2DKPA

Solution structure of the ph domain of pleckstrin homology domain-containing protein family a member 5 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
128
structure length
128
Chain Sequence
GSSGSSGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 5
publication title Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkpA01
3SYXA 2N23A 1X11A 2P0DA 1NI2A 4H8SA 4A6KA 4HATB 1J19A 2DYNA 3CXBB 1DDVA 3D8EA 4GXBA 4L6EA 1XCGA 1KI1B 1DDWA 5DI9B 2HTHB 1ZC3B 5D3YA 5D3WA 2LOXA 3AU4A 1UNRA 3M1IB 3PZDA 2YS3A 2K2JA 1XD4A 2NMBA 1K5DB 2H7EA 1WVHA 5KCVA 4K2PA 2DHIA 2IYBA 2HE7A 3KRWA 4HAUB 3VOQA 5D3XA 1OQNA 4F7GA 3MPXA 3PSCA 2K2UA 4ZRJA 3ODWA 2RGNB 3HK0A 5J3QA 3V5WA 2LULA 3GYPA 4TYZA 2KGXB 2EC1A 3UZTA 1E5WA 4HAZB 4IFSA 2GJYA 2X18A 3FM8C 4HB2B 2P0FA 3TCAA 3PVUA 2Z0OA 1MK7B 2UVMA 1J0WA 3P7ZA 1DDMA 5DIFB 4CHMA 2MWNB 2E2XA 1BAKA 4MT7A 5C79A 3U8ZA 3T06A 1NTYA 1OMWA 2DFKA 4DX8A 2DTCA 1WGUA 5J3TA 2D10A 1XR0B 3PVLA 2RUKB 4TKNA 2DHJA 1UNQA 3OANA 2BCJA 1M7RA 2J0KA 2ROZB 1GG3A 2YS5A 3AU5A 3KY9A 1FGZA 2W2WA 2RLOA 1SHCA 1MPHA 4A6FB 2DLWA 2YS1A 1QC6A 4HDQA 1MKEA 4EKUA 4D0NB 2H7DA 1P3RA 3SV1A 2KUPA 3F5RA 1RRPB 1EF1A 3O96A 4K81A 4KVGB 3LJUX 4F7HA 3FSSA 2D9ZA 2EJ8A 4KAXB 5LONB 2GCLA 5C5BA 1XX0A 2P0HA 3QBVB 4CHJA 1NTVA 1ZC4B 2COAA 4P7IA 1TQZA 3X23A 4IOYX 3DXCA 2D9YA 3TFMA 2AL6A 1EAZA 1M7EA 3ULCA 3ZDTA 4DXAB 1RJ2A 4WJ7A 2YRYA 3P6AA 2D4QA 2DN6A 1N3HA 2M14A 3PEGA 4F7UP 4DBBA 3KSYA 3G9WA 1I7AA 4PQ0A 2DYQA 2AEHA 1X1FA 3ZVRA 1WG7A 3F0WA 3TO1A 2K00A 1K5GB 1XKEA 3ODOA 5J3YA 2D9VA 2J59M 2L1CA 4A5KA 1DBHA 1EVHA 1X1GA 3KRXA 2D11A 4GN1A 1FHOA 2J0JA 2XQNM 5FI0A 2P8VA 5LOPB 1H10A 2IFSA 2VSZA 4A6HA 2OQBA 2GS0A 1WJMA 1UPRA 2KCJA 2V76A 2ELAA 4EMOA 4YONA 1DYNA 2LKOA 1V89A 4WSFA 1WI1A 3IVFA 2YT0A 3ODXA 4K2OA 1WJ1A 3WA0A 1Y5OA 4ZRIA 2EMSA 5HE1A 4HAYB 1W1DA 1ZSQA 4Z2MB 5EFXA 1BTKA 1LW3A 1U5GA 2Z0QA 3HQCA 2JP2A 3SUZA 2Y7BA 3ML4A 1V61A 2NZ8B 3WYFB 1FHXA 1PFJA 4GMXB 2DKPA 3DXEA 1MAIA 2CAYA 3TW1A 4HAXB 1P6SA 1FHWA 1H4RA 2N0YA 2I1KA 2J0MA 3QWMA 2Z0PA 4HB4B 4IAPA 4KHBB 5FI1A 3RCPA 4HB0B 2DX5A 3MDBC 2FJLA 5C6RA 1P5TA 2ADZA 3N7CA 1X05A 5L81A 2MFQA 4KHAA 5KQ1A 1AWEA 2I5CA 1NU2A 2EMTA 3A8QA 3BINA 3ULBA 1PMSA 2ELBA 3D8FA 1ISNA 1Z87A 4HHVA 4Y94A 2CODA 1ZVRA 2VKIA 4GMVA 1UEFA 4NY0A 4C0AA 4GPTB 4YL8A 1PLSA 2LOZA 1TXDA 2L2IA 2COFA 4GZUA 5CLQB 3SO6A 3TVVA 1SGHA 2Y8GA 3HW2B 3KZ1A 4MY6A 4EJNA 2W2XC 1ZM0A 3GYOA 5HE0A 3QIJA 1XODA 1W1HA 4MK0A 4A6FA 5DH9B 5C16A 1V88A 1V5UA 5HE3A 1UNPA 1UPQA 1QQGA 3A8PA 3FEHA 1U29A 2RNRB 2R0DA 3SNHA 5JLJB 1MIZB 1WGQA 2DKQA 2LG1A 4DX90 1BWNA 1W1GA 1U27A 4ZRKA 1KZ7A 4HB3B 2I5FA 2DA0A 2CY5A 2MDXA 1U5FA 2CY4A 4HAWB 5JHGA 3DXDA 2I1JA 3PP2A 4PNKA 4NSWA 5GOWB 1FAOA 2QKLA 4K17A 5DHFB 2ZPYA 5JHHA 2UZSA 1OY2A 3D8DA 1DROA 2OTXA 5D27A 2RSGA 2DHKA 2D9WA 3CIKA 5DHAB 3U7DA 5C5BB 3BJIA 2ROVA 5KQ4A 3PG7A 3A98B 2CRFA 2D2QA 1EGXA 4B6HA 2LYDA 2YVCA 1IRSA 4WVFB 1FGYA 2G35A 4HAVB 2PZ1A 2Y8FA 1GC7A 2MKRA 1B55A 1FB8A 4CYEA 1MK9B 4Z2NA 1Y19B 2QKMA 2RVBB 5JP4A 4BBKA 2YF0A 1X86A 2UZRA 5D3VA 2Q13A 4HDOA 1FOEA 1MIXA 3VIAA 5CLLB 4KHOA 2COCA 1U5EA 1BTNA 1V5PA 1KZGA 2GCJA 2YSZA 3NSUA 2M38A 1TJ6A 2R09A 2D9XA 1LB1A 2VRWB 3PVWA 4XWXA 1V5MA 2W2XD 1Q67A 1I2HA 1U5DA 3AJ4A 5HE2A 2DX1A 1AQCA 1U2BA 1GC6A 2YT1A
chains in the Genus database with same CATH superfamily
3SYXA 2N23A 1X11A 2P0DA 1NI2A 4H8SA 4A6KA 5IRSA 4HATB 1J19A 2DYNA 3CXBB 1DDVA 3D8EA 4L1RA 4GXBA 5I2MA 4L6EA 1XCGA 1KI1B 1DDWA 5DI9B 1MI1A 2HTHB 1ZC3B 5D3YA 5D3WA 2LOXA 3AU4A 1UNRA 3M1IB 4KHBA 3PZDA 4OT1A 2YS3A 2K2JA 2K8EA 1XD4A 2NMBA 1K5DB 2H7EA 1WVHA 5KCVA 4K2PA 2DHIA 4QJ5B 2IYBA 2HE7A 3KRWA 4HAUB 3VOQA 5D3XA 1OQNA 4F7GA 3MPXA 3PSCA 2K2UA 4ZRJA 3ODWA 2RGNB 3HK0A 5J3QA 2Z13A 3V5WA 2LULA 3GYPA 4TYZA 2KGXB 2EC1A 3UZTA 1E5WA 4HAZB 4IFSA 2GJYA 2X18A 3FM8C 4HB2B 2P0FA 3TCAA 3PVUA 2Z0OA 1MK7B 2UVMA 1J0WA 3P7ZA 1DDMA 5DIFB 4CHMA 2MWNB 2E2XA 1BAKA 4MT7A 5C79A 3U8ZA 3T06A 1NTYA 1OMWA 2DFKA 4DX8A 2DTCA 1WGUA 5J3TA 2D10A 1XR0B 3PVLA 2RUKB 4TKNA 2DHJA 1UNQA 3OANA 2BCJA 4GNKB 1M7RA 2J0KA 2ROZB 1GG3A 2YS5A 3AU5A 3KY9A 1FGZA 2W2WA 2RLOA 1SHCA 1MPHA 2GUMA 4A6FB 2DLWA 2YS1A 1QC6A 4HDQA 1MKEA 4EKUA 4D0NB 2H7DA 2KR0A 1P3RA 3SV1A 2KUPA 3F5RA 1RRPB 1EF1A 3O96A 4K81A 4KVGB 3LJUX 4F7HA 3FSSA 2D9ZA 2EJ8A 4KAXB 5LONB 2GCLA 5C5BA 1XX0A 2P0HA 3QBVB 4CHJA 1NTVA 1ZC4B 2K49A 2COAA 4P7IA 1TQZA 4DIXA 3X23A 4IOYX 3DXCA 2D9YA 3TFMA 2AL6A 1EAZA 1M7EA 3ULCA 3ZDTA 4DXAB 4OSNA 1RJ2A 4WJ7A 2YRYA 3P6AA 2D4QA 2DN6A 1N3HA 2M14A 3NW8A 3PEGA 4F7UP 4DBBA 3KSYA 3G9WA 1I7AA 4PQ0A 2DYQA 2AEHA 1X1FA 3ZVRA 1WG7A 3F0WA 3TO1A 2K00A 1K5GB 2Z14A 1XKEA 3ODOA 5J3YA 1ZYIA 2D9VA 2J59M 2L1CA 4A5KA 1DBHA 1EVHA 1X1GA 3KRXA 2D11A 4GN1A 1FHOA 2J0JA 2XQNM 5FI0A 2P8VA 2Z4DA 5LOPB 1H10A 2IFSA 2VSZA 4A6HA 2OQBA 3NWDA 2GS0A 1WJMA 3DCXA 1UPRA 2KCJA 2V76A 2ELAA 4EMOA 4YONA 1DYNA 2LKOA 1V89A 4WSFA 1WI1A 2YT0A 3IVFA 3ODXA 4GOUA 4K2OA 5I2SA 1WJ1A 3WA0A 1Y5OA 4ZRIA 2EMSA 5HE1A 4HAYB 1W1DA 1ZSQA 2KIGA 4Z2MB 5EFXA 1BTKA 2YT2A 1LW3A 3NWFA 1U5GA 2Z0QA 3HQCA 2JP2A 3SUZA 2Y7BA 3ML4A 1V61A 2NZ8B 2Z59A 3WYFB 1FHXA 2KUQA 1PFJA 4GMXB 2DKPA 3DXEA 1MAIA 2CAYA 3TW1A 4HAXB 1P6SA 1FHWA 1H4RA 3B77A 2N0YA 4QJ4B 2I1KA 2J0MA 3QWMA 2Z0PA 4HB4B 4IAPA 4KHBB 5FI1A 3RCPA 4HB0B 2DX5A 3MDBC 2FJLA 2FJUB 5C6RA 1P5TA 2ADZA 3N7CA 1X05A 4QXAB 5L81A 2MFQA 4KHAA 5KQ1A 1AWEA 2I5CA 1NU2A 2EMTA 3A8QA 3BINA 3ULBA 1PMSA 2ELBA 3D8FA 1ISNA 1Z87A 4HHVA 4Y94A 2CODA 1ZVRA 2VKIA 4GMVA 1UEFA 4NY0A 4C0AA 4GPTB 4YL8A 1PLSA 2LOZA 1TXDA 2L2IA 2COFA 4GZUA 5CLQB 3SO6A 4HSIA 3TVVA 1SGHA 3HSAA 3NWAA 2Y8GA 2ZKMX 3HW2B 4CSQA 3KZ1A 4MY6A 4EJNA 2W2XC 1ZM0A 3GYOA 5HE0A 3QIJA 1XODA 1W1HA 4MK0A 1T77A 4A6FA 5DH9B 5C16A 1V88A 1V5UA 5HE3A 1UNPA 1UPQA 3U12A 1QQGA 4D6WA 3A8PA 3FEHA 1U29A 2RNRB 2R0DA 3SNHA 5JLJB 3OHMB 1MIZB 1WGQA 2DKQA 2LG1A 2R2YA 3FVCA 5M4YB 4DX90 1BWNA 1W1GA 1U27A 3A58A 4ZRKA 1KZ7A 4HB3B 2I5FA 2NBVA 2DA0A 2CY5A 2MDXA 1U5FA 2CY4A 4HAWB 5JHGA 3DXDA 2I1JA 3PP2A 4PNKA 4NSWA 5GOWB 1FAOA 2QKLA 4K17A 5DHFB 2KIEA 2ZPYA 5JHHA 2UZSA 1OY2A 3D8DA 5LG4B 1DROA 2OTXA 5D27A 2RSGA 2DHKA 2D9WA 3CIKA 5DHAB 3U7DA 5C5BB 3BJIA 2ROVA 5KQ4A 3PG7A 4QJ3B 3A98B 2CRFA 2D2QA 1EGXA 4B6HA 2LYDA 3HIEA 2YVCA 1IRSA 4WVFB 1FGYA 2G35A 4HAVB 2PZ1A 2Y8FA 1GC7A 2MKRA 1B55A 1FB8A 4CYEA 1MK9B 4Z2NA 1Y19B 2QKMA 2RVBB 5JP4A 4BBKA 2YF0A 1X86A 2UZRA 5D3VA 2Q13A 4HDOA 1FOEA 1MIXA 3VIAA 5CLLB 4KHOA 2COCA 1U5EA 1BTNA 1V5PA 1KZGA 2GCJA 2YSZA 3NSUA 2M38A 1TJ6A 2R09A 2D9XA 1LB1A 2VRWB 3PVWA 4XWXA 1V5MA 2W2XD 1Q67A 1I2HA 1U5DA 3AJ4A 2RRFA 5HE2A 2DX1A 1AQCA 1U2BA 1GC6A 2YT1A
chains in the Genus database with same CATH topology
3SYXA 2N23A 1X11A 2P0DA 1NI2A 4H8SA 4A6KA 4HATB 1J19A 2DYNA 3CXBB 1DDVA 3D8EA 4GXBA 4L6EA 1XCGA 1KI1B 1DDWA 5DI9B 2HTHB 1ZC3B 5D3YA 5D3WA 2LOXA 3AU4A 1UNRA 3M1IB 3PZDA 2YS3A 2K2JA 1XD4A 2NMBA 1K5DB 2H7EA 1WVHA 5KCVA 4K2PA 2DHIA 2IYBA 2HE7A 3KRWA 4HAUB 3VOQA 5D3XA 1OQNA 4F7GA 3MPXA 3PSCA 2K2UA 4ZRJA 3ODWA 2RGNB 3HK0A 5J3QA 3V5WA 2LULA 3GYPA 4TYZA 2KGXB 2EC1A 3UZTA 1E5WA 4HAZB 4IFSA 2GJYA 2X18A 3FM8C 4HB2B 2P0FA 3TCAA 3PVUA 2Z0OA 1MK7B 2UVMA 1J0WA 3P7ZA 1DDMA 5DIFB 4CHMA 2MWNB 2E2XA 1BAKA 4MT7A 5C79A 3U8ZA 3T06A 1NTYA 1OMWA 2DFKA 4DX8A 2DTCA 1WGUA 5J3TA 2D10A 1XR0B 3PVLA 2RUKB 4TKNA 2DHJA 1UNQA 3OANA 2BCJA 1M7RA 2J0KA 2ROZB 1GG3A 2YS5A 3AU5A 3KY9A 1FGZA 2W2WA 2RLOA 1SHCA 1MPHA 4A6FB 2DLWA 2YS1A 1QC6A 4HDQA 1MKEA 4EKUA 4D0NB 2H7DA 1P3RA 3SV1A 2KUPA 3F5RA 1RRPB 1EF1A 3O96A 4K81A 4KVGB 3LJUX 4F7HA 3FSSA 2D9ZA 2EJ8A 4KAXB 5LONB 2GCLA 5C5BA 1XX0A 2P0HA 3QBVB 4CHJA 1NTVA 1ZC4B 2COAA 4P7IA 1TQZA 3X23A 4IOYX 3DXCA 2D9YA 3TFMA 2AL6A 1EAZA 1M7EA 3ULCA 3ZDTA 4DXAB 1RJ2A 4WJ7A 2YRYA 3P6AA 2D4QA 2DN6A 1N3HA 2M14A 3PEGA 4F7UP 4DBBA 3KSYA 3G9WA 1I7AA 4PQ0A 2DYQA 2AEHA 1X1FA 3ZVRA 1WG7A 3F0WA 3TO1A 2K00A 1K5GB 1XKEA 3ODOA 5J3YA 2D9VA 2J59M 2L1CA 4A5KA 1DBHA 1EVHA 1X1GA 3KRXA 2D11A 4GN1A 1FHOA 2J0JA 2XQNM 5FI0A 2P8VA 5LOPB 1H10A 2IFSA 2VSZA 4A6HA 2OQBA 2GS0A 1WJMA 1UPRA 2KCJA 2V76A 2ELAA 4EMOA 4YONA 1DYNA 2LKOA 1V89A 4WSFA 1WI1A 3IVFA 2YT0A 3ODXA 4K2OA 1WJ1A 3WA0A 1Y5OA 4ZRIA 2EMSA 5HE1A 4HAYB 1W1DA 1ZSQA 4Z2MB 5EFXA 1BTKA 1LW3A 1U5GA 2Z0QA 3HQCA 2JP2A 3SUZA 2Y7BA 3ML4A 1V61A 2NZ8B 3WYFB 1FHXA 1PFJA 4GMXB 2DKPA 3DXEA 1MAIA 2CAYA 3TW1A 4HAXB 1P6SA 1FHWA 1H4RA 2N0YA 2I1KA 2J0MA 3QWMA 2Z0PA 4HB4B 4IAPA 4KHBB 5FI1A 3RCPA 4HB0B 2DX5A 3MDBC 2FJLA 5C6RA 1P5TA 2ADZA 3N7CA 1X05A 5L81A 2MFQA 4KHAA 5KQ1A 1AWEA 2I5CA 1NU2A 2EMTA 3A8QA 3BINA 3ULBA 1PMSA 2ELBA 3D8FA 1ISNA 1Z87A 4HHVA 4Y94A 2CODA 1ZVRA 2VKIA 4GMVA 1UEFA 4NY0A 4C0AA 4GPTB 4YL8A 1PLSA 2LOZA 1TXDA 2L2IA 2COFA 4GZUA 5CLQB 3SO6A 3TVVA 1SGHA 2Y8GA 3HW2B 3KZ1A 4MY6A 4EJNA 2W2XC 1ZM0A 3GYOA 5HE0A 3QIJA 1XODA 1W1HA 4MK0A 4A6FA 5DH9B 5C16A 1V88A 1V5UA 5HE3A 1UNPA 1UPQA 1QQGA 3A8PA 3FEHA 1U29A 2RNRB 2R0DA 3SNHA 5JLJB 1MIZB 1WGQA 2DKQA 2LG1A 4DX90 1BWNA 1W1GA 1U27A 4ZRKA 1KZ7A 4HB3B 2I5FA 2DA0A 2CY5A 2MDXA 1U5FA 2CY4A 4HAWB 5JHGA 3DXDA 2I1JA 3PP2A 4PNKA 4NSWA 5GOWB 1FAOA 2QKLA 4K17A 5DHFB 2ZPYA 5JHHA 2UZSA 1OY2A 3D8DA 1DROA 2OTXA 5D27A 2RSGA 2DHKA 2D9WA 3CIKA 5DHAB 3U7DA 5C5BB 3BJIA 2ROVA 5KQ4A 3PG7A 3A98B 2CRFA 2D2QA 1EGXA 4B6HA 2LYDA 2YVCA 1IRSA 4WVFB 1FGYA 2G35A 4HAVB 2PZ1A 2Y8FA 1GC7A 2MKRA 1B55A 1FB8A 4CYEA 1MK9B 4Z2NA 1Y19B 2QKMA 2RVBB 5JP4A 4BBKA 2YF0A 1X86A 2UZRA 5D3VA 2Q13A 4HDOA 1FOEA 1MIXA 3VIAA 5CLLB 4KHOA 2COCA 1U5EA 1BTNA 1V5PA 1KZGA 2GCJA 2YSZA 3NSUA 2M38A 1TJ6A 2R09A 2D9XA 1LB1A 2VRWB 3PVWA 4XWXA 1V5MA 2W2XD 1Q67A 1I2HA 1U5DA 3AJ4A 5HE2A 2DX1A 1AQCA 1U2BA 1GC6A 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYX A;  2N23 A;  1X11 A;  2P0D A;  1NI2 A;  4H8S A;  4A6K A;  4HAT B;  1J19 A;  2DYN A;  3CXB B;  1DDV A;  3D8E A;  4GXB A;  4L6E A;  1XCG A;  1KI1 B;  1DDW A;  5DI9 B;  2HTH B;  1ZC3 B;  5D3Y A;  5D3W A;  2LOX A;  3AU4 A;  1UNR A;  3M1I B;  3PZD A;  2YS3 A;  2K2J A;  1XD4 A;  2NMB A;  1K5D B;  2H7E A;  1WVH A;  5KCV A;  4K2P A;  2DHI A;  2IYB A;  2HE7 A;  3KRW A;  4HAU B;  3VOQ A;  5D3X A;  1OQN A;  4F7G A;  3MPX A;  3PSC A;  2K2U A;  4ZRJ A;  3ODW A;  2RGN B;  3HK0 A;  5J3Q A;  3V5W A;  2LUL A;  3GYP A;  4TYZ A;  2KGX B;  2EC1 A;  3UZT A;  1E5W A;  4HAZ B;  4IFS A;  2GJY A;  2X18 A;  3FM8 C;  4HB2 B;  2P0F A;  3TCA A;  3PVU A;  2Z0O A;  1MK7 B;  2UVM A;  1J0W A;  3P7Z A;  1DDM A;  5DIF B;  4CHM A;  2MWN B;  2E2X A;  1BAK A;  4MT7 A;  5C79 A;  3U8Z A;  3T06 A;  1NTY A;  1OMW A;  2DFK A;  4DX8 A;  2DTC A;  1WGU A;  5J3T A;  2D10 A;  1XR0 B;  3PVL A;  2RUK B;  4TKN A;  2DHJ A;  1UNQ A;  3OAN A;  2BCJ A;  1M7R A;  2J0K A;  2ROZ B;  1GG3 A;  2YS5 A;  3AU5 A;  3KY9 A;  1FGZ A;  2W2W A;  2RLO A;  1SHC A;  1MPH A;  4A6F B;  2DLW A;  2YS1 A;  1QC6 A;  4HDQ A;  1MKE A;  4EKU A;  4D0N B;  2H7D A;  1P3R A;  3SV1 A;  2KUP A;  3F5R A;  1RRP B;  1EF1 A;  3O96 A;  4K81 A;  4KVG B;  3LJU X;  4F7H A;  3FSS A;  2D9Z A;  2EJ8 A;  4KAX B;  5LON B;  2GCL A;  5C5B A;  1XX0 A;  2P0H A;  3QBV B;  4CHJ A;  1NTV A;  1ZC4 B;  2COA A;  4P7I A;  1TQZ A;  3X23 A;  4IOY X;  3DXC A;  2D9Y A;  3TFM A;  2AL6 A;  1EAZ A;  1M7E A;  3ULC A;  3ZDT A;  4DXA B;  1RJ2 A;  4WJ7 A;  2YRY A;  3P6A A;  2D4Q A;  2DN6 A;  1N3H A;  2M14 A;  3PEG A;  4F7U P;  4DBB A;  3KSY A;  3G9W A;  1I7A A;  4PQ0 A;  2DYQ A;  2AEH A;  1X1F A;  3ZVR A;  1WG7 A;  3F0W A;  3TO1 A;  2K00 A;  1K5G B;  1XKE A;  3ODO A;  5J3Y A;  2D9V A;  2J59 M;  2L1C A;  4A5K A;  1DBH A;  1EVH A;  1X1G A;  3KRX A;  2D11 A;  4GN1 A;  1FHO A;  2J0J A;  2XQN M;  5FI0 A;  2P8V A;  5LOP B;  1H10 A;  2IFS A;  2VSZ A;  4A6H A;  2OQB A;  2GS0 A;  1WJM A;  1UPR A;  2KCJ A;  2V76 A;  2ELA A;  4EMO A;  4YON A;  1DYN A;  2LKO A;  1V89 A;  4WSF A;  1WI1 A;  3IVF A;  2YT0 A;  3ODX A;  4K2O A;  1WJ1 A;  3WA0 A;  1Y5O A;  4ZRI A;  2EMS A;  5HE1 A;  4HAY B;  1W1D A;  1ZSQ A;  4Z2M B;  5EFX A;  1BTK A;  1LW3 A;  1U5G A;  2Z0Q A;  3HQC A;  2JP2 A;  3SUZ A;  2Y7B A;  3ML4 A;  1V61 A;  2NZ8 B;  3WYF B;  1FHX A;  1PFJ A;  4GMX B;  2DKP A;  3DXE A;  1MAI A;  2CAY A;  3TW1 A;  4HAX B;  1P6S A;  1FHW A;  1H4R A;  2N0Y A;  2I1K A;  2J0M A;  3QWM A;  2Z0P A;  4HB4 B;  4IAP A;  4KHB B;  5FI1 A;  3RCP A;  4HB0 B;  2DX5 A;  3MDB C;  2FJL A;  5C6R A;  1P5T A;  2ADZ A;  3N7C A;  1X05 A;  5L81 A;  2MFQ A;  4KHA A;  5KQ1 A;  1AWE A;  2I5C A;  1NU2 A;  2EMT A;  3A8Q A;  3BIN A;  3ULB A;  1PMS A;  2ELB A;  3D8F A;  1ISN A;  1Z87 A;  4HHV A;  4Y94 A;  2COD A;  1ZVR A;  2VKI A;  4GMV A;  1UEF A;  4NY0 A;  4C0A A;  4GPT B;  4YL8 A;  1PLS A;  2LOZ A;  1TXD A;  2L2I A;  2COF A;  4GZU A;  5CLQ B;  3SO6 A;  3TVV A;  1SGH A;  2Y8G A;  3HW2 B;  3KZ1 A;  4MY6 A;  4EJN A;  2W2X C;  1ZM0 A;  3GYO A;  5HE0 A;  3QIJ A;  1XOD A;  1W1H A;  4MK0 A;  4A6F A;  5DH9 B;  5C16 A;  1V88 A;  1V5U A;  5HE3 A;  1UNP A;  1UPQ A;  1QQG A;  3A8P A;  3FEH A;  1U29 A;  2RNR B;  2R0D A;  3SNH A;  5JLJ B;  1MIZ B;  1WGQ A;  2DKQ A;  2LG1 A;  4DX9 0;  1BWN A;  1W1G A;  1U27 A;  4ZRK A;  1KZ7 A;  4HB3 B;  2I5F A;  2DA0 A;  2CY5 A;  2MDX A;  1U5F A;  2CY4 A;  4HAW B;  5JHG A;  3DXD A;  2I1J A;  3PP2 A;  4PNK A;  4NSW A;  5GOW B;  1FAO A;  2QKL A;  4K17 A;  5DHF B;  2ZPY A;  5JHH A;  2UZS A;  1OY2 A;  3D8D A;  1DRO A;  2OTX A;  5D27 A;  2RSG A;  2DHK A;  2D9W A;  3CIK A;  5DHA B;  3U7D A;  5C5B B;  3BJI A;  2ROV A;  5KQ4 A;  3PG7 A;  3A98 B;  2CRF A;  2D2Q A;  1EGX A;  4B6H A;  2LYD A;  2YVC A;  1IRS A;  4WVF B;  1FGY A;  2G35 A;  4HAV B;  2PZ1 A;  2Y8F A;  1GC7 A;  2MKR A;  1B55 A;  1FB8 A;  4CYE A;  1MK9 B;  4Z2N A;  1Y19 B;  2QKM A;  2RVB B;  5JP4 A;  4BBK A;  2YF0 A;  1X86 A;  2UZR A;  5D3V A;  2Q13 A;  4HDO A;  1FOE A;  1MIX A;  3VIA A;  5CLL B;  4KHO A;  2COC A;  1U5E A;  1BTN A;  1V5P A;  1KZG A;  2GCJ A;  2YSZ A;  3NSU A;  2M38 A;  1TJ6 A;  2R09 A;  2D9X A;  1LB1 A;  2VRW B;  3PVW A;  4XWX A;  1V5M A;  2W2X D;  1Q67 A;  1I2H A;  1U5D A;  3AJ4 A;  5HE2 A;  2DX1 A;  1AQC A;  1U2B A;  1GC6 A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 3SYX A;  2N23 A;  1X11 A;  2P0D A;  1NI2 A;  4H8S A;  4A6K A;  5IRS A;  4HAT B;  1J19 A;  2DYN A;  3CXB B;  1DDV A;  3D8E A;  4L1R A;  4GXB A;  5I2M A;  4L6E A;  1XCG A;  1KI1 B;  1DDW A;  5DI9 B;  1MI1 A;  2HTH B;  1ZC3 B;  5D3Y A;  5D3W A;  2LOX A;  3AU4 A;  1UNR A;  3M1I B;  4KHB A;  3PZD A;  4OT1 A;  2YS3 A;  2K2J A;  2K8E A;  1XD4 A;  2NMB A;  1K5D B;  2H7E A;  1WVH A;  5KCV A;  4K2P A;  2DHI A;  4QJ5 B;  2IYB A;  2HE7 A;  3KRW A;  4HAU B;  3VOQ A;  5D3X A;  1OQN A;  4F7G A;  3MPX A;  3PSC A;  2K2U A;  4ZRJ A;  3ODW A;  2RGN B;  3HK0 A;  5J3Q A;  2Z13 A;  3V5W A;  2LUL A;  3GYP A;  4TYZ A;  2KGX B;  2EC1 A;  3UZT A;  1E5W A;  4HAZ B;  4IFS A;  2GJY A;  2X18 A;  3FM8 C;  4HB2 B;  2P0F A;  3TCA A;  3PVU A;  2Z0O A;  1MK7 B;  2UVM A;  1J0W A;  3P7Z A;  1DDM A;  5DIF B;  4CHM A;  2MWN B;  2E2X A;  1BAK A;  4MT7 A;  5C79 A;  3U8Z A;  3T06 A;  1NTY A;  1OMW A;  2DFK A;  4DX8 A;  2DTC A;  1WGU A;  5J3T A;  2D10 A;  1XR0 B;  3PVL A;  2RUK B;  4TKN A;  2DHJ A;  1UNQ A;  3OAN A;  2BCJ A;  4GNK B;  1M7R A;  2J0K A;  2ROZ B;  1GG3 A;  2YS5 A;  3AU5 A;  3KY9 A;  1FGZ A;  2W2W A;  2RLO A;  1SHC A;  1MPH A;  2GUM A;  4A6F B;  2DLW A;  2YS1 A;  1QC6 A;  4HDQ A;  1MKE A;  4EKU A;  4D0N B;  2H7D A;  2KR0 A;  1P3R A;  3SV1 A;  2KUP A;  3F5R A;  1RRP B;  1EF1 A;  3O96 A;  4K81 A;  4KVG B;  3LJU X;  4F7H A;  3FSS A;  2D9Z A;  2EJ8 A;  4KAX B;  5LON B;  2GCL A;  5C5B A;  1XX0 A;  2P0H A;  3QBV B;  4CHJ A;  1NTV A;  1ZC4 B;  2K49 A;  2COA A;  4P7I A;  1TQZ A;  4DIX A;  3X23 A;  4IOY X;  3DXC A;  2D9Y A;  3TFM A;  2AL6 A;  1EAZ A;  1M7E A;  3ULC A;  3ZDT A;  4DXA B;  4OSN A;  1RJ2 A;  4WJ7 A;  2YRY A;  3P6A A;  2D4Q A;  2DN6 A;  1N3H A;  2M14 A;  3NW8 A;  3PEG A;  4F7U P;  4DBB A;  3KSY A;  3G9W A;  1I7A A;  4PQ0 A;  2DYQ A;  2AEH A;  1X1F A;  3ZVR A;  1WG7 A;  3F0W A;  3TO1 A;  2K00 A;  1K5G B;  2Z14 A;  1XKE A;  3ODO A;  5J3Y A;  1ZYI A;  2D9V A;  2J59 M;  2L1C A;  4A5K A;  1DBH A;  1EVH A;  1X1G A;  3KRX A;  2D11 A;  4GN1 A;  1FHO A;  2J0J A;  2XQN M;  5FI0 A;  2P8V A;  2Z4D A;  5LOP B;  1H10 A;  2IFS A;  2VSZ A;  4A6H A;  2OQB A;  3NWD A;  2GS0 A;  1WJM A;  3DCX A;  1UPR A;  2KCJ A;  2V76 A;  2ELA A;  4EMO A;  4YON A;  1DYN A;  2LKO A;  1V89 A;  4WSF A;  1WI1 A;  2YT0 A;  3IVF A;  3ODX A;  4GOU A;  4K2O A;  5I2S A;  1WJ1 A;  3WA0 A;  1Y5O A;  4ZRI A;  2EMS A;  5HE1 A;  4HAY B;  1W1D A;  1ZSQ A;  2KIG A;  4Z2M B;  5EFX A;  1BTK A;  2YT2 A;  1LW3 A;  3NWF A;  1U5G A;  2Z0Q A;  3HQC A;  2JP2 A;  3SUZ A;  2Y7B A;  3ML4 A;  1V61 A;  2NZ8 B;  2Z59 A;  3WYF B;  1FHX A;  2KUQ A;  1PFJ A;  4GMX B;  2DKP A;  3DXE A;  1MAI A;  2CAY A;  3TW1 A;  4HAX B;  1P6S A;  1FHW A;  1H4R A;  3B77 A;  2N0Y A;  4QJ4 B;  2I1K A;  2J0M A;  3QWM A;  2Z0P A;  4HB4 B;  4IAP A;  4KHB B;  5FI1 A;  3RCP A;  4HB0 B;  2DX5 A;  3MDB C;  2FJL A;  2FJU B;  5C6R A;  1P5T A;  2ADZ A;  3N7C A;  1X05 A;  4QXA B;  5L81 A;  2MFQ A;  4KHA A;  5KQ1 A;  1AWE A;  2I5C A;  1NU2 A;  2EMT A;  3A8Q A;  3BIN A;  3ULB A;  1PMS A;  2ELB A;  3D8F A;  1ISN A;  1Z87 A;  4HHV A;  4Y94 A;  2COD A;  1ZVR A;  2VKI A;  4GMV A;  1UEF A;  4NY0 A;  4C0A A;  4GPT B;  4YL8 A;  1PLS A;  2LOZ A;  1TXD A;  2L2I A;  2COF A;  4GZU A;  5CLQ B;  3SO6 A;  4HSI A;  3TVV A;  1SGH A;  3HSA A;  3NWA A;  2Y8G A;  2ZKM X;  3HW2 B;  4CSQ A;  3KZ1 A;  4MY6 A;  4EJN A;  2W2X C;  1ZM0 A;  3GYO A;  5HE0 A;  3QIJ A;  1XOD A;  1W1H A;  4MK0 A;  1T77 A;  4A6F A;  5DH9 B;  5C16 A;  1V88 A;  1V5U A;  5HE3 A;  1UNP A;  1UPQ A;  3U12 A;  1QQG A;  4D6W A;  3A8P A;  3FEH A;  1U29 A;  2RNR B;  2R0D A;  3SNH A;  5JLJ B;  3OHM B;  1MIZ B;  1WGQ A;  2DKQ A;  2LG1 A;  2R2Y A;  3FVC A;  5M4Y B;  4DX9 0;  1BWN A;  1W1G A;  1U27 A;  3A58 A;  4ZRK A;  1KZ7 A;  4HB3 B;  2I5F A;  2NBV A;  2DA0 A;  2CY5 A;  2MDX A;  1U5F A;  2CY4 A;  4HAW B;  5JHG A;  3DXD A;  2I1J A;  3PP2 A;  4PNK A;  4NSW A;  5GOW B;  1FAO A;  2QKL A;  4K17 A;  5DHF B;  2KIE A;  2ZPY A;  5JHH A;  2UZS A;  1OY2 A;  3D8D A;  5LG4 B;  1DRO A;  2OTX A;  5D27 A;  2RSG A;  2DHK A;  2D9W A;  3CIK A;  5DHA B;  3U7D A;  5C5B B;  3BJI A;  2ROV A;  5KQ4 A;  3PG7 A;  4QJ3 B;  3A98 B;  2CRF A;  2D2Q A;  1EGX A;  4B6H A;  2LYD A;  3HIE A;  2YVC A;  1IRS A;  4WVF B;  1FGY A;  2G35 A;  4HAV B;  2PZ1 A;  2Y8F A;  1GC7 A;  2MKR A;  1B55 A;  1FB8 A;  4CYE A;  1MK9 B;  4Z2N A;  1Y19 B;  2QKM A;  2RVB B;  5JP4 A;  4BBK A;  2YF0 A;  1X86 A;  2UZR A;  5D3V A;  2Q13 A;  4HDO A;  1FOE A;  1MIX A;  3VIA A;  5CLL B;  4KHO A;  2COC A;  1U5E A;  1BTN A;  1V5P A;  1KZG A;  2GCJ A;  2YSZ A;  3NSU A;  2M38 A;  1TJ6 A;  2R09 A;  2D9X A;  1LB1 A;  2VRW B;  3PVW A;  4XWX A;  1V5M A;  2W2X D;  1Q67 A;  1I2H A;  1U5D A;  3AJ4 A;  2RRF A;  5HE2 A;  2DX1 A;  1AQC A;  1U2B A;  1GC6 A;  2YT1 A; 
#chains in the Genus database with same CATH homology
 3SYX A;  2N23 A;  1X11 A;  2P0D A;  1NI2 A;  4H8S A;  4A6K A;  4HAT B;  1J19 A;  2DYN A;  3CXB B;  1DDV A;  3D8E A;  4GXB A;  4L6E A;  1XCG A;  1KI1 B;  1DDW A;  5DI9 B;  2HTH B;  1ZC3 B;  5D3Y A;  5D3W A;  2LOX A;  3AU4 A;  1UNR A;  3M1I B;  3PZD A;  2YS3 A;  2K2J A;  1XD4 A;  2NMB A;  1K5D B;  2H7E A;  1WVH A;  5KCV A;  4K2P A;  2DHI A;  2IYB A;  2HE7 A;  3KRW A;  4HAU B;  3VOQ A;  5D3X A;  1OQN A;  4F7G A;  3MPX A;  3PSC A;  2K2U A;  4ZRJ A;  3ODW A;  2RGN B;  3HK0 A;  5J3Q A;  3V5W A;  2LUL A;  3GYP A;  4TYZ A;  2KGX B;  2EC1 A;  3UZT A;  1E5W A;  4HAZ B;  4IFS A;  2GJY A;  2X18 A;  3FM8 C;  4HB2 B;  2P0F A;  3TCA A;  3PVU A;  2Z0O A;  1MK7 B;  2UVM A;  1J0W A;  3P7Z A;  1DDM A;  5DIF B;  4CHM A;  2MWN B;  2E2X A;  1BAK A;  4MT7 A;  5C79 A;  3U8Z A;  3T06 A;  1NTY A;  1OMW A;  2DFK A;  4DX8 A;  2DTC A;  1WGU A;  5J3T A;  2D10 A;  1XR0 B;  3PVL A;  2RUK B;  4TKN A;  2DHJ A;  1UNQ A;  3OAN A;  2BCJ A;  1M7R A;  2J0K A;  2ROZ B;  1GG3 A;  2YS5 A;  3AU5 A;  3KY9 A;  1FGZ A;  2W2W A;  2RLO A;  1SHC A;  1MPH A;  4A6F B;  2DLW A;  2YS1 A;  1QC6 A;  4HDQ A;  1MKE A;  4EKU A;  4D0N B;  2H7D A;  1P3R A;  3SV1 A;  2KUP A;  3F5R A;  1RRP B;  1EF1 A;  3O96 A;  4K81 A;  4KVG B;  3LJU X;  4F7H A;  3FSS A;  2D9Z A;  2EJ8 A;  4KAX B;  5LON B;  2GCL A;  5C5B A;  1XX0 A;  2P0H A;  3QBV B;  4CHJ A;  1NTV A;  1ZC4 B;  2COA A;  4P7I A;  1TQZ A;  3X23 A;  4IOY X;  3DXC A;  2D9Y A;  3TFM A;  2AL6 A;  1EAZ A;  1M7E A;  3ULC A;  3ZDT A;  4DXA B;  1RJ2 A;  4WJ7 A;  2YRY A;  3P6A A;  2D4Q A;  2DN6 A;  1N3H A;  2M14 A;  3PEG A;  4F7U P;  4DBB A;  3KSY A;  3G9W A;  1I7A A;  4PQ0 A;  2DYQ A;  2AEH A;  1X1F A;  3ZVR A;  1WG7 A;  3F0W A;  3TO1 A;  2K00 A;  1K5G B;  1XKE A;  3ODO A;  5J3Y A;  2D9V A;  2J59 M;  2L1C A;  4A5K A;  1DBH A;  1EVH A;  1X1G A;  3KRX A;  2D11 A;  4GN1 A;  1FHO A;  2J0J A;  2XQN M;  5FI0 A;  2P8V A;  5LOP B;  1H10 A;  2IFS A;  2VSZ A;  4A6H A;  2OQB A;  2GS0 A;  1WJM A;  1UPR A;  2KCJ A;  2V76 A;  2ELA A;  4EMO A;  4YON A;  1DYN A;  2LKO A;  1V89 A;  4WSF A;  1WI1 A;  3IVF A;  2YT0 A;  3ODX A;  4K2O A;  1WJ1 A;  3WA0 A;  1Y5O A;  4ZRI A;  2EMS A;  5HE1 A;  4HAY B;  1W1D A;  1ZSQ A;  4Z2M B;  5EFX A;  1BTK A;  1LW3 A;  1U5G A;  2Z0Q A;  3HQC A;  2JP2 A;  3SUZ A;  2Y7B A;  3ML4 A;  1V61 A;  2NZ8 B;  3WYF B;  1FHX A;  1PFJ A;  4GMX B;  2DKP A;  3DXE A;  1MAI A;  2CAY A;  3TW1 A;  4HAX B;  1P6S A;  1FHW A;  1H4R A;  2N0Y A;  2I1K A;  2J0M A;  3QWM A;  2Z0P A;  4HB4 B;  4IAP A;  4KHB B;  5FI1 A;  3RCP A;  4HB0 B;  2DX5 A;  3MDB C;  2FJL A;  5C6R A;  1P5T A;  2ADZ A;  3N7C A;  1X05 A;  5L81 A;  2MFQ A;  4KHA A;  5KQ1 A;  1AWE A;  2I5C A;  1NU2 A;  2EMT A;  3A8Q A;  3BIN A;  3ULB A;  1PMS A;  2ELB A;  3D8F A;  1ISN A;  1Z87 A;  4HHV A;  4Y94 A;  2COD A;  1ZVR A;  2VKI A;  4GMV A;  1UEF A;  4NY0 A;  4C0A A;  4GPT B;  4YL8 A;  1PLS A;  2LOZ A;  1TXD A;  2L2I A;  2COF A;  4GZU A;  5CLQ B;  3SO6 A;  3TVV A;  1SGH A;  2Y8G A;  3HW2 B;  3KZ1 A;  4MY6 A;  4EJN A;  2W2X C;  1ZM0 A;  3GYO A;  5HE0 A;  3QIJ A;  1XOD A;  1W1H A;  4MK0 A;  4A6F A;  5DH9 B;  5C16 A;  1V88 A;  1V5U A;  5HE3 A;  1UNP A;  1UPQ A;  1QQG A;  3A8P A;  3FEH A;  1U29 A;  2RNR B;  2R0D A;  3SNH A;  5JLJ B;  1MIZ B;  1WGQ A;  2DKQ A;  2LG1 A;  4DX9 0;  1BWN A;  1W1G A;  1U27 A;  4ZRK A;  1KZ7 A;  4HB3 B;  2I5F A;  2DA0 A;  2CY5 A;  2MDX A;  1U5F A;  2CY4 A;  4HAW B;  5JHG A;  3DXD A;  2I1J A;  3PP2 A;  4PNK A;  4NSW A;  5GOW B;  1FAO A;  2QKL A;  4K17 A;  5DHF B;  2ZPY A;  5JHH A;  2UZS A;  1OY2 A;  3D8D A;  1DRO A;  2OTX A;  5D27 A;  2RSG A;  2DHK A;  2D9W A;  3CIK A;  5DHA B;  3U7D A;  5C5B B;  3BJI A;  2ROV A;  5KQ4 A;  3PG7 A;  3A98 B;  2CRF A;  2D2Q A;  1EGX A;  4B6H A;  2LYD A;  2YVC A;  1IRS A;  4WVF B;  1FGY A;  2G35 A;  4HAV B;  2PZ1 A;  2Y8F A;  1GC7 A;  2MKR A;  1B55 A;  1FB8 A;  4CYE A;  1MK9 B;  4Z2N A;  1Y19 B;  2QKM A;  2RVB B;  5JP4 A;  4BBK A;  2YF0 A;  1X86 A;  2UZR A;  5D3V A;  2Q13 A;  4HDO A;  1FOE A;  1MIX A;  3VIA A;  5CLL B;  4KHO A;  2COC A;  1U5E A;  1BTN A;  1V5P A;  1KZG A;  2GCJ A;  2YSZ A;  3NSU A;  2M38 A;  1TJ6 A;  2R09 A;  2D9X A;  1LB1 A;  2VRW B;  3PVW A;  4XWX A;  1V5M A;  2W2X D;  1Q67 A;  1I2H A;  1U5D A;  3AJ4 A;  5HE2 A;  2DX1 A;  1AQC A;  1U2B A;  1GC6 A;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...