2DKPA

Solution structure of the ph domain of pleckstrin homology domain-containing protein family a member 5 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
128
structure length
128
Chain Sequence
GSSGSSGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family A member 5
publication title Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human
rcsb
source organism Homo sapiens
total genus 12
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkpA01
5JLJB 4ZRKA 1RRPB 3QIJA 4L6EA 4K17A 5DHFB 5LONB 3BINA 1OMWA 3VIAA 1GC6A 1XR0B 4CHMA 4EKUA 2ELBA 2YS5A 4ZRJA 2D9ZA 1V88A 3HK0A 3ML4A 3P6AA 5JHHA 4BBKA 4DBBA 1AWEA 3PEGA 5C6RA 2DA0A 2AEHA 2YS3A 1EAZA 2G35A 1KZ7A 4NSWA 4GMXB 4GXBA 3ODXA 2J59M 1UNRA 4XWXA 3HW2B 3BJIA 2P0FA 4F7HA 5HE3A 3KRXA 4IFSA 1FHXA 4MT7A 1BAKA 2Z0QA 2LOZA 1SHCA 1OY2A 5HE0A 1NU2A 5KQ1A 2H7EA 2DX5A 1PLSA 2LYDA 2D2QA 1FAOA 3PSCA 1LW3A 2MWNB 4B6HA 2R09A 5FI0A 2E2XA 5C5BB 2VKIA 2HE7A 1TQZA 3U8ZA 2DHJA 1Y5OA 1DBHA 2M14A 1FHWA 3TCAA 5KQ4A 3MDBC 4NY0A 2DHKA 3FM8C 2CODA 1J19A 3PG7A 1WG7A 2RGNB 4KVGB 1WGQA 2YS1A 3TO1A 1LB1A 1V5PA 4ZRIA 3AU4A 5J3YA 1P5TA 4GN1A 3RCPA 1XCGA 4Z2NA 2JP2A 2Y8FA 3CIKA 5CLLB 4C0AA 5D3VA 1MK7B 3TVVA 3QWMA 2I1KA 4GMVA 5J3QA 1PFJA 1W1GA 1J0WA 2LG1A 1GG3A 3G9WA 2VRWB 2H7DA 4EMOA 2MDXA 2RLOA 4KHOA 1XKEA 1M7RA 1P6SA 2NMBA 4HDQA 5C79A 2MFQA 1M7EA 2GJYA 1V5MA 5C5BA 4HAUB 1MIXA 3KSYA 4IAPA 2ELAA 1SGHA 4H8SA 1V89A 3KRWA 1ISNA 1EF1A 2EMSA 2GS0A 3GYOA 5C16A 2AL6A 1EVHA 1U5GA 2I1JA 3A8PA 1MK9B 4Z2MB 4MY6A 2BCJA 2DLWA 3DXCA 5D3WA 4HHVA 3AU5A 2R0DA 1U5EA 1ZSQA 4P7IA 2P8VA 1UPRA 4HAZB 5HE1A 2CAYA 2V76A 5J3TA 1UPQA 1FGZA 3O96A 2ZPYA 1X11A 2W2WA 4HAWB 5DI9B 2P0HA 2D9XA 4WSFA 5JHGA 1QQGA 4F7GA 2KUPA 3UZTA 3ODOA 1DYNA 3PVUA 3ULCA 2RNRB 2ROVA 2J0KA 3KY9A 3AJ4A 1V5UA 3D8FA 4HB4B 2N0YA 2Z0OA 1FB8A 3GYPA 2DTCA 2D9WA 2N23A 3P7ZA 2RUKB 3HQCA 4Y94A 5CLQB 3FSSA 2PZ1A 4WJ7A 2W2XD 1K5DB 3PVWA 2DKPA 1N3HA 2DX1A 1NTYA 4DX90 1UEFA 2ROZB 3V5WA 3TFMA 1KZGA 4CHJA 1K5GB 3A98B 3WA0A 1ZVRA 3ULBA 1P3RA 1U27A 4A5KA 3F5RA 2YVCA 2GCLA 1DROA 2CY4A 2M38A 2NZ8B 2Q13A 1NI2A 5FI1A 2DYNA 1X1GA 4DXAB 1BTKA 4KHAA 1I2HA 3X23A 2COFA 1GC7A 1MPHA 2YT0A 2ADZA 3SV1A 4KAXB 4GZUA 2J0JA 2DN6A 2IYBA 4EJNA 3KZ1A 3SYXA 3CXBB 1NTVA 1V61A 2HTHB 1UNPA 1DDVA 2DFKA 3NSUA 4HB3B 3IVFA 1EGXA 2K2JA 2K00A 2IFSA 2MKRA 2L2IA 1X05A 1ZC3B 2OQBA 2YF0A 2XQNM 2RSGA 2I5FA 1WI1A 2OTXA 2D9VA 2COCA 1DDMA 2FJLA 4TKNA 2YT1A 3ZVRA 4KHBB 2GCJA 1E5WA 2YRYA 2DHIA 4HB2B 4YL8A 3TW1A 4WVFB 2X18A 3OANA 2D9YA 5KCVA 1U5FA 3ZDTA 2EC1A 1FHOA 1KI1B 1MIZB 1Z87A 1XODA 5L81A 3FEHA 1XX0A 3DXDA 1B55A 2DKQA 4HAXB 2UVMA 3A8QA 5D3XA 3N7CA 4A6FB 4F7UP 5DH9B 1IRSA 1W1DA 3LJUX 4IOYX 1ZM0A 1W1HA 2LULA 1H10A 2COAA 1WJMA 4CYEA 1H4RA 3QBVB 1I7AA 2KCJA 1BWNA 5EFXA 2K2UA 1DDWA 2UZRA 4TYZA 3VOQA 3T06A 3SO6A 1Y19B 1TJ6A 2EMTA 4HDOA 2J0MA 1X86A 1U2BA 2LKOA 1MKEA 1Q67A 1TXDA 2P0DA 1U5DA 2D4QA 5JP4A 4K2PA 1U29A 5DHAB 2D10A 2Y7BA 3PZDA 4HAVB 4HATB 3WYFB 2QKLA 2L1CA 1WGUA 3PP2A 3SNHA 1AQCA 1UNQA 4K2OA 1X1FA 3D8EA 2QKMA 1OQNA 2LOXA 2DYQA 2RVBB 2Z0PA 4MK0A 5DIFB 4D0NB 1ZC4B 4A6FA 3DXEA 4A6HA 4PQ0A 5GOWB 2CY5A 1MAIA 1RJ2A 1PMSA 3MPXA 3ODWA 1QC6A 2Y8GA 5D3YA 3F0WA 2D11A 1FGYA 1XD4A 5HE2A 5D27A 2KGXB 2UZSA 3PVLA 5LOPB 4K81A 4DX8A 3U7DA 2YSZA 2I5CA 4HB0B 4A6KA 3D8DA 1WJ1A 4YONA 2VSZA 1BTNA 3M1IB 4GPTB 2CRFA 1FOEA 2EJ8A 3SUZA 4PNKA 2W2XC 4HAYB 1WVHA
chains in the Genus database with same CATH superfamily
5JLJB 4ZRKA 2Z14A 1RRPB 3QIJA 2RRFA 4L6EA 4K17A 5DHFB 5LONB 3BINA 1OMWA 3VIAA 1GC6A 1XR0B 4CHMA 4EKUA 2ELBA 2YS5A 4ZRJA 2D9ZA 1V88A 3HK0A 3ML4A 3P6AA 5JHHA 4BBKA 4DBBA 1AWEA 3PEGA 5C6RA 2DA0A 3OHMB 2AEHA 2YS3A 1EAZA 2G35A 1KZ7A 4NSWA 4GMXB 4GXBA 3ODXA 2J59M 1UNRA 4XWXA 1ZYIA 4QJ4B 3HW2B 3BJIA 2P0FA 4F7HA 5HE3A 3KRXA 4IFSA 1FHXA 4MT7A 1BAKA 2Z0QA 2LOZA 1SHCA 1OY2A 5HE0A 1NU2A 5KQ1A 2H7EA 2DX5A 2GUMA 1PLSA 2LYDA 2D2QA 1FAOA 4OT1A 3PSCA 1LW3A 2MWNB 4B6HA 2R09A 5FI0A 2E2XA 5C5BB 4GNKB 2VKIA 2HE7A 1TQZA 3U8ZA 2DHJA 2ZKMX 3NW8A 3NWAA 1Y5OA 1DBHA 2M14A 1FHWA 3TCAA 5KQ4A 3MDBC 4NY0A 3FM8C 2DHKA 2CODA 1J19A 2KUQA 3PG7A 1WG7A 2RGNB 4KVGB 1WGQA 2YS1A 3TO1A 1LB1A 1V5PA 4ZRIA 3AU4A 5J3YA 1P5TA 4GN1A 3RCPA 1XCGA 4Z2NA 2JP2A 2Y8FA 3CIKA 5CLLB 4C0AA 5D3VA 1MK7B 3TVVA 3QWMA 2I1KA 4GMVA 5M4YB 5J3QA 1PFJA 1W1GA 1J0WA 2LG1A 1GG3A 3G9WA 2VRWB 2H7DA 2YT2A 4EMOA 2MDXA 3HSAA 2RLOA 4KHOA 3NWFA 1XKEA 1M7RA 1P6SA 2NMBA 4HDQA 5C79A 2MFQA 1M7EA 2GJYA 1V5MA 5C5BA 4HAUB 1MIXA 3KSYA 4IAPA 2ELAA 1SGHA 4H8SA 1V89A 3KRWA 1ISNA 1EF1A 2EMSA 2GS0A 3GYOA 5C16A 2AL6A 1EVHA 1U5GA 2I1JA 3A8PA 1MK9B 5LG4B 4D6WA 4Z2MB 2R2YA 4MY6A 2Z4DA 2BCJA 2DLWA 3DXCA 5D3WA 4HHVA 3AU5A 2R0DA 1U5EA 1ZSQA 4P7IA 2P8VA 1UPRA 4HAZB 5HE1A 2CAYA 2V76A 5J3TA 1UPQA 1FGZA 3O96A 2ZPYA 1X11A 2W2WA 4HAWB 5DI9B 2P0HA 2D9XA 4WSFA 5JHGA 1QQGA 4F7GA 2KUPA 3UZTA 3ODOA 3B77A 1DYNA 3PVUA 3ULCA 5IRSA 2RNRB 2ROVA 2J0KA 3KY9A 3AJ4A 1V5UA 3D8FA 4DIXA 4HB4B 2N0YA 2Z0OA 1T77A 1FB8A 3GYPA 2DTCA 2D9WA 2N23A 3P7ZA 2RUKB 4HSIA 3HQCA 4Y94A 5CLQB 3FSSA 2PZ1A 4WJ7A 2W2XD 1K5DB 3PVWA 2DKPA 1N3HA 2DX1A 1NTYA 4DX90 1UEFA 2ROZB 3V5WA 3TFMA 1KZGA 4CHJA 1K5GB 3A98B 3WA0A 1ZVRA 3ULBA 1P3RA 1U27A 5I2MA 4A5KA 3F5RA 2YVCA 2GCLA 1DROA 2CY4A 2M38A 2NZ8B 2Q13A 1NI2A 5FI1A 2DYNA 1X1GA 4DXAB 1BTKA 4KHAA 1I2HA 3X23A 3FVCA 2COFA 1GC7A 1MPHA 2YT0A 4CSQA 2K8EA 2ADZA 3SV1A 4KAXB 4GZUA 2J0JA 2DN6A 2IYBA 4EJNA 2FJUB 3KZ1A 3SYXA 3CXBB 1NTVA 1V61A 2HTHB 3A58A 1UNPA 1DDVA 2DFKA 3NSUA 4HB3B 4OSNA 3IVFA 1EGXA 2K2JA 2K00A 2IFSA 2MKRA 2L2IA 1X05A 1ZC3B 2OQBA 2YF0A 2XQNM 2RSGA 2I5FA 1WI1A 2OTXA 2D9VA 2COCA 1DDMA 2FJLA 4TKNA 2YT1A 3ZVRA 4KHBB 2GCJA 1E5WA 2YRYA 4QJ3B 2DHIA 4HB2B 4YL8A 3TW1A 4WVFB 2X18A 3OANA 2D9YA 5KCVA 1U5FA 3ZDTA 2EC1A 1FHOA 1KI1B 3NWDA 1MIZB 1Z87A 1XODA 5I2SA 5L81A 3FEHA 1XX0A 3DXDA 2KR0A 3DCXA 1B55A 2DKQA 4HAXB 2UVMA 3A8QA 5D3XA 3N7CA 4A6FB 4F7UP 5DH9B 1IRSA 1W1DA 3LJUX 3U12A 4IOYX 1ZM0A 1W1HA 2LULA 1H10A 2COAA 1WJMA 4CYEA 1MI1A 1H4RA 3QBVB 1I7AA 2KCJA 1BWNA 5EFXA 2K2UA 1DDWA 2UZRA 4TYZA 3VOQA 3T06A 3SO6A 1Y19B 1TJ6A 2EMTA 4HDOA 2J0MA 1X86A 1U2BA 2LKOA 1MKEA 4L1RA 1Q67A 4QJ5B 1TXDA 4KHBA 2P0DA 1U5DA 2D4QA 5JP4A 4K2PA 1U29A 5DHAB 2D10A 2Y7BA 3PZDA 4HAVB 4HATB 3WYFB 2QKLA 2L1CA 1WGUA 3PP2A 3SNHA 1AQCA 1UNQA 4K2OA 1X1FA 3D8EA 2KIGA 2QKMA 1OQNA 2LOXA 2DYQA 2RVBB 2Z0PA 2Z59A 4MK0A 4GOUA 5DIFB 4D0NB 1ZC4B 4A6FA 3DXEA 4A6HA 4PQ0A 5GOWB 2CY5A 1MAIA 1RJ2A 2KIEA 1PMSA 3MPXA 3ODWA 1QC6A 2Y8GA 5D3YA 3F0WA 2D11A 1FGYA 1XD4A 5HE2A 5D27A 2KGXB 2UZSA 3PVLA 5LOPB 4K81A 4DX8A 3U7DA 2YSZA 2I5CA 4HB0B 4A6KA 3D8DA 1WJ1A 3HIEA 4YONA 2Z13A 4QXAB 2K49A 2VSZA 1BTNA 3M1IB 4GPTB 2CRFA 1FOEA 2EJ8A 3SUZA 2NBVA 4PNKA 2W2XC 4HAYB 1WVHA
chains in the Genus database with same CATH topology
5JLJB 4ZRKA 1RRPB 3QIJA 4L6EA 4K17A 5DHFB 5LONB 3BINA 1OMWA 3VIAA 1GC6A 1XR0B 4CHMA 4EKUA 2ELBA 2YS5A 4ZRJA 2D9ZA 1V88A 3HK0A 3ML4A 3P6AA 5JHHA 4BBKA 4DBBA 1AWEA 3PEGA 5C6RA 2DA0A 2AEHA 2YS3A 1EAZA 2G35A 1KZ7A 4NSWA 4GMXB 4GXBA 3ODXA 2J59M 1UNRA 4XWXA 3HW2B 3BJIA 2P0FA 4F7HA 5HE3A 3KRXA 4IFSA 1FHXA 4MT7A 1BAKA 2Z0QA 2LOZA 1SHCA 1OY2A 5HE0A 1NU2A 5KQ1A 2H7EA 2DX5A 1PLSA 2LYDA 2D2QA 1FAOA 3PSCA 1LW3A 2MWNB 4B6HA 2R09A 5FI0A 2E2XA 5C5BB 2VKIA 2HE7A 1TQZA 3U8ZA 2DHJA 1Y5OA 1DBHA 2M14A 1FHWA 3TCAA 5KQ4A 3MDBC 4NY0A 2DHKA 3FM8C 2CODA 1J19A 3PG7A 1WG7A 2RGNB 4KVGB 1WGQA 2YS1A 3TO1A 1LB1A 1V5PA 4ZRIA 3AU4A 5J3YA 1P5TA 4GN1A 3RCPA 1XCGA 4Z2NA 2JP2A 2Y8FA 3CIKA 5CLLB 4C0AA 5D3VA 1MK7B 3TVVA 3QWMA 2I1KA 4GMVA 5J3QA 1PFJA 1W1GA 1J0WA 2LG1A 1GG3A 3G9WA 2VRWB 2H7DA 4EMOA 2MDXA 2RLOA 4KHOA 1XKEA 1M7RA 1P6SA 2NMBA 4HDQA 5C79A 2MFQA 1M7EA 2GJYA 1V5MA 5C5BA 4HAUB 1MIXA 3KSYA 4IAPA 2ELAA 1SGHA 4H8SA 1V89A 3KRWA 1ISNA 1EF1A 2EMSA 2GS0A 3GYOA 5C16A 2AL6A 1EVHA 1U5GA 2I1JA 3A8PA 1MK9B 4Z2MB 4MY6A 2BCJA 2DLWA 3DXCA 5D3WA 4HHVA 3AU5A 2R0DA 1U5EA 1ZSQA 4P7IA 2P8VA 1UPRA 4HAZB 5HE1A 2CAYA 2V76A 5J3TA 1UPQA 1FGZA 3O96A 2ZPYA 1X11A 2W2WA 4HAWB 5DI9B 2P0HA 2D9XA 4WSFA 5JHGA 1QQGA 4F7GA 2KUPA 3UZTA 3ODOA 1DYNA 3PVUA 3ULCA 2RNRB 2ROVA 2J0KA 3KY9A 3AJ4A 1V5UA 3D8FA 4HB4B 2N0YA 2Z0OA 1FB8A 3GYPA 2DTCA 2D9WA 2N23A 3P7ZA 2RUKB 3HQCA 4Y94A 5CLQB 3FSSA 2PZ1A 4WJ7A 2W2XD 1K5DB 3PVWA 2DKPA 1N3HA 2DX1A 1NTYA 4DX90 1UEFA 2ROZB 3V5WA 3TFMA 1KZGA 4CHJA 1K5GB 3A98B 3WA0A 1ZVRA 3ULBA 1P3RA 1U27A 4A5KA 3F5RA 2YVCA 2GCLA 1DROA 2CY4A 2M38A 2NZ8B 2Q13A 1NI2A 5FI1A 2DYNA 1X1GA 4DXAB 1BTKA 4KHAA 1I2HA 3X23A 2COFA 1GC7A 1MPHA 2YT0A 2ADZA 3SV1A 4KAXB 4GZUA 2J0JA 2DN6A 2IYBA 4EJNA 3KZ1A 3SYXA 3CXBB 1NTVA 1V61A 2HTHB 1UNPA 1DDVA 2DFKA 3NSUA 4HB3B 3IVFA 1EGXA 2K2JA 2K00A 2IFSA 2MKRA 2L2IA 1X05A 1ZC3B 2OQBA 2YF0A 2XQNM 2RSGA 2I5FA 1WI1A 2OTXA 2D9VA 2COCA 1DDMA 2FJLA 4TKNA 2YT1A 3ZVRA 4KHBB 2GCJA 1E5WA 2YRYA 2DHIA 4HB2B 4YL8A 3TW1A 4WVFB 2X18A 3OANA 2D9YA 5KCVA 1U5FA 3ZDTA 2EC1A 1FHOA 1KI1B 1MIZB 1Z87A 1XODA 5L81A 3FEHA 1XX0A 3DXDA 1B55A 2DKQA 4HAXB 2UVMA 3A8QA 5D3XA 3N7CA 4A6FB 4F7UP 5DH9B 1IRSA 1W1DA 3LJUX 4IOYX 1ZM0A 1W1HA 2LULA 1H10A 2COAA 1WJMA 4CYEA 1H4RA 3QBVB 1I7AA 2KCJA 1BWNA 5EFXA 2K2UA 1DDWA 2UZRA 4TYZA 3VOQA 3T06A 3SO6A 1Y19B 1TJ6A 2EMTA 4HDOA 2J0MA 1X86A 1U2BA 2LKOA 1MKEA 1Q67A 1TXDA 2P0DA 1U5DA 2D4QA 5JP4A 4K2PA 1U29A 5DHAB 2D10A 2Y7BA 3PZDA 4HAVB 4HATB 3WYFB 2QKLA 2L1CA 1WGUA 3PP2A 3SNHA 1AQCA 1UNQA 4K2OA 1X1FA 3D8EA 2QKMA 1OQNA 2LOXA 2DYQA 2RVBB 2Z0PA 4MK0A 5DIFB 4D0NB 1ZC4B 4A6FA 3DXEA 4A6HA 4PQ0A 5GOWB 2CY5A 1MAIA 1RJ2A 1PMSA 3MPXA 3ODWA 1QC6A 2Y8GA 5D3YA 3F0WA 2D11A 1FGYA 1XD4A 5HE2A 5D27A 2KGXB 2UZSA 3PVLA 5LOPB 4K81A 4DX8A 3U7DA 2YSZA 2I5CA 4HB0B 4A6KA 3D8DA 1WJ1A 4YONA 2VSZA 1BTNA 3M1IB 4GPTB 2CRFA 1FOEA 2EJ8A 3SUZA 4PNKA 2W2XC 4HAYB 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLJ B;  4ZRK A;  1RRP B;  3QIJ A;  4L6E A;  4K17 A;  5DHF B;  5LON B;  3BIN A;  1OMW A;  3VIA A;  1GC6 A;  1XR0 B;  4CHM A;  4EKU A;  2ELB A;  2YS5 A;  4ZRJ A;  2D9Z A;  1V88 A;  3HK0 A;  3ML4 A;  3P6A A;  5JHH A;  4BBK A;  4DBB A;  1AWE A;  3PEG A;  5C6R A;  2DA0 A;  2AEH A;  2YS3 A;  1EAZ A;  2G35 A;  1KZ7 A;  4NSW A;  4GMX B;  4GXB A;  3ODX A;  2J59 M;  1UNR A;  4XWX A;  3HW2 B;  3BJI A;  2P0F A;  4F7H A;  5HE3 A;  3KRX A;  4IFS A;  1FHX A;  4MT7 A;  1BAK A;  2Z0Q A;  2LOZ A;  1SHC A;  1OY2 A;  5HE0 A;  1NU2 A;  5KQ1 A;  2H7E A;  2DX5 A;  1PLS A;  2LYD A;  2D2Q A;  1FAO A;  3PSC A;  1LW3 A;  2MWN B;  4B6H A;  2R09 A;  5FI0 A;  2E2X A;  5C5B B;  2VKI A;  2HE7 A;  1TQZ A;  3U8Z A;  2DHJ A;  1Y5O A;  1DBH A;  2M14 A;  1FHW A;  3TCA A;  5KQ4 A;  3MDB C;  4NY0 A;  2DHK A;  3FM8 C;  2COD A;  1J19 A;  3PG7 A;  1WG7 A;  2RGN B;  4KVG B;  1WGQ A;  2YS1 A;  3TO1 A;  1LB1 A;  1V5P A;  4ZRI A;  3AU4 A;  5J3Y A;  1P5T A;  4GN1 A;  3RCP A;  1XCG A;  4Z2N A;  2JP2 A;  2Y8F A;  3CIK A;  5CLL B;  4C0A A;  5D3V A;  1MK7 B;  3TVV A;  3QWM A;  2I1K A;  4GMV A;  5J3Q A;  1PFJ A;  1W1G A;  1J0W A;  2LG1 A;  1GG3 A;  3G9W A;  2VRW B;  2H7D A;  4EMO A;  2MDX A;  2RLO A;  4KHO A;  1XKE A;  1M7R A;  1P6S A;  2NMB A;  4HDQ A;  5C79 A;  2MFQ A;  1M7E A;  2GJY A;  1V5M A;  5C5B A;  4HAU B;  1MIX A;  3KSY A;  4IAP A;  2ELA A;  1SGH A;  4H8S A;  1V89 A;  3KRW A;  1ISN A;  1EF1 A;  2EMS A;  2GS0 A;  3GYO A;  5C16 A;  2AL6 A;  1EVH A;  1U5G A;  2I1J A;  3A8P A;  1MK9 B;  4Z2M B;  4MY6 A;  2BCJ A;  2DLW A;  3DXC A;  5D3W A;  4HHV A;  3AU5 A;  2R0D A;  1U5E A;  1ZSQ A;  4P7I A;  2P8V A;  1UPR A;  4HAZ B;  5HE1 A;  2CAY A;  2V76 A;  5J3T A;  1UPQ A;  1FGZ A;  3O96 A;  2ZPY A;  1X11 A;  2W2W A;  4HAW B;  5DI9 B;  2P0H A;  2D9X A;  4WSF A;  5JHG A;  1QQG A;  4F7G A;  2KUP A;  3UZT A;  3ODO A;  1DYN A;  3PVU A;  3ULC A;  2RNR B;  2ROV A;  2J0K A;  3KY9 A;  3AJ4 A;  1V5U A;  3D8F A;  4HB4 B;  2N0Y A;  2Z0O A;  1FB8 A;  3GYP A;  2DTC A;  2D9W A;  2N23 A;  3P7Z A;  2RUK B;  3HQC A;  4Y94 A;  5CLQ B;  3FSS A;  2PZ1 A;  4WJ7 A;  2W2X D;  1K5D B;  3PVW A;  2DKP A;  1N3H A;  2DX1 A;  1NTY A;  4DX9 0;  1UEF A;  2ROZ B;  3V5W A;  3TFM A;  1KZG A;  4CHJ A;  1K5G B;  3A98 B;  3WA0 A;  1ZVR A;  3ULB A;  1P3R A;  1U27 A;  4A5K A;  3F5R A;  2YVC A;  2GCL A;  1DRO A;  2CY4 A;  2M38 A;  2NZ8 B;  2Q13 A;  1NI2 A;  5FI1 A;  2DYN A;  1X1G A;  4DXA B;  1BTK A;  4KHA A;  1I2H A;  3X23 A;  2COF A;  1GC7 A;  1MPH A;  2YT0 A;  2ADZ A;  3SV1 A;  4KAX B;  4GZU A;  2J0J A;  2DN6 A;  2IYB A;  4EJN A;  3KZ1 A;  3SYX A;  3CXB B;  1NTV A;  1V61 A;  2HTH B;  1UNP A;  1DDV A;  2DFK A;  3NSU A;  4HB3 B;  3IVF A;  1EGX A;  2K2J A;  2K00 A;  2IFS A;  2MKR A;  2L2I A;  1X05 A;  1ZC3 B;  2OQB A;  2YF0 A;  2XQN M;  2RSG A;  2I5F A;  1WI1 A;  2OTX A;  2D9V A;  2COC A;  1DDM A;  2FJL A;  4TKN A;  2YT1 A;  3ZVR A;  4KHB B;  2GCJ A;  1E5W A;  2YRY A;  2DHI A;  4HB2 B;  4YL8 A;  3TW1 A;  4WVF B;  2X18 A;  3OAN A;  2D9Y A;  5KCV A;  1U5F A;  3ZDT A;  2EC1 A;  1FHO A;  1KI1 B;  1MIZ B;  1Z87 A;  1XOD A;  5L81 A;  3FEH A;  1XX0 A;  3DXD A;  1B55 A;  2DKQ A;  4HAX B;  2UVM A;  3A8Q A;  5D3X A;  3N7C A;  4A6F B;  4F7U P;  5DH9 B;  1IRS A;  1W1D A;  3LJU X;  4IOY X;  1ZM0 A;  1W1H A;  2LUL A;  1H10 A;  2COA A;  1WJM A;  4CYE A;  1H4R A;  3QBV B;  1I7A A;  2KCJ A;  1BWN A;  5EFX A;  2K2U A;  1DDW A;  2UZR A;  4TYZ A;  3VOQ A;  3T06 A;  3SO6 A;  1Y19 B;  1TJ6 A;  2EMT A;  4HDO A;  2J0M A;  1X86 A;  1U2B A;  2LKO A;  1MKE A;  1Q67 A;  1TXD A;  2P0D A;  1U5D A;  2D4Q A;  5JP4 A;  4K2P A;  1U29 A;  5DHA B;  2D10 A;  2Y7B A;  3PZD A;  4HAV B;  4HAT B;  3WYF B;  2QKL A;  2L1C A;  1WGU A;  3PP2 A;  3SNH A;  1AQC A;  1UNQ A;  4K2O A;  1X1F A;  3D8E A;  2QKM A;  1OQN A;  2LOX A;  2DYQ A;  2RVB B;  2Z0P A;  4MK0 A;  5DIF B;  4D0N B;  1ZC4 B;  4A6F A;  3DXE A;  4A6H A;  4PQ0 A;  5GOW B;  2CY5 A;  1MAI A;  1RJ2 A;  1PMS A;  3MPX A;  3ODW A;  1QC6 A;  2Y8G A;  5D3Y A;  3F0W A;  2D11 A;  1FGY A;  1XD4 A;  5HE2 A;  5D27 A;  2KGX B;  2UZS A;  3PVL A;  5LOP B;  4K81 A;  4DX8 A;  3U7D A;  2YSZ A;  2I5C A;  4HB0 B;  4A6K A;  3D8D A;  1WJ1 A;  4YON A;  2VSZ A;  1BTN A;  3M1I B;  4GPT B;  2CRF A;  1FOE A;  2EJ8 A;  3SUZ A;  4PNK A;  2W2X C;  4HAY B;  1WVH A; 
#chains in the Genus database with same CATH topology
 5JLJ B;  4ZRK A;  2Z14 A;  1RRP B;  3QIJ A;  2RRF A;  4L6E A;  4K17 A;  5DHF B;  5LON B;  3BIN A;  1OMW A;  3VIA A;  1GC6 A;  1XR0 B;  4CHM A;  4EKU A;  2ELB A;  2YS5 A;  4ZRJ A;  2D9Z A;  1V88 A;  3HK0 A;  3ML4 A;  3P6A A;  5JHH A;  4BBK A;  4DBB A;  1AWE A;  3PEG A;  5C6R A;  2DA0 A;  3OHM B;  2AEH A;  2YS3 A;  1EAZ A;  2G35 A;  1KZ7 A;  4NSW A;  4GMX B;  4GXB A;  3ODX A;  2J59 M;  1UNR A;  4XWX A;  1ZYI A;  4QJ4 B;  3HW2 B;  3BJI A;  2P0F A;  4F7H A;  5HE3 A;  3KRX A;  4IFS A;  1FHX A;  4MT7 A;  1BAK A;  2Z0Q A;  2LOZ A;  1SHC A;  1OY2 A;  5HE0 A;  1NU2 A;  5KQ1 A;  2H7E A;  2DX5 A;  2GUM A;  1PLS A;  2LYD A;  2D2Q A;  1FAO A;  4OT1 A;  3PSC A;  1LW3 A;  2MWN B;  4B6H A;  2R09 A;  5FI0 A;  2E2X A;  5C5B B;  4GNK B;  2VKI A;  2HE7 A;  1TQZ A;  3U8Z A;  2DHJ A;  2ZKM X;  3NW8 A;  3NWA A;  1Y5O A;  1DBH A;  2M14 A;  1FHW A;  3TCA A;  5KQ4 A;  3MDB C;  4NY0 A;  3FM8 C;  2DHK A;  2COD A;  1J19 A;  2KUQ A;  3PG7 A;  1WG7 A;  2RGN B;  4KVG B;  1WGQ A;  2YS1 A;  3TO1 A;  1LB1 A;  1V5P A;  4ZRI A;  3AU4 A;  5J3Y A;  1P5T A;  4GN1 A;  3RCP A;  1XCG A;  4Z2N A;  2JP2 A;  2Y8F A;  3CIK A;  5CLL B;  4C0A A;  5D3V A;  1MK7 B;  3TVV A;  3QWM A;  2I1K A;  4GMV A;  5M4Y B;  5J3Q A;  1PFJ A;  1W1G A;  1J0W A;  2LG1 A;  1GG3 A;  3G9W A;  2VRW B;  2H7D A;  2YT2 A;  4EMO A;  2MDX A;  3HSA A;  2RLO A;  4KHO A;  3NWF A;  1XKE A;  1M7R A;  1P6S A;  2NMB A;  4HDQ A;  5C79 A;  2MFQ A;  1M7E A;  2GJY A;  1V5M A;  5C5B A;  4HAU B;  1MIX A;  3KSY A;  4IAP A;  2ELA A;  1SGH A;  4H8S A;  1V89 A;  3KRW A;  1ISN A;  1EF1 A;  2EMS A;  2GS0 A;  3GYO A;  5C16 A;  2AL6 A;  1EVH A;  1U5G A;  2I1J A;  3A8P A;  1MK9 B;  5LG4 B;  4D6W A;  4Z2M B;  2R2Y A;  4MY6 A;  2Z4D A;  2BCJ A;  2DLW A;  3DXC A;  5D3W A;  4HHV A;  3AU5 A;  2R0D A;  1U5E A;  1ZSQ A;  4P7I A;  2P8V A;  1UPR A;  4HAZ B;  5HE1 A;  2CAY A;  2V76 A;  5J3T A;  1UPQ A;  1FGZ A;  3O96 A;  2ZPY A;  1X11 A;  2W2W A;  4HAW B;  5DI9 B;  2P0H A;  2D9X A;  4WSF A;  5JHG A;  1QQG A;  4F7G A;  2KUP A;  3UZT A;  3ODO A;  3B77 A;  1DYN A;  3PVU A;  3ULC A;  5IRS A;  2RNR B;  2ROV A;  2J0K A;  3KY9 A;  3AJ4 A;  1V5U A;  3D8F A;  4DIX A;  4HB4 B;  2N0Y A;  2Z0O A;  1T77 A;  1FB8 A;  3GYP A;  2DTC A;  2D9W A;  2N23 A;  3P7Z A;  2RUK B;  4HSI A;  3HQC A;  4Y94 A;  5CLQ B;  3FSS A;  2PZ1 A;  4WJ7 A;  2W2X D;  1K5D B;  3PVW A;  2DKP A;  1N3H A;  2DX1 A;  1NTY A;  4DX9 0;  1UEF A;  2ROZ B;  3V5W A;  3TFM A;  1KZG A;  4CHJ A;  1K5G B;  3A98 B;  3WA0 A;  1ZVR A;  3ULB A;  1P3R A;  1U27 A;  5I2M A;  4A5K A;  3F5R A;  2YVC A;  2GCL A;  1DRO A;  2CY4 A;  2M38 A;  2NZ8 B;  2Q13 A;  1NI2 A;  5FI1 A;  2DYN A;  1X1G A;  4DXA B;  1BTK A;  4KHA A;  1I2H A;  3X23 A;  3FVC A;  2COF A;  1GC7 A;  1MPH A;  2YT0 A;  4CSQ A;  2K8E A;  2ADZ A;  3SV1 A;  4KAX B;  4GZU A;  2J0J A;  2DN6 A;  2IYB A;  4EJN A;  2FJU B;  3KZ1 A;  3SYX A;  3CXB B;  1NTV A;  1V61 A;  2HTH B;  3A58 A;  1UNP A;  1DDV A;  2DFK A;  3NSU A;  4HB3 B;  4OSN A;  3IVF A;  1EGX A;  2K2J A;  2K00 A;  2IFS A;  2MKR A;  2L2I A;  1X05 A;  1ZC3 B;  2OQB A;  2YF0 A;  2XQN M;  2RSG A;  2I5F A;  1WI1 A;  2OTX A;  2D9V A;  2COC A;  1DDM A;  2FJL A;  4TKN A;  2YT1 A;  3ZVR A;  4KHB B;  2GCJ A;  1E5W A;  2YRY A;  4QJ3 B;  2DHI A;  4HB2 B;  4YL8 A;  3TW1 A;  4WVF B;  2X18 A;  3OAN A;  2D9Y A;  5KCV A;  1U5F A;  3ZDT A;  2EC1 A;  1FHO A;  1KI1 B;  3NWD A;  1MIZ B;  1Z87 A;  1XOD A;  5I2S A;  5L81 A;  3FEH A;  1XX0 A;  3DXD A;  2KR0 A;  3DCX A;  1B55 A;  2DKQ A;  4HAX B;  2UVM A;  3A8Q A;  5D3X A;  3N7C A;  4A6F B;  4F7U P;  5DH9 B;  1IRS A;  1W1D A;  3LJU X;  3U12 A;  4IOY X;  1ZM0 A;  1W1H A;  2LUL A;  1H10 A;  2COA A;  1WJM A;  4CYE A;  1MI1 A;  1H4R A;  3QBV B;  1I7A A;  2KCJ A;  1BWN A;  5EFX A;  2K2U A;  1DDW A;  2UZR A;  4TYZ A;  3VOQ A;  3T06 A;  3SO6 A;  1Y19 B;  1TJ6 A;  2EMT A;  4HDO A;  2J0M A;  1X86 A;  1U2B A;  2LKO A;  1MKE A;  4L1R A;  1Q67 A;  4QJ5 B;  1TXD A;  4KHB A;  2P0D A;  1U5D A;  2D4Q A;  5JP4 A;  4K2P A;  1U29 A;  5DHA B;  2D10 A;  2Y7B A;  3PZD A;  4HAV B;  4HAT B;  3WYF B;  2QKL A;  2L1C A;  1WGU A;  3PP2 A;  3SNH A;  1AQC A;  1UNQ A;  4K2O A;  1X1F A;  3D8E A;  2KIG A;  2QKM A;  1OQN A;  2LOX A;  2DYQ A;  2RVB B;  2Z0P A;  2Z59 A;  4MK0 A;  4GOU A;  5DIF B;  4D0N B;  1ZC4 B;  4A6F A;  3DXE A;  4A6H A;  4PQ0 A;  5GOW B;  2CY5 A;  1MAI A;  1RJ2 A;  2KIE A;  1PMS A;  3MPX A;  3ODW A;  1QC6 A;  2Y8G A;  5D3Y A;  3F0W A;  2D11 A;  1FGY A;  1XD4 A;  5HE2 A;  5D27 A;  2KGX B;  2UZS A;  3PVL A;  5LOP B;  4K81 A;  4DX8 A;  3U7D A;  2YSZ A;  2I5C A;  4HB0 B;  4A6K A;  3D8D A;  1WJ1 A;  3HIE A;  4YON A;  2Z13 A;  4QXA B;  2K49 A;  2VSZ A;  1BTN A;  3M1I B;  4GPT B;  2CRF A;  1FOE A;  2EJ8 A;  3SUZ A;  2NBV A;  4PNK A;  2W2X C;  4HAY B;  1WVH A; 
#chains in the Genus database with same CATH homology
 5JLJ B;  4ZRK A;  1RRP B;  3QIJ A;  4L6E A;  4K17 A;  5DHF B;  5LON B;  3BIN A;  1OMW A;  3VIA A;  1GC6 A;  1XR0 B;  4CHM A;  4EKU A;  2ELB A;  2YS5 A;  4ZRJ A;  2D9Z A;  1V88 A;  3HK0 A;  3ML4 A;  3P6A A;  5JHH A;  4BBK A;  4DBB A;  1AWE A;  3PEG A;  5C6R A;  2DA0 A;  2AEH A;  2YS3 A;  1EAZ A;  2G35 A;  1KZ7 A;  4NSW A;  4GMX B;  4GXB A;  3ODX A;  2J59 M;  1UNR A;  4XWX A;  3HW2 B;  3BJI A;  2P0F A;  4F7H A;  5HE3 A;  3KRX A;  4IFS A;  1FHX A;  4MT7 A;  1BAK A;  2Z0Q A;  2LOZ A;  1SHC A;  1OY2 A;  5HE0 A;  1NU2 A;  5KQ1 A;  2H7E A;  2DX5 A;  1PLS A;  2LYD A;  2D2Q A;  1FAO A;  3PSC A;  1LW3 A;  2MWN B;  4B6H A;  2R09 A;  5FI0 A;  2E2X A;  5C5B B;  2VKI A;  2HE7 A;  1TQZ A;  3U8Z A;  2DHJ A;  1Y5O A;  1DBH A;  2M14 A;  1FHW A;  3TCA A;  5KQ4 A;  3MDB C;  4NY0 A;  2DHK A;  3FM8 C;  2COD A;  1J19 A;  3PG7 A;  1WG7 A;  2RGN B;  4KVG B;  1WGQ A;  2YS1 A;  3TO1 A;  1LB1 A;  1V5P A;  4ZRI A;  3AU4 A;  5J3Y A;  1P5T A;  4GN1 A;  3RCP A;  1XCG A;  4Z2N A;  2JP2 A;  2Y8F A;  3CIK A;  5CLL B;  4C0A A;  5D3V A;  1MK7 B;  3TVV A;  3QWM A;  2I1K A;  4GMV A;  5J3Q A;  1PFJ A;  1W1G A;  1J0W A;  2LG1 A;  1GG3 A;  3G9W A;  2VRW B;  2H7D A;  4EMO A;  2MDX A;  2RLO A;  4KHO A;  1XKE A;  1M7R A;  1P6S A;  2NMB A;  4HDQ A;  5C79 A;  2MFQ A;  1M7E A;  2GJY A;  1V5M A;  5C5B A;  4HAU B;  1MIX A;  3KSY A;  4IAP A;  2ELA A;  1SGH A;  4H8S A;  1V89 A;  3KRW A;  1ISN A;  1EF1 A;  2EMS A;  2GS0 A;  3GYO A;  5C16 A;  2AL6 A;  1EVH A;  1U5G A;  2I1J A;  3A8P A;  1MK9 B;  4Z2M B;  4MY6 A;  2BCJ A;  2DLW A;  3DXC A;  5D3W A;  4HHV A;  3AU5 A;  2R0D A;  1U5E A;  1ZSQ A;  4P7I A;  2P8V A;  1UPR A;  4HAZ B;  5HE1 A;  2CAY A;  2V76 A;  5J3T A;  1UPQ A;  1FGZ A;  3O96 A;  2ZPY A;  1X11 A;  2W2W A;  4HAW B;  5DI9 B;  2P0H A;  2D9X A;  4WSF A;  5JHG A;  1QQG A;  4F7G A;  2KUP A;  3UZT A;  3ODO A;  1DYN A;  3PVU A;  3ULC A;  2RNR B;  2ROV A;  2J0K A;  3KY9 A;  3AJ4 A;  1V5U A;  3D8F A;  4HB4 B;  2N0Y A;  2Z0O A;  1FB8 A;  3GYP A;  2DTC A;  2D9W A;  2N23 A;  3P7Z A;  2RUK B;  3HQC A;  4Y94 A;  5CLQ B;  3FSS A;  2PZ1 A;  4WJ7 A;  2W2X D;  1K5D B;  3PVW A;  2DKP A;  1N3H A;  2DX1 A;  1NTY A;  4DX9 0;  1UEF A;  2ROZ B;  3V5W A;  3TFM A;  1KZG A;  4CHJ A;  1K5G B;  3A98 B;  3WA0 A;  1ZVR A;  3ULB A;  1P3R A;  1U27 A;  4A5K A;  3F5R A;  2YVC A;  2GCL A;  1DRO A;  2CY4 A;  2M38 A;  2NZ8 B;  2Q13 A;  1NI2 A;  5FI1 A;  2DYN A;  1X1G A;  4DXA B;  1BTK A;  4KHA A;  1I2H A;  3X23 A;  2COF A;  1GC7 A;  1MPH A;  2YT0 A;  2ADZ A;  3SV1 A;  4KAX B;  4GZU A;  2J0J A;  2DN6 A;  2IYB A;  4EJN A;  3KZ1 A;  3SYX A;  3CXB B;  1NTV A;  1V61 A;  2HTH B;  1UNP A;  1DDV A;  2DFK A;  3NSU A;  4HB3 B;  3IVF A;  1EGX A;  2K2J A;  2K00 A;  2IFS A;  2MKR A;  2L2I A;  1X05 A;  1ZC3 B;  2OQB A;  2YF0 A;  2XQN M;  2RSG A;  2I5F A;  1WI1 A;  2OTX A;  2D9V A;  2COC A;  1DDM A;  2FJL A;  4TKN A;  2YT1 A;  3ZVR A;  4KHB B;  2GCJ A;  1E5W A;  2YRY A;  2DHI A;  4HB2 B;  4YL8 A;  3TW1 A;  4WVF B;  2X18 A;  3OAN A;  2D9Y A;  5KCV A;  1U5F A;  3ZDT A;  2EC1 A;  1FHO A;  1KI1 B;  1MIZ B;  1Z87 A;  1XOD A;  5L81 A;  3FEH A;  1XX0 A;  3DXD A;  1B55 A;  2DKQ A;  4HAX B;  2UVM A;  3A8Q A;  5D3X A;  3N7C A;  4A6F B;  4F7U P;  5DH9 B;  1IRS A;  1W1D A;  3LJU X;  4IOY X;  1ZM0 A;  1W1H A;  2LUL A;  1H10 A;  2COA A;  1WJM A;  4CYE A;  1H4R A;  3QBV B;  1I7A A;  2KCJ A;  1BWN A;  5EFX A;  2K2U A;  1DDW A;  2UZR A;  4TYZ A;  3VOQ A;  3T06 A;  3SO6 A;  1Y19 B;  1TJ6 A;  2EMT A;  4HDO A;  2J0M A;  1X86 A;  1U2B A;  2LKO A;  1MKE A;  1Q67 A;  1TXD A;  2P0D A;  1U5D A;  2D4Q A;  5JP4 A;  4K2P A;  1U29 A;  5DHA B;  2D10 A;  2Y7B A;  3PZD A;  4HAV B;  4HAT B;  3WYF B;  2QKL A;  2L1C A;  1WGU A;  3PP2 A;  3SNH A;  1AQC A;  1UNQ A;  4K2O A;  1X1F A;  3D8E A;  2QKM A;  1OQN A;  2LOX A;  2DYQ A;  2RVB B;  2Z0P A;  4MK0 A;  5DIF B;  4D0N B;  1ZC4 B;  4A6F A;  3DXE A;  4A6H A;  4PQ0 A;  5GOW B;  2CY5 A;  1MAI A;  1RJ2 A;  1PMS A;  3MPX A;  3ODW A;  1QC6 A;  2Y8G A;  5D3Y A;  3F0W A;  2D11 A;  1FGY A;  1XD4 A;  5HE2 A;  5D27 A;  2KGX B;  2UZS A;  3PVL A;  5LOP B;  4K81 A;  4DX8 A;  3U7D A;  2YSZ A;  2I5C A;  4HB0 B;  4A6K A;  3D8D A;  1WJ1 A;  4YON A;  2VSZ A;  1BTN A;  3M1I B;  4GPT B;  2CRF A;  1FOE A;  2EJ8 A;  3SUZ A;  4PNK A;  2W2X C;  4HAY B;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...