3RCPA

Crystal structure of the fapp1 pleckstrin homology domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
100
Chain Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Molecular Basis of Phosphatidylinositol 4-Phosphate and ARF1 GTPase Recognition by the FAPP1 Pleckstrin Homology (PH) Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 100
sequence length 103
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3rcpA00
5DH9B 1X1FA 2LULA 1UNRA 1U27A 3SUZA 4PQ0A 1GC7A 2D4QA 3V5WA 3D8EA 3F0WA 2YS5A 1I7AA 4HAWB 2W2XC 5JHGA 4DX8A 5DHAB 4WSFA 2DX1A 3T06A 4WJ7A 1ZVRA 2YRYA 1TJ6A 5HE3A 2YF0A 4K2OA 4KAXB 2Y8FA 2EMTA 4HAYB 1V5MA 4ZRKA 4Z2NA 2EMSA 4XWXA 3KY9A 4HHVA 2VKIA 3P7ZA 2RSGA 1UPQA 1WGUA 1X11A 2EJ8A 3AJ4A 1V88A 2LOZA 1NTYA 2RUKB 2ELAA 4KHAA 1H4RA 2YS3A 2DHKA 4GN1A 4DX90 5L81A 2DYNA 5CLLB 1M7EA 2COCA 1RJ2A 2I1JA 2RNRB 3ULCA 2D9ZA 5C6RA 1XKEA 4A6KA 1WVHA 1U5FA 4HB0B 1LB1A 2L2IA 4F7UP 1FHOA 2OQBA 1OQNA 1MK9B 3VOQA 3KSYA 4GZUA 1ZM0A 5C79A 2V76A 3PP2A 1RRPB 2MFQA 4K17A 2DLWA 4YL8A 3QBVB 1X86A 3SV1A 1EGXA 2M38A 3PSCA 2DN6A 2OTXA 2H7DA 3U7DA 4HATB 2PZ1A 3NSUA 4EMOA 2I5CA 2CY4A 2AL6A 2MDXA 1GC6A 1BTNA 1V89A 4K81A 2YT1A 3ODXA 4DBBA 3ODWA 2Y7BA 2CODA 1DDWA 4HAUB 4HAXB 3M1IB 1I2HA 3N7CA 5D3XA 5D3VA 1X05A 1SGHA 1DDVA 4GMXB 1E5WA 4HB3B 4GXBA 2D9XA 4F7GA 2I5FA 3PEGA 3TVVA 2GS0A 1W1HA 1OMWA 4MY6A 1WI1A 3HQCA 1ZC3B 3BINA 2ZPYA 1ZC4B 3BJIA 1DBHA 1TXDA 1KI1B 1KZGA 3GYPA 5DI9B 1LW3A 1UEFA 2K2JA 3FEHA 2XQNM 1U5GA 5D3YA 2D9VA 3MDBC 1ZSQA 1DROA 2K00A 2M14A 2P8VA 2YVCA 1XODA 3CIKA 2D9WA 3PZDA 2P0HA 5JLJB 1XX0A 1AQCA 4KVGB 2I1KA 1FHWA 3SNHA 3TW1A 5HE1A 3GYOA 2DX5A 1EF1A 2QKLA 1BAKA 4IAPA 2ELBA 1V5UA 4NY0A 1NI2A 1W1GA 2G35A 2UZSA 4HB4B 2RVBB 1FHXA 3ULBA 3LJUX 4A6HA 1FGYA 1U2BA 2P0FA 2N23A 1W1DA 5KQ4A 1Q67A 2CRFA 3RCPA 2GCJA 5DIFB 4HDQA 2IYBA 2DKQA 5J3TA 3A8PA 3PVLA 1K5DB 1KZ7A 4C0AA 5C5BB 3F5RA 1DDMA 1FOEA 3TFMA 2DKPA 1Z87A 2X18A 3OANA 1U29A 2J0JA 5J3YA 2D11A 1K5GB 3ZVRA 1DYNA 1P5TA 5GOWB 2RLOA 4HAVB 4P7IA 3SO6A 1AWEA 2LG1A 2Q13A 2MWNB 1FGZA 5FI0A 4A6FB 2J59M 2D9YA 1TQZA 5DHFB 1BWNA 2EC1A 3PVUA 1XD4A 2DA0A 2KGXB 3MPXA 3IVFA 2L1CA 3TCAA 1P6SA 3KRXA 3G9WA 1WJ1A 1X1GA 4DXAB 3VIAA 2UVMA 3QWMA 1V5PA 2GJYA 4ZRJA 4GMVA 2ROVA 2DHJA 2DYQA 1Y19B 4L6EA 1PMSA 4Y94A 1V61A 2JP2A 4KHBB 3FM8C 3AU4A 5HE0A 2HE7A 1WGQA 1QQGA 4ZRIA 5C16A 3D8FA 5LONB 4D0NB 2MKRA 5JHHA 5FI1A 2ROZB 4A6FA 1NTVA 1OY2A 1B55A 4YONA 2R09A 4BBKA 2KCJA 2DTCA 3UZTA 2COAA 2IFSA 2CY5A 3HK0A 1FAOA 1EVHA 3DXDA 1MK7B 4H8SA 1MPHA 1ISNA 2FJLA 5HE2A 2VRWB 3A8QA 1MIXA 1Y5OA 2AEHA 3QIJA 2DHIA 4WVFB 4KHOA 1U5EA 4HDOA 1J0WA 4MT7A 4TYZA 3KZ1A 4CHJA 1UPRA 3AU5A 4EKUA 3X23A 1MKEA 3CXBB 1MAIA 2YT0A 1EAZA 2Y8GA 4Z2MB 5EFXA 4K2PA 1UNPA 1XR0B 2UZRA 1PLSA 5LOPB 5J3QA 5CLQB 2J0KA 3O96A 1WG7A 2DFKA 5KQ1A 1BTKA 3U8ZA 1SHCA 1QC6A 1XCGA 1N3HA 2VSZA 2LKOA 4HB2B 4NSWA 2NMBA 4CHMA 2H7EA 2D2QA 1UNQA 5D3WA 3HW2B 2P0DA 3ODOA 3KRWA 3TO1A 4PNKA 2YSZA 3DXCA 1WJMA 2D10A 2Z0PA 1M7RA 3PG7A 2W2XD 3P6AA 3FSSA 4HAZB 2CAYA 2RGNB 5D27A 1FB8A 1P3RA 4IFSA 1PFJA 1U5DA 2COFA 2LYDA 3DXEA 2HTHB 5KCVA 3ML4A 3SYXA 4TKNA 3WYFB 1H10A 2KUPA 2YS1A 4A5KA 4EJNA 5C5BA 2NZ8B 3D8DA 4MK0A 2E2XA 2J0MA 1J19A 1NU2A 2K2UA 2Z0OA 4CYEA 2R0DA 2BCJA 2N0YA 3PVWA 2QKMA 2GCLA 2W2WA 4IOYX 2ADZA 2Z0QA 1MIZB 4B6HA 4GPTB 4F7HA 3WA0A 3ZDTA 3A98B 1GG3A 5JP4A 1IRSA 2LOXA
chains in the Genus database with same CATH superfamily
4OSNA 5DH9B 3NW8A 1X1FA 2LULA 1UNRA 1U27A 3SUZA 5IRSA 4PQ0A 1GC7A 2D4QA 2Z14A 3D8EA 3DCXA 3F0WA 3V5WA 2YS5A 1I7AA 1MI1A 4HAWB 2W2XC 5JHGA 4DX8A 5DHAB 4WSFA 2DX1A 3T06A 4WJ7A 1ZVRA 5I2SA 2YRYA 2ZKMX 4KHBA 1TJ6A 5HE3A 3HSAA 2YF0A 2FJUB 4K2OA 4KAXB 2Y8FA 2EMTA 4HAYB 1V5MA 4ZRKA 4Z2NA 2EMSA 4XWXA 3KY9A 4HHVA 2VKIA 3P7ZA 2RSGA 1UPQA 1WGUA 1X11A 2EJ8A 3U12A 4GNKB 3AJ4A 1V88A 2LOZA 2NBVA 1NTYA 2RUKB 2ELAA 4KHAA 1H4RA 2YT2A 2YS3A 2DHKA 4GN1A 4DX90 5L81A 2DYNA 5CLLB 1M7EA 2COCA 1RJ2A 2I1JA 2RNRB 3ULCA 2D9ZA 5C6RA 1XKEA 4A6KA 1WVHA 1U5FA 4HB0B 1LB1A 2L2IA 4HSIA 4F7UP 1FHOA 2OQBA 1OQNA 1MK9B 3VOQA 3KSYA 4GZUA 1ZM0A 5C79A 2V76A 3PP2A 4CSQA 1RRPB 2MFQA 4K17A 2DLWA 4YL8A 3QBVB 1X86A 3SV1A 1EGXA 2M38A 3PSCA 2DN6A 2OTXA 2H7DA 3U7DA 4HATB 2PZ1A 3NSUA 4EMOA 2I5CA 2CY4A 2Z59A 2AL6A 2MDXA 1GC6A 1BTNA 1V89A 4K81A 2YT1A 3ODXA 3OHMB 4DBBA 3ODWA 2Y7BA 2CODA 1DDWA 4HAUB 4HAXB 3M1IB 1I2HA 3N7CA 5D3XA 5D3VA 1X05A 1SGHA 1DDVA 4GMXB 1E5WA 4HB3B 4GXBA 2D9XA 4F7GA 2I5FA 3PEGA 3TVVA 3NWAA 2KUQA 2GS0A 1W1HA 2R2YA 1OMWA 4OT1A 4MY6A 3B77A 1WI1A 3HQCA 1ZC3B 3BINA 2ZPYA 1ZC4B 3BJIA 1DBHA 1TXDA 3A58A 1KI1B 1KZGA 3GYPA 5DI9B 1LW3A 1UEFA 2K2JA 3FEHA 2XQNM 1U5GA 5D3YA 2D9VA 3MDBC 1ZSQA 1DROA 2K00A 2M14A 2P8VA 2YVCA 2GUMA 1XODA 3CIKA 2D9WA 3PZDA 2P0HA 2K49A 5M4YB 5JLJB 1XX0A 1AQCA 5I2MA 4KVGB 2I1KA 1FHWA 3SNHA 3TW1A 5HE1A 3GYOA 2DX5A 1EF1A 2QKLA 1BAKA 4IAPA 2ELBA 2RRFA 1V5UA 4NY0A 1NI2A 1W1GA 2G35A 2UZSA 4HB4B 2RVBB 1FHXA 3ULBA 3LJUX 4A6HA 1FGYA 1U2BA 2P0FA 2N23A 1W1DA 5KQ4A 1Q67A 2CRFA 3RCPA 4GOUA 2GCJA 5DIFB 4HDQA 2IYBA 2DKQA 5J3TA 3A8PA 3PVLA 1K5DB 1KZ7A 4C0AA 5C5BB 3F5RA 1DDMA 1FOEA 3TFMA 2DKPA 1Z87A 2X18A 3OANA 1U29A 2J0JA 4D6WA 5J3YA 2D11A 1K5GB 3ZVRA 1DYNA 1P5TA 5GOWB 2RLOA 4HAVB 4P7IA 3SO6A 1AWEA 2LG1A 2Q13A 2MWNB 1FGZA 5FI0A 4A6FB 2J59M 2D9YA 2K8EA 1TQZA 5DHFB 1BWNA 2EC1A 3PVUA 1XD4A 2DA0A 2KGXB 3MPXA 3IVFA 2L1CA 3TCAA 1P6SA 3KRXA 3G9WA 1WJ1A 1X1GA 4DXAB 3VIAA 2UVMA 3QWMA 2Z4DA 1V5PA 2GJYA 3NWDA 4ZRJA 4GMVA 2ROVA 2DHJA 2DYQA 1Y19B 4L6EA 1PMSA 2Z13A 4Y94A 1V61A 2JP2A 4KHBB 3FM8C 3AU4A 5HE0A 2HE7A 1WGQA 1QQGA 4ZRIA 5C16A 3D8FA 5LONB 4D0NB 2MKRA 5JHHA 5FI1A 2ROZB 4A6FA 1NTVA 4DIXA 1OY2A 1B55A 4YONA 2R09A 4BBKA 2KCJA 2DTCA 3UZTA 2COAA 2IFSA 2CY5A 4QJ4B 3HK0A 1FAOA 4QJ3B 1EVHA 3DXDA 1MK7B 4H8SA 5LG4B 1MPHA 1ISNA 2FJLA 2KIGA 5HE2A 2VRWB 3A8QA 1MIXA 1Y5OA 2AEHA 3QIJA 2DHIA 4WVFB 4KHOA 1U5EA 4HDOA 1J0WA 4MT7A 4TYZA 3KZ1A 4CHJA 1UPRA 3AU5A 4EKUA 3X23A 1MKEA 3CXBB 4QXAB 1MAIA 2KR0A 2YT0A 1EAZA 2Y8GA 4Z2MB 5EFXA 4K2PA 1UNPA 1XR0B 2UZRA 1PLSA 5LOPB 5J3QA 5CLQB 2J0KA 3O96A 1WG7A 2DFKA 5KQ1A 1BTKA 3U8ZA 1SHCA 1QC6A 3FVCA 1XCGA 1N3HA 2VSZA 2LKOA 4HB2B 4L1RA 4NSWA 2NMBA 4CHMA 2H7EA 2D2QA 1UNQA 5D3WA 3HW2B 1T77A 2P0DA 3HIEA 3ODOA 3KRWA 3TO1A 4PNKA 2YSZA 3DXCA 1WJMA 2D10A 2Z0PA 1M7RA 2W2XD 3P6AA 3PG7A 3FSSA 4HAZB 2CAYA 2RGNB 5D27A 1FB8A 1P3RA 2KIEA 4IFSA 1PFJA 1U5DA 2COFA 4QJ5B 2LYDA 3DXEA 2HTHB 5KCVA 3ML4A 3SYXA 4TKNA 3WYFB 1H10A 2KUPA 2YS1A 4A5KA 4EJNA 5C5BA 2NZ8B 3D8DA 4MK0A 2E2XA 2J0MA 1J19A 1NU2A 1ZYIA 2K2UA 2Z0OA 4CYEA 2R0DA 2BCJA 2N0YA 3PVWA 2QKMA 2GCLA 2W2WA 4IOYX 2ADZA 2Z0QA 1MIZB 3NWFA 4B6HA 4GPTB 4F7HA 3WA0A 3ZDTA 3A98B 1GG3A 5JP4A 1IRSA 2LOXA
chains in the Genus database with same CATH topology
5DH9B 1X1FA 2LULA 1UNRA 1U27A 3SUZA 4PQ0A 1GC7A 2D4QA 3V5WA 3D8EA 3F0WA 2YS5A 1I7AA 4HAWB 2W2XC 5JHGA 4DX8A 5DHAB 4WSFA 2DX1A 3T06A 4WJ7A 1ZVRA 2YRYA 1TJ6A 5HE3A 2YF0A 4K2OA 4KAXB 2Y8FA 2EMTA 4HAYB 1V5MA 4ZRKA 4Z2NA 2EMSA 4XWXA 3KY9A 4HHVA 2VKIA 3P7ZA 2RSGA 1UPQA 1WGUA 1X11A 2EJ8A 3AJ4A 1V88A 2LOZA 1NTYA 2RUKB 2ELAA 4KHAA 1H4RA 2YS3A 2DHKA 4GN1A 4DX90 5L81A 2DYNA 5CLLB 1M7EA 2COCA 1RJ2A 2I1JA 2RNRB 3ULCA 2D9ZA 5C6RA 1XKEA 4A6KA 1WVHA 1U5FA 4HB0B 1LB1A 2L2IA 4F7UP 1FHOA 2OQBA 1OQNA 1MK9B 3VOQA 3KSYA 4GZUA 1ZM0A 5C79A 2V76A 3PP2A 1RRPB 2MFQA 4K17A 2DLWA 4YL8A 3QBVB 1X86A 3SV1A 1EGXA 2M38A 3PSCA 2DN6A 2OTXA 2H7DA 3U7DA 4HATB 2PZ1A 3NSUA 4EMOA 2I5CA 2CY4A 2AL6A 2MDXA 1GC6A 1BTNA 1V89A 4K81A 2YT1A 3ODXA 4DBBA 3ODWA 2Y7BA 2CODA 1DDWA 4HAUB 4HAXB 3M1IB 1I2HA 3N7CA 5D3XA 5D3VA 1X05A 1SGHA 1DDVA 4GMXB 1E5WA 4HB3B 4GXBA 2D9XA 4F7GA 2I5FA 3PEGA 3TVVA 2GS0A 1W1HA 1OMWA 4MY6A 1WI1A 3HQCA 1ZC3B 3BINA 2ZPYA 1ZC4B 3BJIA 1DBHA 1TXDA 1KI1B 1KZGA 3GYPA 5DI9B 1LW3A 1UEFA 2K2JA 3FEHA 2XQNM 1U5GA 5D3YA 2D9VA 3MDBC 1ZSQA 1DROA 2K00A 2M14A 2P8VA 2YVCA 1XODA 3CIKA 2D9WA 3PZDA 2P0HA 5JLJB 1XX0A 1AQCA 4KVGB 2I1KA 1FHWA 3SNHA 3TW1A 5HE1A 3GYOA 2DX5A 1EF1A 2QKLA 1BAKA 4IAPA 2ELBA 1V5UA 4NY0A 1NI2A 1W1GA 2G35A 2UZSA 4HB4B 2RVBB 1FHXA 3ULBA 3LJUX 4A6HA 1FGYA 1U2BA 2P0FA 2N23A 1W1DA 5KQ4A 1Q67A 2CRFA 3RCPA 2GCJA 5DIFB 4HDQA 2IYBA 2DKQA 5J3TA 3A8PA 3PVLA 1K5DB 1KZ7A 4C0AA 5C5BB 3F5RA 1DDMA 1FOEA 3TFMA 2DKPA 1Z87A 2X18A 3OANA 1U29A 2J0JA 5J3YA 2D11A 1K5GB 3ZVRA 1DYNA 1P5TA 5GOWB 2RLOA 4HAVB 4P7IA 3SO6A 1AWEA 2LG1A 2Q13A 2MWNB 1FGZA 5FI0A 4A6FB 2J59M 2D9YA 1TQZA 5DHFB 1BWNA 2EC1A 3PVUA 1XD4A 2DA0A 2KGXB 3MPXA 3IVFA 2L1CA 3TCAA 1P6SA 3KRXA 3G9WA 1WJ1A 1X1GA 4DXAB 3VIAA 2UVMA 3QWMA 1V5PA 2GJYA 4ZRJA 4GMVA 2ROVA 2DHJA 2DYQA 1Y19B 4L6EA 1PMSA 4Y94A 1V61A 2JP2A 4KHBB 3FM8C 3AU4A 5HE0A 2HE7A 1WGQA 1QQGA 4ZRIA 5C16A 3D8FA 5LONB 4D0NB 2MKRA 5JHHA 5FI1A 2ROZB 4A6FA 1NTVA 1OY2A 1B55A 4YONA 2R09A 4BBKA 2KCJA 2DTCA 3UZTA 2COAA 2IFSA 2CY5A 3HK0A 1FAOA 1EVHA 3DXDA 1MK7B 4H8SA 1MPHA 1ISNA 2FJLA 5HE2A 2VRWB 3A8QA 1MIXA 1Y5OA 2AEHA 3QIJA 2DHIA 4WVFB 4KHOA 1U5EA 4HDOA 1J0WA 4MT7A 4TYZA 3KZ1A 4CHJA 1UPRA 3AU5A 4EKUA 3X23A 1MKEA 3CXBB 1MAIA 2YT0A 1EAZA 2Y8GA 4Z2MB 5EFXA 4K2PA 1UNPA 1XR0B 2UZRA 1PLSA 5LOPB 5J3QA 5CLQB 2J0KA 3O96A 1WG7A 2DFKA 5KQ1A 1BTKA 3U8ZA 1SHCA 1QC6A 1XCGA 1N3HA 2VSZA 2LKOA 4HB2B 4NSWA 2NMBA 4CHMA 2H7EA 2D2QA 1UNQA 5D3WA 3HW2B 2P0DA 3ODOA 3KRWA 3TO1A 4PNKA 2YSZA 3DXCA 1WJMA 2D10A 2Z0PA 1M7RA 3PG7A 2W2XD 3P6AA 3FSSA 4HAZB 2CAYA 2RGNB 5D27A 1FB8A 1P3RA 4IFSA 1PFJA 1U5DA 2COFA 2LYDA 3DXEA 2HTHB 5KCVA 3ML4A 3SYXA 4TKNA 3WYFB 1H10A 2KUPA 2YS1A 4A5KA 4EJNA 5C5BA 2NZ8B 3D8DA 4MK0A 2E2XA 2J0MA 1J19A 1NU2A 2K2UA 2Z0OA 4CYEA 2R0DA 2BCJA 2N0YA 3PVWA 2QKMA 2GCLA 2W2WA 4IOYX 2ADZA 2Z0QA 1MIZB 4B6HA 4GPTB 4F7HA 3WA0A 3ZDTA 3A98B 1GG3A 5JP4A 1IRSA 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  1X1F A;  2LUL A;  1UNR A;  1U27 A;  3SUZ A;  4PQ0 A;  1GC7 A;  2D4Q A;  3V5W A;  3D8E A;  3F0W A;  2YS5 A;  1I7A A;  4HAW B;  2W2X C;  5JHG A;  4DX8 A;  5DHA B;  4WSF A;  2DX1 A;  3T06 A;  4WJ7 A;  1ZVR A;  2YRY A;  1TJ6 A;  5HE3 A;  2YF0 A;  4K2O A;  4KAX B;  2Y8F A;  2EMT A;  4HAY B;  1V5M A;  4ZRK A;  4Z2N A;  2EMS A;  4XWX A;  3KY9 A;  4HHV A;  2VKI A;  3P7Z A;  2RSG A;  1UPQ A;  1WGU A;  1X11 A;  2EJ8 A;  3AJ4 A;  1V88 A;  2LOZ A;  1NTY A;  2RUK B;  2ELA A;  4KHA A;  1H4R A;  2YS3 A;  2DHK A;  4GN1 A;  4DX9 0;  5L81 A;  2DYN A;  5CLL B;  1M7E A;  2COC A;  1RJ2 A;  2I1J A;  2RNR B;  3ULC A;  2D9Z A;  5C6R A;  1XKE A;  4A6K A;  1WVH A;  1U5F A;  4HB0 B;  1LB1 A;  2L2I A;  4F7U P;  1FHO A;  2OQB A;  1OQN A;  1MK9 B;  3VOQ A;  3KSY A;  4GZU A;  1ZM0 A;  5C79 A;  2V76 A;  3PP2 A;  1RRP B;  2MFQ A;  4K17 A;  2DLW A;  4YL8 A;  3QBV B;  1X86 A;  3SV1 A;  1EGX A;  2M38 A;  3PSC A;  2DN6 A;  2OTX A;  2H7D A;  3U7D A;  4HAT B;  2PZ1 A;  3NSU A;  4EMO A;  2I5C A;  2CY4 A;  2AL6 A;  2MDX A;  1GC6 A;  1BTN A;  1V89 A;  4K81 A;  2YT1 A;  3ODX A;  4DBB A;  3ODW A;  2Y7B A;  2COD A;  1DDW A;  4HAU B;  4HAX B;  3M1I B;  1I2H A;  3N7C A;  5D3X A;  5D3V A;  1X05 A;  1SGH A;  1DDV A;  4GMX B;  1E5W A;  4HB3 B;  4GXB A;  2D9X A;  4F7G A;  2I5F A;  3PEG A;  3TVV A;  2GS0 A;  1W1H A;  1OMW A;  4MY6 A;  1WI1 A;  3HQC A;  1ZC3 B;  3BIN A;  2ZPY A;  1ZC4 B;  3BJI A;  1DBH A;  1TXD A;  1KI1 B;  1KZG A;  3GYP A;  5DI9 B;  1LW3 A;  1UEF A;  2K2J A;  3FEH A;  2XQN M;  1U5G A;  5D3Y A;  2D9V A;  3MDB C;  1ZSQ A;  1DRO A;  2K00 A;  2M14 A;  2P8V A;  2YVC A;  1XOD A;  3CIK A;  2D9W A;  3PZD A;  2P0H A;  5JLJ B;  1XX0 A;  1AQC A;  4KVG B;  2I1K A;  1FHW A;  3SNH A;  3TW1 A;  5HE1 A;  3GYO A;  2DX5 A;  1EF1 A;  2QKL A;  1BAK A;  4IAP A;  2ELB A;  1V5U A;  4NY0 A;  1NI2 A;  1W1G A;  2G35 A;  2UZS A;  4HB4 B;  2RVB B;  1FHX A;  3ULB A;  3LJU X;  4A6H A;  1FGY A;  1U2B A;  2P0F A;  2N23 A;  1W1D A;  5KQ4 A;  1Q67 A;  2CRF A;  3RCP A;  2GCJ A;  5DIF B;  4HDQ A;  2IYB A;  2DKQ A;  5J3T A;  3A8P A;  3PVL A;  1K5D B;  1KZ7 A;  4C0A A;  5C5B B;  3F5R A;  1DDM A;  1FOE A;  3TFM A;  2DKP A;  1Z87 A;  2X18 A;  3OAN A;  1U29 A;  2J0J A;  5J3Y A;  2D11 A;  1K5G B;  3ZVR A;  1DYN A;  1P5T A;  5GOW B;  2RLO A;  4HAV B;  4P7I A;  3SO6 A;  1AWE A;  2LG1 A;  2Q13 A;  2MWN B;  1FGZ A;  5FI0 A;  4A6F B;  2J59 M;  2D9Y A;  1TQZ A;  5DHF B;  1BWN A;  2EC1 A;  3PVU A;  1XD4 A;  2DA0 A;  2KGX B;  3MPX A;  3IVF A;  2L1C A;  3TCA A;  1P6S A;  3KRX A;  3G9W A;  1WJ1 A;  1X1G A;  4DXA B;  3VIA A;  2UVM A;  3QWM A;  1V5P A;  2GJY A;  4ZRJ A;  4GMV A;  2ROV A;  2DHJ A;  2DYQ A;  1Y19 B;  4L6E A;  1PMS A;  4Y94 A;  1V61 A;  2JP2 A;  4KHB B;  3FM8 C;  3AU4 A;  5HE0 A;  2HE7 A;  1WGQ A;  1QQG A;  4ZRI A;  5C16 A;  3D8F A;  5LON B;  4D0N B;  2MKR A;  5JHH A;  5FI1 A;  2ROZ B;  4A6F A;  1NTV A;  1OY2 A;  1B55 A;  4YON A;  2R09 A;  4BBK A;  2KCJ A;  2DTC A;  3UZT A;  2COA A;  2IFS A;  2CY5 A;  3HK0 A;  1FAO A;  1EVH A;  3DXD A;  1MK7 B;  4H8S A;  1MPH A;  1ISN A;  2FJL A;  5HE2 A;  2VRW B;  3A8Q A;  1MIX A;  1Y5O A;  2AEH A;  3QIJ A;  2DHI A;  4WVF B;  4KHO A;  1U5E A;  4HDO A;  1J0W A;  4MT7 A;  4TYZ A;  3KZ1 A;  4CHJ A;  1UPR A;  3AU5 A;  4EKU A;  3X23 A;  1MKE A;  3CXB B;  1MAI A;  2YT0 A;  1EAZ A;  2Y8G A;  4Z2M B;  5EFX A;  4K2P A;  1UNP A;  1XR0 B;  2UZR A;  1PLS A;  5LOP B;  5J3Q A;  5CLQ B;  2J0K A;  3O96 A;  1WG7 A;  2DFK A;  5KQ1 A;  1BTK A;  3U8Z A;  1SHC A;  1QC6 A;  1XCG A;  1N3H A;  2VSZ A;  2LKO A;  4HB2 B;  4NSW A;  2NMB A;  4CHM A;  2H7E A;  2D2Q A;  1UNQ A;  5D3W A;  3HW2 B;  2P0D A;  3ODO A;  3KRW A;  3TO1 A;  4PNK A;  2YSZ A;  3DXC A;  1WJM A;  2D10 A;  2Z0P A;  1M7R A;  3PG7 A;  2W2X D;  3P6A A;  3FSS A;  4HAZ B;  2CAY A;  2RGN B;  5D27 A;  1FB8 A;  1P3R A;  4IFS A;  1PFJ A;  1U5D A;  2COF A;  2LYD A;  3DXE A;  2HTH B;  5KCV A;  3ML4 A;  3SYX A;  4TKN A;  3WYF B;  1H10 A;  2KUP A;  2YS1 A;  4A5K A;  4EJN A;  5C5B A;  2NZ8 B;  3D8D A;  4MK0 A;  2E2X A;  2J0M A;  1J19 A;  1NU2 A;  2K2U A;  2Z0O A;  4CYE A;  2R0D A;  2BCJ A;  2N0Y A;  3PVW A;  2QKM A;  2GCL A;  2W2W A;  4IOY X;  2ADZ A;  2Z0Q A;  1MIZ B;  4B6H A;  4GPT B;  4F7H A;  3WA0 A;  3ZDT A;  3A98 B;  1GG3 A;  5JP4 A;  1IRS A;  2LOX A; 
#chains in the Genus database with same CATH topology
 4OSN A;  5DH9 B;  3NW8 A;  1X1F A;  2LUL A;  1UNR A;  1U27 A;  3SUZ A;  5IRS A;  4PQ0 A;  1GC7 A;  2D4Q A;  2Z14 A;  3D8E A;  3DCX A;  3F0W A;  3V5W A;  2YS5 A;  1I7A A;  1MI1 A;  4HAW B;  2W2X C;  5JHG A;  4DX8 A;  5DHA B;  4WSF A;  2DX1 A;  3T06 A;  4WJ7 A;  1ZVR A;  5I2S A;  2YRY A;  2ZKM X;  4KHB A;  1TJ6 A;  5HE3 A;  3HSA A;  2YF0 A;  2FJU B;  4K2O A;  4KAX B;  2Y8F A;  2EMT A;  4HAY B;  1V5M A;  4ZRK A;  4Z2N A;  2EMS A;  4XWX A;  3KY9 A;  4HHV A;  2VKI A;  3P7Z A;  2RSG A;  1UPQ A;  1WGU A;  1X11 A;  2EJ8 A;  3U12 A;  4GNK B;  3AJ4 A;  1V88 A;  2LOZ A;  2NBV A;  1NTY A;  2RUK B;  2ELA A;  4KHA A;  1H4R A;  2YT2 A;  2YS3 A;  2DHK A;  4GN1 A;  4DX9 0;  5L81 A;  2DYN A;  5CLL B;  1M7E A;  2COC A;  1RJ2 A;  2I1J A;  2RNR B;  3ULC A;  2D9Z A;  5C6R A;  1XKE A;  4A6K A;  1WVH A;  1U5F A;  4HB0 B;  1LB1 A;  2L2I A;  4HSI A;  4F7U P;  1FHO A;  2OQB A;  1OQN A;  1MK9 B;  3VOQ A;  3KSY A;  4GZU A;  1ZM0 A;  5C79 A;  2V76 A;  3PP2 A;  4CSQ A;  1RRP B;  2MFQ A;  4K17 A;  2DLW A;  4YL8 A;  3QBV B;  1X86 A;  3SV1 A;  1EGX A;  2M38 A;  3PSC A;  2DN6 A;  2OTX A;  2H7D A;  3U7D A;  4HAT B;  2PZ1 A;  3NSU A;  4EMO A;  2I5C A;  2CY4 A;  2Z59 A;  2AL6 A;  2MDX A;  1GC6 A;  1BTN A;  1V89 A;  4K81 A;  2YT1 A;  3ODX A;  3OHM B;  4DBB A;  3ODW A;  2Y7B A;  2COD A;  1DDW A;  4HAU B;  4HAX B;  3M1I B;  1I2H A;  3N7C A;  5D3X A;  5D3V A;  1X05 A;  1SGH A;  1DDV A;  4GMX B;  1E5W A;  4HB3 B;  4GXB A;  2D9X A;  4F7G A;  2I5F A;  3PEG A;  3TVV A;  3NWA A;  2KUQ A;  2GS0 A;  1W1H A;  2R2Y A;  1OMW A;  4OT1 A;  4MY6 A;  3B77 A;  1WI1 A;  3HQC A;  1ZC3 B;  3BIN A;  2ZPY A;  1ZC4 B;  3BJI A;  1DBH A;  1TXD A;  3A58 A;  1KI1 B;  1KZG A;  3GYP A;  5DI9 B;  1LW3 A;  1UEF A;  2K2J A;  3FEH A;  2XQN M;  1U5G A;  5D3Y A;  2D9V A;  3MDB C;  1ZSQ A;  1DRO A;  2K00 A;  2M14 A;  2P8V A;  2YVC A;  2GUM A;  1XOD A;  3CIK A;  2D9W A;  3PZD A;  2P0H A;  2K49 A;  5M4Y B;  5JLJ B;  1XX0 A;  1AQC A;  5I2M A;  4KVG B;  2I1K A;  1FHW A;  3SNH A;  3TW1 A;  5HE1 A;  3GYO A;  2DX5 A;  1EF1 A;  2QKL A;  1BAK A;  4IAP A;  2ELB A;  2RRF A;  1V5U A;  4NY0 A;  1NI2 A;  1W1G A;  2G35 A;  2UZS A;  4HB4 B;  2RVB B;  1FHX A;  3ULB A;  3LJU X;  4A6H A;  1FGY A;  1U2B A;  2P0F A;  2N23 A;  1W1D A;  5KQ4 A;  1Q67 A;  2CRF A;  3RCP A;  4GOU A;  2GCJ A;  5DIF B;  4HDQ A;  2IYB A;  2DKQ A;  5J3T A;  3A8P A;  3PVL A;  1K5D B;  1KZ7 A;  4C0A A;  5C5B B;  3F5R A;  1DDM A;  1FOE A;  3TFM A;  2DKP A;  1Z87 A;  2X18 A;  3OAN A;  1U29 A;  2J0J A;  4D6W A;  5J3Y A;  2D11 A;  1K5G B;  3ZVR A;  1DYN A;  1P5T A;  5GOW B;  2RLO A;  4HAV B;  4P7I A;  3SO6 A;  1AWE A;  2LG1 A;  2Q13 A;  2MWN B;  1FGZ A;  5FI0 A;  4A6F B;  2J59 M;  2D9Y A;  2K8E A;  1TQZ A;  5DHF B;  1BWN A;  2EC1 A;  3PVU A;  1XD4 A;  2DA0 A;  2KGX B;  3MPX A;  3IVF A;  2L1C A;  3TCA A;  1P6S A;  3KRX A;  3G9W A;  1WJ1 A;  1X1G A;  4DXA B;  3VIA A;  2UVM A;  3QWM A;  2Z4D A;  1V5P A;  2GJY A;  3NWD A;  4ZRJ A;  4GMV A;  2ROV A;  2DHJ A;  2DYQ A;  1Y19 B;  4L6E A;  1PMS A;  2Z13 A;  4Y94 A;  1V61 A;  2JP2 A;  4KHB B;  3FM8 C;  3AU4 A;  5HE0 A;  2HE7 A;  1WGQ A;  1QQG A;  4ZRI A;  5C16 A;  3D8F A;  5LON B;  4D0N B;  2MKR A;  5JHH A;  5FI1 A;  2ROZ B;  4A6F A;  1NTV A;  4DIX A;  1OY2 A;  1B55 A;  4YON A;  2R09 A;  4BBK A;  2KCJ A;  2DTC A;  3UZT A;  2COA A;  2IFS A;  2CY5 A;  4QJ4 B;  3HK0 A;  1FAO A;  4QJ3 B;  1EVH A;  3DXD A;  1MK7 B;  4H8S A;  5LG4 B;  1MPH A;  1ISN A;  2FJL A;  2KIG A;  5HE2 A;  2VRW B;  3A8Q A;  1MIX A;  1Y5O A;  2AEH A;  3QIJ A;  2DHI A;  4WVF B;  4KHO A;  1U5E A;  4HDO A;  1J0W A;  4MT7 A;  4TYZ A;  3KZ1 A;  4CHJ A;  1UPR A;  3AU5 A;  4EKU A;  3X23 A;  1MKE A;  3CXB B;  4QXA B;  1MAI A;  2KR0 A;  2YT0 A;  1EAZ A;  2Y8G A;  4Z2M B;  5EFX A;  4K2P A;  1UNP A;  1XR0 B;  2UZR A;  1PLS A;  5LOP B;  5J3Q A;  5CLQ B;  2J0K A;  3O96 A;  1WG7 A;  2DFK A;  5KQ1 A;  1BTK A;  3U8Z A;  1SHC A;  1QC6 A;  3FVC A;  1XCG A;  1N3H A;  2VSZ A;  2LKO A;  4HB2 B;  4L1R A;  4NSW A;  2NMB A;  4CHM A;  2H7E A;  2D2Q A;  1UNQ A;  5D3W A;  3HW2 B;  1T77 A;  2P0D A;  3HIE A;  3ODO A;  3KRW A;  3TO1 A;  4PNK A;  2YSZ A;  3DXC A;  1WJM A;  2D10 A;  2Z0P A;  1M7R A;  2W2X D;  3P6A A;  3PG7 A;  3FSS A;  4HAZ B;  2CAY A;  2RGN B;  5D27 A;  1FB8 A;  1P3R A;  2KIE A;  4IFS A;  1PFJ A;  1U5D A;  2COF A;  4QJ5 B;  2LYD A;  3DXE A;  2HTH B;  5KCV A;  3ML4 A;  3SYX A;  4TKN A;  3WYF B;  1H10 A;  2KUP A;  2YS1 A;  4A5K A;  4EJN A;  5C5B A;  2NZ8 B;  3D8D A;  4MK0 A;  2E2X A;  2J0M A;  1J19 A;  1NU2 A;  1ZYI A;  2K2U A;  2Z0O A;  4CYE A;  2R0D A;  2BCJ A;  2N0Y A;  3PVW A;  2QKM A;  2GCL A;  2W2W A;  4IOY X;  2ADZ A;  2Z0Q A;  1MIZ B;  3NWF A;  4B6H A;  4GPT B;  4F7H A;  3WA0 A;  3ZDT A;  3A98 B;  1GG3 A;  5JP4 A;  1IRS A;  2LOX A; 
#chains in the Genus database with same CATH homology
 5DH9 B;  1X1F A;  2LUL A;  1UNR A;  1U27 A;  3SUZ A;  4PQ0 A;  1GC7 A;  2D4Q A;  3V5W A;  3D8E A;  3F0W A;  2YS5 A;  1I7A A;  4HAW B;  2W2X C;  5JHG A;  4DX8 A;  5DHA B;  4WSF A;  2DX1 A;  3T06 A;  4WJ7 A;  1ZVR A;  2YRY A;  1TJ6 A;  5HE3 A;  2YF0 A;  4K2O A;  4KAX B;  2Y8F A;  2EMT A;  4HAY B;  1V5M A;  4ZRK A;  4Z2N A;  2EMS A;  4XWX A;  3KY9 A;  4HHV A;  2VKI A;  3P7Z A;  2RSG A;  1UPQ A;  1WGU A;  1X11 A;  2EJ8 A;  3AJ4 A;  1V88 A;  2LOZ A;  1NTY A;  2RUK B;  2ELA A;  4KHA A;  1H4R A;  2YS3 A;  2DHK A;  4GN1 A;  4DX9 0;  5L81 A;  2DYN A;  5CLL B;  1M7E A;  2COC A;  1RJ2 A;  2I1J A;  2RNR B;  3ULC A;  2D9Z A;  5C6R A;  1XKE A;  4A6K A;  1WVH A;  1U5F A;  4HB0 B;  1LB1 A;  2L2I A;  4F7U P;  1FHO A;  2OQB A;  1OQN A;  1MK9 B;  3VOQ A;  3KSY A;  4GZU A;  1ZM0 A;  5C79 A;  2V76 A;  3PP2 A;  1RRP B;  2MFQ A;  4K17 A;  2DLW A;  4YL8 A;  3QBV B;  1X86 A;  3SV1 A;  1EGX A;  2M38 A;  3PSC A;  2DN6 A;  2OTX A;  2H7D A;  3U7D A;  4HAT B;  2PZ1 A;  3NSU A;  4EMO A;  2I5C A;  2CY4 A;  2AL6 A;  2MDX A;  1GC6 A;  1BTN A;  1V89 A;  4K81 A;  2YT1 A;  3ODX A;  4DBB A;  3ODW A;  2Y7B A;  2COD A;  1DDW A;  4HAU B;  4HAX B;  3M1I B;  1I2H A;  3N7C A;  5D3X A;  5D3V A;  1X05 A;  1SGH A;  1DDV A;  4GMX B;  1E5W A;  4HB3 B;  4GXB A;  2D9X A;  4F7G A;  2I5F A;  3PEG A;  3TVV A;  2GS0 A;  1W1H A;  1OMW A;  4MY6 A;  1WI1 A;  3HQC A;  1ZC3 B;  3BIN A;  2ZPY A;  1ZC4 B;  3BJI A;  1DBH A;  1TXD A;  1KI1 B;  1KZG A;  3GYP A;  5DI9 B;  1LW3 A;  1UEF A;  2K2J A;  3FEH A;  2XQN M;  1U5G A;  5D3Y A;  2D9V A;  3MDB C;  1ZSQ A;  1DRO A;  2K00 A;  2M14 A;  2P8V A;  2YVC A;  1XOD A;  3CIK A;  2D9W A;  3PZD A;  2P0H A;  5JLJ B;  1XX0 A;  1AQC A;  4KVG B;  2I1K A;  1FHW A;  3SNH A;  3TW1 A;  5HE1 A;  3GYO A;  2DX5 A;  1EF1 A;  2QKL A;  1BAK A;  4IAP A;  2ELB A;  1V5U A;  4NY0 A;  1NI2 A;  1W1G A;  2G35 A;  2UZS A;  4HB4 B;  2RVB B;  1FHX A;  3ULB A;  3LJU X;  4A6H A;  1FGY A;  1U2B A;  2P0F A;  2N23 A;  1W1D A;  5KQ4 A;  1Q67 A;  2CRF A;  3RCP A;  2GCJ A;  5DIF B;  4HDQ A;  2IYB A;  2DKQ A;  5J3T A;  3A8P A;  3PVL A;  1K5D B;  1KZ7 A;  4C0A A;  5C5B B;  3F5R A;  1DDM A;  1FOE A;  3TFM A;  2DKP A;  1Z87 A;  2X18 A;  3OAN A;  1U29 A;  2J0J A;  5J3Y A;  2D11 A;  1K5G B;  3ZVR A;  1DYN A;  1P5T A;  5GOW B;  2RLO A;  4HAV B;  4P7I A;  3SO6 A;  1AWE A;  2LG1 A;  2Q13 A;  2MWN B;  1FGZ A;  5FI0 A;  4A6F B;  2J59 M;  2D9Y A;  1TQZ A;  5DHF B;  1BWN A;  2EC1 A;  3PVU A;  1XD4 A;  2DA0 A;  2KGX B;  3MPX A;  3IVF A;  2L1C A;  3TCA A;  1P6S A;  3KRX A;  3G9W A;  1WJ1 A;  1X1G A;  4DXA B;  3VIA A;  2UVM A;  3QWM A;  1V5P A;  2GJY A;  4ZRJ A;  4GMV A;  2ROV A;  2DHJ A;  2DYQ A;  1Y19 B;  4L6E A;  1PMS A;  4Y94 A;  1V61 A;  2JP2 A;  4KHB B;  3FM8 C;  3AU4 A;  5HE0 A;  2HE7 A;  1WGQ A;  1QQG A;  4ZRI A;  5C16 A;  3D8F A;  5LON B;  4D0N B;  2MKR A;  5JHH A;  5FI1 A;  2ROZ B;  4A6F A;  1NTV A;  1OY2 A;  1B55 A;  4YON A;  2R09 A;  4BBK A;  2KCJ A;  2DTC A;  3UZT A;  2COA A;  2IFS A;  2CY5 A;  3HK0 A;  1FAO A;  1EVH A;  3DXD A;  1MK7 B;  4H8S A;  1MPH A;  1ISN A;  2FJL A;  5HE2 A;  2VRW B;  3A8Q A;  1MIX A;  1Y5O A;  2AEH A;  3QIJ A;  2DHI A;  4WVF B;  4KHO A;  1U5E A;  4HDO A;  1J0W A;  4MT7 A;  4TYZ A;  3KZ1 A;  4CHJ A;  1UPR A;  3AU5 A;  4EKU A;  3X23 A;  1MKE A;  3CXB B;  1MAI A;  2YT0 A;  1EAZ A;  2Y8G A;  4Z2M B;  5EFX A;  4K2P A;  1UNP A;  1XR0 B;  2UZR A;  1PLS A;  5LOP B;  5J3Q A;  5CLQ B;  2J0K A;  3O96 A;  1WG7 A;  2DFK A;  5KQ1 A;  1BTK A;  3U8Z A;  1SHC A;  1QC6 A;  1XCG A;  1N3H A;  2VSZ A;  2LKO A;  4HB2 B;  4NSW A;  2NMB A;  4CHM A;  2H7E A;  2D2Q A;  1UNQ A;  5D3W A;  3HW2 B;  2P0D A;  3ODO A;  3KRW A;  3TO1 A;  4PNK A;  2YSZ A;  3DXC A;  1WJM A;  2D10 A;  2Z0P A;  1M7R A;  3PG7 A;  2W2X D;  3P6A A;  3FSS A;  4HAZ B;  2CAY A;  2RGN B;  5D27 A;  1FB8 A;  1P3R A;  4IFS A;  1PFJ A;  1U5D A;  2COF A;  2LYD A;  3DXE A;  2HTH B;  5KCV A;  3ML4 A;  3SYX A;  4TKN A;  3WYF B;  1H10 A;  2KUP A;  2YS1 A;  4A5K A;  4EJN A;  5C5B A;  2NZ8 B;  3D8D A;  4MK0 A;  2E2X A;  2J0M A;  1J19 A;  1NU2 A;  2K2U A;  2Z0O A;  4CYE A;  2R0D A;  2BCJ A;  2N0Y A;  3PVW A;  2QKM A;  2GCL A;  2W2W A;  4IOY X;  2ADZ A;  2Z0Q A;  1MIZ B;  4B6H A;  4GPT B;  4F7H A;  3WA0 A;  3ZDT A;  3A98 B;  1GG3 A;  5JP4 A;  1IRS A;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...