2R2YA

Crystal structure of the proteasomal rpn13 pru-domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
YLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Protein ADRM1
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2r2yA00
2KR0A 2NBVA 5IRSA 2Z59A 2Z4DA 2R2YA
chains in the Genus database with same CATH superfamily
2CODA 2I1KA 1PFJA 2J0MA 2ADZA 1EF1A 3D8DA 1V5UA 3OANA 2Z14A 2NZ8B 1DDMA 1Q67A 4GN1A 1H10A 4QXAB 3KZ1A 2MKRA 5KQ1A 1XKEA 1V61A 2COCA 3NWFA 2OQBA 1W1DA 3DXDA 1ZC4B 3A58A 3OHMB 1XR0B 2KCJA 2CRFA 4IOYX 5KQ4A 1WJMA 2NMBA 2FJUB 3NSUA 3P6AA 1WG7A 5IRSA 1QC6A 1UEFA 2IFSA 2LG1A 3IVFA 5C6RA 2Z4DA 2DHJA 5CLLB 3U8ZA 1ISNA 1N3HA 1UNQA 1W1GA 1V5MA 3U12A 1B55A 4HB2B 2K00A 4MT7A 1XX0A 2Z0QA 1LW3A 1NI2A 2Q13A 3MDBC 3G9WA 4HAXB 2MWNB 4DXAB 2K2JA 2LYDA 2H7EA 4TYZA 2I5FA 4ZRJA 2I1JA 1X1FA 4WJ7A 2YVCA 3FM8C 5C16A 2DFKA 2Y8GA 1MKEA 2DKQA 4P7IA 3KRWA 3D8FA 4GPTB 2UZSA 4L6EA 2D11A 3F5RA 5CLQB 4DX8A 2LOXA 3GYOA 1I7AA 1K5DB 2Y7BA 1U5EA 2KR0A 3NW8A 2DYNA 1RRPB 3QWMA 3SYXA 2VRWB 1U29A 4YONA 1K5GB 5GOWB 4WSFA 5JHGA 1WGQA 1BWNA 2R2YA 5JP4A 3HQCA 2N0YA 5JHHA 1U27A 5L81A 3CIKA 1XCGA 1EGXA 1V89A 4GZUA 3N7CA 2GJYA 5JLJB 3BJIA 2NBVA 2ROZB 5D3WA 2P0FA 1U2BA 4HDQA 1UNRA 3CXBB 4K17A 3PVUA 1U5FA 1BAKA 4QJ4B 4HAYB 1MK7B 2DYQA 3B77A 2D9WA 1QQGA 1X86A 2DLWA 1SHCA 2R09A 2D9YA 1MIZB 2VSZA 3QBVB 4ZRIA 2KUQA 4GXBA 2HE7A 2DN6A 3ODXA 4GOUA 5HE0A 3KY9A 2MFQA 3ULBA 1Z87A 2VKIA 1FHXA 1TJ6A 2DTCA 2Y8FA 3PEGA 2K2UA 2YS3A 3PVLA 3SUZA 3BINA 3WYFB 5DHAB 3DXEA 1TQZA 3A98B 4DIXA 1XD4A 2ZKMX 1MI1A 1RJ2A 2QKLA 2ZPYA 3FSSA 4EMOA 4CSQA 1KZ7A 2KIEA 2P0DA 2IYBA 2COAA 3SO6A 5J3QA 1GC6A 4QJ5B 1FAOA 2EMSA 1MIXA 2KUPA 4GMXB 4IFSA 1W1HA 1E5WA 2YF0A 1NTVA 4DBBA 1XODA 4K2PA 4Z2NA 2D4QA 1PMSA 3TCAA 4BBKA 4OT1A 2W2WA 2PZ1A 2Z0OA 4CHMA 3TFMA 4GNKB 4A6FA 2YS5A 1GG3A 4HDOA 1ZC3B 4ZRKA 3SV1A 5KCVA 2LOZA 4CHJA 1UPRA 1MAIA 1OY2A 2L1CA 4F7HA 2YSZA 4A5KA 1I2HA 1T77A 2CY5A 5J3TA 4QJ3B 2Z13A 3V5WA 3LJUX 5EFXA 4HAWB 2N23A 4MY6A 4GMVA 2RRFA 1X1GA 3HIEA 3O96A 3A8QA 2XQNM 1P6SA 1WVHA 5D3YA 3ML4A 2OTXA 1KI1B 2YT0A 3HK0A 3ZDTA 5LOPB 4K2OA 2V76A 1M7RA 5M4YB 4TKNA 1P5TA 1WI1A 5C5BA 1H4RA 1AWEA 4CYEA 2YRYA 3DXCA 1DBHA 2HTHB 2EJ8A 1PLSA 1ZM0A 2GCLA 4YL8A 3TW1A 3X23A 4L1RA 4D6WA 1J0WA 4C0AA 4D0NB 4HB4B 1NTYA 4NSWA 4PNKA 5DIFB 2ELAA 2J0KA 5J3YA 1J19A 1GC7A 2P8VA 2J0JA 1TXDA 4OSNA 4XWXA 1DDVA 2R0DA 2KIGA 1Y19B 4EJNA 2Z59A 1DROA 5D3VA 2D9VA 1P3RA 1SGHA 2RUKB 2YT2A 2D2QA 5HE3A 2X18A 3ODOA 3FEHA 4IAPA 3P7ZA 2GS0A 5DH9B 1FGYA 4KAXB 3ZVRA 5C79A 2ELBA 2K49A 2W2XD 1NU2A 4KHOA 4PQ0A 5LONB 3HW2B 1FOEA 4HAVB 4HB0B 2AL6A 2H7DA 1OQNA 5I2MA 2DKPA 2RNRB 4A6KA 2P0HA 2GUMA 2M38A 4K81A 3KSYA 2EC1A 3UZTA 1UPQA 1FHWA 2K8EA 5DI9B 3D8EA 4KHAA 1UNPA 4HB3B 1LB1A 3TO1A 2JP2A 2AEHA 2CAYA 3AU5A 4A6HA 3DCXA 5FI1A 2DHKA 1FHOA 3VOQA 3PVWA 1U5GA 3U7DA 1WGUA 4KHBB 1V88A 2COFA 2ROVA 5FI0A 2DX5A 2QKMA 2RGNB 2G35A 1WJ1A 2D10A 2J59M 3A8PA 3NWAA 2UVMA 3TVVA 4WVFB 2M14A 1M7EA 2DHIA 4KVGB 4HSIA 5C5BB 3QIJA 2LULA 4Y94A 1X05A 3NWDA 2E2XA 1U5DA 3ULCA 3GYPA 4HAUB 3KRXA 4MK0A 3PSCA 2L2IA 2GCJA 2DA0A 2LKOA 3SNHA 2KGXB 3M1IB 2W2XC 4HHVA 3FVCA 3RCPA 1IRSA 4NY0A 2RLOA 5DHFB 2UZRA 4B6HA 1ZVRA 3T06A 4HAZB 1KZGA 4Z2MB 1DYNA 1Y5OA 2CY4A 1MPHA 1MK9B 1V5PA 1OMWA 4H8SA 2I5CA 1FB8A 3AJ4A 3HSAA 5D27A 2D9ZA 5HE2A 1FGZA 5HE1A 2D9XA 3AU4A 3F0WA 1BTKA 1EVHA 5LG4B 2FJLA 4A6FB 3ODWA 3PG7A 3VIAA 1X11A 1AQCA 2BCJA 2YT1A 2DX1A 5I2SA 1BTNA 4HATB 2Z0PA 2RSGA 4F7UP 1EAZA 1ZSQA 2YS1A 5D3XA 4DX90 1ZYIA 4F7GA 4EKUA 3WA0A 2RVBB 3PP2A 3MPXA 1DDWA 3PZDA 2EMTA 4KHBA 2MDXA
chains in the Genus database with same CATH topology
2KUQA 3NWDA 2RRFA 4IOYX 2GUMA 3HIEA 3GYPA 2YT2A 4Z2MB 2GCLA 4QJ5B 4GOUA 5LG4B 3GYOA 5I2SA 4IFSA 2Z14A 2FJUB 2KR0A 3TW1A 4KHBB 4L1RA 2GCJA 3NW8A 2NBVA 4D6WA 5IRSA 2K8EA 4Z2NA 4QXAB 3FVCA 4KHAA 5M4YB 4DIXA 1ZYIA 4OT1A 2K49A 4QJ3B 2Z13A 4QJ4B 2ZKMX 4KHOA 4PQ0A 3TO1A 2Z4DA 2R2YA 4GNKB 4OSNA 3NWFA 3NWAA 3TVVA 2KIGA 3FSSA 4KHBA 4CSQA 5I2MA 2KIEA 2Z59A 3A58A 4HSIA 3U12A 3OHMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2NBV A;  5IRS A;  2Z59 A;  2Z4D A;  2R2Y A; 
#chains in the Genus database with same CATH topology
 2COD A;  2I1K A;  1PFJ A;  2J0M A;  2ADZ A;  1EF1 A;  3D8D A;  1V5U A;  3OAN A;  2Z14 A;  2NZ8 B;  1DDM A;  1Q67 A;  4GN1 A;  1H10 A;  4QXA B;  3KZ1 A;  2MKR A;  5KQ1 A;  1XKE A;  1V61 A;  2COC A;  3NWF A;  2OQB A;  1W1D A;  3DXD A;  1ZC4 B;  3A58 A;  3OHM B;  1XR0 B;  2KCJ A;  2CRF A;  4IOY X;  5KQ4 A;  1WJM A;  2NMB A;  2FJU B;  3NSU A;  3P6A A;  1WG7 A;  5IRS A;  1QC6 A;  1UEF A;  2IFS A;  2LG1 A;  3IVF A;  5C6R A;  2Z4D A;  2DHJ A;  5CLL B;  3U8Z A;  1ISN A;  1N3H A;  1UNQ A;  1W1G A;  1V5M A;  3U12 A;  1B55 A;  4HB2 B;  2K00 A;  4MT7 A;  1XX0 A;  2Z0Q A;  1LW3 A;  1NI2 A;  2Q13 A;  3MDB C;  3G9W A;  4HAX B;  2MWN B;  4DXA B;  2K2J A;  2LYD A;  2H7E A;  4TYZ A;  2I5F A;  4ZRJ A;  2I1J A;  1X1F A;  4WJ7 A;  2YVC A;  3FM8 C;  5C16 A;  2DFK A;  2Y8G A;  1MKE A;  2DKQ A;  4P7I A;  3KRW A;  3D8F A;  4GPT B;  2UZS A;  4L6E A;  2D11 A;  3F5R A;  5CLQ B;  4DX8 A;  2LOX A;  3GYO A;  1I7A A;  1K5D B;  2Y7B A;  1U5E A;  2KR0 A;  3NW8 A;  2DYN A;  1RRP B;  3QWM A;  3SYX A;  2VRW B;  1U29 A;  4YON A;  1K5G B;  5GOW B;  4WSF A;  5JHG A;  1WGQ A;  1BWN A;  2R2Y A;  5JP4 A;  3HQC A;  2N0Y A;  5JHH A;  1U27 A;  5L81 A;  3CIK A;  1XCG A;  1EGX A;  1V89 A;  4GZU A;  3N7C A;  2GJY A;  5JLJ B;  3BJI A;  2NBV A;  2ROZ B;  5D3W A;  2P0F A;  1U2B A;  4HDQ A;  1UNR A;  3CXB B;  4K17 A;  3PVU A;  1U5F A;  1BAK A;  4QJ4 B;  4HAY B;  1MK7 B;  2DYQ A;  3B77 A;  2D9W A;  1QQG A;  1X86 A;  2DLW A;  1SHC A;  2R09 A;  2D9Y A;  1MIZ B;  2VSZ A;  3QBV B;  4ZRI A;  2KUQ A;  4GXB A;  2HE7 A;  2DN6 A;  3ODX A;  4GOU A;  5HE0 A;  3KY9 A;  2MFQ A;  3ULB A;  1Z87 A;  2VKI A;  1FHX A;  1TJ6 A;  2DTC A;  2Y8F A;  3PEG A;  2K2U A;  2YS3 A;  3PVL A;  3SUZ A;  3BIN A;  3WYF B;  5DHA B;  3DXE A;  1TQZ A;  3A98 B;  4DIX A;  1XD4 A;  2ZKM X;  1MI1 A;  1RJ2 A;  2QKL A;  2ZPY A;  3FSS A;  4EMO A;  4CSQ A;  1KZ7 A;  2KIE A;  2P0D A;  2IYB A;  2COA A;  3SO6 A;  5J3Q A;  1GC6 A;  4QJ5 B;  1FAO A;  2EMS A;  1MIX A;  2KUP A;  4GMX B;  4IFS A;  1W1H A;  1E5W A;  2YF0 A;  1NTV A;  4DBB A;  1XOD A;  4K2P A;  4Z2N A;  2D4Q A;  1PMS A;  3TCA A;  4BBK A;  4OT1 A;  2W2W A;  2PZ1 A;  2Z0O A;  4CHM A;  3TFM A;  4GNK B;  4A6F A;  2YS5 A;  1GG3 A;  4HDO A;  1ZC3 B;  4ZRK A;  3SV1 A;  5KCV A;  2LOZ A;  4CHJ A;  1UPR A;  1MAI A;  1OY2 A;  2L1C A;  4F7H A;  2YSZ A;  4A5K A;  1I2H A;  1T77 A;  2CY5 A;  5J3T A;  4QJ3 B;  2Z13 A;  3V5W A;  3LJU X;  5EFX A;  4HAW B;  2N23 A;  4MY6 A;  4GMV A;  2RRF A;  1X1G A;  3HIE A;  3O96 A;  3A8Q A;  2XQN M;  1P6S A;  1WVH A;  5D3Y A;  3ML4 A;  2OTX A;  1KI1 B;  2YT0 A;  3HK0 A;  3ZDT A;  5LOP B;  4K2O A;  2V76 A;  1M7R A;  5M4Y B;  4TKN A;  1P5T A;  1WI1 A;  5C5B A;  1H4R A;  1AWE A;  4CYE A;  2YRY A;  3DXC A;  1DBH A;  2HTH B;  2EJ8 A;  1PLS A;  1ZM0 A;  2GCL A;  4YL8 A;  3TW1 A;  3X23 A;  4L1R A;  4D6W A;  1J0W A;  4C0A A;  4D0N B;  4HB4 B;  1NTY A;  4NSW A;  4PNK A;  5DIF B;  2ELA A;  2J0K A;  5J3Y A;  1J19 A;  1GC7 A;  2P8V A;  2J0J A;  1TXD A;  4OSN A;  4XWX A;  1DDV A;  2R0D A;  2KIG A;  1Y19 B;  4EJN A;  2Z59 A;  1DRO A;  5D3V A;  2D9V A;  1P3R A;  1SGH A;  2RUK B;  2YT2 A;  2D2Q A;  5HE3 A;  2X18 A;  3ODO A;  3FEH A;  4IAP A;  3P7Z A;  2GS0 A;  5DH9 B;  1FGY A;  4KAX B;  3ZVR A;  5C79 A;  2ELB A;  2K49 A;  2W2X D;  1NU2 A;  4KHO A;  4PQ0 A;  5LON B;  3HW2 B;  1FOE A;  4HAV B;  4HB0 B;  2AL6 A;  2H7D A;  1OQN A;  5I2M A;  2DKP A;  2RNR B;  4A6K A;  2P0H A;  2GUM A;  2M38 A;  4K81 A;  3KSY A;  2EC1 A;  3UZT A;  1UPQ A;  1FHW A;  2K8E A;  5DI9 B;  3D8E A;  4KHA A;  1UNP A;  4HB3 B;  1LB1 A;  3TO1 A;  2JP2 A;  2AEH A;  2CAY A;  3AU5 A;  4A6H A;  3DCX A;  5FI1 A;  2DHK A;  1FHO A;  3VOQ A;  3PVW A;  1U5G A;  3U7D A;  1WGU A;  4KHB B;  1V88 A;  2COF A;  2ROV A;  5FI0 A;  2DX5 A;  2QKM A;  2RGN B;  2G35 A;  1WJ1 A;  2D10 A;  2J59 M;  3A8P A;  3NWA A;  2UVM A;  3TVV A;  4WVF B;  2M14 A;  1M7E A;  2DHI A;  4KVG B;  4HSI A;  5C5B B;  3QIJ A;  2LUL A;  4Y94 A;  1X05 A;  3NWD A;  2E2X A;  1U5D A;  3ULC A;  3GYP A;  4HAU B;  3KRX A;  4MK0 A;  3PSC A;  2L2I A;  2GCJ A;  2DA0 A;  2LKO A;  3SNH A;  2KGX B;  3M1I B;  2W2X C;  4HHV A;  3FVC A;  3RCP A;  1IRS A;  4NY0 A;  2RLO A;  5DHF B;  2UZR A;  4B6H A;  1ZVR A;  3T06 A;  4HAZ B;  1KZG A;  4Z2M B;  1DYN A;  1Y5O A;  2CY4 A;  1MPH A;  1MK9 B;  1V5P A;  1OMW A;  4H8S A;  2I5C A;  1FB8 A;  3AJ4 A;  3HSA A;  5D27 A;  2D9Z A;  5HE2 A;  1FGZ A;  5HE1 A;  2D9X A;  3AU4 A;  3F0W A;  1BTK A;  1EVH A;  5LG4 B;  2FJL A;  4A6F B;  3ODW A;  3PG7 A;  3VIA A;  1X11 A;  1AQC A;  2BCJ A;  2YT1 A;  2DX1 A;  5I2S A;  1BTN A;  4HAT B;  2Z0P A;  2RSG A;  4F7U P;  1EAZ A;  1ZSQ A;  2YS1 A;  5D3X A;  4DX9 0;  1ZYI A;  4F7G A;  4EKU A;  3WA0 A;  2RVB B;  3PP2 A;  3MPX A;  1DDW A;  3PZD A;  2EMT A;  4KHB A;  2MDX A; 
#chains in the Genus database with same CATH homology
 2KUQ A;  3NWD A;  2RRF A;  4IOY X;  2GUM A;  3HIE A;  3GYP A;  2YT2 A;  4Z2M B;  2GCL A;  4QJ5 B;  4GOU A;  5LG4 B;  3GYO A;  5I2S A;  4IFS A;  2Z14 A;  2FJU B;  2KR0 A;  3TW1 A;  4KHB B;  4L1R A;  2GCJ A;  3NW8 A;  2NBV A;  4D6W A;  5IRS A;  2K8E A;  4Z2N A;  4QXA B;  3FVC A;  4KHA A;  5M4Y B;  4DIX A;  1ZYI A;  4OT1 A;  2K49 A;  4QJ3 B;  2Z13 A;  4QJ4 B;  2ZKM X;  4KHO A;  4PQ0 A;  3TO1 A;  2Z4D A;  2R2Y A;  4GNK B;  4OSN A;  3NWF A;  3NWA A;  3TVV A;  2KIG A;  3FSS A;  4KHB A;  4CSQ A;  5I2M A;  2KIE A;  2Z59 A;  3A58 A;  4HSI A;  3U12 A;  3OHM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...