1EVHA

Evh1 domain from murine enabled in complex with acta peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MENA EVH1 DOMAIN)
publication title Structure of the enabled/VASP homology 1 domain-peptide complex: a key component in the spatial control of actin assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Contractile protein
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1evhA00
3UZTA 2OTXA 2VSZA 4KVGB 1BWNA 2DFKA 5J3TA 1U2BA 1Z87A 1MIZB 3NSUA 2COFA 1MPHA 3V5WA 1DDMA 3MPXA 5KQ4A 1V61A 2COAA 2IYBA 4HB4B 3ML4A 1NTYA 3BJIA 2YF0A 4ZRKA 2K2UA 1OQNA 5C79A 2R09A 1FB8A 1W1GA 3PEGA 1P3RA 3A98B 2RNRB 4HB2B 2N23A 1V5UA 1MK9B 1NI2A 1ISNA 2ZPYA 2I1JA 3F5RA 1H4RA 1FGYA 3KSYA 1SHCA 5D27A 1FHXA 1V89A 5HE3A 1ZVRA 3KY9A 2D4QA 2DHIA 1RRPB 1BAKA 2BCJA 3PSCA 4HAWB 3PVUA 4CHMA 4ZRJA 3SNHA 2CAYA 2YVCA 1BTKA 2D9WA 1B55A 5LOPB 5KCVA 5C5BB 3TCAA 4K2PA 5LONB 3FEHA 4GMXB 3F0WA 4HAZB 2RSGA 4KHAA 1TQZA 1UEFA 1EF1A 3PVWA 3GYOA 4WSFA 3P7ZA 1PLSA 1U29A 1EVHA 3HK0A 2DYQA 4HB3B 1QC6A 2X18A 3ODWA 1Q67A 2R0DA 2LYDA 2CODA 3D8FA 2OQBA 1J19A 5HE1A 2EJ8A 4GPTB 1WG7A 2GCLA 3RCPA 2M14A 2NMBA 1QQGA 5J3YA 2YRYA 1U27A 1ZSQA 2P0HA 1M7EA 2Q13A 2LG1A 3VOQA 5D3VA 2KCJA 1UPQA 2PZ1A 5DIFB 2Z0OA 2D9VA 3WA0A 3A8PA 1XCGA 3PZDA 4HAYB 1GC7A 3O96A 5HE2A 2E2XA 1X11A 2V76A 2XQNM 2L2IA 2K2JA 1K5DB 2GS0A 4KHBB 2N0YA 2ELAA 2W2WA 4HDQA 1OMWA 2DHKA 2AEHA 4MT7A 2K00A 2LOXA 2ROZB 2CRFA 3CIKA 1MK7B 4PNKA 4DBBA 4C0AA 3HW2B 3D8DA 5JP4A 4HAXB 1DBHA 1E5WA 1XD4A 3ODXA 1DDVA 3ZDTA 2VRWB 4A6FA 3BINA 3DXDA 1GC6A 1UNPA 1Y19B 4DX90 1XX0A 1X1GA 3OANA 1KI1B 3HQCA 4PQ0A 1WVHA 1SGHA 1N3HA 2LULA 4CHJA 1AWEA 4TKNA 2DYNA 1XKEA 3QWMA 2YT1A 3D8EA 2LKOA 1WI1A 4NY0A 4HHVA 4YL8A 1V5PA 2KUPA 5JHHA 2D2QA 4HAUB 2G35A 2DA0A 2DHJA 2NZ8B 4DXAB 4Y94A 1FOEA 4MY6A 2GJYA 1X05A 2D9ZA 1LB1A 2RVBB 2ELBA 5D3WA 3A8QA 2HE7A 2YS3A 1FGZA 2J0KA 2Y8FA 4F7UP 2Y7BA 1DYNA 1KZ7A 2AL6A 2CY5A 2P8VA 5DHAB 5KQ1A 3TW1A 3DXEA 1MKEA 2HTHB 1WGQA 1BTNA 1WJ1A 5DHFB 5JHGA 2JP2A 3QIJA 2M38A 2UZSA 4K81A 1MIXA 1UNQA 3SUZA 5CLLB 5GOWB 5CLQB 3M1IB 4A6FB 1FHOA 5FI1A 2EMTA 4HATB 3ULCA 1DDWA 2ADZA 4Z2MB 3FM8C 4F7HA 3IVFA 3ZVRA 1UNRA 1U5FA 2MKRA 2J59M 2UVMA 4L6EA 2VKIA 3T06A 5J3QA 2YSZA 2I1KA 1U5DA 1J0WA 3N7CA 4WVFB 3ODOA 2CY4A 1NU2A 2EMSA 1TXDA 3LJUX 2LOZA 1P5TA 2YS5A 3FSSA 2D9YA 2I5CA 1RJ2A 2MWNB 2QKMA 5DH9B 2RLOA 1AQCA 2J0MA 2YS1A 2ROVA 1I7AA 1WGUA 4P7IA 4K2OA 1K5GB 4GZUA 4NSWA 4Z2NA 1TJ6A 1LW3A 3GYPA 1U5GA 4F7GA 5JLJB 4GN1A 1DROA 2W2XC 2DN6A 2J0JA 3G9WA 4KAXB 5L81A 1ZC3B 3KRWA 3AU4A 1Y5OA 2P0DA 4EMOA 3KZ1A 2UZRA 3TO1A 1IRSA 1PMSA 4YONA 1W1HA 3PP2A 4EKUA 1XR0B 2DLWA 2D11A 3AJ4A 3WYFB 2IFSA 3VIAA 3PG7A 4K17A 1PFJA 2KGXB 2Z0PA 3TVVA 2L1CA 1EGXA 1X86A 3CXBB 3AU5A 4D0NB 2D10A 4HDOA 1MAIA 2YT0A 3SYXA 5C6RA 3SO6A 2COCA 2P0FA 4A5KA 4IOYX 3U8ZA 1V88A 2H7EA 3X23A 5FI0A 1I2HA 1U5EA 4HB0B 4TYZA 1M7RA 1W1DA 4H8SA 2DKPA 2EC1A 1ZC4B 2MDXA 2DX1A 1EAZA 2H7DA 1ZM0A 3MDBC 3ULBA 5HE0A 4DX8A 3TFMA 4IAPA 2DX5A 2I5FA 4GXBA 2QKLA 1FAOA 2MFQA 4XWXA 4IFSA 2DKQA 2RGNB 2RUKB 4EJNA 2GCJA 4KHOA 5DI9B 1FHWA 3U7DA 2FJLA 1KZGA 4GMVA 4BBKA 4WJ7A 5D3XA 3KRXA 5C5BA 4CYEA 4MK0A 1OY2A 5EFXA 1P6SA 2DTCA 3QBVB 1NTVA 1V5MA 4A6HA 4B6HA 3DXCA 3SV1A 2D9XA 3P6AA 2W2XD 1H10A 3PVLA 5C16A 4ZRIA 2Y8GA 1UPRA 1XODA 2Z0QA 5D3YA 4HAVB 1X1FA 4A6KA 1GG3A 1WJMA
chains in the Genus database with same CATH superfamily
3UZTA 2OTXA 2VSZA 4QJ5B 4KVGB 1BWNA 2DFKA 5J3TA 1U2BA 2Z59A 1Z87A 1MIZB 3NSUA 2COFA 1MPHA 3V5WA 1DDMA 3MPXA 5KQ4A 1V61A 2COAA 2IYBA 4HB4B 3ML4A 1NTYA 3BJIA 2YF0A 4QXAB 2K2UA 4ZRKA 1OQNA 5C79A 2R09A 1FB8A 1W1GA 3PEGA 1P3RA 3A98B 2RNRB 4HB2B 2N23A 1V5UA 3NW8A 1MK9B 1NI2A 1ISNA 2ZPYA 2I1JA 3F5RA 4HSIA 4GNKB 1H4RA 1FGYA 3KSYA 1SHCA 5D27A 1FHXA 1V89A 5HE3A 1ZVRA 3KY9A 2D4QA 2DHIA 1RRPB 1BAKA 2BCJA 3PSCA 4HAWB 3PVUA 4CHMA 4ZRJA 3SNHA 2CAYA 2YVCA 1BTKA 2D9WA 1B55A 5LOPB 5KCVA 5C5BB 3TCAA 4K2PA 2ZKMX 5LONB 3FEHA 4GMXB 3F0WA 4HAZB 2RSGA 4KHAA 1TQZA 1UEFA 1EF1A 3PVWA 3GYOA 4WSFA 3P7ZA 1PLSA 1U29A 1EVHA 3HK0A 5LG4B 3HSAA 2DYQA 4HB3B 1QC6A 2X18A 3ODWA 1Q67A 2R0DA 2LYDA 2KUQA 2CODA 3D8FA 2OQBA 1J19A 5HE1A 2EJ8A 4GPTB 1WG7A 2GCLA 3RCPA 2M14A 2NMBA 1QQGA 5J3YA 2GUMA 3U12A 2YRYA 2Z13A 3FVCA 1U27A 1ZSQA 2P0HA 1M7EA 2Q13A 2LG1A 3VOQA 5D3VA 2KCJA 1UPQA 3OHMB 2PZ1A 5DIFB 2Z0OA 2D9VA 3WA0A 3A8PA 1XCGA 3PZDA 4HAYB 2KIEA 1GC7A 3O96A 5HE2A 2E2XA 1X11A 2V76A 2XQNM 2L2IA 2K2JA 1K5DB 2GS0A 4KHBB 2N0YA 2ELAA 2W2WA 4HDQA 1OMWA 2DHKA 2AEHA 4MT7A 2K00A 2LOXA 2ROZB 2CRFA 3CIKA 1MK7B 4PNKA 5IRSA 4DBBA 4C0AA 4QJ4B 5M4YB 3HW2B 3D8DA 5JP4A 4HAXB 1DBHA 1E5WA 1XD4A 3NWFA 3ODXA 1DDVA 1T77A 3ZDTA 2VRWB 4A6FA 3BINA 3DXDA 2R2YA 1GC6A 1UNPA 1Y19B 4DX90 1XX0A 1X1GA 3OANA 1ZYIA 1KI1B 5I2SA 3HQCA 4PQ0A 1WVHA 1SGHA 1N3HA 2LULA 4OT1A 4CHJA 1AWEA 4TKNA 2DYNA 1XKEA 3QWMA 4KHBA 2YT1A 3D8EA 2LKOA 1WI1A 4NY0A 4HHVA 4YL8A 1V5PA 4CSQA 2KUPA 5JHHA 2D2QA 4HAUB 2G35A 2DA0A 2DHJA 2NZ8B 4DXAB 4Y94A 2RRFA 1FOEA 4MY6A 2GJYA 1X05A 2D9ZA 1LB1A 2RVBB 2ELBA 5D3WA 3A8QA 2HE7A 2YS3A 1FGZA 2J0KA 2Y8FA 4F7UP 2Y7BA 1DYNA 1KZ7A 2AL6A 2CY5A 2P8VA 5DHAB 5KQ1A 3TW1A 3DXEA 1MKEA 2HTHB 1WGQA 1BTNA 1WJ1A 5DHFB 4OSNA 5JHGA 2JP2A 2Z4DA 3QIJA 2M38A 2UZSA 4K81A 1MIXA 1UNQA 3SUZA 5CLLB 5GOWB 5CLQB 3M1IB 4A6FB 5I2MA 1FHOA 5FI1A 2EMTA 4HATB 3ULCA 1DDWA 2ADZA 4Z2MB 3FM8C 4QJ3B 4D6WA 4F7HA 3IVFA 3ZVRA 1UNRA 1U5FA 2MKRA 2J59M 2UVMA 4L6EA 2VKIA 3T06A 5J3QA 2YSZA 2I1KA 1U5DA 1J0WA 3N7CA 4WVFB 3ODOA 2CY4A 1NU2A 2EMSA 1TXDA 3LJUX 2LOZA 1P5TA 2YS5A 3FSSA 2KR0A 2D9YA 2I5CA 3NWDA 1RJ2A 2MWNB 2QKMA 5DH9B 2RLOA 1AQCA 2J0MA 2YS1A 3B77A 2ROVA 1I7AA 1WGUA 4P7IA 4K2OA 1K5GB 4GZUA 2KIGA 4NSWA 4DIXA 4Z2NA 1TJ6A 1LW3A 3GYPA 1U5GA 4F7GA 5JLJB 4GN1A 1DROA 2FJUB 2W2XC 2DN6A 2J0JA 3G9WA 4KAXB 5L81A 1ZC3B 3KRWA 3AU4A 3HIEA 1Y5OA 2P0DA 4EMOA 3KZ1A 2UZRA 3TO1A 1IRSA 1PMSA 4YONA 1W1HA 3PP2A 4EKUA 1XR0B 2DLWA 2D11A 3AJ4A 3WYFB 2IFSA 3VIAA 3PG7A 4K17A 1PFJA 2KGXB 2Z0PA 3TVVA 2L1CA 2YT2A 1EGXA 1X86A 3CXBB 3AU5A 4D0NB 2D10A 4HDOA 1MAIA 2YT0A 3SYXA 5C6RA 3SO6A 2COCA 2P0FA 4A5KA 4IOYX 3U8ZA 1V88A 2H7EA 3X23A 5FI0A 1I2HA 1MI1A 1U5EA 4HB0B 4TYZA 1M7RA 1W1DA 4H8SA 2DKPA 2EC1A 1ZC4B 2MDXA 2K49A 2DX1A 1EAZA 2H7DA 1ZM0A 3MDBC 3ULBA 5HE0A 4DX8A 3TFMA 4IAPA 2DX5A 2I5FA 2K8EA 4GXBA 2QKLA 1FAOA 3A58A 2MFQA 4XWXA 4IFSA 2NBVA 2DKQA 2RGNB 4L1RA 2RUKB 4EJNA 2GCJA 4KHOA 5DI9B 1FHWA 3DCXA 2FJLA 3U7DA 1KZGA 4GMVA 4BBKA 4WJ7A 3NWAA 5D3XA 3KRXA 5C5BA 4GOUA 4CYEA 4MK0A 1OY2A 5EFXA 1P6SA 2DTCA 3QBVB 1NTVA 1V5MA 4A6HA 4B6HA 3DXCA 3SV1A 2D9XA 3P6AA 2W2XD 1H10A 3PVLA 5C16A 4ZRIA 2Y8GA 1UPRA 1XODA 2Z0QA 5D3YA 4HAVB 1X1FA 4A6KA 1GG3A 1WJMA 2Z14A
chains in the Genus database with same CATH topology
3UZTA 2OTXA 2VSZA 4KVGB 1BWNA 2DFKA 5J3TA 1U2BA 1Z87A 1MIZB 3NSUA 2COFA 1MPHA 3V5WA 1DDMA 3MPXA 5KQ4A 1V61A 2COAA 2IYBA 4HB4B 3ML4A 1NTYA 3BJIA 2YF0A 4ZRKA 2K2UA 1OQNA 5C79A 2R09A 1FB8A 1W1GA 3PEGA 1P3RA 3A98B 2RNRB 4HB2B 2N23A 1V5UA 1MK9B 1NI2A 1ISNA 2ZPYA 2I1JA 3F5RA 1H4RA 1FGYA 3KSYA 1SHCA 5D27A 1FHXA 1V89A 5HE3A 1ZVRA 3KY9A 2D4QA 2DHIA 1RRPB 1BAKA 2BCJA 3PSCA 4HAWB 3PVUA 4CHMA 4ZRJA 3SNHA 2CAYA 2YVCA 1BTKA 2D9WA 1B55A 5LOPB 5KCVA 5C5BB 3TCAA 4K2PA 5LONB 3FEHA 4GMXB 3F0WA 4HAZB 2RSGA 4KHAA 1TQZA 1UEFA 1EF1A 3PVWA 3GYOA 4WSFA 3P7ZA 1PLSA 1U29A 1EVHA 3HK0A 2DYQA 4HB3B 1QC6A 2X18A 3ODWA 1Q67A 2R0DA 2LYDA 2CODA 3D8FA 2OQBA 1J19A 5HE1A 2EJ8A 4GPTB 1WG7A 2GCLA 3RCPA 2M14A 2NMBA 1QQGA 5J3YA 2YRYA 1U27A 1ZSQA 2P0HA 1M7EA 2Q13A 2LG1A 3VOQA 5D3VA 2KCJA 1UPQA 2PZ1A 5DIFB 2Z0OA 2D9VA 3WA0A 3A8PA 1XCGA 3PZDA 4HAYB 1GC7A 3O96A 5HE2A 2E2XA 1X11A 2V76A 2XQNM 2L2IA 2K2JA 1K5DB 2GS0A 4KHBB 2N0YA 2ELAA 2W2WA 4HDQA 1OMWA 2DHKA 2AEHA 4MT7A 2K00A 2LOXA 2ROZB 2CRFA 3CIKA 1MK7B 4PNKA 4DBBA 4C0AA 3HW2B 3D8DA 5JP4A 4HAXB 1DBHA 1E5WA 1XD4A 3ODXA 1DDVA 3ZDTA 2VRWB 4A6FA 3BINA 3DXDA 1GC6A 1UNPA 1Y19B 4DX90 1XX0A 1X1GA 3OANA 1KI1B 3HQCA 4PQ0A 1WVHA 1SGHA 1N3HA 2LULA 4CHJA 1AWEA 4TKNA 2DYNA 1XKEA 3QWMA 2YT1A 3D8EA 2LKOA 1WI1A 4NY0A 4HHVA 4YL8A 1V5PA 2KUPA 5JHHA 2D2QA 4HAUB 2G35A 2DA0A 2DHJA 2NZ8B 4DXAB 4Y94A 1FOEA 4MY6A 2GJYA 1X05A 2D9ZA 1LB1A 2RVBB 2ELBA 5D3WA 3A8QA 2HE7A 2YS3A 1FGZA 2J0KA 2Y8FA 4F7UP 2Y7BA 1DYNA 1KZ7A 2AL6A 2CY5A 2P8VA 5DHAB 5KQ1A 3TW1A 3DXEA 1MKEA 2HTHB 1WGQA 1BTNA 1WJ1A 5DHFB 5JHGA 2JP2A 3QIJA 2M38A 2UZSA 4K81A 1MIXA 1UNQA 3SUZA 5CLLB 5GOWB 5CLQB 3M1IB 4A6FB 1FHOA 5FI1A 2EMTA 4HATB 3ULCA 1DDWA 2ADZA 4Z2MB 3FM8C 4F7HA 3IVFA 3ZVRA 1UNRA 1U5FA 2MKRA 2J59M 2UVMA 4L6EA 2VKIA 3T06A 5J3QA 2YSZA 2I1KA 1U5DA 1J0WA 3N7CA 4WVFB 3ODOA 2CY4A 1NU2A 2EMSA 1TXDA 3LJUX 2LOZA 1P5TA 2YS5A 3FSSA 2D9YA 2I5CA 1RJ2A 2MWNB 2QKMA 5DH9B 2RLOA 1AQCA 2J0MA 2YS1A 2ROVA 1I7AA 1WGUA 4P7IA 4K2OA 1K5GB 4GZUA 4NSWA 4Z2NA 1TJ6A 1LW3A 3GYPA 1U5GA 4F7GA 5JLJB 4GN1A 1DROA 2W2XC 2DN6A 2J0JA 3G9WA 4KAXB 5L81A 1ZC3B 3KRWA 3AU4A 1Y5OA 2P0DA 4EMOA 3KZ1A 2UZRA 3TO1A 1IRSA 1PMSA 4YONA 1W1HA 3PP2A 4EKUA 1XR0B 2DLWA 2D11A 3AJ4A 3WYFB 2IFSA 3VIAA 3PG7A 4K17A 1PFJA 2KGXB 2Z0PA 3TVVA 2L1CA 1EGXA 1X86A 3CXBB 3AU5A 4D0NB 2D10A 4HDOA 1MAIA 2YT0A 3SYXA 5C6RA 3SO6A 2COCA 2P0FA 4A5KA 4IOYX 3U8ZA 1V88A 2H7EA 3X23A 5FI0A 1I2HA 1U5EA 4HB0B 4TYZA 1M7RA 1W1DA 4H8SA 2DKPA 2EC1A 1ZC4B 2MDXA 2DX1A 1EAZA 2H7DA 1ZM0A 3MDBC 3ULBA 5HE0A 4DX8A 3TFMA 4IAPA 2DX5A 2I5FA 4GXBA 2QKLA 1FAOA 2MFQA 4XWXA 4IFSA 2DKQA 2RGNB 2RUKB 4EJNA 2GCJA 4KHOA 5DI9B 1FHWA 3U7DA 2FJLA 1KZGA 4GMVA 4BBKA 4WJ7A 5D3XA 3KRXA 5C5BA 4CYEA 4MK0A 1OY2A 5EFXA 1P6SA 2DTCA 3QBVB 1NTVA 1V5MA 4A6HA 4B6HA 3DXCA 3SV1A 2D9XA 3P6AA 2W2XD 1H10A 3PVLA 5C16A 4ZRIA 2Y8GA 1UPRA 1XODA 2Z0QA 5D3YA 4HAVB 1X1FA 4A6KA 1GG3A 1WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZT A;  2OTX A;  2VSZ A;  4KVG B;  1BWN A;  2DFK A;  5J3T A;  1U2B A;  1Z87 A;  1MIZ B;  3NSU A;  2COF A;  1MPH A;  3V5W A;  1DDM A;  3MPX A;  5KQ4 A;  1V61 A;  2COA A;  2IYB A;  4HB4 B;  3ML4 A;  1NTY A;  3BJI A;  2YF0 A;  4ZRK A;  2K2U A;  1OQN A;  5C79 A;  2R09 A;  1FB8 A;  1W1G A;  3PEG A;  1P3R A;  3A98 B;  2RNR B;  4HB2 B;  2N23 A;  1V5U A;  1MK9 B;  1NI2 A;  1ISN A;  2ZPY A;  2I1J A;  3F5R A;  1H4R A;  1FGY A;  3KSY A;  1SHC A;  5D27 A;  1FHX A;  1V89 A;  5HE3 A;  1ZVR A;  3KY9 A;  2D4Q A;  2DHI A;  1RRP B;  1BAK A;  2BCJ A;  3PSC A;  4HAW B;  3PVU A;  4CHM A;  4ZRJ A;  3SNH A;  2CAY A;  2YVC A;  1BTK A;  2D9W A;  1B55 A;  5LOP B;  5KCV A;  5C5B B;  3TCA A;  4K2P A;  5LON B;  3FEH A;  4GMX B;  3F0W A;  4HAZ B;  2RSG A;  4KHA A;  1TQZ A;  1UEF A;  1EF1 A;  3PVW A;  3GYO A;  4WSF A;  3P7Z A;  1PLS A;  1U29 A;  1EVH A;  3HK0 A;  2DYQ A;  4HB3 B;  1QC6 A;  2X18 A;  3ODW A;  1Q67 A;  2R0D A;  2LYD A;  2COD A;  3D8F A;  2OQB A;  1J19 A;  5HE1 A;  2EJ8 A;  4GPT B;  1WG7 A;  2GCL A;  3RCP A;  2M14 A;  2NMB A;  1QQG A;  5J3Y A;  2YRY A;  1U27 A;  1ZSQ A;  2P0H A;  1M7E A;  2Q13 A;  2LG1 A;  3VOQ A;  5D3V A;  2KCJ A;  1UPQ A;  2PZ1 A;  5DIF B;  2Z0O A;  2D9V A;  3WA0 A;  3A8P A;  1XCG A;  3PZD A;  4HAY B;  1GC7 A;  3O96 A;  5HE2 A;  2E2X A;  1X11 A;  2V76 A;  2XQN M;  2L2I A;  2K2J A;  1K5D B;  2GS0 A;  4KHB B;  2N0Y A;  2ELA A;  2W2W A;  4HDQ A;  1OMW A;  2DHK A;  2AEH A;  4MT7 A;  2K00 A;  2LOX A;  2ROZ B;  2CRF A;  3CIK A;  1MK7 B;  4PNK A;  4DBB A;  4C0A A;  3HW2 B;  3D8D A;  5JP4 A;  4HAX B;  1DBH A;  1E5W A;  1XD4 A;  3ODX A;  1DDV A;  3ZDT A;  2VRW B;  4A6F A;  3BIN A;  3DXD A;  1GC6 A;  1UNP A;  1Y19 B;  4DX9 0;  1XX0 A;  1X1G A;  3OAN A;  1KI1 B;  3HQC A;  4PQ0 A;  1WVH A;  1SGH A;  1N3H A;  2LUL A;  4CHJ A;  1AWE A;  4TKN A;  2DYN A;  1XKE A;  3QWM A;  2YT1 A;  3D8E A;  2LKO A;  1WI1 A;  4NY0 A;  4HHV A;  4YL8 A;  1V5P A;  2KUP A;  5JHH A;  2D2Q A;  4HAU B;  2G35 A;  2DA0 A;  2DHJ A;  2NZ8 B;  4DXA B;  4Y94 A;  1FOE A;  4MY6 A;  2GJY A;  1X05 A;  2D9Z A;  1LB1 A;  2RVB B;  2ELB A;  5D3W A;  3A8Q A;  2HE7 A;  2YS3 A;  1FGZ A;  2J0K A;  2Y8F A;  4F7U P;  2Y7B A;  1DYN A;  1KZ7 A;  2AL6 A;  2CY5 A;  2P8V A;  5DHA B;  5KQ1 A;  3TW1 A;  3DXE A;  1MKE A;  2HTH B;  1WGQ A;  1BTN A;  1WJ1 A;  5DHF B;  5JHG A;  2JP2 A;  3QIJ A;  2M38 A;  2UZS A;  4K81 A;  1MIX A;  1UNQ A;  3SUZ A;  5CLL B;  5GOW B;  5CLQ B;  3M1I B;  4A6F B;  1FHO A;  5FI1 A;  2EMT A;  4HAT B;  3ULC A;  1DDW A;  2ADZ A;  4Z2M B;  3FM8 C;  4F7H A;  3IVF A;  3ZVR A;  1UNR A;  1U5F A;  2MKR A;  2J59 M;  2UVM A;  4L6E A;  2VKI A;  3T06 A;  5J3Q A;  2YSZ A;  2I1K A;  1U5D A;  1J0W A;  3N7C A;  4WVF B;  3ODO A;  2CY4 A;  1NU2 A;  2EMS A;  1TXD A;  3LJU X;  2LOZ A;  1P5T A;  2YS5 A;  3FSS A;  2D9Y A;  2I5C A;  1RJ2 A;  2MWN B;  2QKM A;  5DH9 B;  2RLO A;  1AQC A;  2J0M A;  2YS1 A;  2ROV A;  1I7A A;  1WGU A;  4P7I A;  4K2O A;  1K5G B;  4GZU A;  4NSW A;  4Z2N A;  1TJ6 A;  1LW3 A;  3GYP A;  1U5G A;  4F7G A;  5JLJ B;  4GN1 A;  1DRO A;  2W2X C;  2DN6 A;  2J0J A;  3G9W A;  4KAX B;  5L81 A;  1ZC3 B;  3KRW A;  3AU4 A;  1Y5O A;  2P0D A;  4EMO A;  3KZ1 A;  2UZR A;  3TO1 A;  1IRS A;  1PMS A;  4YON A;  1W1H A;  3PP2 A;  4EKU A;  1XR0 B;  2DLW A;  2D11 A;  3AJ4 A;  3WYF B;  2IFS A;  3VIA A;  3PG7 A;  4K17 A;  1PFJ A;  2KGX B;  2Z0P A;  3TVV A;  2L1C A;  1EGX A;  1X86 A;  3CXB B;  3AU5 A;  4D0N B;  2D10 A;  4HDO A;  1MAI A;  2YT0 A;  3SYX A;  5C6R A;  3SO6 A;  2COC A;  2P0F A;  4A5K A;  4IOY X;  3U8Z A;  1V88 A;  2H7E A;  3X23 A;  5FI0 A;  1I2H A;  1U5E A;  4HB0 B;  4TYZ A;  1M7R A;  1W1D A;  4H8S A;  2DKP A;  2EC1 A;  1ZC4 B;  2MDX A;  2DX1 A;  1EAZ A;  2H7D A;  1ZM0 A;  3MDB C;  3ULB A;  5HE0 A;  4DX8 A;  3TFM A;  4IAP A;  2DX5 A;  2I5F A;  4GXB A;  2QKL A;  1FAO A;  2MFQ A;  4XWX A;  4IFS A;  2DKQ A;  2RGN B;  2RUK B;  4EJN A;  2GCJ A;  4KHO A;  5DI9 B;  1FHW A;  3U7D A;  2FJL A;  1KZG A;  4GMV A;  4BBK A;  4WJ7 A;  5D3X A;  3KRX A;  5C5B A;  4CYE A;  4MK0 A;  1OY2 A;  5EFX A;  1P6S A;  2DTC A;  3QBV B;  1NTV A;  1V5M A;  4A6H A;  4B6H A;  3DXC A;  3SV1 A;  2D9X A;  3P6A A;  2W2X D;  1H10 A;  3PVL A;  5C16 A;  4ZRI A;  2Y8G A;  1UPR A;  1XOD A;  2Z0Q A;  5D3Y A;  4HAV B;  1X1F A;  4A6K A;  1GG3 A;  1WJM A; 
#chains in the Genus database with same CATH topology
 3UZT A;  2OTX A;  2VSZ A;  4QJ5 B;  4KVG B;  1BWN A;  2DFK A;  5J3T A;  1U2B A;  2Z59 A;  1Z87 A;  1MIZ B;  3NSU A;  2COF A;  1MPH A;  3V5W A;  1DDM A;  3MPX A;  5KQ4 A;  1V61 A;  2COA A;  2IYB A;  4HB4 B;  3ML4 A;  1NTY A;  3BJI A;  2YF0 A;  4QXA B;  2K2U A;  4ZRK A;  1OQN A;  5C79 A;  2R09 A;  1FB8 A;  1W1G A;  3PEG A;  1P3R A;  3A98 B;  2RNR B;  4HB2 B;  2N23 A;  1V5U A;  3NW8 A;  1MK9 B;  1NI2 A;  1ISN A;  2ZPY A;  2I1J A;  3F5R A;  4HSI A;  4GNK B;  1H4R A;  1FGY A;  3KSY A;  1SHC A;  5D27 A;  1FHX A;  1V89 A;  5HE3 A;  1ZVR A;  3KY9 A;  2D4Q A;  2DHI A;  1RRP B;  1BAK A;  2BCJ A;  3PSC A;  4HAW B;  3PVU A;  4CHM A;  4ZRJ A;  3SNH A;  2CAY A;  2YVC A;  1BTK A;  2D9W A;  1B55 A;  5LOP B;  5KCV A;  5C5B B;  3TCA A;  4K2P A;  2ZKM X;  5LON B;  3FEH A;  4GMX B;  3F0W A;  4HAZ B;  2RSG A;  4KHA A;  1TQZ A;  1UEF A;  1EF1 A;  3PVW A;  3GYO A;  4WSF A;  3P7Z A;  1PLS A;  1U29 A;  1EVH A;  3HK0 A;  5LG4 B;  3HSA A;  2DYQ A;  4HB3 B;  1QC6 A;  2X18 A;  3ODW A;  1Q67 A;  2R0D A;  2LYD A;  2KUQ A;  2COD A;  3D8F A;  2OQB A;  1J19 A;  5HE1 A;  2EJ8 A;  4GPT B;  1WG7 A;  2GCL A;  3RCP A;  2M14 A;  2NMB A;  1QQG A;  5J3Y A;  2GUM A;  3U12 A;  2YRY A;  2Z13 A;  3FVC A;  1U27 A;  1ZSQ A;  2P0H A;  1M7E A;  2Q13 A;  2LG1 A;  3VOQ A;  5D3V A;  2KCJ A;  1UPQ A;  3OHM B;  2PZ1 A;  5DIF B;  2Z0O A;  2D9V A;  3WA0 A;  3A8P A;  1XCG A;  3PZD A;  4HAY B;  2KIE A;  1GC7 A;  3O96 A;  5HE2 A;  2E2X A;  1X11 A;  2V76 A;  2XQN M;  2L2I A;  2K2J A;  1K5D B;  2GS0 A;  4KHB B;  2N0Y A;  2ELA A;  2W2W A;  4HDQ A;  1OMW A;  2DHK A;  2AEH A;  4MT7 A;  2K00 A;  2LOX A;  2ROZ B;  2CRF A;  3CIK A;  1MK7 B;  4PNK A;  5IRS A;  4DBB A;  4C0A A;  4QJ4 B;  5M4Y B;  3HW2 B;  3D8D A;  5JP4 A;  4HAX B;  1DBH A;  1E5W A;  1XD4 A;  3NWF A;  3ODX A;  1DDV A;  1T77 A;  3ZDT A;  2VRW B;  4A6F A;  3BIN A;  3DXD A;  2R2Y A;  1GC6 A;  1UNP A;  1Y19 B;  4DX9 0;  1XX0 A;  1X1G A;  3OAN A;  1ZYI A;  1KI1 B;  5I2S A;  3HQC A;  4PQ0 A;  1WVH A;  1SGH A;  1N3H A;  2LUL A;  4OT1 A;  4CHJ A;  1AWE A;  4TKN A;  2DYN A;  1XKE A;  3QWM A;  4KHB A;  2YT1 A;  3D8E A;  2LKO A;  1WI1 A;  4NY0 A;  4HHV A;  4YL8 A;  1V5P A;  4CSQ A;  2KUP A;  5JHH A;  2D2Q A;  4HAU B;  2G35 A;  2DA0 A;  2DHJ A;  2NZ8 B;  4DXA B;  4Y94 A;  2RRF A;  1FOE A;  4MY6 A;  2GJY A;  1X05 A;  2D9Z A;  1LB1 A;  2RVB B;  2ELB A;  5D3W A;  3A8Q A;  2HE7 A;  2YS3 A;  1FGZ A;  2J0K A;  2Y8F A;  4F7U P;  2Y7B A;  1DYN A;  1KZ7 A;  2AL6 A;  2CY5 A;  2P8V A;  5DHA B;  5KQ1 A;  3TW1 A;  3DXE A;  1MKE A;  2HTH B;  1WGQ A;  1BTN A;  1WJ1 A;  5DHF B;  4OSN A;  5JHG A;  2JP2 A;  2Z4D A;  3QIJ A;  2M38 A;  2UZS A;  4K81 A;  1MIX A;  1UNQ A;  3SUZ A;  5CLL B;  5GOW B;  5CLQ B;  3M1I B;  4A6F B;  5I2M A;  1FHO A;  5FI1 A;  2EMT A;  4HAT B;  3ULC A;  1DDW A;  2ADZ A;  4Z2M B;  3FM8 C;  4QJ3 B;  4D6W A;  4F7H A;  3IVF A;  3ZVR A;  1UNR A;  1U5F A;  2MKR A;  2J59 M;  2UVM A;  4L6E A;  2VKI A;  3T06 A;  5J3Q A;  2YSZ A;  2I1K A;  1U5D A;  1J0W A;  3N7C A;  4WVF B;  3ODO A;  2CY4 A;  1NU2 A;  2EMS A;  1TXD A;  3LJU X;  2LOZ A;  1P5T A;  2YS5 A;  3FSS A;  2KR0 A;  2D9Y A;  2I5C A;  3NWD A;  1RJ2 A;  2MWN B;  2QKM A;  5DH9 B;  2RLO A;  1AQC A;  2J0M A;  2YS1 A;  3B77 A;  2ROV A;  1I7A A;  1WGU A;  4P7I A;  4K2O A;  1K5G B;  4GZU A;  2KIG A;  4NSW A;  4DIX A;  4Z2N A;  1TJ6 A;  1LW3 A;  3GYP A;  1U5G A;  4F7G A;  5JLJ B;  4GN1 A;  1DRO A;  2FJU B;  2W2X C;  2DN6 A;  2J0J A;  3G9W A;  4KAX B;  5L81 A;  1ZC3 B;  3KRW A;  3AU4 A;  3HIE A;  1Y5O A;  2P0D A;  4EMO A;  3KZ1 A;  2UZR A;  3TO1 A;  1IRS A;  1PMS A;  4YON A;  1W1H A;  3PP2 A;  4EKU A;  1XR0 B;  2DLW A;  2D11 A;  3AJ4 A;  3WYF B;  2IFS A;  3VIA A;  3PG7 A;  4K17 A;  1PFJ A;  2KGX B;  2Z0P A;  3TVV A;  2L1C A;  2YT2 A;  1EGX A;  1X86 A;  3CXB B;  3AU5 A;  4D0N B;  2D10 A;  4HDO A;  1MAI A;  2YT0 A;  3SYX A;  5C6R A;  3SO6 A;  2COC A;  2P0F A;  4A5K A;  4IOY X;  3U8Z A;  1V88 A;  2H7E A;  3X23 A;  5FI0 A;  1I2H A;  1MI1 A;  1U5E A;  4HB0 B;  4TYZ A;  1M7R A;  1W1D A;  4H8S A;  2DKP A;  2EC1 A;  1ZC4 B;  2MDX A;  2K49 A;  2DX1 A;  1EAZ A;  2H7D A;  1ZM0 A;  3MDB C;  3ULB A;  5HE0 A;  4DX8 A;  3TFM A;  4IAP A;  2DX5 A;  2I5F A;  2K8E A;  4GXB A;  2QKL A;  1FAO A;  3A58 A;  2MFQ A;  4XWX A;  4IFS A;  2NBV A;  2DKQ A;  2RGN B;  4L1R A;  2RUK B;  4EJN A;  2GCJ A;  4KHO A;  5DI9 B;  1FHW A;  3DCX A;  2FJL A;  3U7D A;  1KZG A;  4GMV A;  4BBK A;  4WJ7 A;  3NWA A;  5D3X A;  3KRX A;  5C5B A;  4GOU A;  4CYE A;  4MK0 A;  1OY2 A;  5EFX A;  1P6S A;  2DTC A;  3QBV B;  1NTV A;  1V5M A;  4A6H A;  4B6H A;  3DXC A;  3SV1 A;  2D9X A;  3P6A A;  2W2X D;  1H10 A;  3PVL A;  5C16 A;  4ZRI A;  2Y8G A;  1UPR A;  1XOD A;  2Z0Q A;  5D3Y A;  4HAV B;  1X1F A;  4A6K A;  1GG3 A;  1WJM A;  2Z14 A; 
#chains in the Genus database with same CATH homology
 3UZT A;  2OTX A;  2VSZ A;  4KVG B;  1BWN A;  2DFK A;  5J3T A;  1U2B A;  1Z87 A;  1MIZ B;  3NSU A;  2COF A;  1MPH A;  3V5W A;  1DDM A;  3MPX A;  5KQ4 A;  1V61 A;  2COA A;  2IYB A;  4HB4 B;  3ML4 A;  1NTY A;  3BJI A;  2YF0 A;  4ZRK A;  2K2U A;  1OQN A;  5C79 A;  2R09 A;  1FB8 A;  1W1G A;  3PEG A;  1P3R A;  3A98 B;  2RNR B;  4HB2 B;  2N23 A;  1V5U A;  1MK9 B;  1NI2 A;  1ISN A;  2ZPY A;  2I1J A;  3F5R A;  1H4R A;  1FGY A;  3KSY A;  1SHC A;  5D27 A;  1FHX A;  1V89 A;  5HE3 A;  1ZVR A;  3KY9 A;  2D4Q A;  2DHI A;  1RRP B;  1BAK A;  2BCJ A;  3PSC A;  4HAW B;  3PVU A;  4CHM A;  4ZRJ A;  3SNH A;  2CAY A;  2YVC A;  1BTK A;  2D9W A;  1B55 A;  5LOP B;  5KCV A;  5C5B B;  3TCA A;  4K2P A;  5LON B;  3FEH A;  4GMX B;  3F0W A;  4HAZ B;  2RSG A;  4KHA A;  1TQZ A;  1UEF A;  1EF1 A;  3PVW A;  3GYO A;  4WSF A;  3P7Z A;  1PLS A;  1U29 A;  1EVH A;  3HK0 A;  2DYQ A;  4HB3 B;  1QC6 A;  2X18 A;  3ODW A;  1Q67 A;  2R0D A;  2LYD A;  2COD A;  3D8F A;  2OQB A;  1J19 A;  5HE1 A;  2EJ8 A;  4GPT B;  1WG7 A;  2GCL A;  3RCP A;  2M14 A;  2NMB A;  1QQG A;  5J3Y A;  2YRY A;  1U27 A;  1ZSQ A;  2P0H A;  1M7E A;  2Q13 A;  2LG1 A;  3VOQ A;  5D3V A;  2KCJ A;  1UPQ A;  2PZ1 A;  5DIF B;  2Z0O A;  2D9V A;  3WA0 A;  3A8P A;  1XCG A;  3PZD A;  4HAY B;  1GC7 A;  3O96 A;  5HE2 A;  2E2X A;  1X11 A;  2V76 A;  2XQN M;  2L2I A;  2K2J A;  1K5D B;  2GS0 A;  4KHB B;  2N0Y A;  2ELA A;  2W2W A;  4HDQ A;  1OMW A;  2DHK A;  2AEH A;  4MT7 A;  2K00 A;  2LOX A;  2ROZ B;  2CRF A;  3CIK A;  1MK7 B;  4PNK A;  4DBB A;  4C0A A;  3HW2 B;  3D8D A;  5JP4 A;  4HAX B;  1DBH A;  1E5W A;  1XD4 A;  3ODX A;  1DDV A;  3ZDT A;  2VRW B;  4A6F A;  3BIN A;  3DXD A;  1GC6 A;  1UNP A;  1Y19 B;  4DX9 0;  1XX0 A;  1X1G A;  3OAN A;  1KI1 B;  3HQC A;  4PQ0 A;  1WVH A;  1SGH A;  1N3H A;  2LUL A;  4CHJ A;  1AWE A;  4TKN A;  2DYN A;  1XKE A;  3QWM A;  2YT1 A;  3D8E A;  2LKO A;  1WI1 A;  4NY0 A;  4HHV A;  4YL8 A;  1V5P A;  2KUP A;  5JHH A;  2D2Q A;  4HAU B;  2G35 A;  2DA0 A;  2DHJ A;  2NZ8 B;  4DXA B;  4Y94 A;  1FOE A;  4MY6 A;  2GJY A;  1X05 A;  2D9Z A;  1LB1 A;  2RVB B;  2ELB A;  5D3W A;  3A8Q A;  2HE7 A;  2YS3 A;  1FGZ A;  2J0K A;  2Y8F A;  4F7U P;  2Y7B A;  1DYN A;  1KZ7 A;  2AL6 A;  2CY5 A;  2P8V A;  5DHA B;  5KQ1 A;  3TW1 A;  3DXE A;  1MKE A;  2HTH B;  1WGQ A;  1BTN A;  1WJ1 A;  5DHF B;  5JHG A;  2JP2 A;  3QIJ A;  2M38 A;  2UZS A;  4K81 A;  1MIX A;  1UNQ A;  3SUZ A;  5CLL B;  5GOW B;  5CLQ B;  3M1I B;  4A6F B;  1FHO A;  5FI1 A;  2EMT A;  4HAT B;  3ULC A;  1DDW A;  2ADZ A;  4Z2M B;  3FM8 C;  4F7H A;  3IVF A;  3ZVR A;  1UNR A;  1U5F A;  2MKR A;  2J59 M;  2UVM A;  4L6E A;  2VKI A;  3T06 A;  5J3Q A;  2YSZ A;  2I1K A;  1U5D A;  1J0W A;  3N7C A;  4WVF B;  3ODO A;  2CY4 A;  1NU2 A;  2EMS A;  1TXD A;  3LJU X;  2LOZ A;  1P5T A;  2YS5 A;  3FSS A;  2D9Y A;  2I5C A;  1RJ2 A;  2MWN B;  2QKM A;  5DH9 B;  2RLO A;  1AQC A;  2J0M A;  2YS1 A;  2ROV A;  1I7A A;  1WGU A;  4P7I A;  4K2O A;  1K5G B;  4GZU A;  4NSW A;  4Z2N A;  1TJ6 A;  1LW3 A;  3GYP A;  1U5G A;  4F7G A;  5JLJ B;  4GN1 A;  1DRO A;  2W2X C;  2DN6 A;  2J0J A;  3G9W A;  4KAX B;  5L81 A;  1ZC3 B;  3KRW A;  3AU4 A;  1Y5O A;  2P0D A;  4EMO A;  3KZ1 A;  2UZR A;  3TO1 A;  1IRS A;  1PMS A;  4YON A;  1W1H A;  3PP2 A;  4EKU A;  1XR0 B;  2DLW A;  2D11 A;  3AJ4 A;  3WYF B;  2IFS A;  3VIA A;  3PG7 A;  4K17 A;  1PFJ A;  2KGX B;  2Z0P A;  3TVV A;  2L1C A;  1EGX A;  1X86 A;  3CXB B;  3AU5 A;  4D0N B;  2D10 A;  4HDO A;  1MAI A;  2YT0 A;  3SYX A;  5C6R A;  3SO6 A;  2COC A;  2P0F A;  4A5K A;  4IOY X;  3U8Z A;  1V88 A;  2H7E A;  3X23 A;  5FI0 A;  1I2H A;  1U5E A;  4HB0 B;  4TYZ A;  1M7R A;  1W1D A;  4H8S A;  2DKP A;  2EC1 A;  1ZC4 B;  2MDX A;  2DX1 A;  1EAZ A;  2H7D A;  1ZM0 A;  3MDB C;  3ULB A;  5HE0 A;  4DX8 A;  3TFM A;  4IAP A;  2DX5 A;  2I5F A;  4GXB A;  2QKL A;  1FAO A;  2MFQ A;  4XWX A;  4IFS A;  2DKQ A;  2RGN B;  2RUK B;  4EJN A;  2GCJ A;  4KHO A;  5DI9 B;  1FHW A;  3U7D A;  2FJL A;  1KZG A;  4GMV A;  4BBK A;  4WJ7 A;  5D3X A;  3KRX A;  5C5B A;  4CYE A;  4MK0 A;  1OY2 A;  5EFX A;  1P6S A;  2DTC A;  3QBV B;  1NTV A;  1V5M A;  4A6H A;  4B6H A;  3DXC A;  3SV1 A;  2D9X A;  3P6A A;  2W2X D;  1H10 A;  3PVL A;  5C16 A;  4ZRI A;  2Y8G A;  1UPR A;  1XOD A;  2Z0Q A;  5D3Y A;  4HAV B;  1X1F A;  4A6K A;  1GG3 A;  1WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...