1N3HA

Coupling of folding and binding in the ptb domain of the signaling protein shc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
207
structure length
207
Chain Sequence
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SHC Transforming protein
publication title Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2002-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1n3hA00
2N0YA 4ZRJA 2W2XD 1ZVRA 4C0AA 5DH9B 1LW3A 5L81A 2YS5A 1BTKA 5D3XA 1BTNA 5D3WA 2DKQA 5DI9B 3KRWA 3PSCA 1TJ6A 3QBVB 4IFSA 2COAA 4NSWA 1TXDA 5DHAB 2DHIA 1U5FA 3HQCA 1NU2A 1NI2A 1P6SA 1EVHA 2UVMA 3TW1A 2HE7A 4HAZB 1V5MA 3MDBC 1I2HA 2AL6A 2EC1A 2XQNM 5J3QA 2DLWA 5C79A 1FGZA 2ROVA 2GJYA 1OMWA 1U2BA 2DKPA 4HAUB 1M7EA 4NY0A 4KHOA 1PMSA 5HE2A 4KHBB 1V61A 2ZPYA 4D0NB 1V88A 1KZ7A 1MPHA 1U27A 1WVHA 5FI0A 4GN1A 1K5DB 2P8VA 1Q67A 2DTCA 2DYNA 1XKEA 3SUZA 4K81A 1DDWA 1EF1A 3DXDA 1X11A 1N3HA 3D8DA 3V5WA 3A98B 5C6RA 1MK7B 1WG7A 4KVGB 5DHFB 3DXEA 2QKMA 4A6KA 5JHHA 1MAIA 3AJ4A 2GS0A 2L2IA 4XWXA 3HW2B 1WGUA 1ZC3B 3FEHA 2D9XA 1ISNA 2LKOA 1UEFA 2I1JA 2DX1A 2COFA 5JLJB 1MIZB 3AU5A 4YONA 4KHAA 1W1GA 2Z0PA 2H7DA 3UZTA 3NSUA 2DHKA 1XCGA 2QKLA 4HHVA 1V5UA 2M14A 1W1HA 2RVBB 2Z0QA 2DA0A 2CY5A 4Z2NA 2Q13A 2D9WA 1MKEA 4Y94A 2EMTA 1J19A 1RRPB 3U7DA 2DYQA 2I5CA 1J0WA 3TO1A 2DFKA 3ML4A 1FB8A 4A6HA 4WSFA 1FGYA 1GG3A 1DDMA 1X86A 3T06A 4MY6A 3PVUA 2Y8GA 2VKIA 3TVVA 1WJMA 2GCLA 2LOXA 3DXCA 3PZDA 3GYPA 5C16A 2RUKB 3ULCA 4K17A 1NTYA 2D9VA 5CLQB 1ZM0A 1KZGA 4HAXB 2P0DA 2D9YA 1FHOA 2J0MA 2YT1A 2EMSA 3O96A 4HB4B 3U8ZA 2I5FA 2YT0A 1IRSA 1V89A 2COCA 1U5DA 1UNPA 3WYFB 3ODWA 3LJUX 5J3TA 2J59M 4ZRIA 2UZSA 5HE0A 2Z0OA 3PG7A 1U5GA 4K2PA 3SNHA 3MPXA 5D3VA 2K00A 3PP2A 1KI1B 1Y19B 2RGNB 2ELBA 2LOZA 1UNRA 1UPRA 4ZRKA 5DIFB 4A5KA 1SHCA 1NTVA 4HAWB 1M7RA 3ZDTA 1AQCA 2HTHB 2MWNB 3WA0A 3D8EA 3VOQA 1FOEA 3PEGA 2G35A 2P0FA 4HB0B 1WGQA 4A6FB 3F0WA 1XR0B 2J0JA 4TKNA 4L6EA 2V76A 2R0DA 2ADZA 2KCJA 3VIAA 4GPTB 3N7CA 1WI1A 1X05A 2RLOA 3HK0A 3PVWA 5J3YA 4DX8A 2CRFA 1GC7A 4HDQA 3P6AA 4HDOA 2L1CA 5LONB 4P7IA 3CXBB 1BWNA 4F7UP 4EKUA 2VSZA 1WJ1A 2AEHA 2FJLA 4F7HA 2EJ8A 4CYEA 3KY9A 5D3YA 3D8FA 2I1KA 1DDVA 2Y7BA 4K2OA 4GZUA 1QQGA 4HAYB 4WVFB 4BBKA 2YSZA 2N23A 3GYOA 1ZSQA 5KCVA 2H7EA 3RCPA 3PVLA 3ODXA 2VRWB 1BAKA 4GMXB 1Y5OA 5D27A 1MIXA 3A8QA 3A8PA 3ULBA 3SYXA 4B6HA 2CAYA 2YS3A 3KZ1A 3AU4A 3IVFA 1DYNA 5HE1A 1FAOA 2ROZB 4PNKA 1P3RA 4GMVA 4HATB 4DXAB 4H8SA 4F7GA 3M1IB 2OQBA 2PZ1A 4IAPA 1GC6A 2GCJA 4HB3B 1AWEA 2D11A 4EJNA 1PLSA 2CODA 2KUPA 2ELAA 3OANA 1TQZA 3TFMA 5JHGA 2IFSA 1OQNA 1OY2A 2LYDA 2JP2A 5KQ4A 3ODOA 4IOYX 3X23A 2MDXA 2D9ZA 2M38A 3ZVRA 4GXBA 2IYBA 2DN6A 1ZC4B 4DX90 1QC6A 1SGHA 1RJ2A 2MFQA 4MK0A 4YL8A 4DBBA 1FHWA 2NMBA 4WJ7A 1UNQA 5EFXA 2NZ8B 2J0KA 1V5PA 1XX0A 3QWMA 2DHJA 5CLLB 4HAVB 5C5BB 2OTXA 3P7ZA 1DBHA 1EAZA 1U29A 4KAXB 1K5GB 3SV1A 1I7AA 2D10A 1Z87A 2RSGA 3SO6A 2W2XC 2BCJA 1XD4A 3CIKA 2D4QA 1DROA 4Z2MB 5HE3A 2RNRB 3G9WA 5JP4A 1H10A 4A6FA 2K2UA 1X1GA 3TCAA 2CY4A 2Y8FA 5C5BA 1H4RA 2YS1A 4HB2B 1P5TA 2D2QA 1PFJA 1E5WA 3F5RA 2YRYA 2YF0A 4MT7A 4PQ0A 2W2WA 2DX5A 5KQ1A 1EGXA 1UPQA 3KRXA 1LB1A 3BJIA 2P0HA 5LOPB 3FM8C 1MK9B 2YVCA 5GOWB 3BINA 1B55A 2UZRA 3KSYA 2K2JA 2E2XA 4CHMA 2X18A 1XODA 2LG1A 1FHXA 1X1FA 2R09A 3QIJA 2KGXB 5FI1A 2MKRA 4EMOA 2LULA 3FSSA 1U5EA 1W1DA 4TYZA 4CHJA
chains in the Genus database with same CATH superfamily
2N0YA 4ZRJA 2W2XD 1ZVRA 4C0AA 5DH9B 1LW3A 5L81A 2KIGA 2YS5A 1BTKA 5D3XA 1BTNA 5D3WA 2DKQA 2Z13A 5DI9B 3KRWA 3PSCA 1TJ6A 3QBVB 4IFSA 2COAA 4NSWA 1TXDA 5DHAB 2DHIA 1U5FA 3HQCA 1NU2A 1NI2A 1P6SA 1EVHA 2UVMA 3TW1A 2HE7A 4HAZB 2Z4DA 1V5MA 1I2HA 3MDBC 2AL6A 2EC1A 2XQNM 5J3QA 2DLWA 5C79A 1FGZA 2ROVA 2GJYA 1T77A 1OMWA 1U2BA 2DKPA 4HAUB 1M7EA 4NY0A 4KHOA 1PMSA 4HSIA 5HE2A 4KHBB 1V61A 2ZPYA 4D0NB 1V88A 1KZ7A 1MPHA 1U27A 1WVHA 5FI0A 4GN1A 1K5DB 2P8VA 1Q67A 2DTCA 2DYNA 1XKEA 3SUZA 4K81A 1DDWA 1EF1A 3DXDA 1X11A 1N3HA 3D8DA 3V5WA 3A98B 5C6RA 4KHBA 1MK7B 1WG7A 3DCXA 4KVGB 5DHFB 3DXEA 2QKMA 2KUQA 2NBVA 4A6KA 5JHHA 1MAIA 3AJ4A 2GS0A 2L2IA 4XWXA 3HW2B 1WGUA 1ZC3B 3FEHA 2D9XA 1ISNA 2LKOA 1UEFA 2I1JA 2DX1A 2COFA 5JLJB 1MIZB 3AU5A 4YONA 2ZKMX 4KHAA 1W1GA 2Z0PA 2H7DA 3UZTA 3NSUA 3A58A 2DHKA 1XCGA 2QKLA 4HHVA 1V5UA 2M14A 1W1HA 2RVBB 2Z0QA 2DA0A 2CY5A 4Z2NA 2Q13A 2D9WA 1MKEA 4Y94A 4GOUA 5I2SA 2EMTA 1J19A 1RRPB 3U7DA 2DYQA 2I5CA 1J0WA 3TO1A 2DFKA 3ML4A 1FB8A 4A6HA 3HSAA 2GUMA 4WSFA 1FGYA 1GG3A 1DDMA 1X86A 3T06A 2R2YA 4MY6A 3PVUA 4GNKB 2Y8GA 2VKIA 3TVVA 2KIEA 1WJMA 2GCLA 2LOXA 3DXCA 3PZDA 3GYPA 5C16A 2RUKB 3ULCA 4K17A 1NTYA 2D9VA 5CLQB 1ZM0A 1KZGA 4HAXB 2P0DA 2D9YA 1FHOA 2J0MA 2YT1A 2EMSA 3O96A 4HB4B 3HIEA 2I5FA 2YT0A 3U8ZA 1IRSA 1V89A 2COCA 1U5DA 1UNPA 3WYFB 3ODWA 3LJUX 5J3TA 2J59M 4ZRIA 3NW8A 2UZSA 5HE0A 2Z0OA 3PG7A 1U5GA 4K2PA 3SNHA 3OHMB 3MPXA 5D3VA 2Z14A 2K00A 3PP2A 1KI1B 1Y19B 2RGNB 2ELBA 2LOZA 1UNRA 1UPRA 4ZRKA 5DIFB 4A5KA 1SHCA 1NTVA 4HAWB 1M7RA 3NWFA 3ZDTA 1AQCA 2HTHB 2MWNB 3WA0A 3D8EA 3VOQA 1FOEA 3PEGA 2G35A 2P0FA 4HB0B 1WGQA 4A6FB 3F0WA 1XR0B 2J0JA 4TKNA 4L6EA 4QJ3B 2YT2A 2V76A 2R0DA 2ADZA 2KCJA 3VIAA 4GPTB 3N7CA 1WI1A 1X05A 2RLOA 3HK0A 3PVWA 5J3YA 4OT1A 4DX8A 2CRFA 1GC7A 4HDQA 3P6AA 4HDOA 2L1CA 5LONB 4P7IA 3CXBB 3FVCA 1BWNA 4F7UP 4EKUA 2VSZA 1WJ1A 2AEHA 2FJLA 4F7HA 3U12A 2EJ8A 4CYEA 3KY9A 2Z59A 5D3YA 3D8FA 2I1KA 1DDVA 2Y7BA 4K2OA 4GZUA 1QQGA 4HAYB 4WVFB 4BBKA 2YSZA 2N23A 3GYOA 1ZSQA 5KCVA 2H7EA 4DIXA 3RCPA 3PVLA 3ODXA 2VRWB 1BAKA 4OSNA 4GMXB 1Y5OA 5D27A 1MIXA 3A8QA 3A8PA 3ULBA 3SYXA 4B6HA 2CAYA 2FJUB 2YS3A 3KZ1A 3AU4A 3IVFA 1DYNA 5HE1A 1FAOA 2ROZB 4PNKA 1P3RA 4GMVA 4HATB 4DXAB 4H8SA 4CSQA 4F7GA 3M1IB 2OQBA 2PZ1A 4IAPA 1GC6A 2GCJA 4QJ5B 4HB3B 1AWEA 2D11A 4L1RA 4EJNA 1PLSA 2CODA 2KUPA 2ELAA 3OANA 1TQZA 3TFMA 5JHGA 2IFSA 1OQNA 5LG4B 4QJ4B 5I2MA 1OY2A 2LYDA 2JP2A 5KQ4A 3ODOA 4IOYX 3X23A 2MDXA 2D9ZA 2M38A 3ZVRA 4GXBA 2IYBA 2DN6A 1ZC4B 4DX90 3NWDA 2KR0A 1QC6A 1SGHA 1RJ2A 2MFQA 4MK0A 4YL8A 4DBBA 1FHWA 2NMBA 4WJ7A 1UNQA 5EFXA 2NZ8B 2J0KA 1V5PA 1XX0A 3QWMA 3NWAA 2DHJA 5CLLB 2K49A 4HAVB 1ZYIA 5C5BB 2OTXA 3P7ZA 1DBHA 1EAZA 1U29A 4KAXB 1K5GB 2K8EA 3SV1A 1I7AA 2D10A 1Z87A 2RSGA 3SO6A 2W2XC 2BCJA 1XD4A 3CIKA 2D4QA 1DROA 4Z2MB 5HE3A 5M4YB 2RNRB 3G9WA 5JP4A 5IRSA 1H10A 4A6FA 2K2UA 1X1GA 3TCAA 2CY4A 2Y8FA 5C5BA 1MI1A 1H4RA 2YS1A 4HB2B 1P5TA 2D2QA 2RRFA 1PFJA 1E5WA 3F5RA 2YRYA 4D6WA 2YF0A 4MT7A 4PQ0A 4QXAB 2W2WA 2DX5A 5KQ1A 1EGXA 1UPQA 3KRXA 1LB1A 3BJIA 2P0HA 3B77A 5LOPB 3FM8C 1MK9B 2YVCA 5GOWB 3BINA 1B55A 2UZRA 3KSYA 2K2JA 2E2XA 4CHMA 2X18A 1XODA 2LG1A 1FHXA 1X1FA 2R09A 3QIJA 2KGXB 5FI1A 2MKRA 4EMOA 2LULA 3FSSA 1U5EA 1W1DA 4TYZA 4CHJA
chains in the Genus database with same CATH topology
2N0YA 4ZRJA 2W2XD 1ZVRA 4C0AA 5DH9B 1LW3A 5L81A 2YS5A 1BTKA 5D3XA 1BTNA 5D3WA 2DKQA 5DI9B 3KRWA 3PSCA 1TJ6A 3QBVB 4IFSA 2COAA 4NSWA 1TXDA 5DHAB 2DHIA 1U5FA 3HQCA 1NU2A 1NI2A 1P6SA 1EVHA 2UVMA 3TW1A 2HE7A 4HAZB 1V5MA 3MDBC 1I2HA 2AL6A 2EC1A 2XQNM 5J3QA 2DLWA 5C79A 1FGZA 2ROVA 2GJYA 1OMWA 1U2BA 2DKPA 4HAUB 1M7EA 4NY0A 4KHOA 1PMSA 5HE2A 4KHBB 1V61A 2ZPYA 4D0NB 1V88A 1KZ7A 1MPHA 1U27A 1WVHA 5FI0A 4GN1A 1K5DB 2P8VA 1Q67A 2DTCA 2DYNA 1XKEA 3SUZA 4K81A 1DDWA 1EF1A 3DXDA 1X11A 1N3HA 3D8DA 3V5WA 3A98B 5C6RA 1MK7B 1WG7A 4KVGB 5DHFB 3DXEA 2QKMA 4A6KA 5JHHA 1MAIA 3AJ4A 2GS0A 2L2IA 4XWXA 3HW2B 1WGUA 1ZC3B 3FEHA 2D9XA 1ISNA 2LKOA 1UEFA 2I1JA 2DX1A 2COFA 5JLJB 1MIZB 3AU5A 4YONA 4KHAA 1W1GA 2Z0PA 2H7DA 3UZTA 3NSUA 2DHKA 1XCGA 2QKLA 4HHVA 1V5UA 2M14A 1W1HA 2RVBB 2Z0QA 2DA0A 2CY5A 4Z2NA 2Q13A 2D9WA 1MKEA 4Y94A 2EMTA 1J19A 1RRPB 3U7DA 2DYQA 2I5CA 1J0WA 3TO1A 2DFKA 3ML4A 1FB8A 4A6HA 4WSFA 1FGYA 1GG3A 1DDMA 1X86A 3T06A 4MY6A 3PVUA 2Y8GA 2VKIA 3TVVA 1WJMA 2GCLA 2LOXA 3DXCA 3PZDA 3GYPA 5C16A 2RUKB 3ULCA 4K17A 1NTYA 2D9VA 5CLQB 1ZM0A 1KZGA 4HAXB 2P0DA 2D9YA 1FHOA 2J0MA 2YT1A 2EMSA 3O96A 4HB4B 3U8ZA 2I5FA 2YT0A 1IRSA 1V89A 2COCA 1U5DA 1UNPA 3WYFB 3ODWA 3LJUX 5J3TA 2J59M 4ZRIA 2UZSA 5HE0A 2Z0OA 3PG7A 1U5GA 4K2PA 3SNHA 3MPXA 5D3VA 2K00A 3PP2A 1KI1B 1Y19B 2RGNB 2ELBA 2LOZA 1UNRA 1UPRA 4ZRKA 5DIFB 4A5KA 1SHCA 1NTVA 4HAWB 1M7RA 3ZDTA 1AQCA 2HTHB 2MWNB 3WA0A 3D8EA 3VOQA 1FOEA 3PEGA 2G35A 2P0FA 4HB0B 1WGQA 4A6FB 3F0WA 1XR0B 2J0JA 4TKNA 4L6EA 2V76A 2R0DA 2ADZA 2KCJA 3VIAA 4GPTB 3N7CA 1WI1A 1X05A 2RLOA 3HK0A 3PVWA 5J3YA 4DX8A 2CRFA 1GC7A 4HDQA 3P6AA 4HDOA 2L1CA 5LONB 4P7IA 3CXBB 1BWNA 4F7UP 4EKUA 2VSZA 1WJ1A 2AEHA 2FJLA 4F7HA 2EJ8A 4CYEA 3KY9A 5D3YA 3D8FA 2I1KA 1DDVA 2Y7BA 4K2OA 4GZUA 1QQGA 4HAYB 4WVFB 4BBKA 2YSZA 2N23A 3GYOA 1ZSQA 5KCVA 2H7EA 3RCPA 3PVLA 3ODXA 2VRWB 1BAKA 4GMXB 1Y5OA 5D27A 1MIXA 3A8QA 3A8PA 3ULBA 3SYXA 4B6HA 2CAYA 2YS3A 3KZ1A 3AU4A 3IVFA 1DYNA 5HE1A 1FAOA 2ROZB 4PNKA 1P3RA 4GMVA 4HATB 4DXAB 4H8SA 4F7GA 3M1IB 2OQBA 2PZ1A 4IAPA 1GC6A 2GCJA 4HB3B 1AWEA 2D11A 4EJNA 1PLSA 2CODA 2KUPA 2ELAA 3OANA 1TQZA 3TFMA 5JHGA 2IFSA 1OQNA 1OY2A 2LYDA 2JP2A 5KQ4A 3ODOA 4IOYX 3X23A 2MDXA 2D9ZA 2M38A 3ZVRA 4GXBA 2IYBA 2DN6A 1ZC4B 4DX90 1QC6A 1SGHA 1RJ2A 2MFQA 4MK0A 4YL8A 4DBBA 1FHWA 2NMBA 4WJ7A 1UNQA 5EFXA 2NZ8B 2J0KA 1V5PA 1XX0A 3QWMA 2DHJA 5CLLB 4HAVB 5C5BB 2OTXA 3P7ZA 1DBHA 1EAZA 1U29A 4KAXB 1K5GB 3SV1A 1I7AA 2D10A 1Z87A 2RSGA 3SO6A 2W2XC 2BCJA 1XD4A 3CIKA 2D4QA 1DROA 4Z2MB 5HE3A 2RNRB 3G9WA 5JP4A 1H10A 4A6FA 2K2UA 1X1GA 3TCAA 2CY4A 2Y8FA 5C5BA 1H4RA 2YS1A 4HB2B 1P5TA 2D2QA 1PFJA 1E5WA 3F5RA 2YRYA 2YF0A 4MT7A 4PQ0A 2W2WA 2DX5A 5KQ1A 1EGXA 1UPQA 3KRXA 1LB1A 3BJIA 2P0HA 5LOPB 3FM8C 1MK9B 2YVCA 5GOWB 3BINA 1B55A 2UZRA 3KSYA 2K2JA 2E2XA 4CHMA 2X18A 1XODA 2LG1A 1FHXA 1X1FA 2R09A 3QIJA 2KGXB 5FI1A 2MKRA 4EMOA 2LULA 3FSSA 1U5EA 1W1DA 4TYZA 4CHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N0Y A;  4ZRJ A;  2W2X D;  1ZVR A;  4C0A A;  5DH9 B;  1LW3 A;  5L81 A;  2YS5 A;  1BTK A;  5D3X A;  1BTN A;  5D3W A;  2DKQ A;  5DI9 B;  3KRW A;  3PSC A;  1TJ6 A;  3QBV B;  4IFS A;  2COA A;  4NSW A;  1TXD A;  5DHA B;  2DHI A;  1U5F A;  3HQC A;  1NU2 A;  1NI2 A;  1P6S A;  1EVH A;  2UVM A;  3TW1 A;  2HE7 A;  4HAZ B;  1V5M A;  3MDB C;  1I2H A;  2AL6 A;  2EC1 A;  2XQN M;  5J3Q A;  2DLW A;  5C79 A;  1FGZ A;  2ROV A;  2GJY A;  1OMW A;  1U2B A;  2DKP A;  4HAU B;  1M7E A;  4NY0 A;  4KHO A;  1PMS A;  5HE2 A;  4KHB B;  1V61 A;  2ZPY A;  4D0N B;  1V88 A;  1KZ7 A;  1MPH A;  1U27 A;  1WVH A;  5FI0 A;  4GN1 A;  1K5D B;  2P8V A;  1Q67 A;  2DTC A;  2DYN A;  1XKE A;  3SUZ A;  4K81 A;  1DDW A;  1EF1 A;  3DXD A;  1X11 A;  1N3H A;  3D8D A;  3V5W A;  3A98 B;  5C6R A;  1MK7 B;  1WG7 A;  4KVG B;  5DHF B;  3DXE A;  2QKM A;  4A6K A;  5JHH A;  1MAI A;  3AJ4 A;  2GS0 A;  2L2I A;  4XWX A;  3HW2 B;  1WGU A;  1ZC3 B;  3FEH A;  2D9X A;  1ISN A;  2LKO A;  1UEF A;  2I1J A;  2DX1 A;  2COF A;  5JLJ B;  1MIZ B;  3AU5 A;  4YON A;  4KHA A;  1W1G A;  2Z0P A;  2H7D A;  3UZT A;  3NSU A;  2DHK A;  1XCG A;  2QKL A;  4HHV A;  1V5U A;  2M14 A;  1W1H A;  2RVB B;  2Z0Q A;  2DA0 A;  2CY5 A;  4Z2N A;  2Q13 A;  2D9W A;  1MKE A;  4Y94 A;  2EMT A;  1J19 A;  1RRP B;  3U7D A;  2DYQ A;  2I5C A;  1J0W A;  3TO1 A;  2DFK A;  3ML4 A;  1FB8 A;  4A6H A;  4WSF A;  1FGY A;  1GG3 A;  1DDM A;  1X86 A;  3T06 A;  4MY6 A;  3PVU A;  2Y8G A;  2VKI A;  3TVV A;  1WJM A;  2GCL A;  2LOX A;  3DXC A;  3PZD A;  3GYP A;  5C16 A;  2RUK B;  3ULC A;  4K17 A;  1NTY A;  2D9V A;  5CLQ B;  1ZM0 A;  1KZG A;  4HAX B;  2P0D A;  2D9Y A;  1FHO A;  2J0M A;  2YT1 A;  2EMS A;  3O96 A;  4HB4 B;  3U8Z A;  2I5F A;  2YT0 A;  1IRS A;  1V89 A;  2COC A;  1U5D A;  1UNP A;  3WYF B;  3ODW A;  3LJU X;  5J3T A;  2J59 M;  4ZRI A;  2UZS A;  5HE0 A;  2Z0O A;  3PG7 A;  1U5G A;  4K2P A;  3SNH A;  3MPX A;  5D3V A;  2K00 A;  3PP2 A;  1KI1 B;  1Y19 B;  2RGN B;  2ELB A;  2LOZ A;  1UNR A;  1UPR A;  4ZRK A;  5DIF B;  4A5K A;  1SHC A;  1NTV A;  4HAW B;  1M7R A;  3ZDT A;  1AQC A;  2HTH B;  2MWN B;  3WA0 A;  3D8E A;  3VOQ A;  1FOE A;  3PEG A;  2G35 A;  2P0F A;  4HB0 B;  1WGQ A;  4A6F B;  3F0W A;  1XR0 B;  2J0J A;  4TKN A;  4L6E A;  2V76 A;  2R0D A;  2ADZ A;  2KCJ A;  3VIA A;  4GPT B;  3N7C A;  1WI1 A;  1X05 A;  2RLO A;  3HK0 A;  3PVW A;  5J3Y A;  4DX8 A;  2CRF A;  1GC7 A;  4HDQ A;  3P6A A;  4HDO A;  2L1C A;  5LON B;  4P7I A;  3CXB B;  1BWN A;  4F7U P;  4EKU A;  2VSZ A;  1WJ1 A;  2AEH A;  2FJL A;  4F7H A;  2EJ8 A;  4CYE A;  3KY9 A;  5D3Y A;  3D8F A;  2I1K A;  1DDV A;  2Y7B A;  4K2O A;  4GZU A;  1QQG A;  4HAY B;  4WVF B;  4BBK A;  2YSZ A;  2N23 A;  3GYO A;  1ZSQ A;  5KCV A;  2H7E A;  3RCP A;  3PVL A;  3ODX A;  2VRW B;  1BAK A;  4GMX B;  1Y5O A;  5D27 A;  1MIX A;  3A8Q A;  3A8P A;  3ULB A;  3SYX A;  4B6H A;  2CAY A;  2YS3 A;  3KZ1 A;  3AU4 A;  3IVF A;  1DYN A;  5HE1 A;  1FAO A;  2ROZ B;  4PNK A;  1P3R A;  4GMV A;  4HAT B;  4DXA B;  4H8S A;  4F7G A;  3M1I B;  2OQB A;  2PZ1 A;  4IAP A;  1GC6 A;  2GCJ A;  4HB3 B;  1AWE A;  2D11 A;  4EJN A;  1PLS A;  2COD A;  2KUP A;  2ELA A;  3OAN A;  1TQZ A;  3TFM A;  5JHG A;  2IFS A;  1OQN A;  1OY2 A;  2LYD A;  2JP2 A;  5KQ4 A;  3ODO A;  4IOY X;  3X23 A;  2MDX A;  2D9Z A;  2M38 A;  3ZVR A;  4GXB A;  2IYB A;  2DN6 A;  1ZC4 B;  4DX9 0;  1QC6 A;  1SGH A;  1RJ2 A;  2MFQ A;  4MK0 A;  4YL8 A;  4DBB A;  1FHW A;  2NMB A;  4WJ7 A;  1UNQ A;  5EFX A;  2NZ8 B;  2J0K A;  1V5P A;  1XX0 A;  3QWM A;  2DHJ A;  5CLL B;  4HAV B;  5C5B B;  2OTX A;  3P7Z A;  1DBH A;  1EAZ A;  1U29 A;  4KAX B;  1K5G B;  3SV1 A;  1I7A A;  2D10 A;  1Z87 A;  2RSG A;  3SO6 A;  2W2X C;  2BCJ A;  1XD4 A;  3CIK A;  2D4Q A;  1DRO A;  4Z2M B;  5HE3 A;  2RNR B;  3G9W A;  5JP4 A;  1H10 A;  4A6F A;  2K2U A;  1X1G A;  3TCA A;  2CY4 A;  2Y8F A;  5C5B A;  1H4R A;  2YS1 A;  4HB2 B;  1P5T A;  2D2Q A;  1PFJ A;  1E5W A;  3F5R A;  2YRY A;  2YF0 A;  4MT7 A;  4PQ0 A;  2W2W A;  2DX5 A;  5KQ1 A;  1EGX A;  1UPQ A;  3KRX A;  1LB1 A;  3BJI A;  2P0H A;  5LOP B;  3FM8 C;  1MK9 B;  2YVC A;  5GOW B;  3BIN A;  1B55 A;  2UZR A;  3KSY A;  2K2J A;  2E2X A;  4CHM A;  2X18 A;  1XOD A;  2LG1 A;  1FHX A;  1X1F A;  2R09 A;  3QIJ A;  2KGX B;  5FI1 A;  2MKR A;  4EMO A;  2LUL A;  3FSS A;  1U5E A;  1W1D A;  4TYZ A;  4CHJ A; 
#chains in the Genus database with same CATH topology
 2N0Y A;  4ZRJ A;  2W2X D;  1ZVR A;  4C0A A;  5DH9 B;  1LW3 A;  5L81 A;  2KIG A;  2YS5 A;  1BTK A;  5D3X A;  1BTN A;  5D3W A;  2DKQ A;  2Z13 A;  5DI9 B;  3KRW A;  3PSC A;  1TJ6 A;  3QBV B;  4IFS A;  2COA A;  4NSW A;  1TXD A;  5DHA B;  2DHI A;  1U5F A;  3HQC A;  1NU2 A;  1NI2 A;  1P6S A;  1EVH A;  2UVM A;  3TW1 A;  2HE7 A;  4HAZ B;  2Z4D A;  1V5M A;  1I2H A;  3MDB C;  2AL6 A;  2EC1 A;  2XQN M;  5J3Q A;  2DLW A;  5C79 A;  1FGZ A;  2ROV A;  2GJY A;  1T77 A;  1OMW A;  1U2B A;  2DKP A;  4HAU B;  1M7E A;  4NY0 A;  4KHO A;  1PMS A;  4HSI A;  5HE2 A;  4KHB B;  1V61 A;  2ZPY A;  4D0N B;  1V88 A;  1KZ7 A;  1MPH A;  1U27 A;  1WVH A;  5FI0 A;  4GN1 A;  1K5D B;  2P8V A;  1Q67 A;  2DTC A;  2DYN A;  1XKE A;  3SUZ A;  4K81 A;  1DDW A;  1EF1 A;  3DXD A;  1X11 A;  1N3H A;  3D8D A;  3V5W A;  3A98 B;  5C6R A;  4KHB A;  1MK7 B;  1WG7 A;  3DCX A;  4KVG B;  5DHF B;  3DXE A;  2QKM A;  2KUQ A;  2NBV A;  4A6K A;  5JHH A;  1MAI A;  3AJ4 A;  2GS0 A;  2L2I A;  4XWX A;  3HW2 B;  1WGU A;  1ZC3 B;  3FEH A;  2D9X A;  1ISN A;  2LKO A;  1UEF A;  2I1J A;  2DX1 A;  2COF A;  5JLJ B;  1MIZ B;  3AU5 A;  4YON A;  2ZKM X;  4KHA A;  1W1G A;  2Z0P A;  2H7D A;  3UZT A;  3NSU A;  3A58 A;  2DHK A;  1XCG A;  2QKL A;  4HHV A;  1V5U A;  2M14 A;  1W1H A;  2RVB B;  2Z0Q A;  2DA0 A;  2CY5 A;  4Z2N A;  2Q13 A;  2D9W A;  1MKE A;  4Y94 A;  4GOU A;  5I2S A;  2EMT A;  1J19 A;  1RRP B;  3U7D A;  2DYQ A;  2I5C A;  1J0W A;  3TO1 A;  2DFK A;  3ML4 A;  1FB8 A;  4A6H A;  3HSA A;  2GUM A;  4WSF A;  1FGY A;  1GG3 A;  1DDM A;  1X86 A;  3T06 A;  2R2Y A;  4MY6 A;  3PVU A;  4GNK B;  2Y8G A;  2VKI A;  3TVV A;  2KIE A;  1WJM A;  2GCL A;  2LOX A;  3DXC A;  3PZD A;  3GYP A;  5C16 A;  2RUK B;  3ULC A;  4K17 A;  1NTY A;  2D9V A;  5CLQ B;  1ZM0 A;  1KZG A;  4HAX B;  2P0D A;  2D9Y A;  1FHO A;  2J0M A;  2YT1 A;  2EMS A;  3O96 A;  4HB4 B;  3HIE A;  2I5F A;  2YT0 A;  3U8Z A;  1IRS A;  1V89 A;  2COC A;  1U5D A;  1UNP A;  3WYF B;  3ODW A;  3LJU X;  5J3T A;  2J59 M;  4ZRI A;  3NW8 A;  2UZS A;  5HE0 A;  2Z0O A;  3PG7 A;  1U5G A;  4K2P A;  3SNH A;  3OHM B;  3MPX A;  5D3V A;  2Z14 A;  2K00 A;  3PP2 A;  1KI1 B;  1Y19 B;  2RGN B;  2ELB A;  2LOZ A;  1UNR A;  1UPR A;  4ZRK A;  5DIF B;  4A5K A;  1SHC A;  1NTV A;  4HAW B;  1M7R A;  3NWF A;  3ZDT A;  1AQC A;  2HTH B;  2MWN B;  3WA0 A;  3D8E A;  3VOQ A;  1FOE A;  3PEG A;  2G35 A;  2P0F A;  4HB0 B;  1WGQ A;  4A6F B;  3F0W A;  1XR0 B;  2J0J A;  4TKN A;  4L6E A;  4QJ3 B;  2YT2 A;  2V76 A;  2R0D A;  2ADZ A;  2KCJ A;  3VIA A;  4GPT B;  3N7C A;  1WI1 A;  1X05 A;  2RLO A;  3HK0 A;  3PVW A;  5J3Y A;  4OT1 A;  4DX8 A;  2CRF A;  1GC7 A;  4HDQ A;  3P6A A;  4HDO A;  2L1C A;  5LON B;  4P7I A;  3CXB B;  3FVC A;  1BWN A;  4F7U P;  4EKU A;  2VSZ A;  1WJ1 A;  2AEH A;  2FJL A;  4F7H A;  3U12 A;  2EJ8 A;  4CYE A;  3KY9 A;  2Z59 A;  5D3Y A;  3D8F A;  2I1K A;  1DDV A;  2Y7B A;  4K2O A;  4GZU A;  1QQG A;  4HAY B;  4WVF B;  4BBK A;  2YSZ A;  2N23 A;  3GYO A;  1ZSQ A;  5KCV A;  2H7E A;  4DIX A;  3RCP A;  3PVL A;  3ODX A;  2VRW B;  1BAK A;  4OSN A;  4GMX B;  1Y5O A;  5D27 A;  1MIX A;  3A8Q A;  3A8P A;  3ULB A;  3SYX A;  4B6H A;  2CAY A;  2FJU B;  2YS3 A;  3KZ1 A;  3AU4 A;  3IVF A;  1DYN A;  5HE1 A;  1FAO A;  2ROZ B;  4PNK A;  1P3R A;  4GMV A;  4HAT B;  4DXA B;  4H8S A;  4CSQ A;  4F7G A;  3M1I B;  2OQB A;  2PZ1 A;  4IAP A;  1GC6 A;  2GCJ A;  4QJ5 B;  4HB3 B;  1AWE A;  2D11 A;  4L1R A;  4EJN A;  1PLS A;  2COD A;  2KUP A;  2ELA A;  3OAN A;  1TQZ A;  3TFM A;  5JHG A;  2IFS A;  1OQN A;  5LG4 B;  4QJ4 B;  5I2M A;  1OY2 A;  2LYD A;  2JP2 A;  5KQ4 A;  3ODO A;  4IOY X;  3X23 A;  2MDX A;  2D9Z A;  2M38 A;  3ZVR A;  4GXB A;  2IYB A;  2DN6 A;  1ZC4 B;  4DX9 0;  3NWD A;  2KR0 A;  1QC6 A;  1SGH A;  1RJ2 A;  2MFQ A;  4MK0 A;  4YL8 A;  4DBB A;  1FHW A;  2NMB A;  4WJ7 A;  1UNQ A;  5EFX A;  2NZ8 B;  2J0K A;  1V5P A;  1XX0 A;  3QWM A;  3NWA A;  2DHJ A;  5CLL B;  2K49 A;  4HAV B;  1ZYI A;  5C5B B;  2OTX A;  3P7Z A;  1DBH A;  1EAZ A;  1U29 A;  4KAX B;  1K5G B;  2K8E A;  3SV1 A;  1I7A A;  2D10 A;  1Z87 A;  2RSG A;  3SO6 A;  2W2X C;  2BCJ A;  1XD4 A;  3CIK A;  2D4Q A;  1DRO A;  4Z2M B;  5HE3 A;  5M4Y B;  2RNR B;  3G9W A;  5JP4 A;  5IRS A;  1H10 A;  4A6F A;  2K2U A;  1X1G A;  3TCA A;  2CY4 A;  2Y8F A;  5C5B A;  1MI1 A;  1H4R A;  2YS1 A;  4HB2 B;  1P5T A;  2D2Q A;  2RRF A;  1PFJ A;  1E5W A;  3F5R A;  2YRY A;  4D6W A;  2YF0 A;  4MT7 A;  4PQ0 A;  4QXA B;  2W2W A;  2DX5 A;  5KQ1 A;  1EGX A;  1UPQ A;  3KRX A;  1LB1 A;  3BJI A;  2P0H A;  3B77 A;  5LOP B;  3FM8 C;  1MK9 B;  2YVC A;  5GOW B;  3BIN A;  1B55 A;  2UZR A;  3KSY A;  2K2J A;  2E2X A;  4CHM A;  2X18 A;  1XOD A;  2LG1 A;  1FHX A;  1X1F A;  2R09 A;  3QIJ A;  2KGX B;  5FI1 A;  2MKR A;  4EMO A;  2LUL A;  3FSS A;  1U5E A;  1W1D A;  4TYZ A;  4CHJ A; 
#chains in the Genus database with same CATH homology
 2N0Y A;  4ZRJ A;  2W2X D;  1ZVR A;  4C0A A;  5DH9 B;  1LW3 A;  5L81 A;  2YS5 A;  1BTK A;  5D3X A;  1BTN A;  5D3W A;  2DKQ A;  5DI9 B;  3KRW A;  3PSC A;  1TJ6 A;  3QBV B;  4IFS A;  2COA A;  4NSW A;  1TXD A;  5DHA B;  2DHI A;  1U5F A;  3HQC A;  1NU2 A;  1NI2 A;  1P6S A;  1EVH A;  2UVM A;  3TW1 A;  2HE7 A;  4HAZ B;  1V5M A;  3MDB C;  1I2H A;  2AL6 A;  2EC1 A;  2XQN M;  5J3Q A;  2DLW A;  5C79 A;  1FGZ A;  2ROV A;  2GJY A;  1OMW A;  1U2B A;  2DKP A;  4HAU B;  1M7E A;  4NY0 A;  4KHO A;  1PMS A;  5HE2 A;  4KHB B;  1V61 A;  2ZPY A;  4D0N B;  1V88 A;  1KZ7 A;  1MPH A;  1U27 A;  1WVH A;  5FI0 A;  4GN1 A;  1K5D B;  2P8V A;  1Q67 A;  2DTC A;  2DYN A;  1XKE A;  3SUZ A;  4K81 A;  1DDW A;  1EF1 A;  3DXD A;  1X11 A;  1N3H A;  3D8D A;  3V5W A;  3A98 B;  5C6R A;  1MK7 B;  1WG7 A;  4KVG B;  5DHF B;  3DXE A;  2QKM A;  4A6K A;  5JHH A;  1MAI A;  3AJ4 A;  2GS0 A;  2L2I A;  4XWX A;  3HW2 B;  1WGU A;  1ZC3 B;  3FEH A;  2D9X A;  1ISN A;  2LKO A;  1UEF A;  2I1J A;  2DX1 A;  2COF A;  5JLJ B;  1MIZ B;  3AU5 A;  4YON A;  4KHA A;  1W1G A;  2Z0P A;  2H7D A;  3UZT A;  3NSU A;  2DHK A;  1XCG A;  2QKL A;  4HHV A;  1V5U A;  2M14 A;  1W1H A;  2RVB B;  2Z0Q A;  2DA0 A;  2CY5 A;  4Z2N A;  2Q13 A;  2D9W A;  1MKE A;  4Y94 A;  2EMT A;  1J19 A;  1RRP B;  3U7D A;  2DYQ A;  2I5C A;  1J0W A;  3TO1 A;  2DFK A;  3ML4 A;  1FB8 A;  4A6H A;  4WSF A;  1FGY A;  1GG3 A;  1DDM A;  1X86 A;  3T06 A;  4MY6 A;  3PVU A;  2Y8G A;  2VKI A;  3TVV A;  1WJM A;  2GCL A;  2LOX A;  3DXC A;  3PZD A;  3GYP A;  5C16 A;  2RUK B;  3ULC A;  4K17 A;  1NTY A;  2D9V A;  5CLQ B;  1ZM0 A;  1KZG A;  4HAX B;  2P0D A;  2D9Y A;  1FHO A;  2J0M A;  2YT1 A;  2EMS A;  3O96 A;  4HB4 B;  3U8Z A;  2I5F A;  2YT0 A;  1IRS A;  1V89 A;  2COC A;  1U5D A;  1UNP A;  3WYF B;  3ODW A;  3LJU X;  5J3T A;  2J59 M;  4ZRI A;  2UZS A;  5HE0 A;  2Z0O A;  3PG7 A;  1U5G A;  4K2P A;  3SNH A;  3MPX A;  5D3V A;  2K00 A;  3PP2 A;  1KI1 B;  1Y19 B;  2RGN B;  2ELB A;  2LOZ A;  1UNR A;  1UPR A;  4ZRK A;  5DIF B;  4A5K A;  1SHC A;  1NTV A;  4HAW B;  1M7R A;  3ZDT A;  1AQC A;  2HTH B;  2MWN B;  3WA0 A;  3D8E A;  3VOQ A;  1FOE A;  3PEG A;  2G35 A;  2P0F A;  4HB0 B;  1WGQ A;  4A6F B;  3F0W A;  1XR0 B;  2J0J A;  4TKN A;  4L6E A;  2V76 A;  2R0D A;  2ADZ A;  2KCJ A;  3VIA A;  4GPT B;  3N7C A;  1WI1 A;  1X05 A;  2RLO A;  3HK0 A;  3PVW A;  5J3Y A;  4DX8 A;  2CRF A;  1GC7 A;  4HDQ A;  3P6A A;  4HDO A;  2L1C A;  5LON B;  4P7I A;  3CXB B;  1BWN A;  4F7U P;  4EKU A;  2VSZ A;  1WJ1 A;  2AEH A;  2FJL A;  4F7H A;  2EJ8 A;  4CYE A;  3KY9 A;  5D3Y A;  3D8F A;  2I1K A;  1DDV A;  2Y7B A;  4K2O A;  4GZU A;  1QQG A;  4HAY B;  4WVF B;  4BBK A;  2YSZ A;  2N23 A;  3GYO A;  1ZSQ A;  5KCV A;  2H7E A;  3RCP A;  3PVL A;  3ODX A;  2VRW B;  1BAK A;  4GMX B;  1Y5O A;  5D27 A;  1MIX A;  3A8Q A;  3A8P A;  3ULB A;  3SYX A;  4B6H A;  2CAY A;  2YS3 A;  3KZ1 A;  3AU4 A;  3IVF A;  1DYN A;  5HE1 A;  1FAO A;  2ROZ B;  4PNK A;  1P3R A;  4GMV A;  4HAT B;  4DXA B;  4H8S A;  4F7G A;  3M1I B;  2OQB A;  2PZ1 A;  4IAP A;  1GC6 A;  2GCJ A;  4HB3 B;  1AWE A;  2D11 A;  4EJN A;  1PLS A;  2COD A;  2KUP A;  2ELA A;  3OAN A;  1TQZ A;  3TFM A;  5JHG A;  2IFS A;  1OQN A;  1OY2 A;  2LYD A;  2JP2 A;  5KQ4 A;  3ODO A;  4IOY X;  3X23 A;  2MDX A;  2D9Z A;  2M38 A;  3ZVR A;  4GXB A;  2IYB A;  2DN6 A;  1ZC4 B;  4DX9 0;  1QC6 A;  1SGH A;  1RJ2 A;  2MFQ A;  4MK0 A;  4YL8 A;  4DBB A;  1FHW A;  2NMB A;  4WJ7 A;  1UNQ A;  5EFX A;  2NZ8 B;  2J0K A;  1V5P A;  1XX0 A;  3QWM A;  2DHJ A;  5CLL B;  4HAV B;  5C5B B;  2OTX A;  3P7Z A;  1DBH A;  1EAZ A;  1U29 A;  4KAX B;  1K5G B;  3SV1 A;  1I7A A;  2D10 A;  1Z87 A;  2RSG A;  3SO6 A;  2W2X C;  2BCJ A;  1XD4 A;  3CIK A;  2D4Q A;  1DRO A;  4Z2M B;  5HE3 A;  2RNR B;  3G9W A;  5JP4 A;  1H10 A;  4A6F A;  2K2U A;  1X1G A;  3TCA A;  2CY4 A;  2Y8F A;  5C5B A;  1H4R A;  2YS1 A;  4HB2 B;  1P5T A;  2D2Q A;  1PFJ A;  1E5W A;  3F5R A;  2YRY A;  2YF0 A;  4MT7 A;  4PQ0 A;  2W2W A;  2DX5 A;  5KQ1 A;  1EGX A;  1UPQ A;  3KRX A;  1LB1 A;  3BJI A;  2P0H A;  5LOP B;  3FM8 C;  1MK9 B;  2YVC A;  5GOW B;  3BIN A;  1B55 A;  2UZR A;  3KSY A;  2K2J A;  2E2X A;  4CHM A;  2X18 A;  1XOD A;  2LG1 A;  1FHX A;  1X1F A;  2R09 A;  3QIJ A;  2KGX B;  5FI1 A;  2MKR A;  4EMO A;  2LUL A;  3FSS A;  1U5E A;  1W1D A;  4TYZ A;  4CHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...