1N3HA

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
207
structure length
207
Chain Sequence
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SHC Transforming protein
total genus 15
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1n3hA00
1X11A 2L2IA 1V5MA 3ODXA 2BCJA 3U8ZA 5DHAB 4KHBB 2KCJA 1X86A 4ZRIA 2K00A 1KI1B 5C79A 2YT0A 4HAUB 4L6EA 3SV1A 4B6HA 3FEHA 1EGXA 4XWXA 1SHCA 3HQCA 4WSFA 4GN1A 3ULBA 3AU4A 2I1KA 5DI9B 4PQ0A 3F5RA 4HAYB 2D9YA 1M7EA 1WG7A 4A6FA 3SYXA 1E5WA 2YF0A 1SGHA 4HAVB 3KRWA 2UVMA 4HDOA 1W1GA 2AEHA 2K2JA 1K5GB 1NTVA 4HB3B 5GOWB 2JP2A 2ELAA 2LULA 3CXBB 1WVHA 1P3RA 2RGNB 2W2XD 3FM8C 2UZRA 5KCVA 3AU5A 1I7AA 1RRPB 2OTXA 1MIZB 2RSGA 4Z2MB 2N0YA 2P0FA 2DA0A 1DBHA 4HAZB 2CRFA 4Y94A 4HHVA 1RJ2A 1DDMA 1N3HA 2P0HA 5EFXA 3DXDA 4MY6A 1TJ6A 2KUPA 2YS3A 3KSYA 3VOQA 1PLSA 3ZVRA 4HATB 2EMTA 1MK7B 3A8QA 5J3YA 1LB1A 2DHKA 3D8FA 2RLOA 1X1FA 2CODA 2LOZA 2N23A 2GCLA 3LJUX 4CHMA 4H8SA 1QC6A 2P0DA 5HE0A 3X23A 2D9VA 5CLLB 4F7UP 2R09A 4BBKA 5DIFB 2FJLA 4DXAB 2V76A 2NZ8B 2M14A 3GYOA 4GMXB 4TKNA 3KZ1A 2COAA 3HK0A 1I2HA 1FAOA 3TCAA 2J59M 1GC6A 1H4RA 1M7RA 3NSUA 3PZDA 2GCJA 5HE3A 3MDBC 1FHOA 3QIJA 1NU2A 2QKLA 2RNRB 4KVGB 4DX8A 1UPRA 1W1HA 5CLQB 2YSZA 1FGYA 2IFSA 3O96A 1WJ1A 2CY4A 5D27A 1K5DB 4CHJA 2ELBA 1MIXA 3TFMA 2DYNA 2GS0A 3TW1A 3A8PA 3KRXA 3F0WA 1FOEA 5HE2A 4K2PA 1GG3A 1NI2A 3TO1A 5C5BB 5D3VA 2EMSA 1XX0A 2VSZA 3DXCA 2I1JA 2XQNM 4NSWA 3OANA 5JP4A 4F7HA 2Z0PA 3TVVA 1XR0B 4Z2NA 3D8DA 1PMSA 1Y5OA 2LYDA 1MKEA 5D3YA 1PFJA 2EC1A 1MK9B 4ZRKA 1OY2A 1Y19B 3PVWA 1V89A 3AJ4A 2DHIA 1XD4A 2KGXB 2P8VA 3WYFB 1UEFA 3M1IB 2HTHB 1QQGA 2J0JA 3SNHA 3BJIA 2MKRA 2DFKA 5LOPB 3U7DA 1FHWA 2Y8GA 3PP2A 5J3TA 3CIKA 2Q13A 4DX90 5KQ4A 3PVUA 4ZRJA 1MPHA 2HE7A 2ROVA 3IVFA 1FHXA 2OQBA 2ZPYA 1EAZA 2RVBB 1U5EA 1U5FA 4IAPA 5J3QA 1H10A 2I5CA 4D0NB 1XKEA 2DX5A 4HAXB 2W2WA 4IOYX 4KAXB 1V5PA 4GZUA 4K2OA 4EKUA 2GJYA 2D11A 2D4QA 2YT1A 4GMVA 2ROZB 4YONA 1V61A 4HB2B 5JHHA 2ADZA 1WGUA 2NMBA 1DDVA 3PSCA 1UPQA 2R0DA 2PZ1A 2L1CA 1DYNA 5L81A 2Y8FA 1WGQA 4HDQA 5C16A 1XODA 1FGZA 1KZGA 2H7DA 2LKOA 1ZC3B 4A6HA 1J19A 4MK0A 1U5GA 2UZSA 2MFQA 1UNRA 2IYBA 4K81A 1AQCA 4NY0A 2YVCA 1EF1A 4K17A 1IRSA 4A6FB 2YRYA 1BTKA 1ZC4B 1X05A 2RUKB 3PG7A 3N7CA 4P7IA 2X18A 4A6KA 1AWEA 3D8EA 3ML4A 1BWNA 3ZDTA 1EVHA 1J0WA 5DH9B 1DROA 4HB0B 1ZSQA 4HB4B 2DLWA 2DX1A 2D10A 3G9WA 2MWNB 2LG1A 1ZVRA 3A98B 5LONB 1U5DA 3DXEA 1W1DA 4WJ7A 1KZ7A 1BTNA 3ODOA 5D3WA 5DHFB 2D9XA 1WI1A 2QKMA 1ZM0A 3HW2B 2DN6A 2YS1A 4CYEA 2DTCA 2VRWB 2H7EA 4IFSA 4GXBA 1V88A 3QBVB 4C0AA 3RCPA 2D2QA 4A5KA 3V5WA 2DYQA 2Z0OA 4KHOA 2K2UA 1X1GA 2Y7BA 3QWMA 2Z0QA 1FB8A 4HAWB 4YL8A 1P6SA 3SO6A 4KHAA 1ISNA 3ODWA 3T06A 3UZTA 3P6AA 5D3XA 1U29A 5FI0A 1MAIA 5FI1A 4PNKA 5JHGA 2EJ8A 2G35A 1TQZA 3PVLA 2DKPA 5C5BA 1BAKA 2D9ZA 1LW3A 1GC7A 4GPTB 1P5TA 1OMWA 2E2XA 2DHJA 3PEGA 1XCGA 2J0MA 5JLJB 4EJNA 4TYZA 2CY5A 3ULCA 2D9WA 2I5FA 5KQ1A 2M38A 5HE1A 5C6RA 2AL6A 1DDWA 1Q67A 3VIAA 2W2XC 4DBBA 2LOXA 1Z87A 3SUZA 4EMOA 2COCA 4WVFB 4F7GA 1UNPA 1TXDA 3KY9A 2DKQA 1U27A 1U2BA 1OQNA 2CAYA 1UNQA 3BINA 2COFA 3WA0A 3MPXA 2VKIA 1B55A 4MT7A 3FSSA 3GYPA 2YS5A 1V5UA 1NTYA 2MDXA 3P7ZA 2J0KA 1WJMA
chains in the Genus database with same CATH superfamily
1X11A 2L2IA 1V5MA 3NWFA 3ODXA 1ZYIA 2BCJA 3U8ZA 5DHAB 2Z14A 4KHBB 2KCJA 1X86A 4ZRIA 2K00A 1KI1B 5C79A 2YT0A 4HAUB 4L6EA 4D6WA 3SV1A 4B6HA 3FEHA 1EGXA 4XWXA 2NBVA 2R2YA 1SHCA 3HQCA 4WSFA 4GN1A 3ULBA 3AU4A 2I1KA 5DI9B 4PQ0A 3F5RA 4HAYB 2D9YA 1M7EA 1WG7A 4A6FA 1MI1A 3SYXA 1E5WA 2YF0A 1SGHA 4HAVB 3KRWA 2UVMA 4HDOA 1W1GA 2AEHA 2K2JA 1K5GB 1NTVA 4HB3B 5GOWB 2JP2A 4L1RA 2ELAA 2LULA 3CXBB 1WVHA 1P3RA 2RGNB 2W2XD 3FM8C 2UZRA 5KCVA 3AU5A 1I7AA 1RRPB 2OTXA 1MIZB 2RSGA 4Z2MB 2N0YA 2P0FA 2DA0A 1DBHA 4HAZB 2CRFA 4Y94A 4HHVA 1RJ2A 1DDMA 1N3HA 2P0HA 5EFXA 3DXDA 4MY6A 1TJ6A 2KUPA 2YS3A 3KSYA 3VOQA 1PLSA 2Z4DA 3ZVRA 1T77A 4HATB 2EMTA 1MK7B 2KIGA 3A8QA 5J3YA 1LB1A 2DHKA 3D8FA 2RLOA 1X1FA 2CODA 2LOZA 2N23A 2GCLA 3LJUX 4CHMA 4H8SA 1QC6A 2P0DA 5HE0A 3X23A 2D9VA 5CLLB 4F7UP 2R09A 2Z59A 4BBKA 5DIFB 2FJLA 4DXAB 2V76A 2NZ8B 2M14A 3GYOA 4GMXB 3B77A 4TKNA 3KZ1A 2COAA 3HK0A 1I2HA 1FAOA 3TCAA 2J59M 1GC6A 1H4RA 1M7RA 3NSUA 3PZDA 3FVCA 2GCJA 5HE3A 3MDBC 1FHOA 3QIJA 1NU2A 2QKLA 2RNRB 4KVGB 4DX8A 1UPRA 1W1HA 5CLQB 2YSZA 1FGYA 2IFSA 3O96A 1WJ1A 2CY4A 5D27A 1K5DB 4CHJA 2ELBA 1MIXA 3TFMA 2DYNA 2GS0A 3TW1A 2FJUB 3A8PA 5LG4B 3KRXA 3F0WA 1FOEA 5HE2A 4K2PA 1GG3A 1NI2A 3TO1A 2RRFA 5D3VA 5C5BB 2EMSA 1XX0A 2VSZA 3DXCA 2I1JA 2XQNM 4NSWA 3A58A 3OANA 5JP4A 4F7HA 3DCXA 3NWAA 2Z0PA 3TVVA 5M4YB 1XR0B 4Z2NA 3U12A 3D8DA 1PMSA 1Y5OA 2LYDA 1MKEA 5D3YA 5I2SA 4GNKB 1PFJA 3HSAA 2EC1A 1MK9B 4ZRKA 1OY2A 1Y19B 3PVWA 1V89A 2GUMA 3AJ4A 2DHIA 1XD4A 5IRSA 2KGXB 2P8VA 3WYFB 1UEFA 3M1IB 2HTHB 1QQGA 2J0JA 3SNHA 2ZKMX 3BJIA 2MKRA 2DFKA 5LOPB 3U7DA 4OT1A 1FHWA 2KUQA 2Y8GA 3PP2A 5J3TA 3CIKA 2Q13A 4DX90 5KQ4A 3PVUA 4ZRJA 1MPHA 2HE7A 2ROVA 3IVFA 1FHXA 2OQBA 2ZPYA 1EAZA 2RVBB 1U5EA 1U5FA 4IAPA 5J3QA 1H10A 2I5CA 4D0NB 1XKEA 4KHBA 2DX5A 4HAXB 2W2WA 4IOYX 4KAXB 4OSNA 1V5PA 4GZUA 4K2OA 4EKUA 2GJYA 2D11A 2D4QA 2YT1A 4GMVA 2ROZB 4YONA 1V61A 4HB2B 5JHHA 4QJ3B 2ADZA 1WGUA 2NMBA 1DDVA 3PSCA 1UPQA 2R0DA 2PZ1A 2L1CA 1DYNA 5L81A 2Y8FA 1WGQA 4HDQA 5C16A 1XODA 1FGZA 1KZGA 2H7DA 2LKOA 1ZC3B 4A6HA 1J19A 4MK0A 1U5GA 2UZSA 2MFQA 1UNRA 2IYBA 4K81A 1AQCA 4NY0A 2YVCA 1EF1A 4K17A 2Z13A 1IRSA 4A6FB 2YRYA 1BTKA 1ZC4B 1X05A 2RUKB 3PG7A 2YT2A 3N7CA 4P7IA 2X18A 4A6KA 1AWEA 3D8EA 3ML4A 1BWNA 3ZDTA 3NWDA 1EVHA 4QJ5B 1J0WA 5DH9B 3HIEA 2KR0A 1DROA 4HB0B 1ZSQA 2DLWA 2DX1A 4HB4B 2D10A 3G9WA 2MWNB 2LG1A 1ZVRA 3A98B 5LONB 1U5DA 4CSQA 3DXEA 1W1DA 4WJ7A 1KZ7A 1BTNA 3ODOA 5D3WA 2K8EA 5DHFB 2D9XA 1WI1A 2QKMA 1ZM0A 3HW2B 2DN6A 2YS1A 4CYEA 2DTCA 4QJ4B 2VRWB 2H7EA 4IFSA 4GXBA 1V88A 3QBVB 4C0AA 3RCPA 2D2QA 4A5KA 2K49A 3V5WA 2DYQA 2Z0OA 4KHOA 2K2UA 1X1GA 2Y7BA 3QWMA 2Z0QA 1FB8A 4HAWB 4YL8A 1P6SA 3SO6A 2KIEA 4KHAA 1ISNA 3OHMB 3ODWA 3T06A 3UZTA 3P6AA 5D3XA 1U29A 5FI0A 1MAIA 5FI1A 4PNKA 5JHGA 2EJ8A 2G35A 1TQZA 3PVLA 2DKPA 5C5BA 4QXAB 1BAKA 2D9ZA 1LW3A 1GC7A 4GPTB 1P5TA 5I2MA 1OMWA 2E2XA 2DHJA 4HSIA 3PEGA 1XCGA 2J0MA 3NW8A 5JLJB 4GOUA 4EJNA 4TYZA 2CY5A 3ULCA 2D9WA 2I5FA 5KQ1A 2M38A 5HE1A 5C6RA 2AL6A 1DDWA 1Q67A 3VIAA 2W2XC 4DBBA 2LOXA 1Z87A 3SUZA 4EMOA 2COCA 4WVFB 4F7GA 1UNPA 4DIXA 1TXDA 3KY9A 2DKQA 1U27A 1U2BA 1OQNA 2CAYA 1UNQA 3BINA 2COFA 3WA0A 3MPXA 2VKIA 1B55A 4MT7A 3FSSA 3GYPA 2YS5A 1V5UA 1NTYA 2MDXA 3P7ZA 2J0KA 1WJMA
chains in the Genus database with same CATH topology
1X11A 2L2IA 1V5MA 3ODXA 2BCJA 3U8ZA 5DHAB 4KHBB 2KCJA 1X86A 4ZRIA 2K00A 1KI1B 5C79A 2YT0A 4HAUB 4L6EA 3SV1A 4B6HA 3FEHA 1EGXA 4XWXA 1SHCA 3HQCA 4WSFA 4GN1A 3ULBA 3AU4A 2I1KA 5DI9B 4PQ0A 3F5RA 4HAYB 2D9YA 1M7EA 1WG7A 4A6FA 3SYXA 1E5WA 2YF0A 1SGHA 4HAVB 3KRWA 2UVMA 4HDOA 1W1GA 2AEHA 2K2JA 1K5GB 1NTVA 4HB3B 5GOWB 2JP2A 2ELAA 2LULA 3CXBB 1WVHA 1P3RA 2RGNB 2W2XD 3FM8C 2UZRA 5KCVA 3AU5A 1I7AA 1RRPB 2OTXA 1MIZB 2RSGA 4Z2MB 2N0YA 2P0FA 2DA0A 1DBHA 4HAZB 2CRFA 4Y94A 4HHVA 1RJ2A 1DDMA 1N3HA 2P0HA 5EFXA 3DXDA 4MY6A 1TJ6A 2KUPA 2YS3A 3KSYA 3VOQA 1PLSA 3ZVRA 4HATB 2EMTA 1MK7B 3A8QA 5J3YA 1LB1A 2DHKA 3D8FA 2RLOA 1X1FA 2CODA 2LOZA 2N23A 2GCLA 3LJUX 4CHMA 4H8SA 1QC6A 2P0DA 5HE0A 3X23A 2D9VA 5CLLB 4F7UP 2R09A 4BBKA 5DIFB 2FJLA 4DXAB 2V76A 2NZ8B 2M14A 3GYOA 4GMXB 4TKNA 3KZ1A 2COAA 3HK0A 1I2HA 1FAOA 3TCAA 2J59M 1GC6A 1H4RA 1M7RA 3NSUA 3PZDA 2GCJA 5HE3A 3MDBC 1FHOA 3QIJA 1NU2A 2QKLA 2RNRB 4KVGB 4DX8A 1UPRA 1W1HA 5CLQB 2YSZA 1FGYA 2IFSA 3O96A 1WJ1A 2CY4A 5D27A 1K5DB 4CHJA 2ELBA 1MIXA 3TFMA 2DYNA 2GS0A 3TW1A 3A8PA 3KRXA 3F0WA 1FOEA 5HE2A 4K2PA 1GG3A 1NI2A 3TO1A 5C5BB 5D3VA 2EMSA 1XX0A 2VSZA 3DXCA 2I1JA 2XQNM 4NSWA 3OANA 5JP4A 4F7HA 2Z0PA 3TVVA 1XR0B 4Z2NA 3D8DA 1PMSA 1Y5OA 2LYDA 1MKEA 5D3YA 1PFJA 2EC1A 1MK9B 4ZRKA 1OY2A 1Y19B 3PVWA 1V89A 3AJ4A 2DHIA 1XD4A 2KGXB 2P8VA 3WYFB 1UEFA 3M1IB 2HTHB 1QQGA 2J0JA 3SNHA 3BJIA 2MKRA 2DFKA 5LOPB 3U7DA 1FHWA 2Y8GA 3PP2A 5J3TA 3CIKA 2Q13A 4DX90 5KQ4A 3PVUA 4ZRJA 1MPHA 2HE7A 2ROVA 3IVFA 1FHXA 2OQBA 2ZPYA 1EAZA 2RVBB 1U5EA 1U5FA 4IAPA 5J3QA 1H10A 2I5CA 4D0NB 1XKEA 2DX5A 4HAXB 2W2WA 4IOYX 4KAXB 1V5PA 4GZUA 4K2OA 4EKUA 2GJYA 2D11A 2D4QA 2YT1A 4GMVA 2ROZB 4YONA 1V61A 4HB2B 5JHHA 2ADZA 1WGUA 2NMBA 1DDVA 3PSCA 1UPQA 2R0DA 2PZ1A 2L1CA 1DYNA 5L81A 2Y8FA 1WGQA 4HDQA 5C16A 1XODA 1FGZA 1KZGA 2H7DA 2LKOA 1ZC3B 4A6HA 1J19A 4MK0A 1U5GA 2UZSA 2MFQA 1UNRA 2IYBA 4K81A 1AQCA 4NY0A 2YVCA 1EF1A 4K17A 1IRSA 4A6FB 2YRYA 1BTKA 1ZC4B 1X05A 2RUKB 3PG7A 3N7CA 4P7IA 2X18A 4A6KA 1AWEA 3D8EA 3ML4A 1BWNA 3ZDTA 1EVHA 1J0WA 5DH9B 1DROA 4HB0B 1ZSQA 4HB4B 2DLWA 2DX1A 2D10A 3G9WA 2MWNB 2LG1A 1ZVRA 3A98B 5LONB 1U5DA 3DXEA 1W1DA 4WJ7A 1KZ7A 1BTNA 3ODOA 5D3WA 5DHFB 2D9XA 1WI1A 2QKMA 1ZM0A 3HW2B 2DN6A 2YS1A 4CYEA 2DTCA 2VRWB 2H7EA 4IFSA 4GXBA 1V88A 3QBVB 4C0AA 3RCPA 2D2QA 4A5KA 3V5WA 2DYQA 2Z0OA 4KHOA 2K2UA 1X1GA 2Y7BA 3QWMA 2Z0QA 1FB8A 4HAWB 4YL8A 1P6SA 3SO6A 4KHAA 1ISNA 3ODWA 3T06A 3UZTA 3P6AA 5D3XA 1U29A 5FI0A 1MAIA 5FI1A 4PNKA 5JHGA 2EJ8A 2G35A 1TQZA 3PVLA 2DKPA 5C5BA 1BAKA 2D9ZA 1LW3A 1GC7A 4GPTB 1P5TA 1OMWA 2E2XA 2DHJA 3PEGA 1XCGA 2J0MA 5JLJB 4EJNA 4TYZA 2CY5A 3ULCA 2D9WA 2I5FA 5KQ1A 2M38A 5HE1A 5C6RA 2AL6A 1DDWA 1Q67A 3VIAA 2W2XC 4DBBA 2LOXA 1Z87A 3SUZA 4EMOA 2COCA 4WVFB 4F7GA 1UNPA 1TXDA 3KY9A 2DKQA 1U27A 1U2BA 1OQNA 2CAYA 1UNQA 3BINA 2COFA 3WA0A 3MPXA 2VKIA 1B55A 4MT7A 3FSSA 3GYPA 2YS5A 1V5UA 1NTYA 2MDXA 3P7ZA 2J0KA 1WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X11 A;  2L2I A;  1V5M A;  3ODX A;  2BCJ A;  3U8Z A;  5DHA B;  4KHB B;  2KCJ A;  1X86 A;  4ZRI A;  2K00 A;  1KI1 B;  5C79 A;  2YT0 A;  4HAU B;  4L6E A;  3SV1 A;  4B6H A;  3FEH A;  1EGX A;  4XWX A;  1SHC A;  3HQC A;  4WSF A;  4GN1 A;  3ULB A;  3AU4 A;  2I1K A;  5DI9 B;  4PQ0 A;  3F5R A;  4HAY B;  2D9Y A;  1M7E A;  1WG7 A;  4A6F A;  3SYX A;  1E5W A;  2YF0 A;  1SGH A;  4HAV B;  3KRW A;  2UVM A;  4HDO A;  1W1G A;  2AEH A;  2K2J A;  1K5G B;  1NTV A;  4HB3 B;  5GOW B;  2JP2 A;  2ELA A;  2LUL A;  3CXB B;  1WVH A;  1P3R A;  2RGN B;  2W2X D;  3FM8 C;  2UZR A;  5KCV A;  3AU5 A;  1I7A A;  1RRP B;  2OTX A;  1MIZ B;  2RSG A;  4Z2M B;  2N0Y A;  2P0F A;  2DA0 A;  1DBH A;  4HAZ B;  2CRF A;  4Y94 A;  4HHV A;  1RJ2 A;  1DDM A;  1N3H A;  2P0H A;  5EFX A;  3DXD A;  4MY6 A;  1TJ6 A;  2KUP A;  2YS3 A;  3KSY A;  3VOQ A;  1PLS A;  3ZVR A;  4HAT B;  2EMT A;  1MK7 B;  3A8Q A;  5J3Y A;  1LB1 A;  2DHK A;  3D8F A;  2RLO A;  1X1F A;  2COD A;  2LOZ A;  2N23 A;  2GCL A;  3LJU X;  4CHM A;  4H8S A;  1QC6 A;  2P0D A;  5HE0 A;  3X23 A;  2D9V A;  5CLL B;  4F7U P;  2R09 A;  4BBK A;  5DIF B;  2FJL A;  4DXA B;  2V76 A;  2NZ8 B;  2M14 A;  3GYO A;  4GMX B;  4TKN A;  3KZ1 A;  2COA A;  3HK0 A;  1I2H A;  1FAO A;  3TCA A;  2J59 M;  1GC6 A;  1H4R A;  1M7R A;  3NSU A;  3PZD A;  2GCJ A;  5HE3 A;  3MDB C;  1FHO A;  3QIJ A;  1NU2 A;  2QKL A;  2RNR B;  4KVG B;  4DX8 A;  1UPR A;  1W1H A;  5CLQ B;  2YSZ A;  1FGY A;  2IFS A;  3O96 A;  1WJ1 A;  2CY4 A;  5D27 A;  1K5D B;  4CHJ A;  2ELB A;  1MIX A;  3TFM A;  2DYN A;  2GS0 A;  3TW1 A;  3A8P A;  3KRX A;  3F0W A;  1FOE A;  5HE2 A;  4K2P A;  1GG3 A;  1NI2 A;  3TO1 A;  5C5B B;  5D3V A;  2EMS A;  1XX0 A;  2VSZ A;  3DXC A;  2I1J A;  2XQN M;  4NSW A;  3OAN A;  5JP4 A;  4F7H A;  2Z0P A;  3TVV A;  1XR0 B;  4Z2N A;  3D8D A;  1PMS A;  1Y5O A;  2LYD A;  1MKE A;  5D3Y A;  1PFJ A;  2EC1 A;  1MK9 B;  4ZRK A;  1OY2 A;  1Y19 B;  3PVW A;  1V89 A;  3AJ4 A;  2DHI A;  1XD4 A;  2KGX B;  2P8V A;  3WYF B;  1UEF A;  3M1I B;  2HTH B;  1QQG A;  2J0J A;  3SNH A;  3BJI A;  2MKR A;  2DFK A;  5LOP B;  3U7D A;  1FHW A;  2Y8G A;  3PP2 A;  5J3T A;  3CIK A;  2Q13 A;  4DX9 0;  5KQ4 A;  3PVU A;  4ZRJ A;  1MPH A;  2HE7 A;  2ROV A;  3IVF A;  1FHX A;  2OQB A;  2ZPY A;  1EAZ A;  2RVB B;  1U5E A;  1U5F A;  4IAP A;  5J3Q A;  1H10 A;  2I5C A;  4D0N B;  1XKE A;  2DX5 A;  4HAX B;  2W2W A;  4IOY X;  4KAX B;  1V5P A;  4GZU A;  4K2O A;  4EKU A;  2GJY A;  2D11 A;  2D4Q A;  2YT1 A;  4GMV A;  2ROZ B;  4YON A;  1V61 A;  4HB2 B;  5JHH A;  2ADZ A;  1WGU A;  2NMB A;  1DDV A;  3PSC A;  1UPQ A;  2R0D A;  2PZ1 A;  2L1C A;  1DYN A;  5L81 A;  2Y8F A;  1WGQ A;  4HDQ A;  5C16 A;  1XOD A;  1FGZ A;  1KZG A;  2H7D A;  2LKO A;  1ZC3 B;  4A6H A;  1J19 A;  4MK0 A;  1U5G A;  2UZS A;  2MFQ A;  1UNR A;  2IYB A;  4K81 A;  1AQC A;  4NY0 A;  2YVC A;  1EF1 A;  4K17 A;  1IRS A;  4A6F B;  2YRY A;  1BTK A;  1ZC4 B;  1X05 A;  2RUK B;  3PG7 A;  3N7C A;  4P7I A;  2X18 A;  4A6K A;  1AWE A;  3D8E A;  3ML4 A;  1BWN A;  3ZDT A;  1EVH A;  1J0W A;  5DH9 B;  1DRO A;  4HB0 B;  1ZSQ A;  4HB4 B;  2DLW A;  2DX1 A;  2D10 A;  3G9W A;  2MWN B;  2LG1 A;  1ZVR A;  3A98 B;  5LON B;  1U5D A;  3DXE A;  1W1D A;  4WJ7 A;  1KZ7 A;  1BTN A;  3ODO A;  5D3W A;  5DHF B;  2D9X A;  1WI1 A;  2QKM A;  1ZM0 A;  3HW2 B;  2DN6 A;  2YS1 A;  4CYE A;  2DTC A;  2VRW B;  2H7E A;  4IFS A;  4GXB A;  1V88 A;  3QBV B;  4C0A A;  3RCP A;  2D2Q A;  4A5K A;  3V5W A;  2DYQ A;  2Z0O A;  4KHO A;  2K2U A;  1X1G A;  2Y7B A;  3QWM A;  2Z0Q A;  1FB8 A;  4HAW B;  4YL8 A;  1P6S A;  3SO6 A;  4KHA A;  1ISN A;  3ODW A;  3T06 A;  3UZT A;  3P6A A;  5D3X A;  1U29 A;  5FI0 A;  1MAI A;  5FI1 A;  4PNK A;  5JHG A;  2EJ8 A;  2G35 A;  1TQZ A;  3PVL A;  2DKP A;  5C5B A;  1BAK A;  2D9Z A;  1LW3 A;  1GC7 A;  4GPT B;  1P5T A;  1OMW A;  2E2X A;  2DHJ A;  3PEG A;  1XCG A;  2J0M A;  5JLJ B;  4EJN A;  4TYZ A;  2CY5 A;  3ULC A;  2D9W A;  2I5F A;  5KQ1 A;  2M38 A;  5HE1 A;  5C6R A;  2AL6 A;  1DDW A;  1Q67 A;  3VIA A;  2W2X C;  4DBB A;  2LOX A;  1Z87 A;  3SUZ A;  4EMO A;  2COC A;  4WVF B;  4F7G A;  1UNP A;  1TXD A;  3KY9 A;  2DKQ A;  1U27 A;  1U2B A;  1OQN A;  2CAY A;  1UNQ A;  3BIN A;  2COF A;  3WA0 A;  3MPX A;  2VKI A;  1B55 A;  4MT7 A;  3FSS A;  3GYP A;  2YS5 A;  1V5U A;  1NTY A;  2MDX A;  3P7Z A;  2J0K A;  1WJM A; 
#chains in the Genus database with same CATH topology
 1X11 A;  2L2I A;  1V5M A;  3NWF A;  3ODX A;  1ZYI A;  2BCJ A;  3U8Z A;  5DHA B;  2Z14 A;  4KHB B;  2KCJ A;  1X86 A;  4ZRI A;  2K00 A;  1KI1 B;  5C79 A;  2YT0 A;  4HAU B;  4L6E A;  4D6W A;  3SV1 A;  4B6H A;  3FEH A;  1EGX A;  4XWX A;  2NBV A;  2R2Y A;  1SHC A;  3HQC A;  4WSF A;  4GN1 A;  3ULB A;  3AU4 A;  2I1K A;  5DI9 B;  4PQ0 A;  3F5R A;  4HAY B;  2D9Y A;  1M7E A;  1WG7 A;  4A6F A;  1MI1 A;  3SYX A;  1E5W A;  2YF0 A;  1SGH A;  4HAV B;  3KRW A;  2UVM A;  4HDO A;  1W1G A;  2AEH A;  2K2J A;  1K5G B;  1NTV A;  4HB3 B;  5GOW B;  2JP2 A;  4L1R A;  2ELA A;  2LUL A;  3CXB B;  1WVH A;  1P3R A;  2RGN B;  2W2X D;  3FM8 C;  2UZR A;  5KCV A;  3AU5 A;  1I7A A;  1RRP B;  2OTX A;  1MIZ B;  2RSG A;  4Z2M B;  2N0Y A;  2P0F A;  2DA0 A;  1DBH A;  4HAZ B;  2CRF A;  4Y94 A;  4HHV A;  1RJ2 A;  1DDM A;  1N3H A;  2P0H A;  5EFX A;  3DXD A;  4MY6 A;  1TJ6 A;  2KUP A;  2YS3 A;  3KSY A;  3VOQ A;  1PLS A;  2Z4D A;  3ZVR A;  1T77 A;  4HAT B;  2EMT A;  1MK7 B;  2KIG A;  3A8Q A;  5J3Y A;  1LB1 A;  2DHK A;  3D8F A;  2RLO A;  1X1F A;  2COD A;  2LOZ A;  2N23 A;  2GCL A;  3LJU X;  4CHM A;  4H8S A;  1QC6 A;  2P0D A;  5HE0 A;  3X23 A;  2D9V A;  5CLL B;  4F7U P;  2R09 A;  2Z59 A;  4BBK A;  5DIF B;  2FJL A;  4DXA B;  2V76 A;  2NZ8 B;  2M14 A;  3GYO A;  4GMX B;  3B77 A;  4TKN A;  3KZ1 A;  2COA A;  3HK0 A;  1I2H A;  1FAO A;  3TCA A;  2J59 M;  1GC6 A;  1H4R A;  1M7R A;  3NSU A;  3PZD A;  3FVC A;  2GCJ A;  5HE3 A;  3MDB C;  1FHO A;  3QIJ A;  1NU2 A;  2QKL A;  2RNR B;  4KVG B;  4DX8 A;  1UPR A;  1W1H A;  5CLQ B;  2YSZ A;  1FGY A;  2IFS A;  3O96 A;  1WJ1 A;  2CY4 A;  5D27 A;  1K5D B;  4CHJ A;  2ELB A;  1MIX A;  3TFM A;  2DYN A;  2GS0 A;  3TW1 A;  2FJU B;  3A8P A;  5LG4 B;  3KRX A;  3F0W A;  1FOE A;  5HE2 A;  4K2P A;  1GG3 A;  1NI2 A;  3TO1 A;  2RRF A;  5D3V A;  5C5B B;  2EMS A;  1XX0 A;  2VSZ A;  3DXC A;  2I1J A;  2XQN M;  4NSW A;  3A58 A;  3OAN A;  5JP4 A;  4F7H A;  3DCX A;  3NWA A;  2Z0P A;  3TVV A;  5M4Y B;  1XR0 B;  4Z2N A;  3U12 A;  3D8D A;  1PMS A;  1Y5O A;  2LYD A;  1MKE A;  5D3Y A;  5I2S A;  4GNK B;  1PFJ A;  3HSA A;  2EC1 A;  1MK9 B;  4ZRK A;  1OY2 A;  1Y19 B;  3PVW A;  1V89 A;  2GUM A;  3AJ4 A;  2DHI A;  1XD4 A;  5IRS A;  2KGX B;  2P8V A;  3WYF B;  1UEF A;  3M1I B;  2HTH B;  1QQG A;  2J0J A;  3SNH A;  2ZKM X;  3BJI A;  2MKR A;  2DFK A;  5LOP B;  3U7D A;  4OT1 A;  1FHW A;  2KUQ A;  2Y8G A;  3PP2 A;  5J3T A;  3CIK A;  2Q13 A;  4DX9 0;  5KQ4 A;  3PVU A;  4ZRJ A;  1MPH A;  2HE7 A;  2ROV A;  3IVF A;  1FHX A;  2OQB A;  2ZPY A;  1EAZ A;  2RVB B;  1U5E A;  1U5F A;  4IAP A;  5J3Q A;  1H10 A;  2I5C A;  4D0N B;  1XKE A;  4KHB A;  2DX5 A;  4HAX B;  2W2W A;  4IOY X;  4KAX B;  4OSN A;  1V5P A;  4GZU A;  4K2O A;  4EKU A;  2GJY A;  2D11 A;  2D4Q A;  2YT1 A;  4GMV A;  2ROZ B;  4YON A;  1V61 A;  4HB2 B;  5JHH A;  4QJ3 B;  2ADZ A;  1WGU A;  2NMB A;  1DDV A;  3PSC A;  1UPQ A;  2R0D A;  2PZ1 A;  2L1C A;  1DYN A;  5L81 A;  2Y8F A;  1WGQ A;  4HDQ A;  5C16 A;  1XOD A;  1FGZ A;  1KZG A;  2H7D A;  2LKO A;  1ZC3 B;  4A6H A;  1J19 A;  4MK0 A;  1U5G A;  2UZS A;  2MFQ A;  1UNR A;  2IYB A;  4K81 A;  1AQC A;  4NY0 A;  2YVC A;  1EF1 A;  4K17 A;  2Z13 A;  1IRS A;  4A6F B;  2YRY A;  1BTK A;  1ZC4 B;  1X05 A;  2RUK B;  3PG7 A;  2YT2 A;  3N7C A;  4P7I A;  2X18 A;  4A6K A;  1AWE A;  3D8E A;  3ML4 A;  1BWN A;  3ZDT A;  3NWD A;  1EVH A;  4QJ5 B;  1J0W A;  5DH9 B;  3HIE A;  2KR0 A;  1DRO A;  4HB0 B;  1ZSQ A;  2DLW A;  2DX1 A;  4HB4 B;  2D10 A;  3G9W A;  2MWN B;  2LG1 A;  1ZVR A;  3A98 B;  5LON B;  1U5D A;  4CSQ A;  3DXE A;  1W1D A;  4WJ7 A;  1KZ7 A;  1BTN A;  3ODO A;  5D3W A;  2K8E A;  5DHF B;  2D9X A;  1WI1 A;  2QKM A;  1ZM0 A;  3HW2 B;  2DN6 A;  2YS1 A;  4CYE A;  2DTC A;  4QJ4 B;  2VRW B;  2H7E A;  4IFS A;  4GXB A;  1V88 A;  3QBV B;  4C0A A;  3RCP A;  2D2Q A;  4A5K A;  2K49 A;  3V5W A;  2DYQ A;  2Z0O A;  4KHO A;  2K2U A;  1X1G A;  2Y7B A;  3QWM A;  2Z0Q A;  1FB8 A;  4HAW B;  4YL8 A;  1P6S A;  3SO6 A;  2KIE A;  4KHA A;  1ISN A;  3OHM B;  3ODW A;  3T06 A;  3UZT A;  3P6A A;  5D3X A;  1U29 A;  5FI0 A;  1MAI A;  5FI1 A;  4PNK A;  5JHG A;  2EJ8 A;  2G35 A;  1TQZ A;  3PVL A;  2DKP A;  5C5B A;  4QXA B;  1BAK A;  2D9Z A;  1LW3 A;  1GC7 A;  4GPT B;  1P5T A;  5I2M A;  1OMW A;  2E2X A;  2DHJ A;  4HSI A;  3PEG A;  1XCG A;  2J0M A;  3NW8 A;  5JLJ B;  4GOU A;  4EJN A;  4TYZ A;  2CY5 A;  3ULC A;  2D9W A;  2I5F A;  5KQ1 A;  2M38 A;  5HE1 A;  5C6R A;  2AL6 A;  1DDW A;  1Q67 A;  3VIA A;  2W2X C;  4DBB A;  2LOX A;  1Z87 A;  3SUZ A;  4EMO A;  2COC A;  4WVF B;  4F7G A;  1UNP A;  4DIX A;  1TXD A;  3KY9 A;  2DKQ A;  1U27 A;  1U2B A;  1OQN A;  2CAY A;  1UNQ A;  3BIN A;  2COF A;  3WA0 A;  3MPX A;  2VKI A;  1B55 A;  4MT7 A;  3FSS A;  3GYP A;  2YS5 A;  1V5U A;  1NTY A;  2MDX A;  3P7Z A;  2J0K A;  1WJM A; 
#chains in the Genus database with same CATH homology
 1X11 A;  2L2I A;  1V5M A;  3ODX A;  2BCJ A;  3U8Z A;  5DHA B;  4KHB B;  2KCJ A;  1X86 A;  4ZRI A;  2K00 A;  1KI1 B;  5C79 A;  2YT0 A;  4HAU B;  4L6E A;  3SV1 A;  4B6H A;  3FEH A;  1EGX A;  4XWX A;  1SHC A;  3HQC A;  4WSF A;  4GN1 A;  3ULB A;  3AU4 A;  2I1K A;  5DI9 B;  4PQ0 A;  3F5R A;  4HAY B;  2D9Y A;  1M7E A;  1WG7 A;  4A6F A;  3SYX A;  1E5W A;  2YF0 A;  1SGH A;  4HAV B;  3KRW A;  2UVM A;  4HDO A;  1W1G A;  2AEH A;  2K2J A;  1K5G B;  1NTV A;  4HB3 B;  5GOW B;  2JP2 A;  2ELA A;  2LUL A;  3CXB B;  1WVH A;  1P3R A;  2RGN B;  2W2X D;  3FM8 C;  2UZR A;  5KCV A;  3AU5 A;  1I7A A;  1RRP B;  2OTX A;  1MIZ B;  2RSG A;  4Z2M B;  2N0Y A;  2P0F A;  2DA0 A;  1DBH A;  4HAZ B;  2CRF A;  4Y94 A;  4HHV A;  1RJ2 A;  1DDM A;  1N3H A;  2P0H A;  5EFX A;  3DXD A;  4MY6 A;  1TJ6 A;  2KUP A;  2YS3 A;  3KSY A;  3VOQ A;  1PLS A;  3ZVR A;  4HAT B;  2EMT A;  1MK7 B;  3A8Q A;  5J3Y A;  1LB1 A;  2DHK A;  3D8F A;  2RLO A;  1X1F A;  2COD A;  2LOZ A;  2N23 A;  2GCL A;  3LJU X;  4CHM A;  4H8S A;  1QC6 A;  2P0D A;  5HE0 A;  3X23 A;  2D9V A;  5CLL B;  4F7U P;  2R09 A;  4BBK A;  5DIF B;  2FJL A;  4DXA B;  2V76 A;  2NZ8 B;  2M14 A;  3GYO A;  4GMX B;  4TKN A;  3KZ1 A;  2COA A;  3HK0 A;  1I2H A;  1FAO A;  3TCA A;  2J59 M;  1GC6 A;  1H4R A;  1M7R A;  3NSU A;  3PZD A;  2GCJ A;  5HE3 A;  3MDB C;  1FHO A;  3QIJ A;  1NU2 A;  2QKL A;  2RNR B;  4KVG B;  4DX8 A;  1UPR A;  1W1H A;  5CLQ B;  2YSZ A;  1FGY A;  2IFS A;  3O96 A;  1WJ1 A;  2CY4 A;  5D27 A;  1K5D B;  4CHJ A;  2ELB A;  1MIX A;  3TFM A;  2DYN A;  2GS0 A;  3TW1 A;  3A8P A;  3KRX A;  3F0W A;  1FOE A;  5HE2 A;  4K2P A;  1GG3 A;  1NI2 A;  3TO1 A;  5C5B B;  5D3V A;  2EMS A;  1XX0 A;  2VSZ A;  3DXC A;  2I1J A;  2XQN M;  4NSW A;  3OAN A;  5JP4 A;  4F7H A;  2Z0P A;  3TVV A;  1XR0 B;  4Z2N A;  3D8D A;  1PMS A;  1Y5O A;  2LYD A;  1MKE A;  5D3Y A;  1PFJ A;  2EC1 A;  1MK9 B;  4ZRK A;  1OY2 A;  1Y19 B;  3PVW A;  1V89 A;  3AJ4 A;  2DHI A;  1XD4 A;  2KGX B;  2P8V A;  3WYF B;  1UEF A;  3M1I B;  2HTH B;  1QQG A;  2J0J A;  3SNH A;  3BJI A;  2MKR A;  2DFK A;  5LOP B;  3U7D A;  1FHW A;  2Y8G A;  3PP2 A;  5J3T A;  3CIK A;  2Q13 A;  4DX9 0;  5KQ4 A;  3PVU A;  4ZRJ A;  1MPH A;  2HE7 A;  2ROV A;  3IVF A;  1FHX A;  2OQB A;  2ZPY A;  1EAZ A;  2RVB B;  1U5E A;  1U5F A;  4IAP A;  5J3Q A;  1H10 A;  2I5C A;  4D0N B;  1XKE A;  2DX5 A;  4HAX B;  2W2W A;  4IOY X;  4KAX B;  1V5P A;  4GZU A;  4K2O A;  4EKU A;  2GJY A;  2D11 A;  2D4Q A;  2YT1 A;  4GMV A;  2ROZ B;  4YON A;  1V61 A;  4HB2 B;  5JHH A;  2ADZ A;  1WGU A;  2NMB A;  1DDV A;  3PSC A;  1UPQ A;  2R0D A;  2PZ1 A;  2L1C A;  1DYN A;  5L81 A;  2Y8F A;  1WGQ A;  4HDQ A;  5C16 A;  1XOD A;  1FGZ A;  1KZG A;  2H7D A;  2LKO A;  1ZC3 B;  4A6H A;  1J19 A;  4MK0 A;  1U5G A;  2UZS A;  2MFQ A;  1UNR A;  2IYB A;  4K81 A;  1AQC A;  4NY0 A;  2YVC A;  1EF1 A;  4K17 A;  1IRS A;  4A6F B;  2YRY A;  1BTK A;  1ZC4 B;  1X05 A;  2RUK B;  3PG7 A;  3N7C A;  4P7I A;  2X18 A;  4A6K A;  1AWE A;  3D8E A;  3ML4 A;  1BWN A;  3ZDT A;  1EVH A;  1J0W A;  5DH9 B;  1DRO A;  4HB0 B;  1ZSQ A;  4HB4 B;  2DLW A;  2DX1 A;  2D10 A;  3G9W A;  2MWN B;  2LG1 A;  1ZVR A;  3A98 B;  5LON B;  1U5D A;  3DXE A;  1W1D A;  4WJ7 A;  1KZ7 A;  1BTN A;  3ODO A;  5D3W A;  5DHF B;  2D9X A;  1WI1 A;  2QKM A;  1ZM0 A;  3HW2 B;  2DN6 A;  2YS1 A;  4CYE A;  2DTC A;  2VRW B;  2H7E A;  4IFS A;  4GXB A;  1V88 A;  3QBV B;  4C0A A;  3RCP A;  2D2Q A;  4A5K A;  3V5W A;  2DYQ A;  2Z0O A;  4KHO A;  2K2U A;  1X1G A;  2Y7B A;  3QWM A;  2Z0Q A;  1FB8 A;  4HAW B;  4YL8 A;  1P6S A;  3SO6 A;  4KHA A;  1ISN A;  3ODW A;  3T06 A;  3UZT A;  3P6A A;  5D3X A;  1U29 A;  5FI0 A;  1MAI A;  5FI1 A;  4PNK A;  5JHG A;  2EJ8 A;  2G35 A;  1TQZ A;  3PVL A;  2DKP A;  5C5B A;  1BAK A;  2D9Z A;  1LW3 A;  1GC7 A;  4GPT B;  1P5T A;  1OMW A;  2E2X A;  2DHJ A;  3PEG A;  1XCG A;  2J0M A;  5JLJ B;  4EJN A;  4TYZ A;  2CY5 A;  3ULC A;  2D9W A;  2I5F A;  5KQ1 A;  2M38 A;  5HE1 A;  5C6R A;  2AL6 A;  1DDW A;  1Q67 A;  3VIA A;  2W2X C;  4DBB A;  2LOX A;  1Z87 A;  3SUZ A;  4EMO A;  2COC A;  4WVF B;  4F7G A;  1UNP A;  1TXD A;  3KY9 A;  2DKQ A;  1U27 A;  1U2B A;  1OQN A;  2CAY A;  1UNQ A;  3BIN A;  2COF A;  3WA0 A;  3MPX A;  2VKI A;  1B55 A;  4MT7 A;  3FSS A;  3GYP A;  2YS5 A;  1V5U A;  1NTY A;  2MDX A;  3P7Z A;  2J0K A;  1WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...