2R2YA

Crystal structure of the proteasomal rpn13 pru-domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein ADRM1
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2r2yA00
2Z59A 2Z4DA 2R2YA 5IRSA 2NBVA 2KR0A
chains in the Genus database with same CATH superfamily
2Z0QA 1ISNA 1LW3A 3P7ZA 1E5WA 4B6HA 2RVBB 2D2QA 1X1GA 3WYFB 3O96A 2E2XA 5KCVA 3TCAA 1RJ2A 1X86A 5HE1A 1NI2A 4HAVB 1SHCA 5DIFB 4KAXB 1Q67A 1AQCA 1WGUA 1MIZB 4EMOA 2GUMA 4DX8A 3PVLA 2KIGA 3DXCA 3KRWA 5IRSA 3M1IB 4NSWA 3TVVA 2R2YA 2VKIA 5DH9B 4YONA 4TYZA 2P0DA 2MDXA 2D10A 4ZRKA 1M7RA 2DYQA 1U27A 4F7UP 1P6SA 3PSCA 4YL8A 3ZDTA 4MK0A 4KHAA 1X11A 2K8EA 2UZSA 1ZVRA 1U5DA 1FOEA 3HW2B 2RGNB 4EJNA 4ZRJA 3PG7A 1WI1A 1UNPA 3F5RA 1OQNA 4K81A 2LOXA 1XCGA 2KGXB 2H7EA 4Z2NA 4CYEA 4NY0A 3TO1A 5C6RA 4Z2MB 5GOWB 4DXAB 4CHJA 2NMBA 2OTXA 4L6EA 4IAPA 3U12A 4A6FB 2LOZA 2UZRA 4HAYB 1H4RA 1EAZA 2MKRA 1NTYA 5FI0A 5DI9B 2YSZA 1MI1A 4Y94A 3SNHA 1MK9B 1WJMA 2AEHA 1WGQA 2YF0A 2J0MA 1V89A 2DX1A 4A5KA 5LOPB 4GNKB 2OQBA 2EC1A 2YVCA 2KUQA 1EF1A 4QJ5B 5JHGA 2RUKB 3CXBB 2DHKA 3OANA 1P5TA 3HIEA 4H8SA 2K2UA 1UEFA 1MKEA 4P7IA 3QIJA 3IVFA 4QXAB 4DIXA 4D6WA 3KRXA 5KQ1A 2P8VA 2MWNB 1DDWA 1PMSA 4WSFA 4PQ0A 2I5CA 2L2IA 4XWXA 5C79A 1FAOA 5I2SA 3QWMA 4C0AA 1UPRA 2W2XD 3FEHA 4HB4B 1LB1A 4A6FA 4TKNA 4HB3B 2EMTA 1QC6A 3TW1A 4EKUA 3ZVRA 2YT1A 1BTKA 2DN6A 2ELBA 1U2BA 1DBHA 2D9XA 4OT1A 1Y5OA 2LYDA 2KR0A 2COCA 1K5DB 2Q13A 3AU4A 2V76A 2FJUB 4MY6A 1BAKA 3P6AA 2RLOA 5L81A 2X18A 1XX0A 4IOYX 1FHXA 3N7CA 1FGYA 3ULBA 2ZPYA 4GPTB 2DLWA 4HAXB 4CSQA 2EMSA 2COFA 3NWFA 4D0NB 3ULCA 2YS5A 1AWEA 2D9VA 2DYNA 1ZC4B 2Z13A 3QBVB 2Y7BA 3CIKA 5D27A 2ELAA 1UNQA 2W2WA 1QQGA 3MDBC 4A6HA 1T77A 3T06A 2Y8GA 1W1GA 1TXDA 1NU2A 3VOQA 1XKEA 2IYBA 1BWNA 5C5BB 1W1HA 1NTVA 2LULA 1DYNA 2Z0OA 1ZYIA 2P0FA 3AU5A 3FSSA 3GYOA 2D11A 2YS1A 4A6KA 4HDQA 2CY4A 2NBVA 1X1FA 4KHBA 1V5MA 2Z59A 1ZM0A 2CODA 1V61A 4HDOA 2CY5A 2JP2A 4HSIA 2BCJA 1K5GB 1U5EA 3U8ZA 1J19A 1U5FA 2Y8FA 2Z14A 4WJ7A 1WG7A 2J59M 4K17A 1DROA 4GXBA 1ZC3B 1GG3A 1U5GA 2G35A 1TJ6A 5HE0A 3BINA 3U7DA 2W2XC 2ROZB 1IRSA 1BTNA 3SV1A 4KHOA 1WVHA 1H10A 3PVUA 2KIEA 2M14A 3KZ1A 4IFSA 1FHWA 4OSNA 2D9ZA 2Z0PA 1OMWA 2K49A 3KSYA 1MIXA 2N23A 3DXEA 3A58A 3AJ4A 2XQNM 5D3XA 5HE3A 1ZSQA 2D4QA 1KZGA 5C5BA 4PNKA 1UPQA 5J3TA 4ZRIA 3X23A 3OHMB 3ODOA 2UVMA 4GOUA 1X05A 3PVWA 1GC6A 5CLQB 2GS0A 1Y19B 2DKQA 2ADZA 2CRFA 2ZKMX 2GCLA 4HATB 2K2JA 1I2HA 3MPXA 5JP4A 2QKLA 1V5UA 3TFMA 5M4YB 4HAUB 4KHBB 1DDVA 3BJIA 2YS3A 1W1DA 3F0WA 5I2MA 2DHJA 2I1KA 2NZ8B 2D9WA 4HB2B 1MK7B 2KCJA 3NSUA 1I7AA 2R09A 1PLSA 2P0HA 4F7HA 4GMXB 2HTHB 2DKPA 3WA0A 2N0YA 1SGHA 2VRWB 1FGZA 5JLJB 1GC7A 1MPHA 1PFJA 1V88A 3HK0A 1KZ7A 5J3QA 3SO6A 2LKOA 2YT0A 4DX90 4DBBA 2MFQA 3A98B 3A8QA 3HSAA 2VSZA 1XODA 1UNRA 1J0WA 3KY9A 3DXDA 3D8FA 3ODXA 5JHHA 3NW8A 3RCPA 1OY2A 4K2PA 2KUPA 3UZTA 2QKMA 3FM8C 5LONB 1MAIA 2M38A 4HAZB 5DHFB 5LG4B 1FB8A 2GCJA 2J0KA 2L1CA 3NWAA 5D3YA 4QJ4B 4HHVA 2D9YA 4HAWB 1M7EA 2FJLA 3NWDA 3HQCA 2ROVA 4MT7A 2YT2A 3PP2A 2COAA 4GN1A 4GZUA 5C16A 2RRFA 5D3WA 5J3YA 1KI1B 1DDMA 2GJYA 1Z87A 2R0DA 2AL6A 1N3HA 5KQ4A 1XR0B 2RSGA 3D8EA 1WJ1A 3G9WA 3ML4A 1FHOA 2Z4DA 3ODWA 1EVHA 2DTCA 2DFKA 5D3VA 3GYPA 2H7DA 2IFSA 5DHAB 1B55A 5FI1A 2PZ1A 2I5FA 3LJUX 4K2OA 5EFXA 3SYXA 1P3RA 3PZDA 2HE7A 2DHIA 4GMVA 3D8DA 1V5PA 2J0JA 1TQZA 2DX5A 4L1RA 3SUZA 2DA0A 2K00A 4WVFB 3V5WA 4QJ3B 4CHMA 2RNRB 4HB0B 1EGXA 1RRPB 2EJ8A 5CLLB 2CAYA 1U29A 3VIAA 4BBKA 2YRYA 3A8PA 2LG1A 1XD4A 2I1JA 5HE2A 4KVGB 3B77A 3DCXA 4F7GA 3FVCA 3PEGA
chains in the Genus database with same CATH topology
4QJ5B 4KHAA 4GOUA 4L1RA 2Z59A 2FJUB 2K8EA 5I2SA 2KIGA 4KHOA 5LG4B 2Z4DA 5IRSA 2GCJA 2KIEA 4KHBA 4QJ3B 5I2MA 3NWAA 4IOYX 4QJ4B 3GYPA 4HSIA 4IFSA 2ZKMX 3HIEA 3TVVA 4OSNA 2R2YA 2GCLA 3NWDA 3U12A 4GNKB 3TW1A 2K49A 4QXAB 2Z14A 4CSQA 2YT2A 3A58A 4D6WA 4DIXA 3NW8A 3NWFA 4Z2NA 2RRFA 3TO1A 1ZYIA 4Z2MB 5M4YB 3FSSA 3GYOA 4KHBB 4PQ0A 2Z13A 2GUMA 4OT1A 3FVCA 2NBVA 3OHMB 2KR0A 2KUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 A;  2Z4D A;  2R2Y A;  5IRS A;  2NBV A;  2KR0 A; 
#chains in the Genus database with same CATH topology
 2Z0Q A;  1ISN A;  1LW3 A;  3P7Z A;  1E5W A;  4B6H A;  2RVB B;  2D2Q A;  1X1G A;  3WYF B;  3O96 A;  2E2X A;  5KCV A;  3TCA A;  1RJ2 A;  1X86 A;  5HE1 A;  1NI2 A;  4HAV B;  1SHC A;  5DIF B;  4KAX B;  1Q67 A;  1AQC A;  1WGU A;  1MIZ B;  4EMO A;  2GUM A;  4DX8 A;  3PVL A;  2KIG A;  3DXC A;  3KRW A;  5IRS A;  3M1I B;  4NSW A;  3TVV A;  2R2Y A;  2VKI A;  5DH9 B;  4YON A;  4TYZ A;  2P0D A;  2MDX A;  2D10 A;  4ZRK A;  1M7R A;  2DYQ A;  1U27 A;  4F7U P;  1P6S A;  3PSC A;  4YL8 A;  3ZDT A;  4MK0 A;  4KHA A;  1X11 A;  2K8E A;  2UZS A;  1ZVR A;  1U5D A;  1FOE A;  3HW2 B;  2RGN B;  4EJN A;  4ZRJ A;  3PG7 A;  1WI1 A;  1UNP A;  3F5R A;  1OQN A;  4K81 A;  2LOX A;  1XCG A;  2KGX B;  2H7E A;  4Z2N A;  4CYE A;  4NY0 A;  3TO1 A;  5C6R A;  4Z2M B;  5GOW B;  4DXA B;  4CHJ A;  2NMB A;  2OTX A;  4L6E A;  4IAP A;  3U12 A;  4A6F B;  2LOZ A;  2UZR A;  4HAY B;  1H4R A;  1EAZ A;  2MKR A;  1NTY A;  5FI0 A;  5DI9 B;  2YSZ A;  1MI1 A;  4Y94 A;  3SNH A;  1MK9 B;  1WJM A;  2AEH A;  1WGQ A;  2YF0 A;  2J0M A;  1V89 A;  2DX1 A;  4A5K A;  5LOP B;  4GNK B;  2OQB A;  2EC1 A;  2YVC A;  2KUQ A;  1EF1 A;  4QJ5 B;  5JHG A;  2RUK B;  3CXB B;  2DHK A;  3OAN A;  1P5T A;  3HIE A;  4H8S A;  2K2U A;  1UEF A;  1MKE A;  4P7I A;  3QIJ A;  3IVF A;  4QXA B;  4DIX A;  4D6W A;  3KRX A;  5KQ1 A;  2P8V A;  2MWN B;  1DDW A;  1PMS A;  4WSF A;  4PQ0 A;  2I5C A;  2L2I A;  4XWX A;  5C79 A;  1FAO A;  5I2S A;  3QWM A;  4C0A A;  1UPR A;  2W2X D;  3FEH A;  4HB4 B;  1LB1 A;  4A6F A;  4TKN A;  4HB3 B;  2EMT A;  1QC6 A;  3TW1 A;  4EKU A;  3ZVR A;  2YT1 A;  1BTK A;  2DN6 A;  2ELB A;  1U2B A;  1DBH A;  2D9X A;  4OT1 A;  1Y5O A;  2LYD A;  2KR0 A;  2COC A;  1K5D B;  2Q13 A;  3AU4 A;  2V76 A;  2FJU B;  4MY6 A;  1BAK A;  3P6A A;  2RLO A;  5L81 A;  2X18 A;  1XX0 A;  4IOY X;  1FHX A;  3N7C A;  1FGY A;  3ULB A;  2ZPY A;  4GPT B;  2DLW A;  4HAX B;  4CSQ A;  2EMS A;  2COF A;  3NWF A;  4D0N B;  3ULC A;  2YS5 A;  1AWE A;  2D9V A;  2DYN A;  1ZC4 B;  2Z13 A;  3QBV B;  2Y7B A;  3CIK A;  5D27 A;  2ELA A;  1UNQ A;  2W2W A;  1QQG A;  3MDB C;  4A6H A;  1T77 A;  3T06 A;  2Y8G A;  1W1G A;  1TXD A;  1NU2 A;  3VOQ A;  1XKE A;  2IYB A;  1BWN A;  5C5B B;  1W1H A;  1NTV A;  2LUL A;  1DYN A;  2Z0O A;  1ZYI A;  2P0F A;  3AU5 A;  3FSS A;  3GYO A;  2D11 A;  2YS1 A;  4A6K A;  4HDQ A;  2CY4 A;  2NBV A;  1X1F A;  4KHB A;  1V5M A;  2Z59 A;  1ZM0 A;  2COD A;  1V61 A;  4HDO A;  2CY5 A;  2JP2 A;  4HSI A;  2BCJ A;  1K5G B;  1U5E A;  3U8Z A;  1J19 A;  1U5F A;  2Y8F A;  2Z14 A;  4WJ7 A;  1WG7 A;  2J59 M;  4K17 A;  1DRO A;  4GXB A;  1ZC3 B;  1GG3 A;  1U5G A;  2G35 A;  1TJ6 A;  5HE0 A;  3BIN A;  3U7D A;  2W2X C;  2ROZ B;  1IRS A;  1BTN A;  3SV1 A;  4KHO A;  1WVH A;  1H10 A;  3PVU A;  2KIE A;  2M14 A;  3KZ1 A;  4IFS A;  1FHW A;  4OSN A;  2D9Z A;  2Z0P A;  1OMW A;  2K49 A;  3KSY A;  1MIX A;  2N23 A;  3DXE A;  3A58 A;  3AJ4 A;  2XQN M;  5D3X A;  5HE3 A;  1ZSQ A;  2D4Q A;  1KZG A;  5C5B A;  4PNK A;  1UPQ A;  5J3T A;  4ZRI A;  3X23 A;  3OHM B;  3ODO A;  2UVM A;  4GOU A;  1X05 A;  3PVW A;  1GC6 A;  5CLQ B;  2GS0 A;  1Y19 B;  2DKQ A;  2ADZ A;  2CRF A;  2ZKM X;  2GCL A;  4HAT B;  2K2J A;  1I2H A;  3MPX A;  5JP4 A;  2QKL A;  1V5U A;  3TFM A;  5M4Y B;  4HAU B;  4KHB B;  1DDV A;  3BJI A;  2YS3 A;  1W1D A;  3F0W A;  5I2M A;  2DHJ A;  2I1K A;  2NZ8 B;  2D9W A;  4HB2 B;  1MK7 B;  2KCJ A;  3NSU A;  1I7A A;  2R09 A;  1PLS A;  2P0H A;  4F7H A;  4GMX B;  2HTH B;  2DKP A;  3WA0 A;  2N0Y A;  1SGH A;  2VRW B;  1FGZ A;  5JLJ B;  1GC7 A;  1MPH A;  1PFJ A;  1V88 A;  3HK0 A;  1KZ7 A;  5J3Q A;  3SO6 A;  2LKO A;  2YT0 A;  4DX9 0;  4DBB A;  2MFQ A;  3A98 B;  3A8Q A;  3HSA A;  2VSZ A;  1XOD A;  1UNR A;  1J0W A;  3KY9 A;  3DXD A;  3D8F A;  3ODX A;  5JHH A;  3NW8 A;  3RCP A;  1OY2 A;  4K2P A;  2KUP A;  3UZT A;  2QKM A;  3FM8 C;  5LON B;  1MAI A;  2M38 A;  4HAZ B;  5DHF B;  5LG4 B;  1FB8 A;  2GCJ A;  2J0K A;  2L1C A;  3NWA A;  5D3Y A;  4QJ4 B;  4HHV A;  2D9Y A;  4HAW B;  1M7E A;  2FJL A;  3NWD A;  3HQC A;  2ROV A;  4MT7 A;  2YT2 A;  3PP2 A;  2COA A;  4GN1 A;  4GZU A;  5C16 A;  2RRF A;  5D3W A;  5J3Y A;  1KI1 B;  1DDM A;  2GJY A;  1Z87 A;  2R0D A;  2AL6 A;  1N3H A;  5KQ4 A;  1XR0 B;  2RSG A;  3D8E A;  1WJ1 A;  3G9W A;  3ML4 A;  1FHO A;  2Z4D A;  3ODW A;  1EVH A;  2DTC A;  2DFK A;  5D3V A;  3GYP A;  2H7D A;  2IFS A;  5DHA B;  1B55 A;  5FI1 A;  2PZ1 A;  2I5F A;  3LJU X;  4K2O A;  5EFX A;  3SYX A;  1P3R A;  3PZD A;  2HE7 A;  2DHI A;  4GMV A;  3D8D A;  1V5P A;  2J0J A;  1TQZ A;  2DX5 A;  4L1R A;  3SUZ A;  2DA0 A;  2K00 A;  4WVF B;  3V5W A;  4QJ3 B;  4CHM A;  2RNR B;  4HB0 B;  1EGX A;  1RRP B;  2EJ8 A;  5CLL B;  2CAY A;  1U29 A;  3VIA A;  4BBK A;  2YRY A;  3A8P A;  2LG1 A;  1XD4 A;  2I1J A;  5HE2 A;  4KVG B;  3B77 A;  3DCX A;  4F7G A;  3FVC A;  3PEG A; 
#chains in the Genus database with same CATH homology
 4QJ5 B;  4KHA A;  4GOU A;  4L1R A;  2Z59 A;  2FJU B;  2K8E A;  5I2S A;  2KIG A;  4KHO A;  5LG4 B;  2Z4D A;  5IRS A;  2GCJ A;  2KIE A;  4KHB A;  4QJ3 B;  5I2M A;  3NWA A;  4IOY X;  4QJ4 B;  3GYP A;  4HSI A;  4IFS A;  2ZKM X;  3HIE A;  3TVV A;  4OSN A;  2R2Y A;  2GCL A;  3NWD A;  3U12 A;  4GNK B;  3TW1 A;  2K49 A;  4QXA B;  2Z14 A;  4CSQ A;  2YT2 A;  3A58 A;  4D6W A;  4DIX A;  3NW8 A;  3NWF A;  4Z2N A;  2RRF A;  3TO1 A;  1ZYI A;  4Z2M B;  5M4Y B;  3FSS A;  3GYO A;  4KHB B;  4PQ0 A;  2Z13 A;  2GUM A;  4OT1 A;  3FVC A;  2NBV A;  3OHM B;  2KR0 A;  2KUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...