1EVHA

Evh1 domain from murine enabled in complex with acta peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROTEIN (MENA EVH1 DOMAIN)
publication title Structure of the enabled/VASP homology 1 domain-peptide complex: a key component in the spatial control of actin assembly.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1evhA00
2COFA 2LOZA 4WSFA 5DH9B 1DDVA 3KY9A 5C6RA 1MAIA 2BCJA 2G35A 4A6KA 1P5TA 1TXDA 1PLSA 2W2WA 3X23A 2ELAA 1U29A 2HTHB 1I7AA 2QKLA 3P6AA 2H7EA 2EJ8A 5D27A 3ODOA 2RNRB 2V76A 1M7RA 3A8PA 4IFSA 1W1HA 1M7EA 4CHMA 1P6SA 2YRYA 3ULBA 1Z87A 1E5WA 4KHOA 1IRSA 3WA0A 1OQNA 2DFKA 3GYOA 2CY4A 4A6HA 3FEHA 2RGNB 2CRFA 3V5WA 2UVMA 3N7CA 5JHHA 1UNRA 1K5DB 1BWNA 2LOXA 4HAUB 1EAZA 2P8VA 1MK7B 3D8DA 5HE1A 1ISNA 3A8QA 3PVWA 2COAA 3PSCA 3AJ4A 1MK9B 2GCJA 1UEFA 4DX8A 1PMSA 2Z0QA 4D0NB 3MDBC 2OTXA 4WJ7A 1RRPB 4K81A 3KRXA 1FB8A 4TKNA 2LG1A 2K2JA 1P3RA 3F0WA 3F5RA 2XQNM 2Y8FA 1GC7A 1FGZA 3PEGA 1EVHA 5C16A 4KHAA 2P0FA 4DBBA 3GYPA 1MIXA 2NMBA 4DXAB 1SHCA 1U5GA 1UNPA 2CY5A 2YF0A 2CODA 1NU2A 3ML4A 1NI2A 4F7HA 2YVCA 1GC6A 3TVVA 1OY2A 2L1CA 2VRWB 1ZC3B 2HE7A 4HAVB 4HAXB 1U5EA 1V5MA 2KUPA 3A98B 2D10A 1J19A 4H8SA 1WJ1A 4ZRIA 1X11A 4K17A 2DTCA 2X18A 2YS3A 2UZRA 4WVFB 5J3YA 4L6EA 5DIFB 4HATB 1U2BA 1FHXA 2GS0A 1KI1B 3DXDA 2AL6A 1H4RA 1XKEA 3DXCA 2J0KA 4DX90 2DX5A 2EMSA 2AEHA 2UZSA 1FAOA 3HQCA 4GZUA 2DHJA 3UZTA 5J3TA 1WGQA 1AQCA 3SYXA 5HE3A 2J59M 2DKQA 2COCA 3SO6A 3U8ZA 1PFJA 1XD4A 2DYNA 2EC1A 1ZM0A 4EKUA 5CLLB 2P0HA 2I1JA 2IYBA 5KQ1A 2ROVA 4HAYB 4KAXB 5FI0A 4F7UP 2Z0PA 4TYZA 5LOPB 3RCPA 1XCGA 3O96A 3PG7A 3VIAA 2RUKB 4MT7A 4IAPA 1WVHA 2YT1A 4GPTB 3ODWA 1FGYA 1ZC4B 1W1DA 1NTVA 1EF1A 2ZPYA 2L2IA 2DHKA 4F7GA 3ZDTA 5D3YA 4EMOA 1WGUA 2DX1A 2K00A 5KQ4A 2PZ1A 2DYQA 2YS5A 1FHWA 5EFXA 1BAKA 2DKPA 1DBHA 5C79A 4ZRKA 3CIKA 2H7DA 1SGHA 3M1IB 5LONB 1UPQA 3BINA 2D9YA 2I1KA 1BTKA 5CLQB 3TCAA 1U5DA 1QC6A 1MIZB 2ADZA 4MY6A 3HW2B 3FSSA 2ROZB 5JLJB 2M14A 1Q67A 4A5KA 2I5CA 2RLOA 3ULCA 4GMXB 3T06A 1OMWA 4EJNA 1V61A 5JP4A 5D3VA 3MPXA 2RVBB 4HAZB 1UPRA 1DDMA 5DHFB 5HE2A 2J0MA 2LKOA 5D3XA 4C0AA 4YL8A 4GN1A 1LB1A 1QQGA 2RSGA 3SNHA 5GOWB 2DA0A 3OANA 2YS1A 3PVLA 1KZ7A 1FOEA 1U27A 2D9XA 2GCLA 3TW1A 3NSUA 4Z2NA 4GMVA 3BJIA 5KCVA 3DXEA 2CAYA 3G9WA 1Y19B 3PZDA 1V5UA 1DYNA 5D3WA 2IFSA 2J0JA 2MFQA 2YSZA 1UNQA 4HDQA 5FI1A 1BTNA 4ZRJA 2VSZA 4HHVA 1XR0B 1H10A 4K2PA 3SUZA 5C5BA 1FHOA 5L81A 4Z2MB 3SV1A 4HAWB 3AU4A 1NTYA 2EMTA 4HB0B 2MKRA 4PQ0A 2VKIA 2D9ZA 3U7DA 2W2XD 2NZ8B 5DI9B 2W2XC 4NY0A 2D9VA 5C5BB 2P0DA 2N23A 1RJ2A 1V5PA 2LYDA 2D11A 4A6FA 2DN6A 1U5FA 2Y8GA 3FM8C 3KZ1A 3IVFA 2DLWA 2MWNB 1X1GA 2DHIA 5DHAB 2D2QA 3PVUA 4NSWA 1X05A 4HB4B 3KSYA 2ELBA 4CHJA 2K2UA 3ZVRA 1GG3A 3TFMA 4A6FB 2YT0A 2R0DA 1W1GA 2Q13A 2OQBA 4PNKA 3P7ZA 1ZSQA 1ZVRA 2D4QA 1MPHA 3D8FA 4KVGB 4Y94A 1TJ6A 1LW3A 2Z0OA 3TO1A 1TQZA 4IOYX 3QIJA 4HB2B 3ODXA 4YONA 3QWMA 5J3QA 5HE0A 1X1FA 2E2XA 4KHBB 2MDXA 2QKMA 2JP2A 1J0WA 4CYEA 2LULA 1N3HA 1WG7A 2I5FA 1AWEA 1WJMA 5JHGA 4P7IA 2KCJA 4B6HA 3CXBB 3HK0A 1MKEA 1KZGA 4XWXA 2KGXB 1EGXA 1XX0A 2D9WA 1WI1A 1V88A 2Y7BA 3KRWA 3PP2A 2M38A 2N0YA 1V89A 1DROA 3LJUX 2FJLA 1B55A 3QBVB 1K5GB 4GXBA 2GJYA 1DDWA 3D8EA 3VOQA 1XODA 4HB3B 3AU5A 2R09A 4MK0A 1I2HA 4K2OA 4HDOA 1Y5OA 3WYFB 4BBKA 1X86A
chains in the Genus database with same CATH superfamily
2COFA 2LOZA 4WSFA 5DH9B 1DDVA 3KY9A 5C6RA 1MAIA 2BCJA 2G35A 4GOUA 4A6KA 1P5TA 1TXDA 1PLSA 2NBVA 2W2WA 3X23A 2ELAA 1U29A 2HTHB 1I7AA 2QKLA 3P6AA 2H7EA 2EJ8A 5D27A 3ODOA 2RNRB 2V76A 1M7RA 3A8PA 4IFSA 1W1HA 1M7EA 2Z4DA 4CHMA 1P6SA 2YRYA 3ULBA 1Z87A 1E5WA 4KHOA 1IRSA 3WA0A 3FVCA 1OQNA 2DFKA 3GYOA 2CY4A 4A6HA 3FEHA 2RGNB 2CRFA 4HSIA 3U12A 3V5WA 4OSNA 2UVMA 3N7CA 5JHHA 1UNRA 1K5DB 1BWNA 2LOXA 4HAUB 1EAZA 2P8VA 1MK7B 3D8DA 5HE1A 1ISNA 3A8QA 3PVWA 2COAA 3PSCA 4KHBA 3AJ4A 2RRFA 1MK9B 2GCJA 1UEFA 4DX8A 1PMSA 2Z0QA 4D0NB 3MDBC 2OTXA 4WJ7A 1RRPB 4K81A 3KRXA 1FB8A 4TKNA 2LG1A 2K2JA 1P3RA 3F0WA 3F5RA 2XQNM 2Y8FA 1GC7A 1FGZA 3PEGA 1EVHA 5C16A 4KHAA 2P0FA 4DBBA 3GYPA 1MIXA 2NMBA 4DXAB 1SHCA 1U5GA 1UNPA 2CY5A 2YF0A 4DIXA 2CODA 1NU2A 3ML4A 1NI2A 4F7HA 2YVCA 1GC6A 3TVVA 1OY2A 2L1CA 2VRWB 1ZC3B 2HE7A 4HAVB 4HAXB 1U5EA 1V5MA 2KUPA 3A98B 2D10A 1J19A 4OT1A 4H8SA 1WJ1A 2KIEA 4ZRIA 1X11A 4K17A 5M4YB 2DTCA 2X18A 5IRSA 2YS3A 2UZRA 4WVFB 4GNKB 5J3YA 4QJ5B 2KIGA 4L6EA 5DIFB 4HATB 1U2BA 1FHXA 2GUMA 2GS0A 1KI1B 3DXDA 2AL6A 1H4RA 1XKEA 3DXCA 2J0KA 5LG4B 4DX90 2DX5A 2EMSA 2AEHA 2UZSA 1FAOA 3OHMB 3HQCA 4GZUA 2DHJA 3UZTA 5J3TA 1WGQA 1AQCA 3SYXA 5HE3A 2J59M 2DKQA 2COCA 3SO6A 3U8ZA 1PFJA 1XD4A 3NWDA 2DYNA 2EC1A 1ZM0A 4EKUA 5CLLB 2P0HA 2I1JA 2IYBA 5KQ1A 2ROVA 4HAYB 4KAXB 5FI0A 4F7UP 2Z0PA 4TYZA 5LOPB 3RCPA 4L1RA 1XCGA 3O96A 3PG7A 3VIAA 3NWFA 2RUKB 4MT7A 4IAPA 1WVHA 2YT1A 4GPTB 3ODWA 1FGYA 1ZC4B 1W1DA 1NTVA 1EF1A 2ZPYA 5I2SA 2L2IA 2DHKA 4F7GA 3ZDTA 5D3YA 4EMOA 1WGUA 2DX1A 2K00A 5KQ4A 2PZ1A 2DYQA 2YS5A 1FHWA 5EFXA 1BAKA 2DKPA 1DBHA 5C79A 5I2MA 4ZRKA 3CIKA 2H7DA 1SGHA 3M1IB 5LONB 1UPQA 3BINA 2KR0A 2D9YA 2I1KA 1BTKA 5CLQB 3TCAA 1U5DA 1QC6A 1MIZB 2ADZA 4MY6A 3HW2B 3FSSA 2ROZB 5JLJB 2R2YA 2M14A 1Q67A 4QJ3B 2K49A 4A5KA 2I5CA 2RLOA 3ULCA 4GMXB 3T06A 1OMWA 4EJNA 1V61A 5JP4A 5D3VA 3MPXA 2RVBB 4HAZB 1UPRA 1DDMA 5DHFB 5HE2A 1ZYIA 2J0MA 2LKOA 1MI1A 5D3XA 4C0AA 3HSAA 4YL8A 4GN1A 1LB1A 1QQGA 2RSGA 3SNHA 5GOWB 2DA0A 3OANA 2YS1A 3PVLA 3A58A 1KZ7A 2Z59A 1FOEA 1U27A 2KUQA 2D9XA 2GCLA 3TW1A 3NSUA 4Z2NA 3B77A 4GMVA 3BJIA 5KCVA 3DXEA 2CAYA 3G9WA 1Y19B 4CSQA 3PZDA 1V5UA 1DYNA 5D3WA 2IFSA 2J0JA 2MFQA 2YSZA 2K8EA 1UNQA 4QXAB 4HDQA 5FI1A 1BTNA 4ZRJA 2VSZA 4HHVA 1XR0B 1H10A 4K2PA 3SUZA 5C5BA 1FHOA 5L81A 4Z2MB 3SV1A 4HAWB 3AU4A 1NTYA 2EMTA 4HB0B 2MKRA 2ZKMX 4PQ0A 2VKIA 2D9ZA 3U7DA 2W2XD 2NZ8B 5DI9B 2W2XC 4NY0A 2D9VA 5C5BB 2P0DA 2N23A 1RJ2A 1V5PA 2LYDA 2D11A 4D6WA 4A6FA 2DN6A 1U5FA 2Y8GA 3FM8C 2FJUB 3IVFA 3KZ1A 2DLWA 2MWNB 1X1GA 2DHIA 5DHAB 2D2QA 3PVUA 4NSWA 1X05A 4HB4B 3KSYA 2ELBA 4CHJA 2K2UA 3ZVRA 1GG3A 3TFMA 4A6FB 2YT0A 2R0DA 1W1GA 2Z14A 2Q13A 2OQBA 3NWAA 4PNKA 3P7ZA 2Z13A 1ZSQA 1ZVRA 2D4QA 1MPHA 3D8FA 4KVGB 4Y94A 1TJ6A 1LW3A 2Z0OA 3TO1A 1TQZA 4IOYX 3QIJA 4HB2B 3ODXA 3DCXA 4YONA 3QWMA 5J3QA 5HE0A 1X1FA 2E2XA 4KHBB 2MDXA 2QKMA 2JP2A 1J0WA 4CYEA 2LULA 1N3HA 1WG7A 2I5FA 1AWEA 1WJMA 5JHGA 4P7IA 2KCJA 4B6HA 3CXBB 3HIEA 3HK0A 1MKEA 1KZGA 4XWXA 2KGXB 1EGXA 1XX0A 2D9WA 1WI1A 2YT2A 1V88A 2Y7BA 3KRWA 3PP2A 2M38A 1T77A 2N0YA 1V89A 1DROA 3LJUX 2FJLA 1B55A 3QBVB 1K5GB 4GXBA 3NW8A 4QJ4B 2GJYA 1DDWA 3D8EA 3VOQA 1XODA 4HB3B 3AU5A 2R09A 4MK0A 1I2HA 4K2OA 4HDOA 1Y5OA 3WYFB 4BBKA 1X86A
chains in the Genus database with same CATH topology
2COFA 2LOZA 4WSFA 5DH9B 1DDVA 3KY9A 5C6RA 1MAIA 2BCJA 2G35A 4A6KA 1P5TA 1TXDA 1PLSA 2W2WA 3X23A 2ELAA 1U29A 2HTHB 1I7AA 2QKLA 3P6AA 2H7EA 2EJ8A 5D27A 3ODOA 2RNRB 2V76A 1M7RA 3A8PA 4IFSA 1W1HA 1M7EA 4CHMA 1P6SA 2YRYA 3ULBA 1Z87A 1E5WA 4KHOA 1IRSA 3WA0A 1OQNA 2DFKA 3GYOA 2CY4A 4A6HA 3FEHA 2RGNB 2CRFA 3V5WA 2UVMA 3N7CA 5JHHA 1UNRA 1K5DB 1BWNA 2LOXA 4HAUB 1EAZA 2P8VA 1MK7B 3D8DA 5HE1A 1ISNA 3A8QA 3PVWA 2COAA 3PSCA 3AJ4A 1MK9B 2GCJA 1UEFA 4DX8A 1PMSA 2Z0QA 4D0NB 3MDBC 2OTXA 4WJ7A 1RRPB 4K81A 3KRXA 1FB8A 4TKNA 2LG1A 2K2JA 1P3RA 3F0WA 3F5RA 2XQNM 2Y8FA 1GC7A 1FGZA 3PEGA 1EVHA 5C16A 4KHAA 2P0FA 4DBBA 3GYPA 1MIXA 2NMBA 4DXAB 1SHCA 1U5GA 1UNPA 2CY5A 2YF0A 2CODA 1NU2A 3ML4A 1NI2A 4F7HA 2YVCA 1GC6A 3TVVA 1OY2A 2L1CA 2VRWB 1ZC3B 2HE7A 4HAVB 4HAXB 1U5EA 1V5MA 2KUPA 3A98B 2D10A 1J19A 4H8SA 1WJ1A 4ZRIA 1X11A 4K17A 2DTCA 2X18A 2YS3A 2UZRA 4WVFB 5J3YA 4L6EA 5DIFB 4HATB 1U2BA 1FHXA 2GS0A 1KI1B 3DXDA 2AL6A 1H4RA 1XKEA 3DXCA 2J0KA 4DX90 2DX5A 2EMSA 2AEHA 2UZSA 1FAOA 3HQCA 4GZUA 2DHJA 3UZTA 5J3TA 1WGQA 1AQCA 3SYXA 5HE3A 2J59M 2DKQA 2COCA 3SO6A 3U8ZA 1PFJA 1XD4A 2DYNA 2EC1A 1ZM0A 4EKUA 5CLLB 2P0HA 2I1JA 2IYBA 5KQ1A 2ROVA 4HAYB 4KAXB 5FI0A 4F7UP 2Z0PA 4TYZA 5LOPB 3RCPA 1XCGA 3O96A 3PG7A 3VIAA 2RUKB 4MT7A 4IAPA 1WVHA 2YT1A 4GPTB 3ODWA 1FGYA 1ZC4B 1W1DA 1NTVA 1EF1A 2ZPYA 2L2IA 2DHKA 4F7GA 3ZDTA 5D3YA 4EMOA 1WGUA 2DX1A 2K00A 5KQ4A 2PZ1A 2DYQA 2YS5A 1FHWA 5EFXA 1BAKA 2DKPA 1DBHA 5C79A 4ZRKA 3CIKA 2H7DA 1SGHA 3M1IB 5LONB 1UPQA 3BINA 2D9YA 2I1KA 1BTKA 5CLQB 3TCAA 1U5DA 1QC6A 1MIZB 2ADZA 4MY6A 3HW2B 3FSSA 2ROZB 5JLJB 2M14A 1Q67A 4A5KA 2I5CA 2RLOA 3ULCA 4GMXB 3T06A 1OMWA 4EJNA 1V61A 5JP4A 5D3VA 3MPXA 2RVBB 4HAZB 1UPRA 1DDMA 5DHFB 5HE2A 2J0MA 2LKOA 5D3XA 4C0AA 4YL8A 4GN1A 1LB1A 1QQGA 2RSGA 3SNHA 5GOWB 2DA0A 3OANA 2YS1A 3PVLA 1KZ7A 1FOEA 1U27A 2D9XA 2GCLA 3TW1A 3NSUA 4Z2NA 4GMVA 3BJIA 5KCVA 3DXEA 2CAYA 3G9WA 1Y19B 3PZDA 1V5UA 1DYNA 5D3WA 2IFSA 2J0JA 2MFQA 2YSZA 1UNQA 4HDQA 5FI1A 1BTNA 4ZRJA 2VSZA 4HHVA 1XR0B 1H10A 4K2PA 3SUZA 5C5BA 1FHOA 5L81A 4Z2MB 3SV1A 4HAWB 3AU4A 1NTYA 2EMTA 4HB0B 2MKRA 4PQ0A 2VKIA 2D9ZA 3U7DA 2W2XD 2NZ8B 5DI9B 2W2XC 4NY0A 2D9VA 5C5BB 2P0DA 2N23A 1RJ2A 1V5PA 2LYDA 2D11A 4A6FA 2DN6A 1U5FA 2Y8GA 3FM8C 3KZ1A 3IVFA 2DLWA 2MWNB 1X1GA 2DHIA 5DHAB 2D2QA 3PVUA 4NSWA 1X05A 4HB4B 3KSYA 2ELBA 4CHJA 2K2UA 3ZVRA 1GG3A 3TFMA 4A6FB 2YT0A 2R0DA 1W1GA 2Q13A 2OQBA 4PNKA 3P7ZA 1ZSQA 1ZVRA 2D4QA 1MPHA 3D8FA 4KVGB 4Y94A 1TJ6A 1LW3A 2Z0OA 3TO1A 1TQZA 4IOYX 3QIJA 4HB2B 3ODXA 4YONA 3QWMA 5J3QA 5HE0A 1X1FA 2E2XA 4KHBB 2MDXA 2QKMA 2JP2A 1J0WA 4CYEA 2LULA 1N3HA 1WG7A 2I5FA 1AWEA 1WJMA 5JHGA 4P7IA 2KCJA 4B6HA 3CXBB 3HK0A 1MKEA 1KZGA 4XWXA 2KGXB 1EGXA 1XX0A 2D9WA 1WI1A 1V88A 2Y7BA 3KRWA 3PP2A 2M38A 2N0YA 1V89A 1DROA 3LJUX 2FJLA 1B55A 3QBVB 1K5GB 4GXBA 2GJYA 1DDWA 3D8EA 3VOQA 1XODA 4HB3B 3AU5A 2R09A 4MK0A 1I2HA 4K2OA 4HDOA 1Y5OA 3WYFB 4BBKA 1X86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  2LOZ A;  4WSF A;  5DH9 B;  1DDV A;  3KY9 A;  5C6R A;  1MAI A;  2BCJ A;  2G35 A;  4A6K A;  1P5T A;  1TXD A;  1PLS A;  2W2W A;  3X23 A;  2ELA A;  1U29 A;  2HTH B;  1I7A A;  2QKL A;  3P6A A;  2H7E A;  2EJ8 A;  5D27 A;  3ODO A;  2RNR B;  2V76 A;  1M7R A;  3A8P A;  4IFS A;  1W1H A;  1M7E A;  4CHM A;  1P6S A;  2YRY A;  3ULB A;  1Z87 A;  1E5W A;  4KHO A;  1IRS A;  3WA0 A;  1OQN A;  2DFK A;  3GYO A;  2CY4 A;  4A6H A;  3FEH A;  2RGN B;  2CRF A;  3V5W A;  2UVM A;  3N7C A;  5JHH A;  1UNR A;  1K5D B;  1BWN A;  2LOX A;  4HAU B;  1EAZ A;  2P8V A;  1MK7 B;  3D8D A;  5HE1 A;  1ISN A;  3A8Q A;  3PVW A;  2COA A;  3PSC A;  3AJ4 A;  1MK9 B;  2GCJ A;  1UEF A;  4DX8 A;  1PMS A;  2Z0Q A;  4D0N B;  3MDB C;  2OTX A;  4WJ7 A;  1RRP B;  4K81 A;  3KRX A;  1FB8 A;  4TKN A;  2LG1 A;  2K2J A;  1P3R A;  3F0W A;  3F5R A;  2XQN M;  2Y8F A;  1GC7 A;  1FGZ A;  3PEG A;  1EVH A;  5C16 A;  4KHA A;  2P0F A;  4DBB A;  3GYP A;  1MIX A;  2NMB A;  4DXA B;  1SHC A;  1U5G A;  1UNP A;  2CY5 A;  2YF0 A;  2COD A;  1NU2 A;  3ML4 A;  1NI2 A;  4F7H A;  2YVC A;  1GC6 A;  3TVV A;  1OY2 A;  2L1C A;  2VRW B;  1ZC3 B;  2HE7 A;  4HAV B;  4HAX B;  1U5E A;  1V5M A;  2KUP A;  3A98 B;  2D10 A;  1J19 A;  4H8S A;  1WJ1 A;  4ZRI A;  1X11 A;  4K17 A;  2DTC A;  2X18 A;  2YS3 A;  2UZR A;  4WVF B;  5J3Y A;  4L6E A;  5DIF B;  4HAT B;  1U2B A;  1FHX A;  2GS0 A;  1KI1 B;  3DXD A;  2AL6 A;  1H4R A;  1XKE A;  3DXC A;  2J0K A;  4DX9 0;  2DX5 A;  2EMS A;  2AEH A;  2UZS A;  1FAO A;  3HQC A;  4GZU A;  2DHJ A;  3UZT A;  5J3T A;  1WGQ A;  1AQC A;  3SYX A;  5HE3 A;  2J59 M;  2DKQ A;  2COC A;  3SO6 A;  3U8Z A;  1PFJ A;  1XD4 A;  2DYN A;  2EC1 A;  1ZM0 A;  4EKU A;  5CLL B;  2P0H A;  2I1J A;  2IYB A;  5KQ1 A;  2ROV A;  4HAY B;  4KAX B;  5FI0 A;  4F7U P;  2Z0P A;  4TYZ A;  5LOP B;  3RCP A;  1XCG A;  3O96 A;  3PG7 A;  3VIA A;  2RUK B;  4MT7 A;  4IAP A;  1WVH A;  2YT1 A;  4GPT B;  3ODW A;  1FGY A;  1ZC4 B;  1W1D A;  1NTV A;  1EF1 A;  2ZPY A;  2L2I A;  2DHK A;  4F7G A;  3ZDT A;  5D3Y A;  4EMO A;  1WGU A;  2DX1 A;  2K00 A;  5KQ4 A;  2PZ1 A;  2DYQ A;  2YS5 A;  1FHW A;  5EFX A;  1BAK A;  2DKP A;  1DBH A;  5C79 A;  4ZRK A;  3CIK A;  2H7D A;  1SGH A;  3M1I B;  5LON B;  1UPQ A;  3BIN A;  2D9Y A;  2I1K A;  1BTK A;  5CLQ B;  3TCA A;  1U5D A;  1QC6 A;  1MIZ B;  2ADZ A;  4MY6 A;  3HW2 B;  3FSS A;  2ROZ B;  5JLJ B;  2M14 A;  1Q67 A;  4A5K A;  2I5C A;  2RLO A;  3ULC A;  4GMX B;  3T06 A;  1OMW A;  4EJN A;  1V61 A;  5JP4 A;  5D3V A;  3MPX A;  2RVB B;  4HAZ B;  1UPR A;  1DDM A;  5DHF B;  5HE2 A;  2J0M A;  2LKO A;  5D3X A;  4C0A A;  4YL8 A;  4GN1 A;  1LB1 A;  1QQG A;  2RSG A;  3SNH A;  5GOW B;  2DA0 A;  3OAN A;  2YS1 A;  3PVL A;  1KZ7 A;  1FOE A;  1U27 A;  2D9X A;  2GCL A;  3TW1 A;  3NSU A;  4Z2N A;  4GMV A;  3BJI A;  5KCV A;  3DXE A;  2CAY A;  3G9W A;  1Y19 B;  3PZD A;  1V5U A;  1DYN A;  5D3W A;  2IFS A;  2J0J A;  2MFQ A;  2YSZ A;  1UNQ A;  4HDQ A;  5FI1 A;  1BTN A;  4ZRJ A;  2VSZ A;  4HHV A;  1XR0 B;  1H10 A;  4K2P A;  3SUZ A;  5C5B A;  1FHO A;  5L81 A;  4Z2M B;  3SV1 A;  4HAW B;  3AU4 A;  1NTY A;  2EMT A;  4HB0 B;  2MKR A;  4PQ0 A;  2VKI A;  2D9Z A;  3U7D A;  2W2X D;  2NZ8 B;  5DI9 B;  2W2X C;  4NY0 A;  2D9V A;  5C5B B;  2P0D A;  2N23 A;  1RJ2 A;  1V5P A;  2LYD A;  2D11 A;  4A6F A;  2DN6 A;  1U5F A;  2Y8G A;  3FM8 C;  3KZ1 A;  3IVF A;  2DLW A;  2MWN B;  1X1G A;  2DHI A;  5DHA B;  2D2Q A;  3PVU A;  4NSW A;  1X05 A;  4HB4 B;  3KSY A;  2ELB A;  4CHJ A;  2K2U A;  3ZVR A;  1GG3 A;  3TFM A;  4A6F B;  2YT0 A;  2R0D A;  1W1G A;  2Q13 A;  2OQB A;  4PNK A;  3P7Z A;  1ZSQ A;  1ZVR A;  2D4Q A;  1MPH A;  3D8F A;  4KVG B;  4Y94 A;  1TJ6 A;  1LW3 A;  2Z0O A;  3TO1 A;  1TQZ A;  4IOY X;  3QIJ A;  4HB2 B;  3ODX A;  4YON A;  3QWM A;  5J3Q A;  5HE0 A;  1X1F A;  2E2X A;  4KHB B;  2MDX A;  2QKM A;  2JP2 A;  1J0W A;  4CYE A;  2LUL A;  1N3H A;  1WG7 A;  2I5F A;  1AWE A;  1WJM A;  5JHG A;  4P7I A;  2KCJ A;  4B6H A;  3CXB B;  3HK0 A;  1MKE A;  1KZG A;  4XWX A;  2KGX B;  1EGX A;  1XX0 A;  2D9W A;  1WI1 A;  1V88 A;  2Y7B A;  3KRW A;  3PP2 A;  2M38 A;  2N0Y A;  1V89 A;  1DRO A;  3LJU X;  2FJL A;  1B55 A;  3QBV B;  1K5G B;  4GXB A;  2GJY A;  1DDW A;  3D8E A;  3VOQ A;  1XOD A;  4HB3 B;  3AU5 A;  2R09 A;  4MK0 A;  1I2H A;  4K2O A;  4HDO A;  1Y5O A;  3WYF B;  4BBK A;  1X86 A; 
#chains in the Genus database with same CATH topology
 2COF A;  2LOZ A;  4WSF A;  5DH9 B;  1DDV A;  3KY9 A;  5C6R A;  1MAI A;  2BCJ A;  2G35 A;  4GOU A;  4A6K A;  1P5T A;  1TXD A;  1PLS A;  2NBV A;  2W2W A;  3X23 A;  2ELA A;  1U29 A;  2HTH B;  1I7A A;  2QKL A;  3P6A A;  2H7E A;  2EJ8 A;  5D27 A;  3ODO A;  2RNR B;  2V76 A;  1M7R A;  3A8P A;  4IFS A;  1W1H A;  1M7E A;  2Z4D A;  4CHM A;  1P6S A;  2YRY A;  3ULB A;  1Z87 A;  1E5W A;  4KHO A;  1IRS A;  3WA0 A;  3FVC A;  1OQN A;  2DFK A;  3GYO A;  2CY4 A;  4A6H A;  3FEH A;  2RGN B;  2CRF A;  4HSI A;  3U12 A;  3V5W A;  4OSN A;  2UVM A;  3N7C A;  5JHH A;  1UNR A;  1K5D B;  1BWN A;  2LOX A;  4HAU B;  1EAZ A;  2P8V A;  1MK7 B;  3D8D A;  5HE1 A;  1ISN A;  3A8Q A;  3PVW A;  2COA A;  3PSC A;  4KHB A;  3AJ4 A;  2RRF A;  1MK9 B;  2GCJ A;  1UEF A;  4DX8 A;  1PMS A;  2Z0Q A;  4D0N B;  3MDB C;  2OTX A;  4WJ7 A;  1RRP B;  4K81 A;  3KRX A;  1FB8 A;  4TKN A;  2LG1 A;  2K2J A;  1P3R A;  3F0W A;  3F5R A;  2XQN M;  2Y8F A;  1GC7 A;  1FGZ A;  3PEG A;  1EVH A;  5C16 A;  4KHA A;  2P0F A;  4DBB A;  3GYP A;  1MIX A;  2NMB A;  4DXA B;  1SHC A;  1U5G A;  1UNP A;  2CY5 A;  2YF0 A;  4DIX A;  2COD A;  1NU2 A;  3ML4 A;  1NI2 A;  4F7H A;  2YVC A;  1GC6 A;  3TVV A;  1OY2 A;  2L1C A;  2VRW B;  1ZC3 B;  2HE7 A;  4HAV B;  4HAX B;  1U5E A;  1V5M A;  2KUP A;  3A98 B;  2D10 A;  1J19 A;  4OT1 A;  4H8S A;  1WJ1 A;  2KIE A;  4ZRI A;  1X11 A;  4K17 A;  5M4Y B;  2DTC A;  2X18 A;  5IRS A;  2YS3 A;  2UZR A;  4WVF B;  4GNK B;  5J3Y A;  4QJ5 B;  2KIG A;  4L6E A;  5DIF B;  4HAT B;  1U2B A;  1FHX A;  2GUM A;  2GS0 A;  1KI1 B;  3DXD A;  2AL6 A;  1H4R A;  1XKE A;  3DXC A;  2J0K A;  5LG4 B;  4DX9 0;  2DX5 A;  2EMS A;  2AEH A;  2UZS A;  1FAO A;  3OHM B;  3HQC A;  4GZU A;  2DHJ A;  3UZT A;  5J3T A;  1WGQ A;  1AQC A;  3SYX A;  5HE3 A;  2J59 M;  2DKQ A;  2COC A;  3SO6 A;  3U8Z A;  1PFJ A;  1XD4 A;  3NWD A;  2DYN A;  2EC1 A;  1ZM0 A;  4EKU A;  5CLL B;  2P0H A;  2I1J A;  2IYB A;  5KQ1 A;  2ROV A;  4HAY B;  4KAX B;  5FI0 A;  4F7U P;  2Z0P A;  4TYZ A;  5LOP B;  3RCP A;  4L1R A;  1XCG A;  3O96 A;  3PG7 A;  3VIA A;  3NWF A;  2RUK B;  4MT7 A;  4IAP A;  1WVH A;  2YT1 A;  4GPT B;  3ODW A;  1FGY A;  1ZC4 B;  1W1D A;  1NTV A;  1EF1 A;  2ZPY A;  5I2S A;  2L2I A;  2DHK A;  4F7G A;  3ZDT A;  5D3Y A;  4EMO A;  1WGU A;  2DX1 A;  2K00 A;  5KQ4 A;  2PZ1 A;  2DYQ A;  2YS5 A;  1FHW A;  5EFX A;  1BAK A;  2DKP A;  1DBH A;  5C79 A;  5I2M A;  4ZRK A;  3CIK A;  2H7D A;  1SGH A;  3M1I B;  5LON B;  1UPQ A;  3BIN A;  2KR0 A;  2D9Y A;  2I1K A;  1BTK A;  5CLQ B;  3TCA A;  1U5D A;  1QC6 A;  1MIZ B;  2ADZ A;  4MY6 A;  3HW2 B;  3FSS A;  2ROZ B;  5JLJ B;  2R2Y A;  2M14 A;  1Q67 A;  4QJ3 B;  2K49 A;  4A5K A;  2I5C A;  2RLO A;  3ULC A;  4GMX B;  3T06 A;  1OMW A;  4EJN A;  1V61 A;  5JP4 A;  5D3V A;  3MPX A;  2RVB B;  4HAZ B;  1UPR A;  1DDM A;  5DHF B;  5HE2 A;  1ZYI A;  2J0M A;  2LKO A;  1MI1 A;  5D3X A;  4C0A A;  3HSA A;  4YL8 A;  4GN1 A;  1LB1 A;  1QQG A;  2RSG A;  3SNH A;  5GOW B;  2DA0 A;  3OAN A;  2YS1 A;  3PVL A;  3A58 A;  1KZ7 A;  2Z59 A;  1FOE A;  1U27 A;  2KUQ A;  2D9X A;  2GCL A;  3TW1 A;  3NSU A;  4Z2N A;  3B77 A;  4GMV A;  3BJI A;  5KCV A;  3DXE A;  2CAY A;  3G9W A;  1Y19 B;  4CSQ A;  3PZD A;  1V5U A;  1DYN A;  5D3W A;  2IFS A;  2J0J A;  2MFQ A;  2YSZ A;  2K8E A;  1UNQ A;  4QXA B;  4HDQ A;  5FI1 A;  1BTN A;  4ZRJ A;  2VSZ A;  4HHV A;  1XR0 B;  1H10 A;  4K2P A;  3SUZ A;  5C5B A;  1FHO A;  5L81 A;  4Z2M B;  3SV1 A;  4HAW B;  3AU4 A;  1NTY A;  2EMT A;  4HB0 B;  2MKR A;  2ZKM X;  4PQ0 A;  2VKI A;  2D9Z A;  3U7D A;  2W2X D;  2NZ8 B;  5DI9 B;  2W2X C;  4NY0 A;  2D9V A;  5C5B B;  2P0D A;  2N23 A;  1RJ2 A;  1V5P A;  2LYD A;  2D11 A;  4D6W A;  4A6F A;  2DN6 A;  1U5F A;  2Y8G A;  3FM8 C;  2FJU B;  3IVF A;  3KZ1 A;  2DLW A;  2MWN B;  1X1G A;  2DHI A;  5DHA B;  2D2Q A;  3PVU A;  4NSW A;  1X05 A;  4HB4 B;  3KSY A;  2ELB A;  4CHJ A;  2K2U A;  3ZVR A;  1GG3 A;  3TFM A;  4A6F B;  2YT0 A;  2R0D A;  1W1G A;  2Z14 A;  2Q13 A;  2OQB A;  3NWA A;  4PNK A;  3P7Z A;  2Z13 A;  1ZSQ A;  1ZVR A;  2D4Q A;  1MPH A;  3D8F A;  4KVG B;  4Y94 A;  1TJ6 A;  1LW3 A;  2Z0O A;  3TO1 A;  1TQZ A;  4IOY X;  3QIJ A;  4HB2 B;  3ODX A;  3DCX A;  4YON A;  3QWM A;  5J3Q A;  5HE0 A;  1X1F A;  2E2X A;  4KHB B;  2MDX A;  2QKM A;  2JP2 A;  1J0W A;  4CYE A;  2LUL A;  1N3H A;  1WG7 A;  2I5F A;  1AWE A;  1WJM A;  5JHG A;  4P7I A;  2KCJ A;  4B6H A;  3CXB B;  3HIE A;  3HK0 A;  1MKE A;  1KZG A;  4XWX A;  2KGX B;  1EGX A;  1XX0 A;  2D9W A;  1WI1 A;  2YT2 A;  1V88 A;  2Y7B A;  3KRW A;  3PP2 A;  2M38 A;  1T77 A;  2N0Y A;  1V89 A;  1DRO A;  3LJU X;  2FJL A;  1B55 A;  3QBV B;  1K5G B;  4GXB A;  3NW8 A;  4QJ4 B;  2GJY A;  1DDW A;  3D8E A;  3VOQ A;  1XOD A;  4HB3 B;  3AU5 A;  2R09 A;  4MK0 A;  1I2H A;  4K2O A;  4HDO A;  1Y5O A;  3WYF B;  4BBK A;  1X86 A; 
#chains in the Genus database with same CATH homology
 2COF A;  2LOZ A;  4WSF A;  5DH9 B;  1DDV A;  3KY9 A;  5C6R A;  1MAI A;  2BCJ A;  2G35 A;  4A6K A;  1P5T A;  1TXD A;  1PLS A;  2W2W A;  3X23 A;  2ELA A;  1U29 A;  2HTH B;  1I7A A;  2QKL A;  3P6A A;  2H7E A;  2EJ8 A;  5D27 A;  3ODO A;  2RNR B;  2V76 A;  1M7R A;  3A8P A;  4IFS A;  1W1H A;  1M7E A;  4CHM A;  1P6S A;  2YRY A;  3ULB A;  1Z87 A;  1E5W A;  4KHO A;  1IRS A;  3WA0 A;  1OQN A;  2DFK A;  3GYO A;  2CY4 A;  4A6H A;  3FEH A;  2RGN B;  2CRF A;  3V5W A;  2UVM A;  3N7C A;  5JHH A;  1UNR A;  1K5D B;  1BWN A;  2LOX A;  4HAU B;  1EAZ A;  2P8V A;  1MK7 B;  3D8D A;  5HE1 A;  1ISN A;  3A8Q A;  3PVW A;  2COA A;  3PSC A;  3AJ4 A;  1MK9 B;  2GCJ A;  1UEF A;  4DX8 A;  1PMS A;  2Z0Q A;  4D0N B;  3MDB C;  2OTX A;  4WJ7 A;  1RRP B;  4K81 A;  3KRX A;  1FB8 A;  4TKN A;  2LG1 A;  2K2J A;  1P3R A;  3F0W A;  3F5R A;  2XQN M;  2Y8F A;  1GC7 A;  1FGZ A;  3PEG A;  1EVH A;  5C16 A;  4KHA A;  2P0F A;  4DBB A;  3GYP A;  1MIX A;  2NMB A;  4DXA B;  1SHC A;  1U5G A;  1UNP A;  2CY5 A;  2YF0 A;  2COD A;  1NU2 A;  3ML4 A;  1NI2 A;  4F7H A;  2YVC A;  1GC6 A;  3TVV A;  1OY2 A;  2L1C A;  2VRW B;  1ZC3 B;  2HE7 A;  4HAV B;  4HAX B;  1U5E A;  1V5M A;  2KUP A;  3A98 B;  2D10 A;  1J19 A;  4H8S A;  1WJ1 A;  4ZRI A;  1X11 A;  4K17 A;  2DTC A;  2X18 A;  2YS3 A;  2UZR A;  4WVF B;  5J3Y A;  4L6E A;  5DIF B;  4HAT B;  1U2B A;  1FHX A;  2GS0 A;  1KI1 B;  3DXD A;  2AL6 A;  1H4R A;  1XKE A;  3DXC A;  2J0K A;  4DX9 0;  2DX5 A;  2EMS A;  2AEH A;  2UZS A;  1FAO A;  3HQC A;  4GZU A;  2DHJ A;  3UZT A;  5J3T A;  1WGQ A;  1AQC A;  3SYX A;  5HE3 A;  2J59 M;  2DKQ A;  2COC A;  3SO6 A;  3U8Z A;  1PFJ A;  1XD4 A;  2DYN A;  2EC1 A;  1ZM0 A;  4EKU A;  5CLL B;  2P0H A;  2I1J A;  2IYB A;  5KQ1 A;  2ROV A;  4HAY B;  4KAX B;  5FI0 A;  4F7U P;  2Z0P A;  4TYZ A;  5LOP B;  3RCP A;  1XCG A;  3O96 A;  3PG7 A;  3VIA A;  2RUK B;  4MT7 A;  4IAP A;  1WVH A;  2YT1 A;  4GPT B;  3ODW A;  1FGY A;  1ZC4 B;  1W1D A;  1NTV A;  1EF1 A;  2ZPY A;  2L2I A;  2DHK A;  4F7G A;  3ZDT A;  5D3Y A;  4EMO A;  1WGU A;  2DX1 A;  2K00 A;  5KQ4 A;  2PZ1 A;  2DYQ A;  2YS5 A;  1FHW A;  5EFX A;  1BAK A;  2DKP A;  1DBH A;  5C79 A;  4ZRK A;  3CIK A;  2H7D A;  1SGH A;  3M1I B;  5LON B;  1UPQ A;  3BIN A;  2D9Y A;  2I1K A;  1BTK A;  5CLQ B;  3TCA A;  1U5D A;  1QC6 A;  1MIZ B;  2ADZ A;  4MY6 A;  3HW2 B;  3FSS A;  2ROZ B;  5JLJ B;  2M14 A;  1Q67 A;  4A5K A;  2I5C A;  2RLO A;  3ULC A;  4GMX B;  3T06 A;  1OMW A;  4EJN A;  1V61 A;  5JP4 A;  5D3V A;  3MPX A;  2RVB B;  4HAZ B;  1UPR A;  1DDM A;  5DHF B;  5HE2 A;  2J0M A;  2LKO A;  5D3X A;  4C0A A;  4YL8 A;  4GN1 A;  1LB1 A;  1QQG A;  2RSG A;  3SNH A;  5GOW B;  2DA0 A;  3OAN A;  2YS1 A;  3PVL A;  1KZ7 A;  1FOE A;  1U27 A;  2D9X A;  2GCL A;  3TW1 A;  3NSU A;  4Z2N A;  4GMV A;  3BJI A;  5KCV A;  3DXE A;  2CAY A;  3G9W A;  1Y19 B;  3PZD A;  1V5U A;  1DYN A;  5D3W A;  2IFS A;  2J0J A;  2MFQ A;  2YSZ A;  1UNQ A;  4HDQ A;  5FI1 A;  1BTN A;  4ZRJ A;  2VSZ A;  4HHV A;  1XR0 B;  1H10 A;  4K2P A;  3SUZ A;  5C5B A;  1FHO A;  5L81 A;  4Z2M B;  3SV1 A;  4HAW B;  3AU4 A;  1NTY A;  2EMT A;  4HB0 B;  2MKR A;  4PQ0 A;  2VKI A;  2D9Z A;  3U7D A;  2W2X D;  2NZ8 B;  5DI9 B;  2W2X C;  4NY0 A;  2D9V A;  5C5B B;  2P0D A;  2N23 A;  1RJ2 A;  1V5P A;  2LYD A;  2D11 A;  4A6F A;  2DN6 A;  1U5F A;  2Y8G A;  3FM8 C;  3KZ1 A;  3IVF A;  2DLW A;  2MWN B;  1X1G A;  2DHI A;  5DHA B;  2D2Q A;  3PVU A;  4NSW A;  1X05 A;  4HB4 B;  3KSY A;  2ELB A;  4CHJ A;  2K2U A;  3ZVR A;  1GG3 A;  3TFM A;  4A6F B;  2YT0 A;  2R0D A;  1W1G A;  2Q13 A;  2OQB A;  4PNK A;  3P7Z A;  1ZSQ A;  1ZVR A;  2D4Q A;  1MPH A;  3D8F A;  4KVG B;  4Y94 A;  1TJ6 A;  1LW3 A;  2Z0O A;  3TO1 A;  1TQZ A;  4IOY X;  3QIJ A;  4HB2 B;  3ODX A;  4YON A;  3QWM A;  5J3Q A;  5HE0 A;  1X1F A;  2E2X A;  4KHB B;  2MDX A;  2QKM A;  2JP2 A;  1J0W A;  4CYE A;  2LUL A;  1N3H A;  1WG7 A;  2I5F A;  1AWE A;  1WJM A;  5JHG A;  4P7I A;  2KCJ A;  4B6H A;  3CXB B;  3HK0 A;  1MKE A;  1KZG A;  4XWX A;  2KGX B;  1EGX A;  1XX0 A;  2D9W A;  1WI1 A;  1V88 A;  2Y7B A;  3KRW A;  3PP2 A;  2M38 A;  2N0Y A;  1V89 A;  1DRO A;  3LJU X;  2FJL A;  1B55 A;  3QBV B;  1K5G B;  4GXB A;  2GJY A;  1DDW A;  3D8E A;  3VOQ A;  1XOD A;  4HB3 B;  3AU5 A;  2R09 A;  4MK0 A;  1I2H A;  4K2O A;  4HDO A;  1Y5O A;  3WYF B;  4BBK A;  1X86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...