3RCPA

Crystal structure of the fapp1 pleckstrin homology domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
100
Chain Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of Phosphatidylinositol 4-Phosphate and ARF1 GTPase Recognition by the FAPP1 Pleckstrin Homology (PH) Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Pleckstrin homology domain-containing family A member 3
total genus 15
structure length 100
sequence length 103
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3rcpA00
2P8VA 1FHOA 4HHVA 3SNHA 5DHFB 1EGXA 5C79A 5KQ1A 5D3YA 4BBKA 1BTKA 1PLSA 2Z0QA 2X18A 3FSSA 5HE1A 2UVMA 2JP2A 1XX0A 2P0HA 3PG7A 4A6HA 2DN6A 4DXAB 4K81A 3TO1A 4GZUA 4HAUB 3IVFA 3D8EA 3KY9A 4HAXB 4KVGB 3V5WA 3U8ZA 3UZTA 1U5GA 2DKQA 3ODOA 2Y7BA 1QQGA 1OMWA 4KHOA 2CODA 2RVBB 4D0NB 2MKRA 2ROVA 1WJMA 3D8DA 3PZDA 5GOWB 4HAWB 1W1GA 2QKMA 1K5DB 5HE3A 3A8QA 2P0DA 5DH9B 1M7RA 2ROZB 1TQZA 3GYOA 5C16A 1X86A 1PMSA 4WJ7A 3DXEA 2I5CA 2DX1A 1DBHA 5FI1A 4P7IA 1XODA 5D27A 4DX90 3P6AA 2R0DA 5DHAB 2I1KA 2CY5A 2DTCA 1WVHA 5HE0A 3KZ1A 3N7CA 5C5BB 2NZ8B 1W1HA 4GXBA 2L2IA 4CYEA 2GCLA 1NTYA 2L1CA 2P0FA 4HDQA 1XCGA 2CRFA 2Q13A 4Z2NA 3U7DA 1FGYA 5KCVA 3M1IB 3RCPA 3TCAA 1ZSQA 2YT1A 3SYXA 2DA0A 4MK0A 4A5KA 3D8FA 2HTHB 1MIXA 1GG3A 3KRXA 2D9ZA 5L81A 2OQBA 2Y8GA 1ZC4B 1J19A 4NY0A 4HB2B 1WG7A 2IYBA 1DDVA 5DI9B 5JP4A 2LULA 1BAKA 2ZPYA 2YS1A 3QBVB 3X23A 3TVVA 1UEFA 1B55A 5C6RA 1MIZB 3NSUA 1I7AA 5KQ4A 1NI2A 3SO6A 3P7ZA 2D4QA 1SGHA 1P5TA 4GMVA 1MAIA 3FEHA 3ZVRA 4K2PA 1BWNA 1FB8A 2EMTA 2COAA 3TFMA 3F5RA 1LB1A 3ZDTA 4WVFB 1X05A 1ISNA 4CHJA 3QIJA 1V5MA 2K2UA 1OY2A 2UZRA 2MWNB 1N3HA 2W2XC 4YONA 2FJLA 3OANA 2DYNA 2I1JA 5FI0A 1UNQA 2DLWA 2ADZA 4IOYX 3ULBA 1MPHA 1FGZA 1W1DA 1KZ7A 1X11A 1FOEA 1E5WA 3GYPA 4A6FA 2K00A 1UPRA 5CLLB 2MFQA 4K17A 2NMBA 5HE2A 2H7EA 2CAYA 1PFJA 2EJ8A 2COFA 4EJNA 2D9VA 1AQCA 3PVWA 4XWXA 1K5GB 5JHGA 2YS5A 4EKUA 4F7HA 3QWMA 1DDWA 1H10A 3G9WA 1EF1A 2E2XA 2DHKA 2I5FA 2VRWB 1RJ2A 3PEGA 4TKNA 1V89A 4GMXB 2D9XA 3F0WA 1GC7A 1BTNA 1I2HA 2J59M 1QC6A 5D3WA 5CLQB 1M7EA 3AU5A 3CIKA 1XKEA 3MDBC 3BINA 4DBBA 2DHJA 2RUKB 1FHWA 1V88A 5J3YA 4B6HA 4KHAA 3HW2B 2KCJA 2LOXA 1GC6A 2M14A 1TJ6A 5D3XA 2DKPA 3WYFB 2W2XD 4KHBB 2AEHA 4Z2MB 3TW1A 2GJYA 1Q67A 2G35A 4HAVB 2RNRB 2LKOA 2GCJA 2ELBA 1WI1A 1Y19B 4IAPA 1Z87A 2YT0A 2V76A 4NSWA 1MK7B 1U29A 2EC1A 2K2JA 1WJ1A 5JLJB 4IFSA 1DYNA 5LONB 4HDOA 3CXBB 1ZC3B 3KRWA 2YF0A 4F7UP 3VIAA 1XD4A 1FHXA 2YS3A 1V5PA 3DXDA 1MK9B 4TYZA 5DIFB 2EMSA 3BJIA 1U2BA 3A8PA 2QKLA 2VSZA 2Z0PA 3T06A 3HQCA 4Y94A 1V5UA 4ZRKA 1UPQA 1AWEA 2D9YA 4DX8A 1EAZA 1WGUA 5J3TA 4GPTB 1KZGA 2DFKA 3LJUX 4HB4B 2PZ1A 4H8SA 3KSYA 3PSCA 2OTXA 1U5EA 1EVHA 4EMOA 5JHHA 1X1FA 2DX5A 2COCA 1FAOA 2N0YA 2Y8FA 1Y5OA 1U5FA 2DYQA 2R09A 1U5DA 3A98B 2D11A 1H4RA 1IRSA 5EFXA 2RSGA 5LOPB 3O96A 3FM8C 3ODXA 2J0JA 1SHCA 2D2QA 3VOQA 2D9WA 1MKEA 1XR0B 2H7DA 2D10A 1ZM0A 2Z0OA 2IFSA 4KAXB 2LOZA 3ULCA 3PP2A 2W2WA 2BCJA 4K2OA 2J0KA 1UNPA 3ODWA 4WSFA 5C5BA 1KI1B 4HB3B 2N23A 2VKIA 1LW3A 2RLOA 2DHIA 3ML4A 2ELAA 2LYDA 2CY4A 4GN1A 2MDXA 2YSZA 4C0AA 1V61A 2HE7A 3SUZA 3HK0A 1DROA 4L6EA 1X1GA 4A6FB 2J0MA 1U27A 3MPXA 5D3VA 2KGXB 2AL6A 3WA0A 1P6SA 4ZRIA 4PQ0A 4A6KA 5J3QA 2YRYA 4ZRJA 3DXCA 4PNKA 4CHMA 1NU2A 4HAZB 2YVCA 4YL8A 2GS0A 4HATB 1TXDA 1RRPB 4MY6A 2KUPA 1J0WA 3PVLA 1DDMA 2XQNM 4MT7A 3PVUA 3SV1A 1WGQA 4F7GA 3AJ4A 4HB0B 2UZSA 2LG1A 2M38A 1UNRA 4HAYB 3AU4A 1P3RA 1ZVRA 2RGNB 1OQNA 1NTVA
chains in the Genus database with same CATH superfamily
2P8VA 1FHOA 5IRSA 4HHVA 3SNHA 5DHFB 1EGXA 5C79A 1MI1A 5KQ1A 5D3YA 4BBKA 1BTKA 1PLSA 2Z0QA 2X18A 3FSSA 3HSAA 5HE1A 2UVMA 2JP2A 1XX0A 2P0HA 3PG7A 4A6HA 2DN6A 4DXAB 4K81A 3NWFA 3TO1A 4GZUA 4HAUB 3IVFA 3D8EA 3KY9A 4HAXB 4KVGB 3V5WA 3U8ZA 3UZTA 1U5GA 2DKQA 3ODOA 2Y7BA 1QQGA 1OMWA 4KHOA 2CODA 4QJ4B 2RVBB 4D0NB 2MKRA 2ROVA 1WJMA 3D8DA 3PZDA 5GOWB 4HAWB 1W1GA 2QKMA 1K5DB 1T77A 5HE3A 3A8QA 2P0DA 2Z4DA 5DH9B 2Z14A 1M7RA 2ROZB 1TQZA 3GYOA 5C16A 1X86A 1PMSA 4WJ7A 3DXEA 2I5CA 4OT1A 2DX1A 3OHMB 1DBHA 5FI1A 4P7IA 1XODA 5D27A 4DX90 4OSNA 3P6AA 3HIEA 2R0DA 5DHAB 2I1KA 2CY5A 2DTCA 1WVHA 5HE0A 2YT2A 3KZ1A 3N7CA 5C5BB 2NZ8B 1W1HA 4GXBA 2L2IA 4CYEA 2GCLA 1NTYA 2L1CA 2P0FA 4HDQA 1XCGA 2CRFA 2Q13A 4Z2NA 2KR0A 2KIGA 3U7DA 3A58A 1FGYA 4GOUA 5KCVA 3M1IB 3RCPA 3TCAA 1ZSQA 3DCXA 4GNKB 2YT1A 3SYXA 5M4YB 2DA0A 4KHBA 4MK0A 4A5KA 3D8FA 2HTHB 1MIXA 1GG3A 3KRXA 2D9ZA 5L81A 2OQBA 2Y8GA 2FJUB 1ZC4B 1J19A 4NY0A 4HB2B 1WG7A 2IYBA 1ZYIA 1DDVA 5DI9B 5JP4A 4HSIA 2LULA 1BAKA 2ZPYA 2YS1A 3QBVB 3X23A 3TVVA 1UEFA 1B55A 5C6RA 1MIZB 3NSUA 1I7AA 5KQ4A 1NI2A 3SO6A 3P7ZA 2D4QA 1SGHA 1P5TA 4GMVA 3B77A 1MAIA 3FEHA 3ZVRA 4K2PA 1BWNA 1FB8A 2EMTA 2COAA 5I2SA 3TFMA 3F5RA 1LB1A 3ZDTA 4WVFB 2KIEA 1X05A 2ZKMX 1ISNA 2K49A 4CHJA 3QIJA 1V5MA 2K2UA 1OY2A 2UZRA 2MWNB 1N3HA 2W2XC 4YONA 2FJLA 2Z59A 3OANA 2DYNA 2I1JA 5FI0A 4DIXA 1UNQA 2DLWA 2R2YA 2ADZA 4IOYX 3ULBA 1MPHA 1FGZA 1W1DA 1KZ7A 1X11A 4QXAB 1FOEA 1E5WA 3GYPA 4A6FA 2K00A 1UPRA 5CLLB 2MFQA 4K17A 2NMBA 5HE2A 2H7EA 2CAYA 1PFJA 2EJ8A 2COFA 4EJNA 2D9VA 1AQCA 3PVWA 4XWXA 1K5GB 5JHGA 2YS5A 4EKUA 4F7HA 3QWMA 1DDWA 1H10A 3G9WA 1EF1A 2E2XA 2DHKA 2I5FA 2VRWB 2GUMA 1RJ2A 3FVCA 3PEGA 4TKNA 1V89A 4GMXB 2D9XA 3F0WA 1GC7A 1BTNA 1I2HA 2J59M 1QC6A 5D3WA 5CLQB 1M7EA 3AU5A 3CIKA 1XKEA 3MDBC 3BINA 4DBBA 2DHJA 2RUKB 1FHWA 1V88A 5J3YA 4B6HA 4KHAA 3HW2B 2KCJA 2LOXA 1GC6A 2M14A 1TJ6A 5D3XA 2DKPA 3WYFB 2W2XD 4KHBB 2AEHA 4Z2MB 3TW1A 2GJYA 1Q67A 2G35A 4HAVB 2RNRB 2LKOA 4QJ5B 3NW8A 2GCJA 2ELBA 3NWDA 1WI1A 1Y19B 4L1RA 2RRFA 4IAPA 1Z87A 2YT0A 2V76A 4NSWA 1MK7B 1U29A 2EC1A 2K2JA 1WJ1A 5JLJB 4IFSA 1DYNA 5LONB 4HDOA 3CXBB 1ZC3B 3KRWA 2YF0A 4F7UP 4D6WA 3VIAA 1XD4A 1FHXA 2YS3A 2NBVA 1V5PA 3DXDA 1MK9B 4TYZA 5DIFB 2EMSA 3BJIA 1U2BA 2Z13A 3A8PA 2QKLA 2VSZA 4CSQA 2Z0PA 3T06A 3HQCA 4Y94A 1V5UA 4ZRKA 1UPQA 1AWEA 2D9YA 4DX8A 1EAZA 1WGUA 5J3TA 4GPTB 1KZGA 2DFKA 3LJUX 4HB4B 2PZ1A 4H8SA 3KSYA 3PSCA 2OTXA 1U5EA 1EVHA 4EMOA 5JHHA 1X1FA 2DX5A 2COCA 1FAOA 2N0YA 2Y8FA 1Y5OA 1U5FA 2DYQA 2R09A 1U5DA 3A98B 2KUQA 2D11A 1H4RA 1IRSA 5EFXA 2RSGA 5LOPB 3O96A 3FM8C 3ODXA 2J0JA 1SHCA 2D2QA 3VOQA 2D9WA 1MKEA 1XR0B 2H7DA 2D10A 1ZM0A 2Z0OA 2IFSA 4KAXB 2LOZA 3ULCA 3PP2A 2W2WA 2BCJA 4K2OA 2J0KA 1UNPA 3ODWA 4WSFA 5C5BA 1KI1B 4HB3B 2N23A 2VKIA 1LW3A 2RLOA 2DHIA 3ML4A 2ELAA 2LYDA 2CY4A 4GN1A 5I2MA 2MDXA 2YSZA 4C0AA 5LG4B 1V61A 2HE7A 3NWAA 3HK0A 3SUZA 1DROA 4L6EA 1X1GA 4A6FB 2J0MA 1U27A 3MPXA 5D3VA 2KGXB 2AL6A 3WA0A 1P6SA 4ZRIA 4PQ0A 4A6KA 5J3QA 2YRYA 4ZRJA 4QJ3B 3DXCA 4PNKA 4CHMA 1NU2A 4HAZB 2YVCA 3U12A 4YL8A 2GS0A 4HATB 1TXDA 1RRPB 4MY6A 2KUPA 1J0WA 3PVLA 2K8EA 1DDMA 2XQNM 4MT7A 3PVUA 3SV1A 1WGQA 4F7GA 3AJ4A 4HB0B 2UZSA 2LG1A 2M38A 1UNRA 4HAYB 3AU4A 1P3RA 1ZVRA 2RGNB 1OQNA 1NTVA
chains in the Genus database with same CATH topology
2P8VA 1FHOA 4HHVA 3SNHA 5DHFB 1EGXA 5C79A 5KQ1A 5D3YA 4BBKA 1BTKA 1PLSA 2Z0QA 2X18A 3FSSA 5HE1A 2UVMA 2JP2A 1XX0A 2P0HA 3PG7A 4A6HA 2DN6A 4DXAB 4K81A 3TO1A 4GZUA 4HAUB 3IVFA 3D8EA 3KY9A 4HAXB 4KVGB 3V5WA 3U8ZA 3UZTA 1U5GA 2DKQA 3ODOA 2Y7BA 1QQGA 1OMWA 4KHOA 2CODA 2RVBB 4D0NB 2MKRA 2ROVA 1WJMA 3D8DA 3PZDA 5GOWB 4HAWB 1W1GA 2QKMA 1K5DB 5HE3A 3A8QA 2P0DA 5DH9B 1M7RA 2ROZB 1TQZA 3GYOA 5C16A 1X86A 1PMSA 4WJ7A 3DXEA 2I5CA 2DX1A 1DBHA 5FI1A 4P7IA 1XODA 5D27A 4DX90 3P6AA 2R0DA 5DHAB 2I1KA 2CY5A 2DTCA 1WVHA 5HE0A 3KZ1A 3N7CA 5C5BB 2NZ8B 1W1HA 4GXBA 2L2IA 4CYEA 2GCLA 1NTYA 2L1CA 2P0FA 4HDQA 1XCGA 2CRFA 2Q13A 4Z2NA 3U7DA 1FGYA 5KCVA 3M1IB 3RCPA 3TCAA 1ZSQA 2YT1A 3SYXA 2DA0A 4MK0A 4A5KA 3D8FA 2HTHB 1MIXA 1GG3A 3KRXA 2D9ZA 5L81A 2OQBA 2Y8GA 1ZC4B 1J19A 4NY0A 4HB2B 1WG7A 2IYBA 1DDVA 5DI9B 5JP4A 2LULA 1BAKA 2ZPYA 2YS1A 3QBVB 3X23A 3TVVA 1UEFA 1B55A 5C6RA 1MIZB 3NSUA 1I7AA 5KQ4A 1NI2A 3SO6A 3P7ZA 2D4QA 1SGHA 1P5TA 4GMVA 1MAIA 3FEHA 3ZVRA 4K2PA 1BWNA 1FB8A 2EMTA 2COAA 3TFMA 3F5RA 1LB1A 3ZDTA 4WVFB 1X05A 1ISNA 4CHJA 3QIJA 1V5MA 2K2UA 1OY2A 2UZRA 2MWNB 1N3HA 2W2XC 4YONA 2FJLA 3OANA 2DYNA 2I1JA 5FI0A 1UNQA 2DLWA 2ADZA 4IOYX 3ULBA 1MPHA 1FGZA 1W1DA 1KZ7A 1X11A 1FOEA 1E5WA 3GYPA 4A6FA 2K00A 1UPRA 5CLLB 2MFQA 4K17A 2NMBA 5HE2A 2H7EA 2CAYA 1PFJA 2EJ8A 2COFA 4EJNA 2D9VA 1AQCA 3PVWA 4XWXA 1K5GB 5JHGA 2YS5A 4EKUA 4F7HA 3QWMA 1DDWA 1H10A 3G9WA 1EF1A 2E2XA 2DHKA 2I5FA 2VRWB 1RJ2A 3PEGA 4TKNA 1V89A 4GMXB 2D9XA 3F0WA 1GC7A 1BTNA 1I2HA 2J59M 1QC6A 5D3WA 5CLQB 1M7EA 3AU5A 3CIKA 1XKEA 3MDBC 3BINA 4DBBA 2DHJA 2RUKB 1FHWA 1V88A 5J3YA 4B6HA 4KHAA 3HW2B 2KCJA 2LOXA 1GC6A 2M14A 1TJ6A 5D3XA 2DKPA 3WYFB 2W2XD 4KHBB 2AEHA 4Z2MB 3TW1A 2GJYA 1Q67A 2G35A 4HAVB 2RNRB 2LKOA 2GCJA 2ELBA 1WI1A 1Y19B 4IAPA 1Z87A 2YT0A 2V76A 4NSWA 1MK7B 1U29A 2EC1A 2K2JA 1WJ1A 5JLJB 4IFSA 1DYNA 5LONB 4HDOA 3CXBB 1ZC3B 3KRWA 2YF0A 4F7UP 3VIAA 1XD4A 1FHXA 2YS3A 1V5PA 3DXDA 1MK9B 4TYZA 5DIFB 2EMSA 3BJIA 1U2BA 3A8PA 2QKLA 2VSZA 2Z0PA 3T06A 3HQCA 4Y94A 1V5UA 4ZRKA 1UPQA 1AWEA 2D9YA 4DX8A 1EAZA 1WGUA 5J3TA 4GPTB 1KZGA 2DFKA 3LJUX 4HB4B 2PZ1A 4H8SA 3KSYA 3PSCA 2OTXA 1U5EA 1EVHA 4EMOA 5JHHA 1X1FA 2DX5A 2COCA 1FAOA 2N0YA 2Y8FA 1Y5OA 1U5FA 2DYQA 2R09A 1U5DA 3A98B 2D11A 1H4RA 1IRSA 5EFXA 2RSGA 5LOPB 3O96A 3FM8C 3ODXA 2J0JA 1SHCA 2D2QA 3VOQA 2D9WA 1MKEA 1XR0B 2H7DA 2D10A 1ZM0A 2Z0OA 2IFSA 4KAXB 2LOZA 3ULCA 3PP2A 2W2WA 2BCJA 4K2OA 2J0KA 1UNPA 3ODWA 4WSFA 5C5BA 1KI1B 4HB3B 2N23A 2VKIA 1LW3A 2RLOA 2DHIA 3ML4A 2ELAA 2LYDA 2CY4A 4GN1A 2MDXA 2YSZA 4C0AA 1V61A 2HE7A 3SUZA 3HK0A 1DROA 4L6EA 1X1GA 4A6FB 2J0MA 1U27A 3MPXA 5D3VA 2KGXB 2AL6A 3WA0A 1P6SA 4ZRIA 4PQ0A 4A6KA 5J3QA 2YRYA 4ZRJA 3DXCA 4PNKA 4CHMA 1NU2A 4HAZB 2YVCA 4YL8A 2GS0A 4HATB 1TXDA 1RRPB 4MY6A 2KUPA 1J0WA 3PVLA 1DDMA 2XQNM 4MT7A 3PVUA 3SV1A 1WGQA 4F7GA 3AJ4A 4HB0B 2UZSA 2LG1A 2M38A 1UNRA 4HAYB 3AU4A 1P3RA 1ZVRA 2RGNB 1OQNA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8V A;  1FHO A;  4HHV A;  3SNH A;  5DHF B;  1EGX A;  5C79 A;  5KQ1 A;  5D3Y A;  4BBK A;  1BTK A;  1PLS A;  2Z0Q A;  2X18 A;  3FSS A;  5HE1 A;  2UVM A;  2JP2 A;  1XX0 A;  2P0H A;  3PG7 A;  4A6H A;  2DN6 A;  4DXA B;  4K81 A;  3TO1 A;  4GZU A;  4HAU B;  3IVF A;  3D8E A;  3KY9 A;  4HAX B;  4KVG B;  3V5W A;  3U8Z A;  3UZT A;  1U5G A;  2DKQ A;  3ODO A;  2Y7B A;  1QQG A;  1OMW A;  4KHO A;  2COD A;  2RVB B;  4D0N B;  2MKR A;  2ROV A;  1WJM A;  3D8D A;  3PZD A;  5GOW B;  4HAW B;  1W1G A;  2QKM A;  1K5D B;  5HE3 A;  3A8Q A;  2P0D A;  5DH9 B;  1M7R A;  2ROZ B;  1TQZ A;  3GYO A;  5C16 A;  1X86 A;  1PMS A;  4WJ7 A;  3DXE A;  2I5C A;  2DX1 A;  1DBH A;  5FI1 A;  4P7I A;  1XOD A;  5D27 A;  4DX9 0;  3P6A A;  2R0D A;  5DHA B;  2I1K A;  2CY5 A;  2DTC A;  1WVH A;  5HE0 A;  3KZ1 A;  3N7C A;  5C5B B;  2NZ8 B;  1W1H A;  4GXB A;  2L2I A;  4CYE A;  2GCL A;  1NTY A;  2L1C A;  2P0F A;  4HDQ A;  1XCG A;  2CRF A;  2Q13 A;  4Z2N A;  3U7D A;  1FGY A;  5KCV A;  3M1I B;  3RCP A;  3TCA A;  1ZSQ A;  2YT1 A;  3SYX A;  2DA0 A;  4MK0 A;  4A5K A;  3D8F A;  2HTH B;  1MIX A;  1GG3 A;  3KRX A;  2D9Z A;  5L81 A;  2OQB A;  2Y8G A;  1ZC4 B;  1J19 A;  4NY0 A;  4HB2 B;  1WG7 A;  2IYB A;  1DDV A;  5DI9 B;  5JP4 A;  2LUL A;  1BAK A;  2ZPY A;  2YS1 A;  3QBV B;  3X23 A;  3TVV A;  1UEF A;  1B55 A;  5C6R A;  1MIZ B;  3NSU A;  1I7A A;  5KQ4 A;  1NI2 A;  3SO6 A;  3P7Z A;  2D4Q A;  1SGH A;  1P5T A;  4GMV A;  1MAI A;  3FEH A;  3ZVR A;  4K2P A;  1BWN A;  1FB8 A;  2EMT A;  2COA A;  3TFM A;  3F5R A;  1LB1 A;  3ZDT A;  4WVF B;  1X05 A;  1ISN A;  4CHJ A;  3QIJ A;  1V5M A;  2K2U A;  1OY2 A;  2UZR A;  2MWN B;  1N3H A;  2W2X C;  4YON A;  2FJL A;  3OAN A;  2DYN A;  2I1J A;  5FI0 A;  1UNQ A;  2DLW A;  2ADZ A;  4IOY X;  3ULB A;  1MPH A;  1FGZ A;  1W1D A;  1KZ7 A;  1X11 A;  1FOE A;  1E5W A;  3GYP A;  4A6F A;  2K00 A;  1UPR A;  5CLL B;  2MFQ A;  4K17 A;  2NMB A;  5HE2 A;  2H7E A;  2CAY A;  1PFJ A;  2EJ8 A;  2COF A;  4EJN A;  2D9V A;  1AQC A;  3PVW A;  4XWX A;  1K5G B;  5JHG A;  2YS5 A;  4EKU A;  4F7H A;  3QWM A;  1DDW A;  1H10 A;  3G9W A;  1EF1 A;  2E2X A;  2DHK A;  2I5F A;  2VRW B;  1RJ2 A;  3PEG A;  4TKN A;  1V89 A;  4GMX B;  2D9X A;  3F0W A;  1GC7 A;  1BTN A;  1I2H A;  2J59 M;  1QC6 A;  5D3W A;  5CLQ B;  1M7E A;  3AU5 A;  3CIK A;  1XKE A;  3MDB C;  3BIN A;  4DBB A;  2DHJ A;  2RUK B;  1FHW A;  1V88 A;  5J3Y A;  4B6H A;  4KHA A;  3HW2 B;  2KCJ A;  2LOX A;  1GC6 A;  2M14 A;  1TJ6 A;  5D3X A;  2DKP A;  3WYF B;  2W2X D;  4KHB B;  2AEH A;  4Z2M B;  3TW1 A;  2GJY A;  1Q67 A;  2G35 A;  4HAV B;  2RNR B;  2LKO A;  2GCJ A;  2ELB A;  1WI1 A;  1Y19 B;  4IAP A;  1Z87 A;  2YT0 A;  2V76 A;  4NSW A;  1MK7 B;  1U29 A;  2EC1 A;  2K2J A;  1WJ1 A;  5JLJ B;  4IFS A;  1DYN A;  5LON B;  4HDO A;  3CXB B;  1ZC3 B;  3KRW A;  2YF0 A;  4F7U P;  3VIA A;  1XD4 A;  1FHX A;  2YS3 A;  1V5P A;  3DXD A;  1MK9 B;  4TYZ A;  5DIF B;  2EMS A;  3BJI A;  1U2B A;  3A8P A;  2QKL A;  2VSZ A;  2Z0P A;  3T06 A;  3HQC A;  4Y94 A;  1V5U A;  4ZRK A;  1UPQ A;  1AWE A;  2D9Y A;  4DX8 A;  1EAZ A;  1WGU A;  5J3T A;  4GPT B;  1KZG A;  2DFK A;  3LJU X;  4HB4 B;  2PZ1 A;  4H8S A;  3KSY A;  3PSC A;  2OTX A;  1U5E A;  1EVH A;  4EMO A;  5JHH A;  1X1F A;  2DX5 A;  2COC A;  1FAO A;  2N0Y A;  2Y8F A;  1Y5O A;  1U5F A;  2DYQ A;  2R09 A;  1U5D A;  3A98 B;  2D11 A;  1H4R A;  1IRS A;  5EFX A;  2RSG A;  5LOP B;  3O96 A;  3FM8 C;  3ODX A;  2J0J A;  1SHC A;  2D2Q A;  3VOQ A;  2D9W A;  1MKE A;  1XR0 B;  2H7D A;  2D10 A;  1ZM0 A;  2Z0O A;  2IFS A;  4KAX B;  2LOZ A;  3ULC A;  3PP2 A;  2W2W A;  2BCJ A;  4K2O A;  2J0K A;  1UNP A;  3ODW A;  4WSF A;  5C5B A;  1KI1 B;  4HB3 B;  2N23 A;  2VKI A;  1LW3 A;  2RLO A;  2DHI A;  3ML4 A;  2ELA A;  2LYD A;  2CY4 A;  4GN1 A;  2MDX A;  2YSZ A;  4C0A A;  1V61 A;  2HE7 A;  3SUZ A;  3HK0 A;  1DRO A;  4L6E A;  1X1G A;  4A6F B;  2J0M A;  1U27 A;  3MPX A;  5D3V A;  2KGX B;  2AL6 A;  3WA0 A;  1P6S A;  4ZRI A;  4PQ0 A;  4A6K A;  5J3Q A;  2YRY A;  4ZRJ A;  3DXC A;  4PNK A;  4CHM A;  1NU2 A;  4HAZ B;  2YVC A;  4YL8 A;  2GS0 A;  4HAT B;  1TXD A;  1RRP B;  4MY6 A;  2KUP A;  1J0W A;  3PVL A;  1DDM A;  2XQN M;  4MT7 A;  3PVU A;  3SV1 A;  1WGQ A;  4F7G A;  3AJ4 A;  4HB0 B;  2UZS A;  2LG1 A;  2M38 A;  1UNR A;  4HAY B;  3AU4 A;  1P3R A;  1ZVR A;  2RGN B;  1OQN A;  1NTV A; 
#chains in the Genus database with same CATH topology
 2P8V A;  1FHO A;  5IRS A;  4HHV A;  3SNH A;  5DHF B;  1EGX A;  5C79 A;  1MI1 A;  5KQ1 A;  5D3Y A;  4BBK A;  1BTK A;  1PLS A;  2Z0Q A;  2X18 A;  3FSS A;  3HSA A;  5HE1 A;  2UVM A;  2JP2 A;  1XX0 A;  2P0H A;  3PG7 A;  4A6H A;  2DN6 A;  4DXA B;  4K81 A;  3NWF A;  3TO1 A;  4GZU A;  4HAU B;  3IVF A;  3D8E A;  3KY9 A;  4HAX B;  4KVG B;  3V5W A;  3U8Z A;  3UZT A;  1U5G A;  2DKQ A;  3ODO A;  2Y7B A;  1QQG A;  1OMW A;  4KHO A;  2COD A;  4QJ4 B;  2RVB B;  4D0N B;  2MKR A;  2ROV A;  1WJM A;  3D8D A;  3PZD A;  5GOW B;  4HAW B;  1W1G A;  2QKM A;  1K5D B;  1T77 A;  5HE3 A;  3A8Q A;  2P0D A;  2Z4D A;  5DH9 B;  2Z14 A;  1M7R A;  2ROZ B;  1TQZ A;  3GYO A;  5C16 A;  1X86 A;  1PMS A;  4WJ7 A;  3DXE A;  2I5C A;  4OT1 A;  2DX1 A;  3OHM B;  1DBH A;  5FI1 A;  4P7I A;  1XOD A;  5D27 A;  4DX9 0;  4OSN A;  3P6A A;  3HIE A;  2R0D A;  5DHA B;  2I1K A;  2CY5 A;  2DTC A;  1WVH A;  5HE0 A;  2YT2 A;  3KZ1 A;  3N7C A;  5C5B B;  2NZ8 B;  1W1H A;  4GXB A;  2L2I A;  4CYE A;  2GCL A;  1NTY A;  2L1C A;  2P0F A;  4HDQ A;  1XCG A;  2CRF A;  2Q13 A;  4Z2N A;  2KR0 A;  2KIG A;  3U7D A;  3A58 A;  1FGY A;  4GOU A;  5KCV A;  3M1I B;  3RCP A;  3TCA A;  1ZSQ A;  3DCX A;  4GNK B;  2YT1 A;  3SYX A;  5M4Y B;  2DA0 A;  4KHB A;  4MK0 A;  4A5K A;  3D8F A;  2HTH B;  1MIX A;  1GG3 A;  3KRX A;  2D9Z A;  5L81 A;  2OQB A;  2Y8G A;  2FJU B;  1ZC4 B;  1J19 A;  4NY0 A;  4HB2 B;  1WG7 A;  2IYB A;  1ZYI A;  1DDV A;  5DI9 B;  5JP4 A;  4HSI A;  2LUL A;  1BAK A;  2ZPY A;  2YS1 A;  3QBV B;  3X23 A;  3TVV A;  1UEF A;  1B55 A;  5C6R A;  1MIZ B;  3NSU A;  1I7A A;  5KQ4 A;  1NI2 A;  3SO6 A;  3P7Z A;  2D4Q A;  1SGH A;  1P5T A;  4GMV A;  3B77 A;  1MAI A;  3FEH A;  3ZVR A;  4K2P A;  1BWN A;  1FB8 A;  2EMT A;  2COA A;  5I2S A;  3TFM A;  3F5R A;  1LB1 A;  3ZDT A;  4WVF B;  2KIE A;  1X05 A;  2ZKM X;  1ISN A;  2K49 A;  4CHJ A;  3QIJ A;  1V5M A;  2K2U A;  1OY2 A;  2UZR A;  2MWN B;  1N3H A;  2W2X C;  4YON A;  2FJL A;  2Z59 A;  3OAN A;  2DYN A;  2I1J A;  5FI0 A;  4DIX A;  1UNQ A;  2DLW A;  2R2Y A;  2ADZ A;  4IOY X;  3ULB A;  1MPH A;  1FGZ A;  1W1D A;  1KZ7 A;  1X11 A;  4QXA B;  1FOE A;  1E5W A;  3GYP A;  4A6F A;  2K00 A;  1UPR A;  5CLL B;  2MFQ A;  4K17 A;  2NMB A;  5HE2 A;  2H7E A;  2CAY A;  1PFJ A;  2EJ8 A;  2COF A;  4EJN A;  2D9V A;  1AQC A;  3PVW A;  4XWX A;  1K5G B;  5JHG A;  2YS5 A;  4EKU A;  4F7H A;  3QWM A;  1DDW A;  1H10 A;  3G9W A;  1EF1 A;  2E2X A;  2DHK A;  2I5F A;  2VRW B;  2GUM A;  1RJ2 A;  3FVC A;  3PEG A;  4TKN A;  1V89 A;  4GMX B;  2D9X A;  3F0W A;  1GC7 A;  1BTN A;  1I2H A;  2J59 M;  1QC6 A;  5D3W A;  5CLQ B;  1M7E A;  3AU5 A;  3CIK A;  1XKE A;  3MDB C;  3BIN A;  4DBB A;  2DHJ A;  2RUK B;  1FHW A;  1V88 A;  5J3Y A;  4B6H A;  4KHA A;  3HW2 B;  2KCJ A;  2LOX A;  1GC6 A;  2M14 A;  1TJ6 A;  5D3X A;  2DKP A;  3WYF B;  2W2X D;  4KHB B;  2AEH A;  4Z2M B;  3TW1 A;  2GJY A;  1Q67 A;  2G35 A;  4HAV B;  2RNR B;  2LKO A;  4QJ5 B;  3NW8 A;  2GCJ A;  2ELB A;  3NWD A;  1WI1 A;  1Y19 B;  4L1R A;  2RRF A;  4IAP A;  1Z87 A;  2YT0 A;  2V76 A;  4NSW A;  1MK7 B;  1U29 A;  2EC1 A;  2K2J A;  1WJ1 A;  5JLJ B;  4IFS A;  1DYN A;  5LON B;  4HDO A;  3CXB B;  1ZC3 B;  3KRW A;  2YF0 A;  4F7U P;  4D6W A;  3VIA A;  1XD4 A;  1FHX A;  2YS3 A;  2NBV A;  1V5P A;  3DXD A;  1MK9 B;  4TYZ A;  5DIF B;  2EMS A;  3BJI A;  1U2B A;  2Z13 A;  3A8P A;  2QKL A;  2VSZ A;  4CSQ A;  2Z0P A;  3T06 A;  3HQC A;  4Y94 A;  1V5U A;  4ZRK A;  1UPQ A;  1AWE A;  2D9Y A;  4DX8 A;  1EAZ A;  1WGU A;  5J3T A;  4GPT B;  1KZG A;  2DFK A;  3LJU X;  4HB4 B;  2PZ1 A;  4H8S A;  3KSY A;  3PSC A;  2OTX A;  1U5E A;  1EVH A;  4EMO A;  5JHH A;  1X1F A;  2DX5 A;  2COC A;  1FAO A;  2N0Y A;  2Y8F A;  1Y5O A;  1U5F A;  2DYQ A;  2R09 A;  1U5D A;  3A98 B;  2KUQ A;  2D11 A;  1H4R A;  1IRS A;  5EFX A;  2RSG A;  5LOP B;  3O96 A;  3FM8 C;  3ODX A;  2J0J A;  1SHC A;  2D2Q A;  3VOQ A;  2D9W A;  1MKE A;  1XR0 B;  2H7D A;  2D10 A;  1ZM0 A;  2Z0O A;  2IFS A;  4KAX B;  2LOZ A;  3ULC A;  3PP2 A;  2W2W A;  2BCJ A;  4K2O A;  2J0K A;  1UNP A;  3ODW A;  4WSF A;  5C5B A;  1KI1 B;  4HB3 B;  2N23 A;  2VKI A;  1LW3 A;  2RLO A;  2DHI A;  3ML4 A;  2ELA A;  2LYD A;  2CY4 A;  4GN1 A;  5I2M A;  2MDX A;  2YSZ A;  4C0A A;  5LG4 B;  1V61 A;  2HE7 A;  3NWA A;  3HK0 A;  3SUZ A;  1DRO A;  4L6E A;  1X1G A;  4A6F B;  2J0M A;  1U27 A;  3MPX A;  5D3V A;  2KGX B;  2AL6 A;  3WA0 A;  1P6S A;  4ZRI A;  4PQ0 A;  4A6K A;  5J3Q A;  2YRY A;  4ZRJ A;  4QJ3 B;  3DXC A;  4PNK A;  4CHM A;  1NU2 A;  4HAZ B;  2YVC A;  3U12 A;  4YL8 A;  2GS0 A;  4HAT B;  1TXD A;  1RRP B;  4MY6 A;  2KUP A;  1J0W A;  3PVL A;  2K8E A;  1DDM A;  2XQN M;  4MT7 A;  3PVU A;  3SV1 A;  1WGQ A;  4F7G A;  3AJ4 A;  4HB0 B;  2UZS A;  2LG1 A;  2M38 A;  1UNR A;  4HAY B;  3AU4 A;  1P3R A;  1ZVR A;  2RGN B;  1OQN A;  1NTV A; 
#chains in the Genus database with same CATH homology
 2P8V A;  1FHO A;  4HHV A;  3SNH A;  5DHF B;  1EGX A;  5C79 A;  5KQ1 A;  5D3Y A;  4BBK A;  1BTK A;  1PLS A;  2Z0Q A;  2X18 A;  3FSS A;  5HE1 A;  2UVM A;  2JP2 A;  1XX0 A;  2P0H A;  3PG7 A;  4A6H A;  2DN6 A;  4DXA B;  4K81 A;  3TO1 A;  4GZU A;  4HAU B;  3IVF A;  3D8E A;  3KY9 A;  4HAX B;  4KVG B;  3V5W A;  3U8Z A;  3UZT A;  1U5G A;  2DKQ A;  3ODO A;  2Y7B A;  1QQG A;  1OMW A;  4KHO A;  2COD A;  2RVB B;  4D0N B;  2MKR A;  2ROV A;  1WJM A;  3D8D A;  3PZD A;  5GOW B;  4HAW B;  1W1G A;  2QKM A;  1K5D B;  5HE3 A;  3A8Q A;  2P0D A;  5DH9 B;  1M7R A;  2ROZ B;  1TQZ A;  3GYO A;  5C16 A;  1X86 A;  1PMS A;  4WJ7 A;  3DXE A;  2I5C A;  2DX1 A;  1DBH A;  5FI1 A;  4P7I A;  1XOD A;  5D27 A;  4DX9 0;  3P6A A;  2R0D A;  5DHA B;  2I1K A;  2CY5 A;  2DTC A;  1WVH A;  5HE0 A;  3KZ1 A;  3N7C A;  5C5B B;  2NZ8 B;  1W1H A;  4GXB A;  2L2I A;  4CYE A;  2GCL A;  1NTY A;  2L1C A;  2P0F A;  4HDQ A;  1XCG A;  2CRF A;  2Q13 A;  4Z2N A;  3U7D A;  1FGY A;  5KCV A;  3M1I B;  3RCP A;  3TCA A;  1ZSQ A;  2YT1 A;  3SYX A;  2DA0 A;  4MK0 A;  4A5K A;  3D8F A;  2HTH B;  1MIX A;  1GG3 A;  3KRX A;  2D9Z A;  5L81 A;  2OQB A;  2Y8G A;  1ZC4 B;  1J19 A;  4NY0 A;  4HB2 B;  1WG7 A;  2IYB A;  1DDV A;  5DI9 B;  5JP4 A;  2LUL A;  1BAK A;  2ZPY A;  2YS1 A;  3QBV B;  3X23 A;  3TVV A;  1UEF A;  1B55 A;  5C6R A;  1MIZ B;  3NSU A;  1I7A A;  5KQ4 A;  1NI2 A;  3SO6 A;  3P7Z A;  2D4Q A;  1SGH A;  1P5T A;  4GMV A;  1MAI A;  3FEH A;  3ZVR A;  4K2P A;  1BWN A;  1FB8 A;  2EMT A;  2COA A;  3TFM A;  3F5R A;  1LB1 A;  3ZDT A;  4WVF B;  1X05 A;  1ISN A;  4CHJ A;  3QIJ A;  1V5M A;  2K2U A;  1OY2 A;  2UZR A;  2MWN B;  1N3H A;  2W2X C;  4YON A;  2FJL A;  3OAN A;  2DYN A;  2I1J A;  5FI0 A;  1UNQ A;  2DLW A;  2ADZ A;  4IOY X;  3ULB A;  1MPH A;  1FGZ A;  1W1D A;  1KZ7 A;  1X11 A;  1FOE A;  1E5W A;  3GYP A;  4A6F A;  2K00 A;  1UPR A;  5CLL B;  2MFQ A;  4K17 A;  2NMB A;  5HE2 A;  2H7E A;  2CAY A;  1PFJ A;  2EJ8 A;  2COF A;  4EJN A;  2D9V A;  1AQC A;  3PVW A;  4XWX A;  1K5G B;  5JHG A;  2YS5 A;  4EKU A;  4F7H A;  3QWM A;  1DDW A;  1H10 A;  3G9W A;  1EF1 A;  2E2X A;  2DHK A;  2I5F A;  2VRW B;  1RJ2 A;  3PEG A;  4TKN A;  1V89 A;  4GMX B;  2D9X A;  3F0W A;  1GC7 A;  1BTN A;  1I2H A;  2J59 M;  1QC6 A;  5D3W A;  5CLQ B;  1M7E A;  3AU5 A;  3CIK A;  1XKE A;  3MDB C;  3BIN A;  4DBB A;  2DHJ A;  2RUK B;  1FHW A;  1V88 A;  5J3Y A;  4B6H A;  4KHA A;  3HW2 B;  2KCJ A;  2LOX A;  1GC6 A;  2M14 A;  1TJ6 A;  5D3X A;  2DKP A;  3WYF B;  2W2X D;  4KHB B;  2AEH A;  4Z2M B;  3TW1 A;  2GJY A;  1Q67 A;  2G35 A;  4HAV B;  2RNR B;  2LKO A;  2GCJ A;  2ELB A;  1WI1 A;  1Y19 B;  4IAP A;  1Z87 A;  2YT0 A;  2V76 A;  4NSW A;  1MK7 B;  1U29 A;  2EC1 A;  2K2J A;  1WJ1 A;  5JLJ B;  4IFS A;  1DYN A;  5LON B;  4HDO A;  3CXB B;  1ZC3 B;  3KRW A;  2YF0 A;  4F7U P;  3VIA A;  1XD4 A;  1FHX A;  2YS3 A;  1V5P A;  3DXD A;  1MK9 B;  4TYZ A;  5DIF B;  2EMS A;  3BJI A;  1U2B A;  3A8P A;  2QKL A;  2VSZ A;  2Z0P A;  3T06 A;  3HQC A;  4Y94 A;  1V5U A;  4ZRK A;  1UPQ A;  1AWE A;  2D9Y A;  4DX8 A;  1EAZ A;  1WGU A;  5J3T A;  4GPT B;  1KZG A;  2DFK A;  3LJU X;  4HB4 B;  2PZ1 A;  4H8S A;  3KSY A;  3PSC A;  2OTX A;  1U5E A;  1EVH A;  4EMO A;  5JHH A;  1X1F A;  2DX5 A;  2COC A;  1FAO A;  2N0Y A;  2Y8F A;  1Y5O A;  1U5F A;  2DYQ A;  2R09 A;  1U5D A;  3A98 B;  2D11 A;  1H4R A;  1IRS A;  5EFX A;  2RSG A;  5LOP B;  3O96 A;  3FM8 C;  3ODX A;  2J0J A;  1SHC A;  2D2Q A;  3VOQ A;  2D9W A;  1MKE A;  1XR0 B;  2H7D A;  2D10 A;  1ZM0 A;  2Z0O A;  2IFS A;  4KAX B;  2LOZ A;  3ULC A;  3PP2 A;  2W2W A;  2BCJ A;  4K2O A;  2J0K A;  1UNP A;  3ODW A;  4WSF A;  5C5B A;  1KI1 B;  4HB3 B;  2N23 A;  2VKI A;  1LW3 A;  2RLO A;  2DHI A;  3ML4 A;  2ELA A;  2LYD A;  2CY4 A;  4GN1 A;  2MDX A;  2YSZ A;  4C0A A;  1V61 A;  2HE7 A;  3SUZ A;  3HK0 A;  1DRO A;  4L6E A;  1X1G A;  4A6F B;  2J0M A;  1U27 A;  3MPX A;  5D3V A;  2KGX B;  2AL6 A;  3WA0 A;  1P6S A;  4ZRI A;  4PQ0 A;  4A6K A;  5J3Q A;  2YRY A;  4ZRJ A;  3DXC A;  4PNK A;  4CHM A;  1NU2 A;  4HAZ B;  2YVC A;  4YL8 A;  2GS0 A;  4HAT B;  1TXD A;  1RRP B;  4MY6 A;  2KUP A;  1J0W A;  3PVL A;  1DDM A;  2XQN M;  4MT7 A;  3PVU A;  3SV1 A;  1WGQ A;  4F7G A;  3AJ4 A;  4HB0 B;  2UZS A;  2LG1 A;  2M38 A;  1UNR A;  4HAY B;  3AU4 A;  1P3R A;  1ZVR A;  2RGN B;  1OQN A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...