5HE0 A;  3VOQ A;  4TKN A;  3HK0 A;  2K2J A;  3BJI A;  1AQC A;  1MAI A;  2DN6 A;  2YT0 A;  3PSC A;  1FHO A;  2KGX B;  2AL6 A;  4GZU A;  4F7U P;  2QKM A;  3U8Z A;  2LG1 A;  2COD A;  4Z2M B;  3PZD A;  1WJM A;  4KVG B;  3G9W A;  2Z0Q A;  2HTH B;  5JHG A;  1P5T A;  4DX9 0;  1UNQ A;  2YVC A;  2DYQ A;  1K5D B;  2GS0 A;  3DXC A;  1MPH A;  2DA0 A;  4HAZ B;  3F0W A;  1XCG A;  1EAZ A;  2J0J A;  1GC7 A;  1FB8 A;  2MWN B;  4HB4 B;  2LKO A;  1LB1 A;  2XQN M;  2EMT A;  3QWM A;  4F7G A;  4GMV A;  2I5F A;  3TW1 A;  5D3W A;  5D3X A;  2PZ1 A;  4ZRJ A;  1H4R A;  1EGX A;  4MK0 A;  4MT7 A;  5J3T A;  2Y8G A;  3IVF A;  2KUP A;  4GMX B;  4B6H A;  2D2Q A;  2FJL A;  1ZC3 B;  1W1H A;  3P7Z A;  1BWN A;  4BBK A;  1FHW A;  1GG3 A;  3N7C A;  4A6K A;  2DFK A;  1V61 A;  4A6H A;  5EFX A;  3M1I B;  4YL8 A;  2RNR B;  1U5F A;  3KRX A;  5J3Q A;  1WGQ A;  2VKI A;  1V5P A;  3TCA A;  2CY5 A;  2HE7 A;  3SNH A;  2P0F A;  2ADZ A;  2RUK B;  2YF0 A;  3KRW A;  3PVW A;  1FGZ A;  1TQZ A;  1X11 A;  3AJ4 A;  2W2X D;  1MK9 B;  1Z87 A;  1DRO A;  1UPR A;  3WA0 A;  2D9W A;  3LJU X;  1RJ2 A;  1WJ1 A;  5C5B B;  1DBH A;  3ODO A;  3MPX A;  4IAP A;  1ZSQ A;  3P6A A;  2UZS A;  3GYO A;  3D8E A;  1J0W A;  1KI1 B;  3ZVR A;  5D27 A;  4DX8 A;  2DHK A;  4HAV B;  2OTX A;  1OY2 A;  3O96 A;  4HDQ A;  3ODX A;  4GXB A;  5C6R A;  5KQ1 A;  2UVM A;  2Y7B A;  4KHO A;  3A8P A;  4YON A;  2BCJ A;  3A8Q A;  2LOX A;  1EVH A;  2N0Y A;  1DDV A;  1TXD A;  4HAU B;  2D11 A;  2K2U A;  3PVU A;  4A6F A;  1U29 A;  2Y8F A;  2YS5 A;  2D9X A;  4TYZ A;  2DHI A;  1MIX A;  5HE1 A; 
#chains in the Genus database with same CATH topology
 1NTY A;  4HAT B;  4K17 A;  4L1R A;  1UNP A;  3MDB C;  3B77 A;  2MFQ A;  1XR0 B;  1Y19 B;  3VIA A;  2ELB A;  2ROZ B;  2LOZ A;  1IRS A;  4HAW B;  3FVC A;  3F5R A;  2YSZ A;  3SYX A;  1UPQ A;  4D6W A;  4EKU A;  5CLL B;  1BTK A;  3NSU A;  5KCV A;  1PFJ A;  2I1K A;  4GPT B;  3FEH A;  2DX5 A;  1U5D A;  1FGY A;  4PNK A;  2EC1 A;  1FAO A;  1N3H A;  2V76 A;  3NW8 A;  4Y94 A;  4A5K A;  1NI2 A;  2K00 A;  2RLO A;  4EMO A;  5D3Y A;  2UZR A;  1TJ6 A;  2AEH A;  1X05 A;  4ZRK A;  1ISN A;  2GCJ A;  4HSI A;  3A98 B;  4QJ5 B;  4WVF B;  3TVV A;  1P3R A;  1KZG A;  4KHB B;  4CSQ A;  1T77 A;  3OAN A;  2RSG A;  3RCP A;  3PG7 A;  4F7H A;  4EJN A;  1J19 A;  1SGH A;  1OMW A;  3ODW A;  1EF1 A;  1NU2 A;  2D9Y A;  3D8F A;  3GYP A;  3FSS A;  2Q13 A;  3BIN A;  3AU4 A;  3SUZ A;  2R0D A;  2EMS A;  2DLW A;  3DXE A;  4WSF A;  5FI0 A;  5JHH A;  1ZVR A;  1NTV A;  2I5C A;  3HSA A;  3UZT A;  1QQG A;  2YT1 A;  1DYN A;  3QBV B;  4NSW A;  5I2M A;  2IFS A;  4IFS A;  1XKE A;  2L2I A;  2OQB A;  2W2W A;  2DTC A;  1DDM A;  2J0K A;  1W1D A;  3A58 A;  2Z0P A;  2L1C A;  2D4Q A;  2COA A;  2VSZ A;  4HB0 B;  1BTN A;  1U5E A;  1M7E A;  3ULC A;  1AWE A;  4H8S A;  4HB3 B;  1UNR A;  3X23 A;  4KHA A;  1WI1 A;  5D3V A;  2VRW B;  1K5G B;  2ZPY A;  2DHJ A;  4NY0 A;  1P6S A;  2N23 A;  3CXB B;  3NWA A;  3ZDT A;  2MDX A;  3DXD A;  1V5M A;  4OT1 A;  4HHV A;  3TFM A;  4OSN A;  4ZRI A;  1Y5O A;  2ZKM X;  5KQ4 A;  1H10 A;  2JP2 A;  3AU5 A;  4MY6 A;  4CHM A;  1OQN A;  2J0M A;  1WG7 A;  1MKE A;  4K81 A;  2P0D A;  1X1F A;  1ZC4 B;  5GOW B;  3FM8 C;  4IOY X;  2KUQ A;  1XX0 A;  1MIZ B;  1LW3 A;  1MK7 B;  3OHM B;  2D9V A;  2R09 A;  2NMB A;  2NZ8 B;  3CIK A;  2CY4 A;  2E2X A;  4GN1 A;  5J3Y A;  5C16 A;  2G35 A;  5C79 A;  1DDW A;  2H7D A;  2IYB A;  1B55 A;  3SV1 A;  3KY9 A;  3NWF A;  5DH9 B;  4K2O A;  2YS3 A;  2FJU B;  2M14 A;  2QKL A;  3HW2 B;  3PP2 A;  1UEF A;  3D8D A;  2LUL A;  1X1G A;  4HDO A;  4D0N B;  4Z2N A;  2CAY A;  2RGN B;  5DHA B;  4P7I A;  1E5W A;  2YRY A;  5C5B A;  5JP4 A;  1XD4 A;  2DKQ A;  2GCL A;  5HE2 A;  3SO6 A;  1WGU A;  5LOP B;  1V5U A;  5DIF B;  2Z0O A;  5L81 A;  2M38 A;  4PQ0 A;  2J59 M;  2GJY A;  5DI9 B;  4DXA B;  1W1G A;  1QC6 A;  1XOD A;  3PEG A;  1FOE A;  3PVL A;  1U2B A;  2YS1 A;  3KZ1 A;  4L6E A;  1FHX A;  1MI1 A;  4CHJ A;  4A6F B;  2P8V A;  2EJ8 A;  2LYD A;  2MKR A;  3QIJ A;  1M7R A;  4HAY B;  2DYN A;  4HB2 B;  4HAX B;  4QJ3 B;  4DBB A;  3TO1 A;  3V5W A;  4GOU A;  1PLS A;  3HQC A;  1RRP B;  4CYE A;  5M4Y B;  5JLJ B;  3KSY A;  2H7E A;  2COC A;  1I2H A;  2KR0 A;  5FI1 A;  5CLQ B;  3T06 A;  3ULB A;  1PMS A;  4WJ7 A;  3DCX A;  5LON B;  2W2X C;  2DX1 A;  4K2P A;  2ELA A;  2DKP A;  1GC6 A;  3ML4 A;  1V89 A;  2X18 A;  1I7A A;  3U7D A;  1U5G A;  2RVB B;  1V88 A;  2Z14 A;  2D10 A;  4KAX B;  1BAK A;  2CRF A;  2P0H A;  1X86 A;  3WYF B;  4QXA B;  5DHF B;  2KIG A;  4C0A A;  1Q67 A;  2COF A;  1U27 A;  5I2S A;  1KZ7 A;  2D9Z A;  2ROV A;  5HE3 A;  2KCJ A;  1WVH A;  4XWX A;  1ZM0 A;  2I1J A;  2R2Y A;  1SHC A;  5HE0 A;  1ZYI A;  3VOQ A;  2K8E A;  4TKN A;  4GNK B;  2GUM A;  3HK0 A;  2K2J A;  4KHB A;  3BJI A;  1AQC A;  3NWD A;  5IRS A;  3U12 A;  1MAI A;  2DN6 A;  2YT0 A;  3PSC A;  1FHO A;  2KGX B;  2AL6 A;  4GZU A;  4F7U P;  2QKM A;  3U8Z A;  2LG1 A;  2COD A;  4Z2M B;  3PZD A;  1WJM A;  4KVG B;  3G9W A;  2Z0Q A;  2HTH B;  5JHG A;  1P5T A;  4DX9 0;  1UNQ A;  2YVC A;  2DYQ A;  1K5D B;  2GS0 A;  3DXC A;  1MPH A;  2DA0 A;  4HAZ B;  3F0W A;  1XCG A;  1EAZ A;  2J0J A;  1GC7 A;  1FB8 A;  2MWN B;  4HB4 B;  2LKO A;  1LB1 A;  2XQN M;  2EMT A;  3QWM A;  4F7G A;  4GMV A;  2I5F A;  3TW1 A;  5D3W A;  5D3X A;  2PZ1 A;  4ZRJ A;  1H4R A;  1EGX A;  4MK0 A;  4MT7 A;  5J3T A;  2Y8G A;  3IVF A;  2KUP A;  4GMX B;  4B6H A;  2D2Q A;  2FJL A;  1ZC3 B;  1W1H A;  3P7Z A;  1BWN A;  4BBK A;  1FHW A;  1GG3 A;  2Z13 A;  3N7C A;  4A6K A;  2DFK A;  1V61 A;  4A6H A;  5EFX A;  3M1I B;  4YL8 A;  2RNR B;  1U5F A;  2Z59 A;  3KRX A;  5J3Q A;  5LG4 B;  1WGQ A;  2VKI A;  1V5P A;  3TCA A;  2CY5 A;  2HE7 A;  3SNH A;  2P0F A;  2ADZ A;  3HIE A;  2RUK B;  2YF0 A;  3KRW A;  3PVW A;  1FGZ A;  1TQZ A;  1X11 A;  3AJ4 A;  2W2X D;  2RRF A;  2KIE A;  1MK9 B;  1Z87 A;  1DRO A;  1UPR A;  3WA0 A;  4QJ4 B;  2D9W A;  3LJU X;  1RJ2 A;  1WJ1 A;  5C5B B;  1DBH A;  3ODO A;  3MPX A;  4IAP A;  1ZSQ A;  3P6A A;  2UZS A;  3GYO A;  3D8E A;  1J0W A;  2Z4D A;  1KI1 B;  3ZVR A;  2YT2 A;  5D27 A;  4DX8 A;  2DHK A;  4HAV B;  2OTX A;  1OY2 A;  3O96 A;  4HDQ A;  3ODX A;  4GXB A;  5C6R A;  5KQ1 A;  2UVM A;  2Y7B A;  4KHO A;  3A8P A;  2NBV A;  4YON A;  2BCJ A;  3A8Q A;  4DIX A;  2LOX A;  1EVH A;  2N0Y A;  1DDV A;  1TXD A;  4HAU B;  2D11 A;  2K2U A;  3PVU A;  2K49 A;  4A6F A;  1U29 A;  2Y8F A;  2YS5 A;  2D9X A;  4TYZ A;  2DHI A;  1MIX A;  5HE1 A; 
#chains in the Genus database with same CATH homology
 1NTY A;  4HAT B;  4K17 A;  1UNP A;  3MDB C;  2MFQ A;  1XR0 B;  1Y19 B;  3VIA A;  2ELB A;  2ROZ B;  2LOZ A;  1IRS A;  4HAW B;  3F5R A;  2YSZ A;  3SYX A;  1UPQ A;  4EKU A;  5CLL B;  1BTK A;  3NSU A;  5KCV A;  1PFJ A;  2I1K A;  4GPT B;  3FEH A;  2DX5 A;  1U5D A;  1FGY A;  4PNK A;  2EC1 A;  1FAO A;  1N3H A;  2V76 A;  4Y94 A;  4A5K A;  1NI2 A;  2K00 A;  2RLO A;  4EMO A;  5D3Y A;  2UZR A;  1TJ6 A;  2AEH A;  1X05 A;  4ZRK A;  1ISN A;  2GCJ A;  3A98 B;  4WVF B;  3TVV A;  1P3R A;  1KZG A;  4KHB B;  3OAN A;  2RSG A;  3RCP A;  3PG7 A;  4F7H A;  4EJN A;  1J19 A;  1SGH A;  1OMW A;  3ODW A;  1EF1 A;  1NU2 A;  2D9Y A;  3D8F A;  3GYP A;  3FSS A;  2Q13 A;  3BIN A;  3AU4 A;  3SUZ A;  2R0D A;  2EMS A;  2DLW A;  3DXE A;  4WSF A;  5FI0 A;  5JHH A;  1ZVR A;  1NTV A;  2I5C A;  3UZT A;  1QQG A;  2YT1 A;  1DYN A;  3QBV B;  4NSW A;  2IFS A;  4IFS A;  1XKE A;  2L2I A;  2OQB A;  2W2W A;  2DTC A;  1DDM A;  2J0K A;  1W1D A;  2Z0P A;  2L1C A;  2D4Q A;  2COA A;  2VSZ A;  4HB0 B;  1BTN A;  1U5E A;  1M7E A;  3ULC A;  1AWE A;  4H8S A;  4HB3 B;  1UNR A;  3X23 A;  4KHA A;  1WI1 A;  5D3V A;  2VRW B;  1K5G B;  2ZPY A;  2DHJ A;  4NY0 A;  1P6S A;  2N23 A;  3CXB B;  3ZDT A;  2MDX A;  3DXD A;  1V5M A;  4HHV A;  3TFM A;  4ZRI A;  1Y5O A;  5KQ4 A;  1H10 A;  2JP2 A;  3AU5 A;  4MY6 A;  4CHM A;  1OQN A;  2J0M A;  1WG7 A;  1MKE A;  4K81 A;  2P0D A;  1X1F A;  1ZC4 B;  5GOW B;  3FM8 C;  4IOY X;  1XX0 A;  1MIZ B;  1LW3 A;  1MK7 B;  2D9V A;  2R09 A;  2NMB A;  2NZ8 B;  3CIK A;  2CY4 A;  2E2X A;  4GN1 A;  5J3Y A;  5C16 A;  2G35 A;  5C79 A;  1DDW A;  2H7D A;  2IYB A;  1B55 A;  3SV1 A;  3KY9 A;  5DH9 B;  4K2O A;  2YS3 A;  2M14 A;  2QKL A;  3HW2 B;  3PP2 A;  1UEF A;  3D8D A;  2LUL A;  1X1G A;  4HDO A;  4D0N B;  4Z2N A;  2CAY A;  2RGN B;  5DHA B;  4P7I A;  1E5W A;  2YRY A;  5C5B A;  5JP4 A;  1XD4 A;  2DKQ A;  2GCL A;  5HE2 A;  3SO6 A;  1WGU A;  5LOP B;  1V5U A;  5DIF B;  2Z0O A;  5L81 A;  2M38 A;  4PQ0 A;  2J59 M;  2GJY A;  5DI9 B;  4DXA B;  1W1G A;  1QC6 A;  1XOD A;  3PEG A;  1FOE A;  3PVL A;  1U2B A;  2YS1 A;  3KZ1 A;  4L6E A;  1FHX A;  4CHJ A;  4A6F B;  2P8V A;  2EJ8 A;  2LYD A;  2MKR A;  3QIJ A;  1M7R A;  4HAY B;  2DYN A;  4HB2 B;  4HAX B;  4DBB A;  3TO1 A;  3V5W A;  1PLS A;  3HQC A;  1RRP B;  4CYE A;  5JLJ B;  3KSY A;  2H7E A;  2COC A;  1I2H A;  5FI1 A;  5CLQ B;  3T06 A;  3ULB A;  1PMS A;  4WJ7 A;  5LON B;  2W2X C;  2DX1 A;  4K2P A;  2ELA A;  2DKP A;  1GC6 A;  3ML4 A;  1V89 A;  2X18 A;  1I7A A;  3U7D A;  1U5G A;  2RVB B;  1V88 A;  2D10 A;  4KAX B;  1BAK A;  2CRF A;  2P0H A;  1X86 A;  3WYF B;  5DHF B;  4C0A A;  1Q67 A;  2COF A;  1U27 A;  1KZ7 A;  2D9Z A;  2ROV A;  5HE3 A;  2KCJ A;  1WVH A;  4XWX A;  1ZM0 A;  2I1J A;  1SHC A;  5HE0 A;  3VOQ A;  4TKN A;  3HK0 A;  2K2J A;  3BJI A;  1AQC A;  1MAI A;  2DN6 A;  2YT0 A;  3PSC A;  1FHO A;  2KGX B;  2AL6 A;  4GZU A;  4F7U P;  2QKM A;  3U8Z A;  2LG1 A;  2COD A;  4Z2M B;  3PZD A;  1WJM A;  4KVG B;  3G9W A;  2Z0Q A;  2HTH B;  5JHG A;  1P5T A;  4DX9 0;  1UNQ A;  2YVC A;  2DYQ A;  1K5D B;  2GS0 A;  3DXC A;  1MPH A;  2DA0 A;  4HAZ B;  3F0W A;  1XCG A;  1EAZ A;  2J0J A;  1GC7 A;  1FB8 A;  2MWN B;  4HB4 B;  2LKO A;  1LB1 A;  2XQN M;  2EMT A;  3QWM A;  4F7G A;  4GMV A;  2I5F A;  3TW1 A;  5D3W A;  5D3X A;  2PZ1 A;  4ZRJ A;  1H4R A;  1EGX A;  4MK0 A;  4MT7 A;  5J3T A;  2Y8G A;  3IVF A;  2KUP A;  4GMX B;  4B6H A;  2D2Q A;  2FJL A;  1ZC3 B;  1W1H A;  3P7Z A;  1BWN A;  4BBK A;  1FHW A;  1GG3 A;  3N7C A;  4A6K A;  2DFK A;  1V61 A;  4A6H A;  5EFX A;  3M1I B;  4YL8 A;  2RNR B;  1U5F A;  3KRX A;  5J3Q A;  1WGQ A;  2VKI A;  1V5P A;  3TCA A;  2CY5 A;  2HE7 A;  3SNH A;  2P0F A;  2ADZ A;  2RUK B;  2YF0 A;  3KRW A;  3PVW A;  1FGZ A;  1TQZ A;  1X11 A;  3AJ4 A;  2W2X D;  1MK9 B;  1Z87 A;  1DRO A;  1UPR A;  3WA0 A;  2D9W A;  3LJU X;  1RJ2 A;  1WJ1 A;  5C5B B;  1DBH A;  3ODO A;  3MPX A;  4IAP A;  1ZSQ A;  3P6A A;  2UZS A;  3GYO A;  3D8E A;  1J0W A;  1KI1 B;  3ZVR A;  5D27 A;  4DX8 A;  2DHK A;  4HAV B;  2OTX A;  1OY2 A;  3O96 A;  4HDQ A;  3ODX A;  4GXB A;  5C6R A;  5KQ1 A;  2UVM A;  2Y7B A;  4KHO A;  3A8P A;  4YON A;  2BCJ A;  3A8Q A;  2LOX A;  1EVH A;  2N0Y A;  1DDV A;  1TXD A;  4HAU B;  2D11 A;  2K2U A;  3PVU A;  4A6F A;  1U29 A;  2Y8F A;  2YS5 A;  2D9X A;  4TYZ A;  2DHI A;  1MIX A;  5HE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...