2DKPA

Solution structure of the ph domain of pleckstrin homology domain-containing protein family a member 5 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
128
structure length
128
Chain Sequence
GSSGSSGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family A member 5
total genus 12
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkpA01
2YRYA 5LONB 4Z2MB 2RUKB 3F0WA 1W1GA 3KRXA 1PLSA 3X23A 1V5MA 4CYEA 4F7GA 3PVLA 4PNKA 2QKMA 1FOEA 2DHJA 1XCGA 5JHHA 4K2PA 1QC6A 2D9VA 3SYXA 3ULCA 4EKUA 3KZ1A 3ZDTA 4WSFA 4A6FA 1DYNA 2E2XA 1ZC3B 2RSGA 2DYQA 2AL6A 4XWXA 1DBHA 2DLWA 5LOPB 1WJMA 5C6RA 2DN6A 4HAWB 3PZDA 3WA0A 2DHKA 2P8VA 4HB2B 1WJ1A 5HE2A 4ZRIA 2LKOA 4HB4B 2LG1A 1WVHA 5FI0A 5C16A 2GJYA 3CXBB 4DX8A 4DBBA 2DKPA 1BWNA 3LJUX 2DX5A 2J0KA 1P5TA 2OTXA 1GC7A 1NU2A 2ROZB 1WGQA 5HE3A 1FHOA 4IFSA 3ODXA 3T06A 4HB0B 2LULA 5HE1A 4A5KA 2D9XA 3VOQA 4A6FB 2ELBA 2EMSA 1TXDA 2KGXB 1V89A 5J3QA 1I7AA 2HE7A 1BTKA 1ISNA 1OQNA 3HQCA 1RJ2A 2UVMA 4WVFB 2MKRA 4HB3B 2I5CA 5C5BA 1PFJA 4HAXB 4HAYB 2YT0A 1Q67A 2ROVA 2N23A 2CODA 1DDVA 1MIXA 1KI1B 5EFXA 5JLJB 1M7EA 2YS1A 1WI1A 4EJNA 1OY2A 3D8FA 3ODWA 4NSWA 4WJ7A 1MAIA 4A6HA 1FHXA 4HAVB 1KZGA 2DFKA 2DHIA 1EGXA 2J59M 3D8DA 1EF1A 3GYPA 2VKIA 4DXAB 1U5FA 2I1JA 4GPTB 1XD4A 1N3HA 1XKEA 1MIZB 4CHMA 2YF0A 1Y5OA 3WYFB 2GCJA 4NY0A 5FI1A 2DA0A 1IRSA 1J19A 1XX0A 3HK0A 5D3VA 2IFSA 1B55A 5JP4A 2D9YA 2NMBA 1J0WA 2UZRA 3AU4A 2RGNB 4Z2NA 1PMSA 1MK7B 3HW2B 4F7HA 2ADZA 2GCLA 3DXDA 1U5EA 4HAZB 3KY9A 1P6SA 1ZM0A 2KCJA 1K5GB 2LYDA 2PZ1A 2M38A 4CHJA 3PVUA 2NZ8B 4HATB 5DHFB 3DXEA 2CY4A 4ZRJA 2N0YA 3N7CA 1E5WA 1FHWA 3PSCA 2Y7BA 2P0FA 1H4RA 1K5DB 2Y8FA 1I2HA 1UNPA 3U8ZA 4TKNA 1X1GA 1ZC4B 5GOWB 5CLLB 2RLOA 1UEFA 2D9ZA 3FEHA 1QQGA 4HDQA 2R0DA 1TQZA 2D4QA 2RVBB 5J3YA 2ZPYA 4Y94A 2V76A 5C5BB 1P3RA 4PQ0A 4HDOA 1H10A 3ML4A 1EAZA 1FGYA 2D11A 2H7DA 1MKEA 3F5RA 1GG3A 1U29A 3UZTA 2CRFA 3TFMA 4IOYX 3V5WA 4B6HA 2YS3A 3SUZA 1ZSQA 4C0AA 3A8QA 2MFQA 5HE0A 5C79A 4YONA 3OANA 1OMWA 1GC6A 4HHVA 1SGHA 1FB8A 2EC1A 5D3YA 5KCVA 3D8EA 3QBVB 1LB1A 1NI2A 4MK0A 1Z87A 5DHAB 1V5PA 2YVCA 2Z0PA 2Q13A 1KZ7A 2I1KA 5D3XA 2EMTA 1ZVRA 1U2BA 2MWNB 4DX90 2W2XC 1V5UA 2L2IA 2YT1A 1SHCA 1X86A 2RNRB 5D27A 2ELAA 4K17A 2YSZA 2J0MA 2W2XD 2DYNA 3FSSA 5D3WA 3TO1A 4A6KA 1UPRA 3A98B 2COCA 1V61A 4H8SA 5JHGA 3G9WA 1Y19B 3IVFA 2MDXA 3PG7A 1NTVA 3DXCA 2I5FA 4KVGB 2P0DA 1U5GA 3U7DA 4GMVA 5KQ4A 4IAPA 1BAKA 4KHBB 2K00A 2LOXA 4KHOA 1WGUA 2FJLA 2XQNM 2K2JA 5KQ1A 4KAXB 3O96A 3KRWA 2HTHB 3QIJA 2DTCA 4MY6A 3AU5A 1WG7A 2J0JA 3A8PA 2D9WA 1X05A 2UZSA 4L6EA 3ZVRA 5DI9B 2VSZA 4YL8A 2JP2A 3VIAA 1FGZA 4GN1A 4EMOA 2H7EA 1AWEA 3SNHA 3M1IB 4F7UP 1DROA 4P7IA 1DDMA 1TJ6A 3BJIA 2VRWB 4MT7A 1UPQA 2Z0OA 4TYZA 4BBKA 1NTYA 3RCPA 3PP2A 2R09A 2CAYA 1BTNA 2EJ8A 1XR0B 2P0HA 1AQCA 3TW1A 4K2OA 5J3TA 1X1FA 4GMXB 2D2QA 2M14A 4KHAA 2LOZA 3NSUA 5DIFB 2COFA 2Z0QA 1MK9B 4ZRKA 1X11A 3TVVA 2Y8GA 3KSYA 3GYOA 1W1DA 1M7RA 1U5DA 2L1CA 2OQBA 2AEHA 2X18A 3FM8C 2COAA 2DKQA 1UNQA 1V88A 3P7ZA 3ULBA 1EVHA 5DH9B 2D10A 2BCJA 3QWMA 1LW3A 1DDWA 3CIKA 4HAUB 3ODOA 3MPXA 3BINA 5L81A 2K2UA 1RRPB 2CY5A 1XODA 2YS5A 3AJ4A 4GZUA 3SV1A 3SO6A 3TCAA 1MPHA 4D0NB 5CLQB 2DX1A 1UNRA 2W2WA 2G35A 3P6AA 1FAOA 1W1HA 4K81A 3PEGA 3PVWA 2IYBA 4GXBA 2QKLA 2GS0A 2KUPA 1U27A 3MDBC
chains in the Genus database with same CATH superfamily
2YRYA 5LONB 4Z2MB 2RUKB 3F0WA 1W1GA 3KRXA 1PLSA 3OHMB 3X23A 1V5MA 4CYEA 3NWFA 4F7GA 2Z14A 3PVLA 4PNKA 2QKMA 1FOEA 2DHJA 1XCGA 5JHHA 4K2PA 1QC6A 2D9VA 3SYXA 3ULCA 4EKUA 3KZ1A 1MI1A 3ZDTA 2GUMA 5M4YB 4WSFA 4A6FA 1DYNA 2E2XA 1ZC3B 2RSGA 2DYQA 2AL6A 4XWXA 1DBHA 2DLWA 5LOPB 1WJMA 5C6RA 2DN6A 4HAWB 3PZDA 3WA0A 2DHKA 2P8VA 4HB2B 1WJ1A 5HE2A 4ZRIA 2LKOA 4HB4B 2LG1A 1WVHA 5FI0A 5C16A 2NBVA 2GJYA 3CXBB 4DX8A 4DBBA 2DKPA 1BWNA 3LJUX 2DX5A 2J0KA 1P5TA 2OTXA 1GC7A 5I2SA 1NU2A 2ROZB 1WGQA 5HE3A 1FHOA 4IFSA 3ODXA 3T06A 4HB0B 2LULA 5HE1A 4A5KA 2D9XA 3VOQA 4A6FB 2ELBA 2EMSA 1TXDA 2KGXB 1V89A 5J3QA 1I7AA 2HE7A 1BTKA 1ISNA 1OQNA 3HQCA 1RJ2A 2UVMA 4WVFB 2MKRA 4OSNA 4HB3B 2I5CA 5C5BA 1PFJA 2Z13A 4HAXB 4HAYB 2YT0A 1Q67A 2ROVA 2N23A 2CODA 1DDVA 1MIXA 1KI1B 5EFXA 5JLJB 1M7EA 2YS1A 3FVCA 1WI1A 4EJNA 1OY2A 3D8FA 3ODWA 4NSWA 4WJ7A 1MAIA 4A6HA 1FHXA 4HAVB 1KZGA 2DFKA 2DHIA 1EGXA 2J59M 3D8DA 1EF1A 3GYPA 2VKIA 4DXAB 1U5FA 2I1JA 4GPTB 1XD4A 4L1RA 2KR0A 1N3HA 2Z59A 1XKEA 3NW8A 1MIZB 4CHMA 3U12A 2YF0A 1Y5OA 3WYFB 2GCJA 4NY0A 5FI1A 2DA0A 1IRSA 1J19A 1XX0A 3HK0A 5D3VA 2IFSA 1B55A 5JP4A 2D9YA 2NMBA 1J0WA 2UZRA 3AU4A 2RGNB 4Z2NA 1PMSA 1MK7B 3HW2B 4F7HA 2ADZA 2GCLA 3DXDA 1U5EA 3KY9A 4HAZB 1P6SA 1ZM0A 2KCJA 4QJ3B 1K5GB 2LYDA 2YT2A 3DCXA 2PZ1A 2M38A 4CHJA 3PVUA 2NZ8B 4HATB 3B77A 5DHFB 3DXEA 2CY4A 4ZRJA 2N0YA 3N7CA 4GOUA 1E5WA 1FHWA 3PSCA 2Y7BA 2P0FA 1H4RA 1K5DB 2Y8FA 1I2HA 1UNPA 3U8ZA 1ZYIA 1X1GA 1ZC4B 4TKNA 5GOWB 5CLLB 2RLOA 1UEFA 2D9ZA 3FEHA 1QQGA 4HDQA 2R0DA 1TQZA 2D4QA 2RVBB 5J3YA 2ZPYA 4Y94A 2V76A 5C5BB 1P3RA 4PQ0A 4HDOA 1H10A 2KIEA 3ML4A 1EAZA 1FGYA 2D11A 2H7DA 1MKEA 3F5RA 1GG3A 1U29A 3UZTA 2CRFA 3TFMA 4IOYX 3V5WA 4B6HA 2YS3A 3SUZA 1ZSQA 4C0AA 2KUQA 2MFQA 3A8QA 5HE0A 5C79A 4YONA 3OANA 1OMWA 1GC6A 4HHVA 1SGHA 1FB8A 2EC1A 5D3YA 5KCVA 3D8EA 3QBVB 4QXAB 1LB1A 1NI2A 4MK0A 1Z87A 5DHAB 1V5PA 2YVCA 2Z0PA 2Q13A 1KZ7A 4OT1A 5LG4B 2I1KA 5D3XA 2EMTA 1ZVRA 1U2BA 2MWNB 3A58A 4DX90 2W2XC 1V5UA 3HSAA 2L2IA 2YT1A 1SHCA 1X86A 2RNRB 5D27A 2ELAA 4K17A 2YSZA 2J0MA 2W2XD 2DYNA 3FSSA 5D3WA 3TO1A 4A6KA 1UPRA 3A98B 2COCA 2Z4DA 1V61A 4H8SA 5JHGA 3G9WA 1Y19B 3IVFA 2MDXA 4DIXA 3PG7A 4GNKB 3NWAA 1NTVA 3DXCA 2I5FA 4KVGB 2P0DA 1U5GA 2K8EA 3U7DA 4GMVA 5KQ4A 4IAPA 1BAKA 4KHBB 2K00A 2LOXA 4KHOA 1WGUA 2FJLA 2XQNM 2K2JA 5KQ1A 4KAXB 3O96A 3KRWA 2HTHB 2DTCA 3QIJA 4MY6A 3AU5A 1WG7A 2J0JA 3A8PA 2D9WA 1X05A 2UZSA 4L6EA 3ZVRA 5DI9B 3NWDA 2VSZA 4YL8A 2JP2A 3VIAA 1FGZA 4GN1A 4EMOA 2H7EA 1AWEA 2ZKMX 3SNHA 3M1IB 4F7UP 1DROA 4P7IA 1DDMA 1TJ6A 3BJIA 2VRWB 4MT7A 1UPQA 2Z0OA 4TYZA 4BBKA 1NTYA 4QJ5B 2KIGA 2RRFA 3RCPA 3PP2A 2R09A 2CAYA 1BTNA 2EJ8A 2K49A 1XR0B 2P0HA 1AQCA 3TW1A 4K2OA 5J3TA 1X1FA 4GMXB 2D2QA 2M14A 4KHAA 2LOZA 3NSUA 5DIFB 2COFA 2Z0QA 4HSIA 1MK9B 4ZRKA 1X11A 3TVVA 2Y8GA 3KSYA 3GYOA 3HIEA 1W1DA 1M7RA 1U5DA 2L1CA 2OQBA 4CSQA 2AEHA 2X18A 3FM8C 2COAA 2DKQA 1UNQA 1V88A 3P7ZA 5IRSA 3ULBA 1EVHA 5DH9B 2D10A 2BCJA 3QWMA 1LW3A 1T77A 1DDWA 3CIKA 4HAUB 4D6WA 2R2YA 3ODOA 3MPXA 3BINA 5L81A 2K2UA 1RRPB 2CY5A 1XODA 2YS5A 3AJ4A 4GZUA 3SV1A 3SO6A 3TCAA 1MPHA 4D0NB 5CLQB 2DX1A 1UNRA 2W2WA 2G35A 3P6AA 4KHBA 1FAOA 5I2MA 1W1HA 2FJUB 4K81A 3PEGA 3PVWA 2IYBA 4GXBA 2QKLA 4QJ4B 2GS0A 2KUPA 1U27A 3MDBC
chains in the Genus database with same CATH topology
2YRYA 5LONB 4Z2MB 2RUKB 3F0WA 1W1GA 3KRXA 1PLSA 3X23A 1V5MA 4CYEA 4F7GA 3PVLA 4PNKA 2QKMA 1FOEA 2DHJA 1XCGA 5JHHA 4K2PA 1QC6A 2D9VA 3SYXA 3ULCA 4EKUA 3KZ1A 3ZDTA 4WSFA 4A6FA 1DYNA 2E2XA 1ZC3B 2RSGA 2DYQA 2AL6A 4XWXA 1DBHA 2DLWA 5LOPB 1WJMA 5C6RA 2DN6A 4HAWB 3PZDA 3WA0A 2DHKA 2P8VA 4HB2B 1WJ1A 5HE2A 4ZRIA 2LKOA 4HB4B 2LG1A 1WVHA 5FI0A 5C16A 2GJYA 3CXBB 4DX8A 4DBBA 2DKPA 1BWNA 3LJUX 2DX5A 2J0KA 1P5TA 2OTXA 1GC7A 1NU2A 2ROZB 1WGQA 5HE3A 1FHOA 4IFSA 3ODXA 3T06A 4HB0B 2LULA 5HE1A 4A5KA 2D9XA 3VOQA 4A6FB 2ELBA 2EMSA 1TXDA 2KGXB 1V89A 5J3QA 1I7AA 2HE7A 1BTKA 1ISNA 1OQNA 3HQCA 1RJ2A 2UVMA 4WVFB 2MKRA 4HB3B 2I5CA 5C5BA 1PFJA 4HAXB 4HAYB 2YT0A 1Q67A 2ROVA 2N23A 2CODA 1DDVA 1MIXA 1KI1B 5EFXA 5JLJB 1M7EA 2YS1A 1WI1A 4EJNA 1OY2A 3D8FA 3ODWA 4NSWA 4WJ7A 1MAIA 4A6HA 1FHXA 4HAVB 1KZGA 2DFKA 2DHIA 1EGXA 2J59M 3D8DA 1EF1A 3GYPA 2VKIA 4DXAB 1U5FA 2I1JA 4GPTB 1XD4A 1N3HA 1XKEA 1MIZB 4CHMA 2YF0A 1Y5OA 3WYFB 2GCJA 4NY0A 5FI1A 2DA0A 1IRSA 1J19A 1XX0A 3HK0A 5D3VA 2IFSA 1B55A 5JP4A 2D9YA 2NMBA 1J0WA 2UZRA 3AU4A 2RGNB 4Z2NA 1PMSA 1MK7B 3HW2B 4F7HA 2ADZA 2GCLA 3DXDA 1U5EA 4HAZB 3KY9A 1P6SA 1ZM0A 2KCJA 1K5GB 2LYDA 2PZ1A 2M38A 4CHJA 3PVUA 2NZ8B 4HATB 5DHFB 3DXEA 2CY4A 4ZRJA 2N0YA 3N7CA 1E5WA 1FHWA 3PSCA 2Y7BA 2P0FA 1H4RA 1K5DB 2Y8FA 1I2HA 1UNPA 3U8ZA 4TKNA 1X1GA 1ZC4B 5GOWB 5CLLB 2RLOA 1UEFA 2D9ZA 3FEHA 1QQGA 4HDQA 2R0DA 1TQZA 2D4QA 2RVBB 5J3YA 2ZPYA 4Y94A 2V76A 5C5BB 1P3RA 4PQ0A 4HDOA 1H10A 3ML4A 1EAZA 1FGYA 2D11A 2H7DA 1MKEA 3F5RA 1GG3A 1U29A 3UZTA 2CRFA 3TFMA 4IOYX 3V5WA 4B6HA 2YS3A 3SUZA 1ZSQA 4C0AA 3A8QA 2MFQA 5HE0A 5C79A 4YONA 3OANA 1OMWA 1GC6A 4HHVA 1SGHA 1FB8A 2EC1A 5D3YA 5KCVA 3D8EA 3QBVB 1LB1A 1NI2A 4MK0A 1Z87A 5DHAB 1V5PA 2YVCA 2Z0PA 2Q13A 1KZ7A 2I1KA 5D3XA 2EMTA 1ZVRA 1U2BA 2MWNB 4DX90 2W2XC 1V5UA 2L2IA 2YT1A 1SHCA 1X86A 2RNRB 5D27A 2ELAA 4K17A 2YSZA 2J0MA 2W2XD 2DYNA 3FSSA 5D3WA 3TO1A 4A6KA 1UPRA 3A98B 2COCA 1V61A 4H8SA 5JHGA 3G9WA 1Y19B 3IVFA 2MDXA 3PG7A 1NTVA 3DXCA 2I5FA 4KVGB 2P0DA 1U5GA 3U7DA 4GMVA 5KQ4A 4IAPA 1BAKA 4KHBB 2K00A 2LOXA 4KHOA 1WGUA 2FJLA 2XQNM 2K2JA 5KQ1A 4KAXB 3O96A 3KRWA 2HTHB 3QIJA 2DTCA 4MY6A 3AU5A 1WG7A 2J0JA 3A8PA 2D9WA 1X05A 2UZSA 4L6EA 3ZVRA 5DI9B 2VSZA 4YL8A 2JP2A 3VIAA 1FGZA 4GN1A 4EMOA 2H7EA 1AWEA 3SNHA 3M1IB 4F7UP 1DROA 4P7IA 1DDMA 1TJ6A 3BJIA 2VRWB 4MT7A 1UPQA 2Z0OA 4TYZA 4BBKA 1NTYA 3RCPA 3PP2A 2R09A 2CAYA 1BTNA 2EJ8A 1XR0B 2P0HA 1AQCA 3TW1A 4K2OA 5J3TA 1X1FA 4GMXB 2D2QA 2M14A 4KHAA 2LOZA 3NSUA 5DIFB 2COFA 2Z0QA 1MK9B 4ZRKA 1X11A 3TVVA 2Y8GA 3KSYA 3GYOA 1W1DA 1M7RA 1U5DA 2L1CA 2OQBA 2AEHA 2X18A 3FM8C 2COAA 2DKQA 1UNQA 1V88A 3P7ZA 3ULBA 1EVHA 5DH9B 2D10A 2BCJA 3QWMA 1LW3A 1DDWA 3CIKA 4HAUB 3ODOA 3MPXA 3BINA 5L81A 2K2UA 1RRPB 2CY5A 1XODA 2YS5A 3AJ4A 4GZUA 3SV1A 3SO6A 3TCAA 1MPHA 4D0NB 5CLQB 2DX1A 1UNRA 2W2WA 2G35A 3P6AA 1FAOA 1W1HA 4K81A 3PEGA 3PVWA 2IYBA 4GXBA 2QKLA 2GS0A 2KUPA 1U27A 3MDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRY A;  5LON B;  4Z2M B;  2RUK B;  3F0W A;  1W1G A;  3KRX A;  1PLS A;  3X23 A;  1V5M A;  4CYE A;  4F7G A;  3PVL A;  4PNK A;  2QKM A;  1FOE A;  2DHJ A;  1XCG A;  5JHH A;  4K2P A;  1QC6 A;  2D9V A;  3SYX A;  3ULC A;  4EKU A;  3KZ1 A;  3ZDT A;  4WSF A;  4A6F A;  1DYN A;  2E2X A;  1ZC3 B;  2RSG A;  2DYQ A;  2AL6 A;  4XWX A;  1DBH A;  2DLW A;  5LOP B;  1WJM A;  5C6R A;  2DN6 A;  4HAW B;  3PZD A;  3WA0 A;  2DHK A;  2P8V A;  4HB2 B;  1WJ1 A;  5HE2 A;  4ZRI A;  2LKO A;  4HB4 B;  2LG1 A;  1WVH A;  5FI0 A;  5C16 A;  2GJY A;  3CXB B;  4DX8 A;  4DBB A;  2DKP A;  1BWN A;  3LJU X;  2DX5 A;  2J0K A;  1P5T A;  2OTX A;  1GC7 A;  1NU2 A;  2ROZ B;  1WGQ A;  5HE3 A;  1FHO A;  4IFS A;  3ODX A;  3T06 A;  4HB0 B;  2LUL A;  5HE1 A;  4A5K A;  2D9X A;  3VOQ A;  4A6F B;  2ELB A;  2EMS A;  1TXD A;  2KGX B;  1V89 A;  5J3Q A;  1I7A A;  2HE7 A;  1BTK A;  1ISN A;  1OQN A;  3HQC A;  1RJ2 A;  2UVM A;  4WVF B;  2MKR A;  4HB3 B;  2I5C A;  5C5B A;  1PFJ A;  4HAX B;  4HAY B;  2YT0 A;  1Q67 A;  2ROV A;  2N23 A;  2COD A;  1DDV A;  1MIX A;  1KI1 B;  5EFX A;  5JLJ B;  1M7E A;  2YS1 A;  1WI1 A;  4EJN A;  1OY2 A;  3D8F A;  3ODW A;  4NSW A;  4WJ7 A;  1MAI A;  4A6H A;  1FHX A;  4HAV B;  1KZG A;  2DFK A;  2DHI A;  1EGX A;  2J59 M;  3D8D A;  1EF1 A;  3GYP A;  2VKI A;  4DXA B;  1U5F A;  2I1J A;  4GPT B;  1XD4 A;  1N3H A;  1XKE A;  1MIZ B;  4CHM A;  2YF0 A;  1Y5O A;  3WYF B;  2GCJ A;  4NY0 A;  5FI1 A;  2DA0 A;  1IRS A;  1J19 A;  1XX0 A;  3HK0 A;  5D3V A;  2IFS A;  1B55 A;  5JP4 A;  2D9Y A;  2NMB A;  1J0W A;  2UZR A;  3AU4 A;  2RGN B;  4Z2N A;  1PMS A;  1MK7 B;  3HW2 B;  4F7H A;  2ADZ A;  2GCL A;  3DXD A;  1U5E A;  4HAZ B;  3KY9 A;  1P6S A;  1ZM0 A;  2KCJ A;  1K5G B;  2LYD A;  2PZ1 A;  2M38 A;  4CHJ A;  3PVU A;  2NZ8 B;  4HAT B;  5DHF B;  3DXE A;  2CY4 A;  4ZRJ A;  2N0Y A;  3N7C A;  1E5W A;  1FHW A;  3PSC A;  2Y7B A;  2P0F A;  1H4R A;  1K5D B;  2Y8F A;  1I2H A;  1UNP A;  3U8Z A;  4TKN A;  1X1G A;  1ZC4 B;  5GOW B;  5CLL B;  2RLO A;  1UEF A;  2D9Z A;  3FEH A;  1QQG A;  4HDQ A;  2R0D A;  1TQZ A;  2D4Q A;  2RVB B;  5J3Y A;  2ZPY A;  4Y94 A;  2V76 A;  5C5B B;  1P3R A;  4PQ0 A;  4HDO A;  1H10 A;  3ML4 A;  1EAZ A;  1FGY A;  2D11 A;  2H7D A;  1MKE A;  3F5R A;  1GG3 A;  1U29 A;  3UZT A;  2CRF A;  3TFM A;  4IOY X;  3V5W A;  4B6H A;  2YS3 A;  3SUZ A;  1ZSQ A;  4C0A A;  3A8Q A;  2MFQ A;  5HE0 A;  5C79 A;  4YON A;  3OAN A;  1OMW A;  1GC6 A;  4HHV A;  1SGH A;  1FB8 A;  2EC1 A;  5D3Y A;  5KCV A;  3D8E A;  3QBV B;  1LB1 A;  1NI2 A;  4MK0 A;  1Z87 A;  5DHA B;  1V5P A;  2YVC A;  2Z0P A;  2Q13 A;  1KZ7 A;  2I1K A;  5D3X A;  2EMT A;  1ZVR A;  1U2B A;  2MWN B;  4DX9 0;  2W2X C;  1V5U A;  2L2I A;  2YT1 A;  1SHC A;  1X86 A;  2RNR B;  5D27 A;  2ELA A;  4K17 A;  2YSZ A;  2J0M A;  2W2X D;  2DYN A;  3FSS A;  5D3W A;  3TO1 A;  4A6K A;  1UPR A;  3A98 B;  2COC A;  1V61 A;  4H8S A;  5JHG A;  3G9W A;  1Y19 B;  3IVF A;  2MDX A;  3PG7 A;  1NTV A;  3DXC A;  2I5F A;  4KVG B;  2P0D A;  1U5G A;  3U7D A;  4GMV A;  5KQ4 A;  4IAP A;  1BAK A;  4KHB B;  2K00 A;  2LOX A;  4KHO A;  1WGU A;  2FJL A;  2XQN M;  2K2J A;  5KQ1 A;  4KAX B;  3O96 A;  3KRW A;  2HTH B;  3QIJ A;  2DTC A;  4MY6 A;  3AU5 A;  1WG7 A;  2J0J A;  3A8P A;  2D9W A;  1X05 A;  2UZS A;  4L6E A;  3ZVR A;  5DI9 B;  2VSZ A;  4YL8 A;  2JP2 A;  3VIA A;  1FGZ A;  4GN1 A;  4EMO A;  2H7E A;  1AWE A;  3SNH A;  3M1I B;  4F7U P;  1DRO A;  4P7I A;  1DDM A;  1TJ6 A;  3BJI A;  2VRW B;  4MT7 A;  1UPQ A;  2Z0O A;  4TYZ A;  4BBK A;  1NTY A;  3RCP A;  3PP2 A;  2R09 A;  2CAY A;  1BTN A;  2EJ8 A;  1XR0 B;  2P0H A;  1AQC A;  3TW1 A;  4K2O A;  5J3T A;  1X1F A;  4GMX B;  2D2Q A;  2M14 A;  4KHA A;  2LOZ A;  3NSU A;  5DIF B;  2COF A;  2Z0Q A;  1MK9 B;  4ZRK A;  1X11 A;  3TVV A;  2Y8G A;  3KSY A;  3GYO A;  1W1D A;  1M7R A;  1U5D A;  2L1C A;  2OQB A;  2AEH A;  2X18 A;  3FM8 C;  2COA A;  2DKQ A;  1UNQ A;  1V88 A;  3P7Z A;  3ULB A;  1EVH A;  5DH9 B;  2D10 A;  2BCJ A;  3QWM A;  1LW3 A;  1DDW A;  3CIK A;  4HAU B;  3ODO A;  3MPX A;  3BIN A;  5L81 A;  2K2U A;  1RRP B;  2CY5 A;  1XOD A;  2YS5 A;  3AJ4 A;  4GZU A;  3SV1 A;  3SO6 A;  3TCA A;  1MPH A;  4D0N B;  5CLQ B;  2DX1 A;  1UNR A;  2W2W A;  2G35 A;  3P6A A;  1FAO A;  1W1H A;  4K81 A;  3PEG A;  3PVW A;  2IYB A;  4GXB A;  2QKL A;  2GS0 A;  2KUP A;  1U27 A;  3MDB C; 
#chains in the Genus database with same CATH topology
 2YRY A;  5LON B;  4Z2M B;  2RUK B;  3F0W A;  1W1G A;  3KRX A;  1PLS A;  3OHM B;  3X23 A;  1V5M A;  4CYE A;  3NWF A;  4F7G A;  2Z14 A;  3PVL A;  4PNK A;  2QKM A;  1FOE A;  2DHJ A;  1XCG A;  5JHH A;  4K2P A;  1QC6 A;  2D9V A;  3SYX A;  3ULC A;  4EKU A;  3KZ1 A;  1MI1 A;  3ZDT A;  2GUM A;  5M4Y B;  4WSF A;  4A6F A;  1DYN A;  2E2X A;  1ZC3 B;  2RSG A;  2DYQ A;  2AL6 A;  4XWX A;  1DBH A;  2DLW A;  5LOP B;  1WJM A;  5C6R A;  2DN6 A;  4HAW B;  3PZD A;  3WA0 A;  2DHK A;  2P8V A;  4HB2 B;  1WJ1 A;  5HE2 A;  4ZRI A;  2LKO A;  4HB4 B;  2LG1 A;  1WVH A;  5FI0 A;  5C16 A;  2NBV A;  2GJY A;  3CXB B;  4DX8 A;  4DBB A;  2DKP A;  1BWN A;  3LJU X;  2DX5 A;  2J0K A;  1P5T A;  2OTX A;  1GC7 A;  5I2S A;  1NU2 A;  2ROZ B;  1WGQ A;  5HE3 A;  1FHO A;  4IFS A;  3ODX A;  3T06 A;  4HB0 B;  2LUL A;  5HE1 A;  4A5K A;  2D9X A;  3VOQ A;  4A6F B;  2ELB A;  2EMS A;  1TXD A;  2KGX B;  1V89 A;  5J3Q A;  1I7A A;  2HE7 A;  1BTK A;  1ISN A;  1OQN A;  3HQC A;  1RJ2 A;  2UVM A;  4WVF B;  2MKR A;  4OSN A;  4HB3 B;  2I5C A;  5C5B A;  1PFJ A;  2Z13 A;  4HAX B;  4HAY B;  2YT0 A;  1Q67 A;  2ROV A;  2N23 A;  2COD A;  1DDV A;  1MIX A;  1KI1 B;  5EFX A;  5JLJ B;  1M7E A;  2YS1 A;  3FVC A;  1WI1 A;  4EJN A;  1OY2 A;  3D8F A;  3ODW A;  4NSW A;  4WJ7 A;  1MAI A;  4A6H A;  1FHX A;  4HAV B;  1KZG A;  2DFK A;  2DHI A;  1EGX A;  2J59 M;  3D8D A;  1EF1 A;  3GYP A;  2VKI A;  4DXA B;  1U5F A;  2I1J A;  4GPT B;  1XD4 A;  4L1R A;  2KR0 A;  1N3H A;  2Z59 A;  1XKE A;  3NW8 A;  1MIZ B;  4CHM A;  3U12 A;  2YF0 A;  1Y5O A;  3WYF B;  2GCJ A;  4NY0 A;  5FI1 A;  2DA0 A;  1IRS A;  1J19 A;  1XX0 A;  3HK0 A;  5D3V A;  2IFS A;  1B55 A;  5JP4 A;  2D9Y A;  2NMB A;  1J0W A;  2UZR A;  3AU4 A;  2RGN B;  4Z2N A;  1PMS A;  1MK7 B;  3HW2 B;  4F7H A;  2ADZ A;  2GCL A;  3DXD A;  1U5E A;  3KY9 A;  4HAZ B;  1P6S A;  1ZM0 A;  2KCJ A;  4QJ3 B;  1K5G B;  2LYD A;  2YT2 A;  3DCX A;  2PZ1 A;  2M38 A;  4CHJ A;  3PVU A;  2NZ8 B;  4HAT B;  3B77 A;  5DHF B;  3DXE A;  2CY4 A;  4ZRJ A;  2N0Y A;  3N7C A;  4GOU A;  1E5W A;  1FHW A;  3PSC A;  2Y7B A;  2P0F A;  1H4R A;  1K5D B;  2Y8F A;  1I2H A;  1UNP A;  3U8Z A;  1ZYI A;  1X1G A;  1ZC4 B;  4TKN A;  5GOW B;  5CLL B;  2RLO A;  1UEF A;  2D9Z A;  3FEH A;  1QQG A;  4HDQ A;  2R0D A;  1TQZ A;  2D4Q A;  2RVB B;  5J3Y A;  2ZPY A;  4Y94 A;  2V76 A;  5C5B B;  1P3R A;  4PQ0 A;  4HDO A;  1H10 A;  2KIE A;  3ML4 A;  1EAZ A;  1FGY A;  2D11 A;  2H7D A;  1MKE A;  3F5R A;  1GG3 A;  1U29 A;  3UZT A;  2CRF A;  3TFM A;  4IOY X;  3V5W A;  4B6H A;  2YS3 A;  3SUZ A;  1ZSQ A;  4C0A A;  2KUQ A;  2MFQ A;  3A8Q A;  5HE0 A;  5C79 A;  4YON A;  3OAN A;  1OMW A;  1GC6 A;  4HHV A;  1SGH A;  1FB8 A;  2EC1 A;  5D3Y A;  5KCV A;  3D8E A;  3QBV B;  4QXA B;  1LB1 A;  1NI2 A;  4MK0 A;  1Z87 A;  5DHA B;  1V5P A;  2YVC A;  2Z0P A;  2Q13 A;  1KZ7 A;  4OT1 A;  5LG4 B;  2I1K A;  5D3X A;  2EMT A;  1ZVR A;  1U2B A;  2MWN B;  3A58 A;  4DX9 0;  2W2X C;  1V5U A;  3HSA A;  2L2I A;  2YT1 A;  1SHC A;  1X86 A;  2RNR B;  5D27 A;  2ELA A;  4K17 A;  2YSZ A;  2J0M A;  2W2X D;  2DYN A;  3FSS A;  5D3W A;  3TO1 A;  4A6K A;  1UPR A;  3A98 B;  2COC A;  2Z4D A;  1V61 A;  4H8S A;  5JHG A;  3G9W A;  1Y19 B;  3IVF A;  2MDX A;  4DIX A;  3PG7 A;  4GNK B;  3NWA A;  1NTV A;  3DXC A;  2I5F A;  4KVG B;  2P0D A;  1U5G A;  2K8E A;  3U7D A;  4GMV A;  5KQ4 A;  4IAP A;  1BAK A;  4KHB B;  2K00 A;  2LOX A;  4KHO A;  1WGU A;  2FJL A;  2XQN M;  2K2J A;  5KQ1 A;  4KAX B;  3O96 A;  3KRW A;  2HTH B;  2DTC A;  3QIJ A;  4MY6 A;  3AU5 A;  1WG7 A;  2J0J A;  3A8P A;  2D9W A;  1X05 A;  2UZS A;  4L6E A;  3ZVR A;  5DI9 B;  3NWD A;  2VSZ A;  4YL8 A;  2JP2 A;  3VIA A;  1FGZ A;  4GN1 A;  4EMO A;  2H7E A;  1AWE A;  2ZKM X;  3SNH A;  3M1I B;  4F7U P;  1DRO A;  4P7I A;  1DDM A;  1TJ6 A;  3BJI A;  2VRW B;  4MT7 A;  1UPQ A;  2Z0O A;  4TYZ A;  4BBK A;  1NTY A;  4QJ5 B;  2KIG A;  2RRF A;  3RCP A;  3PP2 A;  2R09 A;  2CAY A;  1BTN A;  2EJ8 A;  2K49 A;  1XR0 B;  2P0H A;  1AQC A;  3TW1 A;  4K2O A;  5J3T A;  1X1F A;  4GMX B;  2D2Q A;  2M14 A;  4KHA A;  2LOZ A;  3NSU A;  5DIF B;  2COF A;  2Z0Q A;  4HSI A;  1MK9 B;  4ZRK A;  1X11 A;  3TVV A;  2Y8G A;  3KSY A;  3GYO A;  3HIE A;  1W1D A;  1M7R A;  1U5D A;  2L1C A;  2OQB A;  4CSQ A;  2AEH A;  2X18 A;  3FM8 C;  2COA A;  2DKQ A;  1UNQ A;  1V88 A;  3P7Z A;  5IRS A;  3ULB A;  1EVH A;  5DH9 B;  2D10 A;  2BCJ A;  3QWM A;  1LW3 A;  1T77 A;  1DDW A;  3CIK A;  4HAU B;  4D6W A;  2R2Y A;  3ODO A;  3MPX A;  3BIN A;  5L81 A;  2K2U A;  1RRP B;  2CY5 A;  1XOD A;  2YS5 A;  3AJ4 A;  4GZU A;  3SV1 A;  3SO6 A;  3TCA A;  1MPH A;  4D0N B;  5CLQ B;  2DX1 A;  1UNR A;  2W2W A;  2G35 A;  3P6A A;  4KHB A;  1FAO A;  5I2M A;  1W1H A;  2FJU B;  4K81 A;  3PEG A;  3PVW A;  2IYB A;  4GXB A;  2QKL A;  4QJ4 B;  2GS0 A;  2KUP A;  1U27 A;  3MDB C; 
#chains in the Genus database with same CATH homology
 2YRY A;  5LON B;  4Z2M B;  2RUK B;  3F0W A;  1W1G A;  3KRX A;  1PLS A;  3X23 A;  1V5M A;  4CYE A;  4F7G A;  3PVL A;  4PNK A;  2QKM A;  1FOE A;  2DHJ A;  1XCG A;  5JHH A;  4K2P A;  1QC6 A;  2D9V A;  3SYX A;  3ULC A;  4EKU A;  3KZ1 A;  3ZDT A;  4WSF A;  4A6F A;  1DYN A;  2E2X A;  1ZC3 B;  2RSG A;  2DYQ A;  2AL6 A;  4XWX A;  1DBH A;  2DLW A;  5LOP B;  1WJM A;  5C6R A;  2DN6 A;  4HAW B;  3PZD A;  3WA0 A;  2DHK A;  2P8V A;  4HB2 B;  1WJ1 A;  5HE2 A;  4ZRI A;  2LKO A;  4HB4 B;  2LG1 A;  1WVH A;  5FI0 A;  5C16 A;  2GJY A;  3CXB B;  4DX8 A;  4DBB A;  2DKP A;  1BWN A;  3LJU X;  2DX5 A;  2J0K A;  1P5T A;  2OTX A;  1GC7 A;  1NU2 A;  2ROZ B;  1WGQ A;  5HE3 A;  1FHO A;  4IFS A;  3ODX A;  3T06 A;  4HB0 B;  2LUL A;  5HE1 A;  4A5K A;  2D9X A;  3VOQ A;  4A6F B;  2ELB A;  2EMS A;  1TXD A;  2KGX B;  1V89 A;  5J3Q A;  1I7A A;  2HE7 A;  1BTK A;  1ISN A;  1OQN A;  3HQC A;  1RJ2 A;  2UVM A;  4WVF B;  2MKR A;  4HB3 B;  2I5C A;  5C5B A;  1PFJ A;  4HAX B;  4HAY B;  2YT0 A;  1Q67 A;  2ROV A;  2N23 A;  2COD A;  1DDV A;  1MIX A;  1KI1 B;  5EFX A;  5JLJ B;  1M7E A;  2YS1 A;  1WI1 A;  4EJN A;  1OY2 A;  3D8F A;  3ODW A;  4NSW A;  4WJ7 A;  1MAI A;  4A6H A;  1FHX A;  4HAV B;  1KZG A;  2DFK A;  2DHI A;  1EGX A;  2J59 M;  3D8D A;  1EF1 A;  3GYP A;  2VKI A;  4DXA B;  1U5F A;  2I1J A;  4GPT B;  1XD4 A;  1N3H A;  1XKE A;  1MIZ B;  4CHM A;  2YF0 A;  1Y5O A;  3WYF B;  2GCJ A;  4NY0 A;  5FI1 A;  2DA0 A;  1IRS A;  1J19 A;  1XX0 A;  3HK0 A;  5D3V A;  2IFS A;  1B55 A;  5JP4 A;  2D9Y A;  2NMB A;  1J0W A;  2UZR A;  3AU4 A;  2RGN B;  4Z2N A;  1PMS A;  1MK7 B;  3HW2 B;  4F7H A;  2ADZ A;  2GCL A;  3DXD A;  1U5E A;  4HAZ B;  3KY9 A;  1P6S A;  1ZM0 A;  2KCJ A;  1K5G B;  2LYD A;  2PZ1 A;  2M38 A;  4CHJ A;  3PVU A;  2NZ8 B;  4HAT B;  5DHF B;  3DXE A;  2CY4 A;  4ZRJ A;  2N0Y A;  3N7C A;  1E5W A;  1FHW A;  3PSC A;  2Y7B A;  2P0F A;  1H4R A;  1K5D B;  2Y8F A;  1I2H A;  1UNP A;  3U8Z A;  4TKN A;  1X1G A;  1ZC4 B;  5GOW B;  5CLL B;  2RLO A;  1UEF A;  2D9Z A;  3FEH A;  1QQG A;  4HDQ A;  2R0D A;  1TQZ A;  2D4Q A;  2RVB B;  5J3Y A;  2ZPY A;  4Y94 A;  2V76 A;  5C5B B;  1P3R A;  4PQ0 A;  4HDO A;  1H10 A;  3ML4 A;  1EAZ A;  1FGY A;  2D11 A;  2H7D A;  1MKE A;  3F5R A;  1GG3 A;  1U29 A;  3UZT A;  2CRF A;  3TFM A;  4IOY X;  3V5W A;  4B6H A;  2YS3 A;  3SUZ A;  1ZSQ A;  4C0A A;  3A8Q A;  2MFQ A;  5HE0 A;  5C79 A;  4YON A;  3OAN A;  1OMW A;  1GC6 A;  4HHV A;  1SGH A;  1FB8 A;  2EC1 A;  5D3Y A;  5KCV A;  3D8E A;  3QBV B;  1LB1 A;  1NI2 A;  4MK0 A;  1Z87 A;  5DHA B;  1V5P A;  2YVC A;  2Z0P A;  2Q13 A;  1KZ7 A;  2I1K A;  5D3X A;  2EMT A;  1ZVR A;  1U2B A;  2MWN B;  4DX9 0;  2W2X C;  1V5U A;  2L2I A;  2YT1 A;  1SHC A;  1X86 A;  2RNR B;  5D27 A;  2ELA A;  4K17 A;  2YSZ A;  2J0M A;  2W2X D;  2DYN A;  3FSS A;  5D3W A;  3TO1 A;  4A6K A;  1UPR A;  3A98 B;  2COC A;  1V61 A;  4H8S A;  5JHG A;  3G9W A;  1Y19 B;  3IVF A;  2MDX A;  3PG7 A;  1NTV A;  3DXC A;  2I5F A;  4KVG B;  2P0D A;  1U5G A;  3U7D A;  4GMV A;  5KQ4 A;  4IAP A;  1BAK A;  4KHB B;  2K00 A;  2LOX A;  4KHO A;  1WGU A;  2FJL A;  2XQN M;  2K2J A;  5KQ1 A;  4KAX B;  3O96 A;  3KRW A;  2HTH B;  3QIJ A;  2DTC A;  4MY6 A;  3AU5 A;  1WG7 A;  2J0J A;  3A8P A;  2D9W A;  1X05 A;  2UZS A;  4L6E A;  3ZVR A;  5DI9 B;  2VSZ A;  4YL8 A;  2JP2 A;  3VIA A;  1FGZ A;  4GN1 A;  4EMO A;  2H7E A;  1AWE A;  3SNH A;  3M1I B;  4F7U P;  1DRO A;  4P7I A;  1DDM A;  1TJ6 A;  3BJI A;  2VRW B;  4MT7 A;  1UPQ A;  2Z0O A;  4TYZ A;  4BBK A;  1NTY A;  3RCP A;  3PP2 A;  2R09 A;  2CAY A;  1BTN A;  2EJ8 A;  1XR0 B;  2P0H A;  1AQC A;  3TW1 A;  4K2O A;  5J3T A;  1X1F A;  4GMX B;  2D2Q A;  2M14 A;  4KHA A;  2LOZ A;  3NSU A;  5DIF B;  2COF A;  2Z0Q A;  1MK9 B;  4ZRK A;  1X11 A;  3TVV A;  2Y8G A;  3KSY A;  3GYO A;  1W1D A;  1M7R A;  1U5D A;  2L1C A;  2OQB A;  2AEH A;  2X18 A;  3FM8 C;  2COA A;  2DKQ A;  1UNQ A;  1V88 A;  3P7Z A;  3ULB A;  1EVH A;  5DH9 B;  2D10 A;  2BCJ A;  3QWM A;  1LW3 A;  1DDW A;  3CIK A;  4HAU B;  3ODO A;  3MPX A;  3BIN A;  5L81 A;  2K2U A;  1RRP B;  2CY5 A;  1XOD A;  2YS5 A;  3AJ4 A;  4GZU A;  3SV1 A;  3SO6 A;  3TCA A;  1MPH A;  4D0N B;  5CLQ B;  2DX1 A;  1UNR A;  2W2W A;  2G35 A;  3P6A A;  1FAO A;  1W1H A;  4K81 A;  3PEG A;  3PVW A;  2IYB A;  4GXB A;  2QKL A;  2GS0 A;  2KUP A;  1U27 A;  3MDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...