1N3HA

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
207
structure length
207
Chain Sequence
b'MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC Transforming protein
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1n3hA00
3DXEA 3A98B 2OQBA 2K2JA 1OY2A 1Z87A 1WJMA 3PVLA 3F5RA 2Z0QA 4HAZB 1V89A 2DKPA 2GCJA 5D3XA 5D3VA 2LG1A 2P0FA 3ML4A 5EFXA 2COAA 2HE7A 1IRSA 4Y94A 4WJ7A 1NI2A 5C79A 1EVHA 1LB1A 1DROA 3G9WA 4HAVB 2I5CA 2DKQA 1ZSQA 2E2XA 4F7HA 2MFQA 4PNKA 2YT0A 4K2PA 2DHIA 5L81A 1XKEA 4HAUB 2BCJA 3F0WA 2R09A 2GS0A 2M14A 3CXBB 2VKIA 4A6HA 3QBVB 5GOWB 3PP2A 4Z2NA 4K81A 2YSZA 2YS3A 4IAPA 4EMOA 4KHOA 3BINA 3IVFA 4D0NB 4KHAA 1XODA 1WGQA 3ODWA 2G35A 2VRWB 1PMSA 3KZ1A 2RGNB 2EMTA 2J0KA 2D9XA 4HB4B 4NSWA 2M38A 1ZM0A 3TVVA 1PLSA 2V76A 4GN1A 5KQ4A 2J59M 2H7DA 2DHKA 1B55A 1KI1B 1TJ6A 4EKUA 3AU4A 1MIXA 3PVUA 4HATB 4A6FA 1DDVA 3AJ4A 2DX5A 1FOEA 2DLWA 1MKEA 5HE1A 2CRFA 3PZDA 1BWNA 3KRXA 1V61A 1U29A 4A6FB 2YF0A 1NU2A 2L2IA 5KCVA 1MAIA 1UNQA 2AL6A 2W2XD 1W1DA 4MY6A 2Y8FA 3PSCA 1QC6A 3PVWA 3O96A 5D27A 2KGXB 4CHMA 2ROZB 3P6AA 3MDBC 1TQZA 1OQNA 5C16A 1U5EA 2IYBA 1DDMA 1QQGA 1X11A 2I1KA 2Z0PA 3PEGA 3QWMA 4GZUA 2N0YA 1AWEA 5LONB 1RJ2A 1Y19B 3N7CA 3V5WA 4HAXB 2X18A 1NTVA 1W1GA 2KUPA 2H7EA 3KSYA 1V5UA 1TXDA 2PZ1A 5FI0A 2MDXA 2LKOA 3NSUA 3U7DA 5HE3A 1WI1A 3VIAA 2COCA 1P3RA 3WA0A 3HQCA 2COFA 1V88A 1DBHA 5FI1A 3DXDA 2NMBA 4EJNA 5C5BA 5JHGA 3ZDTA 4DX90 2XQNM 1U2BA 4BBKA 5DIFB 2FJLA 1AQCA 4HB2B 1RRPB 1XD4A 1ZC3B 2W2WA 4DBBA 5HE0A 2P0HA 4GMVA 1FB8A 2DHJA 4Z2MB 1FGYA 1DDWA 2J0MA 2DFKA 3HW2B 1M7RA 5JP4A 3KY9A 4YONA 1WGUA 4MK0A 2N23A 1Y5OA 3P7ZA 3TFMA 4H8SA 3DXCA 3A8PA 1UPQA 3ZVRA 1X05A 1FAOA 2Y7BA 1XCGA 4ZRJA 2UVMA 2DTCA 5JLJB 4A6KA 1J0WA 2R0DA 4TYZA 4NY0A 1FHWA 4F7UP 4L6EA 1LW3A 1SGHA 2RLOA 2Q13A 2ELBA 2K00A 4B6HA 1UPRA 2ELAA 2RVBB 1MK7B 2DYQA 4WVFB 2YS1A 1I2HA 5HE2A 2D10A 2D4QA 2ZPYA 1GC7A 3RCPA 2Z0OA 3A8QA 2YVCA 1OMWA 2I1JA 2D9VA 1BAKA 2CY5A 1E5WA 1WVHA 1XX0A 4HDOA 4ZRIA 5J3TA 4K17A 4HAYB 4MT7A 2ROVA 3MPXA 4YL8A 2K2UA 4DXAB 1FHXA 5CLLB 2UZRA 5DI9B 1UNPA 5J3YA 2DX1A 1MPHA 3SNHA 2P0DA 4WSFA 4F7GA 3ODOA 5CLQB 2CODA 1K5GB 1U27A 2CY4A 1EGXA 2RSGA 1KZ7A 5DHFB 4HB0B 1PFJA 3QIJA 1U5DA 2YS5A 1WJ1A 3BJIA 4GMXB 5KQ1A 2EMSA 3ULCA 4DX8A 4ZRKA 3FSSA 1XR0B 2DYNA 4KVGB 1ZVRA 2KCJA 2VSZA 4IFSA 4CYEA 5DH9B 2D11A 1MK9B 1MIZB 2LOXA 1X86A 4TKNA 2P8VA 4GPTB 1EF1A 2I5FA 4KHBB 2JP2A 3SV1A 5C5BB 1X1FA 3AU5A 2IFSA 3PG7A 5J3QA 1ISNA 4HAWB 2HTHB 2QKMA 1X1GA 2L1CA 1WG7A 3ODXA 3VOQA 1V5MA 2MWNB 3WYFB 5DHAB 2EJ8A 4GXBA 2D9ZA 4HDQA 1FHOA 1EAZA 3D8DA 1K5DB 3ULBA 3M1IB 1KZGA 2UZSA 1GC6A 2DN6A 1P5TA 4HHVA 2MKRA 1I7AA 3TW1A 2GJYA 2ADZA 4A5KA 3GYOA 2LOZA 2Y8GA 2QKLA 5LOPB 3HK0A 1U5GA 1M7EA 1UNRA 1U5FA 4IOYX 4K2OA 1GG3A 1SHCA 2W2XC 1DYNA 5D3YA 1ZC4B 2LYDA 5JHHA 1UEFA 3CIKA 5C6RA 2NZ8B 1N3HA 2D9WA 1J19A 4KAXB 1P6SA 2D2QA 3TO1A 3SYXA 4C0AA 3SO6A 2OTXA 3OANA 1NTYA 2LULA 2EC1A 2RUKB 3SUZA 2DA0A 3D8FA 2D9YA 4HB3B 2CAYA 2RNRB 3T06A 1Q67A 1BTNA 1H10A 3KRWA 2J0JA 2YRYA 3TCAA 3X23A 3LJUX 1BTKA 1FGZA 3D8EA 3FEHA 4XWXA 4PQ0A 1V5PA 2AEHA 2GCLA 4CHJA 1W1HA 3GYPA 3FM8C 3U8ZA 3UZTA 5D3WA 1H4RA 4P7IA 2YT1A
chains in the Genus database with same CATH superfamily
3DXEA 4GOUA 3A98B 2OQBA 2K2JA 1OY2A 1Z87A 1WJMA 3PVLA 3F5RA 2Z0QA 4HAZB 1V89A 2DKPA 2GCJA 5D3XA 5D3VA 2LG1A 2P0FA 3ML4A 5EFXA 2COAA 2HE7A 1IRSA 4Y94A 4WJ7A 1NI2A 5C79A 1EVHA 1LB1A 1DROA 3G9WA 4HAVB 2I5CA 2DKQA 1ZSQA 2E2XA 4F7HA 2MFQA 4PNKA 2YT0A 4K2PA 3NWFA 2DHIA 5L81A 1XKEA 4HAUB 2BCJA 3F0WA 2R09A 2GS0A 2M14A 3CXBB 2VKIA 4A6HA 3QBVB 3HIEA 5GOWB 3PP2A 4Z2NA 4GNKB 4K81A 2YSZA 2YS3A 4IAPA 4EMOA 4KHOA 3BINA 3IVFA 4D0NB 4KHAA 5LG4B 1XODA 1WGQA 3ODWA 2RRFA 2G35A 2KR0A 2VRWB 1PMSA 3KZ1A 2RGNB 2EMTA 2J0KA 2D9XA 4HB4B 4NSWA 2M38A 4QJ3B 1ZM0A 3TVVA 1PLSA 2V76A 4GN1A 5KQ4A 2J59M 2H7DA 2DHKA 2KIEA 1B55A 1KI1B 4QXAB 1TJ6A 4EKUA 3AU4A 1MIXA 3PVUA 4HATB 4A6FA 1DDVA 4CSQA 3AJ4A 2DX5A 1FOEA 2DLWA 1MKEA 5HE1A 2CRFA 3PZDA 1BWNA 3KRXA 1V61A 1U29A 4A6FB 2YF0A 1NU2A 2L2IA 5KCVA 1MAIA 1UNQA 2AL6A 2W2XD 1W1DA 4MY6A 4D6WA 2Y8FA 3PSCA 1QC6A 3PVWA 3O96A 5D27A 2KGXB 2NBVA 4CHMA 2ROZB 3P6AA 3MDBC 1TQZA 1OQNA 5C16A 1U5EA 2IYBA 1DDMA 1QQGA 1X11A 2I1KA 2Z0PA 3PEGA 3QWMA 4GZUA 2N0YA 1AWEA 5LONB 1RJ2A 1Y19B 3N7CA 3V5WA 4HAXB 2X18A 1NTVA 1W1GA 2KUPA 2H7EA 3KSYA 1V5UA 1TXDA 2PZ1A 5FI0A 2MDXA 1MI1A 3A58A 2LKOA 3NSUA 3U7DA 5HE3A 1WI1A 3VIAA 2COCA 3NWAA 2K8EA 1P3RA 3WA0A 3HQCA 2COFA 1V88A 1DBHA 4KHBA 5FI1A 3DXDA 2NMBA 4EJNA 5C5BA 5JHGA 3ZDTA 4DX90 2XQNM 1U2BA 4BBKA 5DIFB 2FJLA 1AQCA 4HB2B 1RRPB 1XD4A 1ZC3B 4QJ4B 2W2WA 4DBBA 5HE0A 2P0HA 4GMVA 1FB8A 2DHJA 4Z2MB 1FGYA 1DDWA 2J0MA 3HSAA 2DFKA 3HW2B 1M7RA 3B77A 3U12A 5JP4A 3KY9A 4YONA 1WGUA 4MK0A 2N23A 1Y5OA 4QJ5B 3P7ZA 3TFMA 4H8SA 3DXCA 3A8PA 1UPQA 3ZVRA 1X05A 2ZKMX 1FAOA 2Y7BA 1XCGA 4ZRJA 2UVMA 2DTCA 5JLJB 4A6KA 1J0WA 2K49A 2R0DA 4TYZA 4NY0A 1FHWA 4F7UP 4L6EA 1LW3A 1SGHA 2RLOA 2Q13A 2ELBA 2K00A 4B6HA 1UPRA 2ELAA 2RVBB 1MK7B 2DYQA 4WVFB 2YS1A 4HSIA 1I2HA 5HE2A 2D10A 2D4QA 2ZPYA 1GC7A 3RCPA 2Z0OA 3A8QA 4DIXA 2YVCA 1OMWA 2I1JA 2D9VA 1BAKA 2CY5A 1E5WA 1WVHA 1XX0A 4HDOA 4ZRIA 5J3TA 4K17A 4L1RA 4HAYB 4MT7A 2ROVA 3MPXA 4YL8A 2K2UA 4DXAB 1FHXA 2Z13A 2UZRA 5CLLB 5DI9B 1UNPA 5J3YA 2DX1A 2R2YA 1MPHA 2GUMA 3SNHA 2P0DA 4WSFA 4F7GA 3ODOA 5CLQB 2CODA 2Z4DA 1K5GB 1U27A 2CY4A 1EGXA 2RSGA 1KZ7A 5DHFB 4HB0B 1PFJA 3QIJA 1U5DA 2YS5A 1WJ1A 3BJIA 4GMXB 5KQ1A 2EMSA 3ULCA 4DX8A 5M4YB 4ZRKA 3FSSA 1XR0B 2DYNA 4KVGB 1ZVRA 2KCJA 2VSZA 4IFSA 4CYEA 5DH9B 2D11A 1MK9B 1MIZB 2LOXA 1X86A 4TKNA 2P8VA 4GPTB 5IRSA 1EF1A 4OT1A 2I5FA 4KHBB 2JP2A 3SV1A 5C5BB 1X1FA 3AU5A 2IFSA 3OHMB 3PG7A 1ISNA 5J3QA 4HAWB 2HTHB 2QKMA 3NWDA 2Z59A 1X1GA 2L1CA 3FVCA 1WG7A 3ODXA 3VOQA 1V5MA 2MWNB 3WYFB 5DHAB 5I2MA 2EJ8A 1ZYIA 4GXBA 2D9ZA 2YT2A 4HDQA 1FHOA 1EAZA 3D8DA 1K5DB 2Z14A 3ULBA 3M1IB 1KZGA 2UZSA 1GC6A 1T77A 2DN6A 1P5TA 2KUQA 4HHVA 4OSNA 2MKRA 1I7AA 3TW1A 2GJYA 2ADZA 4A5KA 3GYOA 2LOZA 2Y8GA 2QKLA 5LOPB 3HK0A 1U5GA 3DCXA 1M7EA 1UNRA 1U5FA 4IOYX 2FJUB 1GG3A 4K2OA 1SHCA 2W2XC 1DYNA 5D3YA 1ZC4B 2LYDA 5JHHA 1UEFA 3CIKA 5C6RA 2NZ8B 1N3HA 2D9WA 1J19A 4KAXB 1P6SA 2D2QA 3TO1A 3SYXA 4C0AA 3SO6A 3NW8A 2OTXA 2KIGA 3OANA 1NTYA 2LULA 2EC1A 2RUKB 3SUZA 2DA0A 3D8FA 2D9YA 4HB3B 2CAYA 2RNRB 3T06A 1Q67A 1BTNA 1H10A 3KRWA 2J0JA 2YRYA 3TCAA 3X23A 3LJUX 1BTKA 1FGZA 3D8EA 3FEHA 4XWXA 4PQ0A 1V5PA 2AEHA 2GCLA 4CHJA 1W1HA 3GYPA 3FM8C 3U8ZA 3UZTA 5D3WA 1H4RA 4P7IA 5I2SA 2YT1A
chains in the Genus database with same CATH topology
3DXEA 3A98B 2OQBA 2K2JA 1OY2A 1Z87A 1WJMA 3PVLA 3F5RA 2Z0QA 4HAZB 1V89A 2DKPA 2GCJA 5D3XA 5D3VA 2LG1A 2P0FA 3ML4A 5EFXA 2COAA 2HE7A 1IRSA 4Y94A 4WJ7A 1NI2A 5C79A 1EVHA 1LB1A 1DROA 3G9WA 4HAVB 2I5CA 2DKQA 1ZSQA 2E2XA 4F7HA 2MFQA 4PNKA 2YT0A 4K2PA 2DHIA 5L81A 1XKEA 4HAUB 2BCJA 3F0WA 2R09A 2GS0A 2M14A 3CXBB 2VKIA 4A6HA 3QBVB 5GOWB 3PP2A 4Z2NA 4K81A 2YSZA 2YS3A 4IAPA 4EMOA 4KHOA 3BINA 3IVFA 4D0NB 4KHAA 1XODA 1WGQA 3ODWA 2G35A 2VRWB 1PMSA 3KZ1A 2RGNB 2EMTA 2J0KA 2D9XA 4HB4B 4NSWA 2M38A 1ZM0A 3TVVA 1PLSA 2V76A 4GN1A 5KQ4A 2J59M 2H7DA 2DHKA 1B55A 1KI1B 1TJ6A 4EKUA 3AU4A 1MIXA 3PVUA 4HATB 4A6FA 1DDVA 3AJ4A 2DX5A 1FOEA 2DLWA 1MKEA 5HE1A 2CRFA 3PZDA 1BWNA 3KRXA 1V61A 1U29A 4A6FB 2YF0A 1NU2A 2L2IA 5KCVA 1MAIA 1UNQA 2AL6A 2W2XD 1W1DA 4MY6A 2Y8FA 3PSCA 1QC6A 3PVWA 3O96A 5D27A 2KGXB 4CHMA 2ROZB 3P6AA 3MDBC 1TQZA 1OQNA 5C16A 1U5EA 2IYBA 1DDMA 1QQGA 1X11A 2I1KA 2Z0PA 3PEGA 3QWMA 4GZUA 2N0YA 1AWEA 5LONB 1RJ2A 1Y19B 3N7CA 3V5WA 4HAXB 2X18A 1NTVA 1W1GA 2KUPA 2H7EA 3KSYA 1V5UA 1TXDA 2PZ1A 5FI0A 2MDXA 2LKOA 3NSUA 3U7DA 5HE3A 1WI1A 3VIAA 2COCA 1P3RA 3WA0A 3HQCA 2COFA 1V88A 1DBHA 5FI1A 3DXDA 2NMBA 4EJNA 5C5BA 5JHGA 3ZDTA 4DX90 2XQNM 1U2BA 4BBKA 5DIFB 2FJLA 1AQCA 4HB2B 1RRPB 1XD4A 1ZC3B 2W2WA 4DBBA 5HE0A 2P0HA 4GMVA 1FB8A 2DHJA 4Z2MB 1FGYA 1DDWA 2J0MA 2DFKA 3HW2B 1M7RA 5JP4A 3KY9A 4YONA 1WGUA 4MK0A 2N23A 1Y5OA 3P7ZA 3TFMA 4H8SA 3DXCA 3A8PA 1UPQA 3ZVRA 1X05A 1FAOA 2Y7BA 1XCGA 4ZRJA 2UVMA 2DTCA 5JLJB 4A6KA 1J0WA 2R0DA 4TYZA 4NY0A 1FHWA 4F7UP 4L6EA 1LW3A 1SGHA 2RLOA 2Q13A 2ELBA 2K00A 4B6HA 1UPRA 2ELAA 2RVBB 1MK7B 2DYQA 4WVFB 2YS1A 1I2HA 5HE2A 2D10A 2D4QA 2ZPYA 1GC7A 3RCPA 2Z0OA 3A8QA 2YVCA 1OMWA 2I1JA 2D9VA 1BAKA 2CY5A 1E5WA 1WVHA 1XX0A 4HDOA 4ZRIA 5J3TA 4K17A 4HAYB 4MT7A 2ROVA 3MPXA 4YL8A 2K2UA 4DXAB 1FHXA 5CLLB 2UZRA 5DI9B 1UNPA 5J3YA 2DX1A 1MPHA 3SNHA 2P0DA 4WSFA 4F7GA 3ODOA 5CLQB 2CODA 1K5GB 1U27A 2CY4A 1EGXA 2RSGA 1KZ7A 5DHFB 4HB0B 1PFJA 3QIJA 1U5DA 2YS5A 1WJ1A 3BJIA 4GMXB 5KQ1A 2EMSA 3ULCA 4DX8A 4ZRKA 3FSSA 1XR0B 2DYNA 4KVGB 1ZVRA 2KCJA 2VSZA 4IFSA 4CYEA 5DH9B 2D11A 1MK9B 1MIZB 2LOXA 1X86A 4TKNA 2P8VA 4GPTB 1EF1A 2I5FA 4KHBB 2JP2A 3SV1A 5C5BB 1X1FA 3AU5A 2IFSA 3PG7A 5J3QA 1ISNA 4HAWB 2HTHB 2QKMA 1X1GA 2L1CA 1WG7A 3ODXA 3VOQA 1V5MA 2MWNB 3WYFB 5DHAB 2EJ8A 4GXBA 2D9ZA 4HDQA 1FHOA 1EAZA 3D8DA 1K5DB 3ULBA 3M1IB 1KZGA 2UZSA 1GC6A 2DN6A 1P5TA 4HHVA 2MKRA 1I7AA 3TW1A 2GJYA 2ADZA 4A5KA 3GYOA 2LOZA 2Y8GA 2QKLA 5LOPB 3HK0A 1U5GA 1M7EA 1UNRA 1U5FA 4IOYX 4K2OA 1GG3A 1SHCA 2W2XC 1DYNA 5D3YA 1ZC4B 2LYDA 5JHHA 1UEFA 3CIKA 5C6RA 2NZ8B 1N3HA 2D9WA 1J19A 4KAXB 1P6SA 2D2QA 3TO1A 3SYXA 4C0AA 3SO6A 2OTXA 3OANA 1NTYA 2LULA 2EC1A 2RUKB 3SUZA 2DA0A 3D8FA 2D9YA 4HB3B 2CAYA 2RNRB 3T06A 1Q67A 1BTNA 1H10A 3KRWA 2J0JA 2YRYA 3TCAA 3X23A 3LJUX 1BTKA 1FGZA 3D8EA 3FEHA 4XWXA 4PQ0A 1V5PA 2AEHA 2GCLA 4CHJA 1W1HA 3GYPA 3FM8C 3U8ZA 3UZTA 5D3WA 1H4RA 4P7IA 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  3A98 B;  2OQB A;  2K2J A;  1OY2 A;  1Z87 A;  1WJM A;  3PVL A;  3F5R A;  2Z0Q A;  4HAZ B;  1V89 A;  2DKP A;  2GCJ A;  5D3X A;  5D3V A;  2LG1 A;  2P0F A;  3ML4 A;  5EFX A;  2COA A;  2HE7 A;  1IRS A;  4Y94 A;  4WJ7 A;  1NI2 A;  5C79 A;  1EVH A;  1LB1 A;  1DRO A;  3G9W A;  4HAV B;  2I5C A;  2DKQ A;  1ZSQ A;  2E2X A;  4F7H A;  2MFQ A;  4PNK A;  2YT0 A;  4K2P A;  2DHI A;  5L81 A;  1XKE A;  4HAU B;  2BCJ A;  3F0W A;  2R09 A;  2GS0 A;  2M14 A;  3CXB B;  2VKI A;  4A6H A;  3QBV B;  5GOW B;  3PP2 A;  4Z2N A;  4K81 A;  2YSZ A;  2YS3 A;  4IAP A;  4EMO A;  4KHO A;  3BIN A;  3IVF A;  4D0N B;  4KHA A;  1XOD A;  1WGQ A;  3ODW A;  2G35 A;  2VRW B;  1PMS A;  3KZ1 A;  2RGN B;  2EMT A;  2J0K A;  2D9X A;  4HB4 B;  4NSW A;  2M38 A;  1ZM0 A;  3TVV A;  1PLS A;  2V76 A;  4GN1 A;  5KQ4 A;  2J59 M;  2H7D A;  2DHK A;  1B55 A;  1KI1 B;  1TJ6 A;  4EKU A;  3AU4 A;  1MIX A;  3PVU A;  4HAT B;  4A6F A;  1DDV A;  3AJ4 A;  2DX5 A;  1FOE A;  2DLW A;  1MKE A;  5HE1 A;  2CRF A;  3PZD A;  1BWN A;  3KRX A;  1V61 A;  1U29 A;  4A6F B;  2YF0 A;  1NU2 A;  2L2I A;  5KCV A;  1MAI A;  1UNQ A;  2AL6 A;  2W2X D;  1W1D A;  4MY6 A;  2Y8F A;  3PSC A;  1QC6 A;  3PVW A;  3O96 A;  5D27 A;  2KGX B;  4CHM A;  2ROZ B;  3P6A A;  3MDB C;  1TQZ A;  1OQN A;  5C16 A;  1U5E A;  2IYB A;  1DDM A;  1QQG A;  1X11 A;  2I1K A;  2Z0P A;  3PEG A;  3QWM A;  4GZU A;  2N0Y A;  1AWE A;  5LON B;  1RJ2 A;  1Y19 B;  3N7C A;  3V5W A;  4HAX B;  2X18 A;  1NTV A;  1W1G A;  2KUP A;  2H7E A;  3KSY A;  1V5U A;  1TXD A;  2PZ1 A;  5FI0 A;  2MDX A;  2LKO A;  3NSU A;  3U7D A;  5HE3 A;  1WI1 A;  3VIA A;  2COC A;  1P3R A;  3WA0 A;  3HQC A;  2COF A;  1V88 A;  1DBH A;  5FI1 A;  3DXD A;  2NMB A;  4EJN A;  5C5B A;  5JHG A;  3ZDT A;  4DX9 0;  2XQN M;  1U2B A;  4BBK A;  5DIF B;  2FJL A;  1AQC A;  4HB2 B;  1RRP B;  1XD4 A;  1ZC3 B;  2W2W A;  4DBB A;  5HE0 A;  2P0H A;  4GMV A;  1FB8 A;  2DHJ A;  4Z2M B;  1FGY A;  1DDW A;  2J0M A;  2DFK A;  3HW2 B;  1M7R A;  5JP4 A;  3KY9 A;  4YON A;  1WGU A;  4MK0 A;  2N23 A;  1Y5O A;  3P7Z A;  3TFM A;  4H8S A;  3DXC A;  3A8P A;  1UPQ A;  3ZVR A;  1X05 A;  1FAO A;  2Y7B A;  1XCG A;  4ZRJ A;  2UVM A;  2DTC A;  5JLJ B;  4A6K A;  1J0W A;  2R0D A;  4TYZ A;  4NY0 A;  1FHW A;  4F7U P;  4L6E A;  1LW3 A;  1SGH A;  2RLO A;  2Q13 A;  2ELB A;  2K00 A;  4B6H A;  1UPR A;  2ELA A;  2RVB B;  1MK7 B;  2DYQ A;  4WVF B;  2YS1 A;  1I2H A;  5HE2 A;  2D10 A;  2D4Q A;  2ZPY A;  1GC7 A;  3RCP A;  2Z0O A;  3A8Q A;  2YVC A;  1OMW A;  2I1J A;  2D9V A;  1BAK A;  2CY5 A;  1E5W A;  1WVH A;  1XX0 A;  4HDO A;  4ZRI A;  5J3T A;  4K17 A;  4HAY B;  4MT7 A;  2ROV A;  3MPX A;  4YL8 A;  2K2U A;  4DXA B;  1FHX A;  5CLL B;  2UZR A;  5DI9 B;  1UNP A;  5J3Y A;  2DX1 A;  1MPH A;  3SNH A;  2P0D A;  4WSF A;  4F7G A;  3ODO A;  5CLQ B;  2COD A;  1K5G B;  1U27 A;  2CY4 A;  1EGX A;  2RSG A;  1KZ7 A;  5DHF B;  4HB0 B;  1PFJ A;  3QIJ A;  1U5D A;  2YS5 A;  1WJ1 A;  3BJI A;  4GMX B;  5KQ1 A;  2EMS A;  3ULC A;  4DX8 A;  4ZRK A;  3FSS A;  1XR0 B;  2DYN A;  4KVG B;  1ZVR A;  2KCJ A;  2VSZ A;  4IFS A;  4CYE A;  5DH9 B;  2D11 A;  1MK9 B;  1MIZ B;  2LOX A;  1X86 A;  4TKN A;  2P8V A;  4GPT B;  1EF1 A;  2I5F A;  4KHB B;  2JP2 A;  3SV1 A;  5C5B B;  1X1F A;  3AU5 A;  2IFS A;  3PG7 A;  5J3Q A;  1ISN A;  4HAW B;  2HTH B;  2QKM A;  1X1G A;  2L1C A;  1WG7 A;  3ODX A;  3VOQ A;  1V5M A;  2MWN B;  3WYF B;  5DHA B;  2EJ8 A;  4GXB A;  2D9Z A;  4HDQ A;  1FHO A;  1EAZ A;  3D8D A;  1K5D B;  3ULB A;  3M1I B;  1KZG A;  2UZS A;  1GC6 A;  2DN6 A;  1P5T A;  4HHV A;  2MKR A;  1I7A A;  3TW1 A;  2GJY A;  2ADZ A;  4A5K A;  3GYO A;  2LOZ A;  2Y8G A;  2QKL A;  5LOP B;  3HK0 A;  1U5G A;  1M7E A;  1UNR A;  1U5F A;  4IOY X;  4K2O A;  1GG3 A;  1SHC A;  2W2X C;  1DYN A;  5D3Y A;  1ZC4 B;  2LYD A;  5JHH A;  1UEF A;  3CIK A;  5C6R A;  2NZ8 B;  1N3H A;  2D9W A;  1J19 A;  4KAX B;  1P6S A;  2D2Q A;  3TO1 A;  3SYX A;  4C0A A;  3SO6 A;  2OTX A;  3OAN A;  1NTY A;  2LUL A;  2EC1 A;  2RUK B;  3SUZ A;  2DA0 A;  3D8F A;  2D9Y A;  4HB3 B;  2CAY A;  2RNR B;  3T06 A;  1Q67 A;  1BTN A;  1H10 A;  3KRW A;  2J0J A;  2YRY A;  3TCA A;  3X23 A;  3LJU X;  1BTK A;  1FGZ A;  3D8E A;  3FEH A;  4XWX A;  4PQ0 A;  1V5P A;  2AEH A;  2GCL A;  4CHJ A;  1W1H A;  3GYP A;  3FM8 C;  3U8Z A;  3UZT A;  5D3W A;  1H4R A;  4P7I A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 3DXE A;  4GOU A;  3A98 B;  2OQB A;  2K2J A;  1OY2 A;  1Z87 A;  1WJM A;  3PVL A;  3F5R A;  2Z0Q A;  4HAZ B;  1V89 A;  2DKP A;  2GCJ A;  5D3X A;  5D3V A;  2LG1 A;  2P0F A;  3ML4 A;  5EFX A;  2COA A;  2HE7 A;  1IRS A;  4Y94 A;  4WJ7 A;  1NI2 A;  5C79 A;  1EVH A;  1LB1 A;  1DRO A;  3G9W A;  4HAV B;  2I5C A;  2DKQ A;  1ZSQ A;  2E2X A;  4F7H A;  2MFQ A;  4PNK A;  2YT0 A;  4K2P A;  3NWF A;  2DHI A;  5L81 A;  1XKE A;  4HAU B;  2BCJ A;  3F0W A;  2R09 A;  2GS0 A;  2M14 A;  3CXB B;  2VKI A;  4A6H A;  3QBV B;  3HIE A;  5GOW B;  3PP2 A;  4Z2N A;  4GNK B;  4K81 A;  2YSZ A;  2YS3 A;  4IAP A;  4EMO A;  4KHO A;  3BIN A;  3IVF A;  4D0N B;  4KHA A;  5LG4 B;  1XOD A;  1WGQ A;  3ODW A;  2RRF A;  2G35 A;  2KR0 A;  2VRW B;  1PMS A;  3KZ1 A;  2RGN B;  2EMT A;  2J0K A;  2D9X A;  4HB4 B;  4NSW A;  2M38 A;  4QJ3 B;  1ZM0 A;  3TVV A;  1PLS A;  2V76 A;  4GN1 A;  5KQ4 A;  2J59 M;  2H7D A;  2DHK A;  2KIE A;  1B55 A;  1KI1 B;  4QXA B;  1TJ6 A;  4EKU A;  3AU4 A;  1MIX A;  3PVU A;  4HAT B;  4A6F A;  1DDV A;  4CSQ A;  3AJ4 A;  2DX5 A;  1FOE A;  2DLW A;  1MKE A;  5HE1 A;  2CRF A;  3PZD A;  1BWN A;  3KRX A;  1V61 A;  1U29 A;  4A6F B;  2YF0 A;  1NU2 A;  2L2I A;  5KCV A;  1MAI A;  1UNQ A;  2AL6 A;  2W2X D;  1W1D A;  4MY6 A;  4D6W A;  2Y8F A;  3PSC A;  1QC6 A;  3PVW A;  3O96 A;  5D27 A;  2KGX B;  2NBV A;  4CHM A;  2ROZ B;  3P6A A;  3MDB C;  1TQZ A;  1OQN A;  5C16 A;  1U5E A;  2IYB A;  1DDM A;  1QQG A;  1X11 A;  2I1K A;  2Z0P A;  3PEG A;  3QWM A;  4GZU A;  2N0Y A;  1AWE A;  5LON B;  1RJ2 A;  1Y19 B;  3N7C A;  3V5W A;  4HAX B;  2X18 A;  1NTV A;  1W1G A;  2KUP A;  2H7E A;  3KSY A;  1V5U A;  1TXD A;  2PZ1 A;  5FI0 A;  2MDX A;  1MI1 A;  3A58 A;  2LKO A;  3NSU A;  3U7D A;  5HE3 A;  1WI1 A;  3VIA A;  2COC A;  3NWA A;  2K8E A;  1P3R A;  3WA0 A;  3HQC A;  2COF A;  1V88 A;  1DBH A;  4KHB A;  5FI1 A;  3DXD A;  2NMB A;  4EJN A;  5C5B A;  5JHG A;  3ZDT A;  4DX9 0;  2XQN M;  1U2B A;  4BBK A;  5DIF B;  2FJL A;  1AQC A;  4HB2 B;  1RRP B;  1XD4 A;  1ZC3 B;  4QJ4 B;  2W2W A;  4DBB A;  5HE0 A;  2P0H A;  4GMV A;  1FB8 A;  2DHJ A;  4Z2M B;  1FGY A;  1DDW A;  2J0M A;  3HSA A;  2DFK A;  3HW2 B;  1M7R A;  3B77 A;  3U12 A;  5JP4 A;  3KY9 A;  4YON A;  1WGU A;  4MK0 A;  2N23 A;  1Y5O A;  4QJ5 B;  3P7Z A;  3TFM A;  4H8S A;  3DXC A;  3A8P A;  1UPQ A;  3ZVR A;  1X05 A;  2ZKM X;  1FAO A;  2Y7B A;  1XCG A;  4ZRJ A;  2UVM A;  2DTC A;  5JLJ B;  4A6K A;  1J0W A;  2K49 A;  2R0D A;  4TYZ A;  4NY0 A;  1FHW A;  4F7U P;  4L6E A;  1LW3 A;  1SGH A;  2RLO A;  2Q13 A;  2ELB A;  2K00 A;  4B6H A;  1UPR A;  2ELA A;  2RVB B;  1MK7 B;  2DYQ A;  4WVF B;  2YS1 A;  4HSI A;  1I2H A;  5HE2 A;  2D10 A;  2D4Q A;  2ZPY A;  1GC7 A;  3RCP A;  2Z0O A;  3A8Q A;  4DIX A;  2YVC A;  1OMW A;  2I1J A;  2D9V A;  1BAK A;  2CY5 A;  1E5W A;  1WVH A;  1XX0 A;  4HDO A;  4ZRI A;  5J3T A;  4K17 A;  4L1R A;  4HAY B;  4MT7 A;  2ROV A;  3MPX A;  4YL8 A;  2K2U A;  4DXA B;  1FHX A;  2Z13 A;  2UZR A;  5CLL B;  5DI9 B;  1UNP A;  5J3Y A;  2DX1 A;  2R2Y A;  1MPH A;  2GUM A;  3SNH A;  2P0D A;  4WSF A;  4F7G A;  3ODO A;  5CLQ B;  2COD A;  2Z4D A;  1K5G B;  1U27 A;  2CY4 A;  1EGX A;  2RSG A;  1KZ7 A;  5DHF B;  4HB0 B;  1PFJ A;  3QIJ A;  1U5D A;  2YS5 A;  1WJ1 A;  3BJI A;  4GMX B;  5KQ1 A;  2EMS A;  3ULC A;  4DX8 A;  5M4Y B;  4ZRK A;  3FSS A;  1XR0 B;  2DYN A;  4KVG B;  1ZVR A;  2KCJ A;  2VSZ A;  4IFS A;  4CYE A;  5DH9 B;  2D11 A;  1MK9 B;  1MIZ B;  2LOX A;  1X86 A;  4TKN A;  2P8V A;  4GPT B;  5IRS A;  1EF1 A;  4OT1 A;  2I5F A;  4KHB B;  2JP2 A;  3SV1 A;  5C5B B;  1X1F A;  3AU5 A;  2IFS A;  3OHM B;  3PG7 A;  1ISN A;  5J3Q A;  4HAW B;  2HTH B;  2QKM A;  3NWD A;  2Z59 A;  1X1G A;  2L1C A;  3FVC A;  1WG7 A;  3ODX A;  3VOQ A;  1V5M A;  2MWN B;  3WYF B;  5DHA B;  5I2M A;  2EJ8 A;  1ZYI A;  4GXB A;  2D9Z A;  2YT2 A;  4HDQ A;  1FHO A;  1EAZ A;  3D8D A;  1K5D B;  2Z14 A;  3ULB A;  3M1I B;  1KZG A;  2UZS A;  1GC6 A;  1T77 A;  2DN6 A;  1P5T A;  2KUQ A;  4HHV A;  4OSN A;  2MKR A;  1I7A A;  3TW1 A;  2GJY A;  2ADZ A;  4A5K A;  3GYO A;  2LOZ A;  2Y8G A;  2QKL A;  5LOP B;  3HK0 A;  1U5G A;  3DCX A;  1M7E A;  1UNR A;  1U5F A;  4IOY X;  2FJU B;  1GG3 A;  4K2O A;  1SHC A;  2W2X C;  1DYN A;  5D3Y A;  1ZC4 B;  2LYD A;  5JHH A;  1UEF A;  3CIK A;  5C6R A;  2NZ8 B;  1N3H A;  2D9W A;  1J19 A;  4KAX B;  1P6S A;  2D2Q A;  3TO1 A;  3SYX A;  4C0A A;  3SO6 A;  3NW8 A;  2OTX A;  2KIG A;  3OAN A;  1NTY A;  2LUL A;  2EC1 A;  2RUK B;  3SUZ A;  2DA0 A;  3D8F A;  2D9Y A;  4HB3 B;  2CAY A;  2RNR B;  3T06 A;  1Q67 A;  1BTN A;  1H10 A;  3KRW A;  2J0J A;  2YRY A;  3TCA A;  3X23 A;  3LJU X;  1BTK A;  1FGZ A;  3D8E A;  3FEH A;  4XWX A;  4PQ0 A;  1V5P A;  2AEH A;  2GCL A;  4CHJ A;  1W1H A;  3GYP A;  3FM8 C;  3U8Z A;  3UZT A;  5D3W A;  1H4R A;  4P7I A;  5I2S A;  2YT1 A; 
#chains in the Genus database with same CATH homology
 3DXE A;  3A98 B;  2OQB A;  2K2J A;  1OY2 A;  1Z87 A;  1WJM A;  3PVL A;  3F5R A;  2Z0Q A;  4HAZ B;  1V89 A;  2DKP A;  2GCJ A;  5D3X A;  5D3V A;  2LG1 A;  2P0F A;  3ML4 A;  5EFX A;  2COA A;  2HE7 A;  1IRS A;  4Y94 A;  4WJ7 A;  1NI2 A;  5C79 A;  1EVH A;  1LB1 A;  1DRO A;  3G9W A;  4HAV B;  2I5C A;  2DKQ A;  1ZSQ A;  2E2X A;  4F7H A;  2MFQ A;  4PNK A;  2YT0 A;  4K2P A;  2DHI A;  5L81 A;  1XKE A;  4HAU B;  2BCJ A;  3F0W A;  2R09 A;  2GS0 A;  2M14 A;  3CXB B;  2VKI A;  4A6H A;  3QBV B;  5GOW B;  3PP2 A;  4Z2N A;  4K81 A;  2YSZ A;  2YS3 A;  4IAP A;  4EMO A;  4KHO A;  3BIN A;  3IVF A;  4D0N B;  4KHA A;  1XOD A;  1WGQ A;  3ODW A;  2G35 A;  2VRW B;  1PMS A;  3KZ1 A;  2RGN B;  2EMT A;  2J0K A;  2D9X A;  4HB4 B;  4NSW A;  2M38 A;  1ZM0 A;  3TVV A;  1PLS A;  2V76 A;  4GN1 A;  5KQ4 A;  2J59 M;  2H7D A;  2DHK A;  1B55 A;  1KI1 B;  1TJ6 A;  4EKU A;  3AU4 A;  1MIX A;  3PVU A;  4HAT B;  4A6F A;  1DDV A;  3AJ4 A;  2DX5 A;  1FOE A;  2DLW A;  1MKE A;  5HE1 A;  2CRF A;  3PZD A;  1BWN A;  3KRX A;  1V61 A;  1U29 A;  4A6F B;  2YF0 A;  1NU2 A;  2L2I A;  5KCV A;  1MAI A;  1UNQ A;  2AL6 A;  2W2X D;  1W1D A;  4MY6 A;  2Y8F A;  3PSC A;  1QC6 A;  3PVW A;  3O96 A;  5D27 A;  2KGX B;  4CHM A;  2ROZ B;  3P6A A;  3MDB C;  1TQZ A;  1OQN A;  5C16 A;  1U5E A;  2IYB A;  1DDM A;  1QQG A;  1X11 A;  2I1K A;  2Z0P A;  3PEG A;  3QWM A;  4GZU A;  2N0Y A;  1AWE A;  5LON B;  1RJ2 A;  1Y19 B;  3N7C A;  3V5W A;  4HAX B;  2X18 A;  1NTV A;  1W1G A;  2KUP A;  2H7E A;  3KSY A;  1V5U A;  1TXD A;  2PZ1 A;  5FI0 A;  2MDX A;  2LKO A;  3NSU A;  3U7D A;  5HE3 A;  1WI1 A;  3VIA A;  2COC A;  1P3R A;  3WA0 A;  3HQC A;  2COF A;  1V88 A;  1DBH A;  5FI1 A;  3DXD A;  2NMB A;  4EJN A;  5C5B A;  5JHG A;  3ZDT A;  4DX9 0;  2XQN M;  1U2B A;  4BBK A;  5DIF B;  2FJL A;  1AQC A;  4HB2 B;  1RRP B;  1XD4 A;  1ZC3 B;  2W2W A;  4DBB A;  5HE0 A;  2P0H A;  4GMV A;  1FB8 A;  2DHJ A;  4Z2M B;  1FGY A;  1DDW A;  2J0M A;  2DFK A;  3HW2 B;  1M7R A;  5JP4 A;  3KY9 A;  4YON A;  1WGU A;  4MK0 A;  2N23 A;  1Y5O A;  3P7Z A;  3TFM A;  4H8S A;  3DXC A;  3A8P A;  1UPQ A;  3ZVR A;  1X05 A;  1FAO A;  2Y7B A;  1XCG A;  4ZRJ A;  2UVM A;  2DTC A;  5JLJ B;  4A6K A;  1J0W A;  2R0D A;  4TYZ A;  4NY0 A;  1FHW A;  4F7U P;  4L6E A;  1LW3 A;  1SGH A;  2RLO A;  2Q13 A;  2ELB A;  2K00 A;  4B6H A;  1UPR A;  2ELA A;  2RVB B;  1MK7 B;  2DYQ A;  4WVF B;  2YS1 A;  1I2H A;  5HE2 A;  2D10 A;  2D4Q A;  2ZPY A;  1GC7 A;  3RCP A;  2Z0O A;  3A8Q A;  2YVC A;  1OMW A;  2I1J A;  2D9V A;  1BAK A;  2CY5 A;  1E5W A;  1WVH A;  1XX0 A;  4HDO A;  4ZRI A;  5J3T A;  4K17 A;  4HAY B;  4MT7 A;  2ROV A;  3MPX A;  4YL8 A;  2K2U A;  4DXA B;  1FHX A;  5CLL B;  2UZR A;  5DI9 B;  1UNP A;  5J3Y A;  2DX1 A;  1MPH A;  3SNH A;  2P0D A;  4WSF A;  4F7G A;  3ODO A;  5CLQ B;  2COD A;  1K5G B;  1U27 A;  2CY4 A;  1EGX A;  2RSG A;  1KZ7 A;  5DHF B;  4HB0 B;  1PFJ A;  3QIJ A;  1U5D A;  2YS5 A;  1WJ1 A;  3BJI A;  4GMX B;  5KQ1 A;  2EMS A;  3ULC A;  4DX8 A;  4ZRK A;  3FSS A;  1XR0 B;  2DYN A;  4KVG B;  1ZVR A;  2KCJ A;  2VSZ A;  4IFS A;  4CYE A;  5DH9 B;  2D11 A;  1MK9 B;  1MIZ B;  2LOX A;  1X86 A;  4TKN A;  2P8V A;  4GPT B;  1EF1 A;  2I5F A;  4KHB B;  2JP2 A;  3SV1 A;  5C5B B;  1X1F A;  3AU5 A;  2IFS A;  3PG7 A;  5J3Q A;  1ISN A;  4HAW B;  2HTH B;  2QKM A;  1X1G A;  2L1C A;  1WG7 A;  3ODX A;  3VOQ A;  1V5M A;  2MWN B;  3WYF B;  5DHA B;  2EJ8 A;  4GXB A;  2D9Z A;  4HDQ A;  1FHO A;  1EAZ A;  3D8D A;  1K5D B;  3ULB A;  3M1I B;  1KZG A;  2UZS A;  1GC6 A;  2DN6 A;  1P5T A;  4HHV A;  2MKR A;  1I7A A;  3TW1 A;  2GJY A;  2ADZ A;  4A5K A;  3GYO A;  2LOZ A;  2Y8G A;  2QKL A;  5LOP B;  3HK0 A;  1U5G A;  1M7E A;  1UNR A;  1U5F A;  4IOY X;  4K2O A;  1GG3 A;  1SHC A;  2W2X C;  1DYN A;  5D3Y A;  1ZC4 B;  2LYD A;  5JHH A;  1UEF A;  3CIK A;  5C6R A;  2NZ8 B;  1N3H A;  2D9W A;  1J19 A;  4KAX B;  1P6S A;  2D2Q A;  3TO1 A;  3SYX A;  4C0A A;  3SO6 A;  2OTX A;  3OAN A;  1NTY A;  2LUL A;  2EC1 A;  2RUK B;  3SUZ A;  2DA0 A;  3D8F A;  2D9Y A;  4HB3 B;  2CAY A;  2RNR B;  3T06 A;  1Q67 A;  1BTN A;  1H10 A;  3KRW A;  2J0J A;  2YRY A;  3TCA A;  3X23 A;  3LJU X;  1BTK A;  1FGZ A;  3D8E A;  3FEH A;  4XWX A;  4PQ0 A;  1V5P A;  2AEH A;  2GCL A;  4CHJ A;  1W1H A;  3GYP A;  3FM8 C;  3U8Z A;  3UZT A;  5D3W A;  1H4R A;  4P7I A;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...