2M14A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna binding protein
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m14A00
2D9YA 1UNQA 2N0YA 4HB2B 1AWEA 1SGHA 2P0HA 2OTXA 2CODA 4CYEA 2E2XA 1RJ2A 2OQBA 2VSZA 2D10A 4WVFB 5C6RA 4GMXB 2FJLA 4KHBB 1DBHA 1DDWA 3QIJA 1U29A 2CAYA 3MDBC 1M7EA 2LYDA 5HE3A 1U27A 4IFSA 3G9WA 2DN6A 3TFMA 1XR0B 4GZUA 2M14A 2R0DA 4BBKA 2I5CA 3SUZA 2HE7A 4A5KA 1X11A 1MK7B 1WGQA 1XCGA 4A6HA 4ZRJA 5EFXA 2MFQA 2EJ8A 2RLOA 1LW3A 4KVGB 1W1HA 2D9VA 2Z0PA 2H7EA 4K2PA 2ROVA 4HAYB 5CLLB 1PMSA 1V88A 3D8DA 5LOPB 2DHIA 5JP4A 2VKIA 2X18A 2W2XD 4HATB 2BCJA 2LULA 3ZDTA 4HDQA 2IYBA 1GC6A 2Y8FA 1Z87A 2RNRB 2J0JA 4MK0A 5D3YA 2YT0A 1BAKA 5LONB 4A6FA 2DYQA 1U5EA 2LOZA 2I1KA 4MT7A 1OY2A 3VOQA 3DXCA 2DKPA 1P3RA 1MAIA 5C79A 1Q67A 4WJ7A 3CXBB 3U8ZA 3A8PA 3CIKA 3SV1A 2DTCA 2P0DA 4DX8A 2RVBB 3D8EA 4YL8A 4F7GA 1U2BA 5DIFB 3SNHA 2NMBA 4EKUA 1SHCA 1E5WA 4CHJA 4HAVB 1OMWA 2J59M 4DX90 2MDXA 2D2QA 4K17A 1WG7A 3O96A 3SO6A 1X05A 2YVCA 3M1IB 1FGZA 1TJ6A 5J3YA 2ELAA 2EMTA 1J0WA 4PQ0A 1EGXA 1FHXA 2UZRA 3PSCA 1DYNA 1TXDA 1MKEA 3GYPA 1U5DA 2ADZA 3PVWA 1WI1A 4F7HA 2DLWA 5JHHA 2Y7BA 1ISNA 4KHAA 1DDMA 3KY9A 2YS3A 3N7CA 1PLSA 4HAZB 2L1CA 2G35A 1K5DB 2EMSA 1BTNA 1FHWA 1MK9B 3ML4A 4H8SA 2AL6A 1TQZA 4B6HA 1ZVRA 4YONA 2YS5A 4ZRKA 3FSSA 1ZC3B 1ZSQA 1WGUA 4IAPA 3D8FA 2QKMA 2N23A 1KI1B 1MIZB 1U5FA 4PNKA 4TYZA 1U5GA 4TKNA 3SYXA 3TO1A 1XD4A 3U7DA 4HHVA 1NI2A 5C5BB 1EF1A 5DH9B 1X1FA 3AU5A 2AEHA 1WJMA 1FHOA 3PEGA 4F7UP 2D4QA 5FI1A 4EJNA 3ZVRA 2LOXA 5D3XA 2K2UA 4HAXB 2YT1A 1UNPA 1XX0A 2NZ8B 2Z0OA 2K00A 1Y19B 3MPXA 2KCJA 1N3HA 4DBBA 1FOEA 2DX5A 2XQNM 3HK0A 4HB3B 3FM8C 2W2XC 3V5WA 1KZ7A 3KRWA 3PP2A 1PFJA 2KUPA 4D0NB 4K2OA 1WJ1A 2QKLA 2K2JA 2MKRA 3KRXA 1EVHA 2CY5A 3PVLA 1X1GA 2UZSA 3FEHA 5D27A 3ULCA 1P5TA 2V76A 5DI9B 1MPHA 2DA0A 2D9XA 1WVHA 2Q13A 3KSYA 3ODXA 2COAA 4WSFA 1AQCA 4Z2NA 3QWMA 5J3TA 2PZ1A 3PVUA 4HB4B 3ULBA 3TVVA 4A6KA 1I7AA 2H7DA 4CHMA 4KHOA 2DHJA 3DXDA 1DROA 4HAUB 3ODOA 2HTHB 4GN1A 4HDOA 3BINA 2GS0A 3AJ4A 3BJIA 1J19A 3LJUX 3PZDA 4Y94A 3NSUA 2MWNB 2GCLA 2UVMA 3DXEA 2DYNA 2JP2A 3HW2B 1QC6A 2YF0A 4C0AA 2J0MA 5GOWB 1H10A 2LKOA 2DFKA 4P7IA 5KCVA 1V5UA 5FI0A 1NTYA 3T06A 3WA0A 2IFSA 3UZTA 2VRWB 2M38A 2DX1A 5KQ4A 4DXAB 3F0WA 2D9WA 5HE0A 4GPTB 1BTKA 2ROZB 2W2WA 4GXBA 1NTVA 1QQGA 1IRSA 1UEFA 1NU2A 4A6FB 4L6EA 1M7RA 4EMOA 2I1JA 1X86A 5CLQB 1KZGA 2COCA 1W1DA 5C16A 2YSZA 2YS1A 2Z0QA 4XWXA 1B55A 1GC7A 1FGYA 3ODWA 5DHAB 1UPRA 4NY0A 2ZPYA 5KQ1A 1XODA 2DHKA 3OANA 3A98B 5L81A 1ZC4B 5D3WA 2CY4A 2YRYA 1Y5OA 4Z2MB 1P6SA 1ZM0A 2RUKB 1LB1A 3QBVB 1RRPB 4IOYX 4HB0B 1DDVA 3RCPA 2GJYA 2GCJA 2Y8GA 4GMVA 5DHFB 3IVFA 2R09A 5J3QA 5JLJB 5HE2A 1XKEA 1BWNA 1V5PA 2L2IA 3AU4A 3GYOA 3KZ1A 3VIAA 2D9ZA 3WYFB 1V5MA 2COFA 3P6AA 3F5RA 1V61A 2I5FA 1W1GA 1FB8A 2P8VA 1OQNA 1FAOA 1MIXA 5JHGA 3TW1A 2J0KA 3P7ZA 3TCAA 2P0FA 1I2HA 4ZRIA 4HAWB 4K81A 3A8QA 2EC1A 2LG1A 3PG7A 4KAXB 1UNRA 2CRFA 5D3VA 4MY6A 1UPQA 1K5GB 3X23A 3HQCA 4NSWA 2D11A 5C5BA 1EAZA 2KGXB 2ELBA 1GG3A 1H4RA 2RGNB 1V89A 2DKQA 5HE1A 2RSGA
chains in the Genus database with same CATH superfamily
2D9YA 1UNQA 2N0YA 4HB2B 1AWEA 1SGHA 2P0HA 2OTXA 2CODA 4CYEA 2E2XA 1RJ2A 2OQBA 2VSZA 2D10A 4WVFB 5C6RA 4GMXB 2FJLA 4GNKB 4KHBB 1DBHA 1DDWA 3QIJA 1U29A 2CAYA 3MDBC 1M7EA 2LYDA 5HE3A 1U27A 2KR0A 4IFSA 4D6WA 2Z14A 3G9WA 2DN6A 2Z59A 3TFMA 1XR0B 4GZUA 2M14A 2R0DA 4BBKA 2I5CA 3NWFA 3SUZA 2HE7A 4A5KA 4QJ4B 1X11A 1MK7B 1WGQA 1XCGA 4A6HA 4ZRJA 5EFXA 2MFQA 1ZYIA 2EJ8A 2RLOA 1LW3A 4KVGB 4L1RA 1W1HA 2D9VA 2Z0PA 2H7EA 4K2PA 2ROVA 2K8EA 4HAYB 5CLLB 1PMSA 1V88A 5IRSA 3D8DA 5LOPB 4QJ3B 2DHIA 2Z13A 2GUMA 5JP4A 2VKIA 2X18A 2W2XD 4HATB 2BCJA 2LULA 3ZDTA 4HDQA 2IYBA 1GC6A 2Y8FA 1Z87A 2RNRB 2J0JA 4MK0A 5D3YA 2YT0A 4QXAB 1BAKA 5LONB 4A6FA 2KIEA 2DYQA 1U5EA 2LOZA 2I1KA 4MT7A 1OY2A 3VOQA 3DXCA 2DKPA 1P3RA 1MAIA 5C79A 1Q67A 4WJ7A 3CXBB 3U8ZA 3A8PA 3CIKA 3SV1A 2DTCA 2P0DA 4DX8A 2RVBB 3D8EA 4YL8A 4F7GA 1U2BA 5DIFB 3SNHA 2NMBA 4EKUA 1SHCA 1E5WA 4CHJA 4HAVB 1OMWA 2J59M 4DX90 2MDXA 2D2QA 4K17A 1WG7A 3O96A 4QJ5B 3SO6A 1X05A 2YVCA 5I2SA 3M1IB 1FGZA 1TJ6A 5J3YA 2ELAA 2EMTA 1J0WA 4PQ0A 1EGXA 1FHXA 2UZRA 3PSCA 1DYNA 1TXDA 1MKEA 3GYPA 1U5DA 2ADZA 3PVWA 1WI1A 4F7HA 2DLWA 5JHHA 2Y7BA 1ISNA 2KIGA 4KHAA 1DDMA 3KY9A 2YS3A 3N7CA 1PLSA 2ZKMX 4HAZB 2L1CA 2G35A 3HSAA 1K5DB 2EMSA 1BTNA 1FHWA 4GOUA 1MK9B 3ML4A 4H8SA 2AL6A 1TQZA 4B6HA 1ZVRA 4YONA 2YS5A 4ZRKA 3FSSA 1ZC3B 1ZSQA 1WGUA 4IAPA 3D8FA 2QKMA 2N23A 1KI1B 1MIZB 1U5FA 4PNKA 4TYZA 1U5GA 4TKNA 3SYXA 3TO1A 1XD4A 3U7DA 4HHVA 1NI2A 5C5BB 1EF1A 5DH9B 1X1FA 3AU5A 2K49A 2AEHA 1WJMA 1FHOA 3PEGA 4F7UP 2D4QA 5FI1A 4EJNA 3ZVRA 2LOXA 5D3XA 2K2UA 1MI1A 4HAXB 2YT1A 1UNPA 1XX0A 2NZ8B 2Z0OA 3MPXA 1Y19B 2K00A 2KCJA 1N3HA 4DBBA 1FOEA 2DX5A 4HSIA 2XQNM 3HK0A 4HB3B 3FM8C 2W2XC 2R2YA 3V5WA 1KZ7A 3KRWA 3PP2A 1PFJA 2KUPA 4D0NB 4K2OA 1WJ1A 3U12A 2QKLA 3HIEA 2K2JA 2MKRA 3KRXA 1EVHA 2CY5A 3PVLA 5M4YB 1X1GA 2UZSA 3FEHA 5D27A 3ULCA 1P5TA 2V76A 5DI9B 1MPHA 2DA0A 2D9XA 1WVHA 2Q13A 3KSYA 3ODXA 2COAA 3NWDA 4WSFA 1AQCA 4Z2NA 3QWMA 5J3TA 2PZ1A 3PVUA 2RRFA 4HB4B 3ULBA 3TVVA 4A6KA 1I7AA 2H7DA 4CHMA 4KHOA 2DHJA 3DXDA 1DROA 4HAUB 3ODOA 2HTHB 4GN1A 4HDOA 3BINA 2GS0A 3AJ4A 3BJIA 1J19A 3LJUX 3PZDA 4Y94A 3NSUA 2MWNB 5I2MA 2GCLA 2UVMA 3DXEA 2DYNA 2JP2A 3HW2B 1QC6A 2YF0A 4C0AA 2J0MA 5GOWB 1H10A 4OSNA 2LKOA 2DFKA 4P7IA 5KCVA 1V5UA 5FI0A 1NTYA 3T06A 3WA0A 2IFSA 3UZTA 2VRWB 2M38A 2DX1A 4CSQA 5KQ4A 4DXAB 3F0WA 2D9WA 5HE0A 4GPTB 2FJUB 1BTKA 2ROZB 2W2WA 4GXBA 1NTVA 1QQGA 1IRSA 1UEFA 1NU2A 4A6FB 4L6EA 1M7RA 4EMOA 2I1JA 1X86A 2NBVA 3OHMB 4OT1A 5CLQB 1KZGA 2COCA 1W1DA 5C16A 3B77A 2YSZA 2YS1A 2Z0QA 4XWXA 1B55A 1GC7A 1FGYA 2YT2A 3ODWA 5DHAB 1UPRA 4NY0A 2ZPYA 5KQ1A 1XODA 3DCXA 2DHKA 3OANA 3A98B 5L81A 1ZC4B 5D3WA 2CY4A 2YRYA 1Y5OA 4Z2MB 1P6SA 1ZM0A 2RUKB 1LB1A 3QBVB 1T77A 1RRPB 4IOYX 4HB0B 1DDVA 3RCPA 2GJYA 2GCJA 2Y8GA 4GMVA 5DHFB 3IVFA 2R09A 5J3QA 4DIXA 5JLJB 5HE2A 5LG4B 1XKEA 2Z4DA 1BWNA 1V5PA 2L2IA 3AU4A 3GYOA 3KZ1A 3VIAA 2D9ZA 3A58A 3WYFB 3NWAA 1V5MA 2COFA 3P6AA 3F5RA 1V61A 2I5FA 1W1GA 1FB8A 2P8VA 1OQNA 1FAOA 1MIXA 5JHGA 3TW1A 2J0KA 3P7ZA 3TCAA 2P0FA 1I2HA 4ZRIA 4HAWB 4K81A 4KHBA 3A8QA 2EC1A 2LG1A 3PG7A 4KAXB 1UNRA 2KUQA 2CRFA 5D3VA 4MY6A 1UPQA 1K5GB 3X23A 3HQCA 4NSWA 2D11A 5C5BA 1EAZA 2KGXB 2ELBA 3FVCA 3NW8A 1GG3A 1H4RA 2RGNB 1V89A 2DKQA 5HE1A 2RSGA
chains in the Genus database with same CATH topology
2D9YA 1UNQA 2N0YA 4HB2B 1AWEA 1SGHA 2P0HA 2OTXA 2CODA 4CYEA 2E2XA 1RJ2A 2OQBA 2VSZA 2D10A 4WVFB 5C6RA 4GMXB 2FJLA 4KHBB 1DBHA 1DDWA 3QIJA 1U29A 2CAYA 3MDBC 1M7EA 2LYDA 5HE3A 1U27A 4IFSA 3G9WA 2DN6A 3TFMA 1XR0B 4GZUA 2M14A 2R0DA 4BBKA 2I5CA 3SUZA 2HE7A 4A5KA 1X11A 1MK7B 1WGQA 1XCGA 4A6HA 4ZRJA 5EFXA 2MFQA 2EJ8A 2RLOA 1LW3A 4KVGB 1W1HA 2D9VA 2Z0PA 2H7EA 4K2PA 2ROVA 4HAYB 5CLLB 1PMSA 1V88A 3D8DA 5LOPB 2DHIA 5JP4A 2VKIA 2X18A 2W2XD 4HATB 2BCJA 2LULA 3ZDTA 4HDQA 2IYBA 1GC6A 2Y8FA 1Z87A 2RNRB 2J0JA 4MK0A 5D3YA 2YT0A 1BAKA 5LONB 4A6FA 2DYQA 1U5EA 2LOZA 2I1KA 4MT7A 1OY2A 3VOQA 3DXCA 2DKPA 1P3RA 1MAIA 5C79A 1Q67A 4WJ7A 3CXBB 3U8ZA 3A8PA 3CIKA 3SV1A 2DTCA 2P0DA 4DX8A 2RVBB 3D8EA 4YL8A 4F7GA 1U2BA 5DIFB 3SNHA 2NMBA 4EKUA 1SHCA 1E5WA 4CHJA 4HAVB 1OMWA 2J59M 4DX90 2MDXA 2D2QA 4K17A 1WG7A 3O96A 3SO6A 1X05A 2YVCA 3M1IB 1FGZA 1TJ6A 5J3YA 2ELAA 2EMTA 1J0WA 4PQ0A 1EGXA 1FHXA 2UZRA 3PSCA 1DYNA 1TXDA 1MKEA 3GYPA 1U5DA 2ADZA 3PVWA 1WI1A 4F7HA 2DLWA 5JHHA 2Y7BA 1ISNA 4KHAA 1DDMA 3KY9A 2YS3A 3N7CA 1PLSA 4HAZB 2L1CA 2G35A 1K5DB 2EMSA 1BTNA 1FHWA 1MK9B 3ML4A 4H8SA 2AL6A 1TQZA 4B6HA 1ZVRA 4YONA 2YS5A 4ZRKA 3FSSA 1ZC3B 1ZSQA 1WGUA 4IAPA 3D8FA 2QKMA 2N23A 1KI1B 1MIZB 1U5FA 4PNKA 4TYZA 1U5GA 4TKNA 3SYXA 3TO1A 1XD4A 3U7DA 4HHVA 1NI2A 5C5BB 1EF1A 5DH9B 1X1FA 3AU5A 2AEHA 1WJMA 1FHOA 3PEGA 4F7UP 2D4QA 5FI1A 4EJNA 3ZVRA 2LOXA 5D3XA 2K2UA 4HAXB 2YT1A 1UNPA 1XX0A 2NZ8B 2Z0OA 2K00A 1Y19B 3MPXA 2KCJA 1N3HA 4DBBA 1FOEA 2DX5A 2XQNM 3HK0A 4HB3B 3FM8C 2W2XC 3V5WA 1KZ7A 3KRWA 3PP2A 1PFJA 2KUPA 4D0NB 4K2OA 1WJ1A 2QKLA 2K2JA 2MKRA 3KRXA 1EVHA 2CY5A 3PVLA 1X1GA 2UZSA 3FEHA 5D27A 3ULCA 1P5TA 2V76A 5DI9B 1MPHA 2DA0A 2D9XA 1WVHA 2Q13A 3KSYA 3ODXA 2COAA 4WSFA 1AQCA 4Z2NA 3QWMA 5J3TA 2PZ1A 3PVUA 4HB4B 3ULBA 3TVVA 4A6KA 1I7AA 2H7DA 4CHMA 4KHOA 2DHJA 3DXDA 1DROA 4HAUB 3ODOA 2HTHB 4GN1A 4HDOA 3BINA 2GS0A 3AJ4A 3BJIA 1J19A 3LJUX 3PZDA 4Y94A 3NSUA 2MWNB 2GCLA 2UVMA 3DXEA 2DYNA 2JP2A 3HW2B 1QC6A 2YF0A 4C0AA 2J0MA 5GOWB 1H10A 2LKOA 2DFKA 4P7IA 5KCVA 1V5UA 5FI0A 1NTYA 3T06A 3WA0A 2IFSA 3UZTA 2VRWB 2M38A 2DX1A 5KQ4A 4DXAB 3F0WA 2D9WA 5HE0A 4GPTB 1BTKA 2ROZB 2W2WA 4GXBA 1NTVA 1QQGA 1IRSA 1UEFA 1NU2A 4A6FB 4L6EA 1M7RA 4EMOA 2I1JA 1X86A 5CLQB 1KZGA 2COCA 1W1DA 5C16A 2YSZA 2YS1A 2Z0QA 4XWXA 1B55A 1GC7A 1FGYA 3ODWA 5DHAB 1UPRA 4NY0A 2ZPYA 5KQ1A 1XODA 2DHKA 3OANA 3A98B 5L81A 1ZC4B 5D3WA 2CY4A 2YRYA 1Y5OA 4Z2MB 1P6SA 1ZM0A 2RUKB 1LB1A 3QBVB 1RRPB 4IOYX 4HB0B 1DDVA 3RCPA 2GJYA 2GCJA 2Y8GA 4GMVA 5DHFB 3IVFA 2R09A 5J3QA 5JLJB 5HE2A 1XKEA 1BWNA 1V5PA 2L2IA 3AU4A 3GYOA 3KZ1A 3VIAA 2D9ZA 3WYFB 1V5MA 2COFA 3P6AA 3F5RA 1V61A 2I5FA 1W1GA 1FB8A 2P8VA 1OQNA 1FAOA 1MIXA 5JHGA 3TW1A 2J0KA 3P7ZA 3TCAA 2P0FA 1I2HA 4ZRIA 4HAWB 4K81A 3A8QA 2EC1A 2LG1A 3PG7A 4KAXB 1UNRA 2CRFA 5D3VA 4MY6A 1UPQA 1K5GB 3X23A 3HQCA 4NSWA 2D11A 5C5BA 1EAZA 2KGXB 2ELBA 1GG3A 1H4RA 2RGNB 1V89A 2DKQA 5HE1A 2RSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9Y A;  1UNQ A;  2N0Y A;  4HB2 B;  1AWE A;  1SGH A;  2P0H A;  2OTX A;  2COD A;  4CYE A;  2E2X A;  1RJ2 A;  2OQB A;  2VSZ A;  2D10 A;  4WVF B;  5C6R A;  4GMX B;  2FJL A;  4KHB B;  1DBH A;  1DDW A;  3QIJ A;  1U29 A;  2CAY A;  3MDB C;  1M7E A;  2LYD A;  5HE3 A;  1U27 A;  4IFS A;  3G9W A;  2DN6 A;  3TFM A;  1XR0 B;  4GZU A;  2M14 A;  2R0D A;  4BBK A;  2I5C A;  3SUZ A;  2HE7 A;  4A5K A;  1X11 A;  1MK7 B;  1WGQ A;  1XCG A;  4A6H A;  4ZRJ A;  5EFX A;  2MFQ A;  2EJ8 A;  2RLO A;  1LW3 A;  4KVG B;  1W1H A;  2D9V A;  2Z0P A;  2H7E A;  4K2P A;  2ROV A;  4HAY B;  5CLL B;  1PMS A;  1V88 A;  3D8D A;  5LOP B;  2DHI A;  5JP4 A;  2VKI A;  2X18 A;  2W2X D;  4HAT B;  2BCJ A;  2LUL A;  3ZDT A;  4HDQ A;  2IYB A;  1GC6 A;  2Y8F A;  1Z87 A;  2RNR B;  2J0J A;  4MK0 A;  5D3Y A;  2YT0 A;  1BAK A;  5LON B;  4A6F A;  2DYQ A;  1U5E A;  2LOZ A;  2I1K A;  4MT7 A;  1OY2 A;  3VOQ A;  3DXC A;  2DKP A;  1P3R A;  1MAI A;  5C79 A;  1Q67 A;  4WJ7 A;  3CXB B;  3U8Z A;  3A8P A;  3CIK A;  3SV1 A;  2DTC A;  2P0D A;  4DX8 A;  2RVB B;  3D8E A;  4YL8 A;  4F7G A;  1U2B A;  5DIF B;  3SNH A;  2NMB A;  4EKU A;  1SHC A;  1E5W A;  4CHJ A;  4HAV B;  1OMW A;  2J59 M;  4DX9 0;  2MDX A;  2D2Q A;  4K17 A;  1WG7 A;  3O96 A;  3SO6 A;  1X05 A;  2YVC A;  3M1I B;  1FGZ A;  1TJ6 A;  5J3Y A;  2ELA A;  2EMT A;  1J0W A;  4PQ0 A;  1EGX A;  1FHX A;  2UZR A;  3PSC A;  1DYN A;  1TXD A;  1MKE A;  3GYP A;  1U5D A;  2ADZ A;  3PVW A;  1WI1 A;  4F7H A;  2DLW A;  5JHH A;  2Y7B A;  1ISN A;  4KHA A;  1DDM A;  3KY9 A;  2YS3 A;  3N7C A;  1PLS A;  4HAZ B;  2L1C A;  2G35 A;  1K5D B;  2EMS A;  1BTN A;  1FHW A;  1MK9 B;  3ML4 A;  4H8S A;  2AL6 A;  1TQZ A;  4B6H A;  1ZVR A;  4YON A;  2YS5 A;  4ZRK A;  3FSS A;  1ZC3 B;  1ZSQ A;  1WGU A;  4IAP A;  3D8F A;  2QKM A;  2N23 A;  1KI1 B;  1MIZ B;  1U5F A;  4PNK A;  4TYZ A;  1U5G A;  4TKN A;  3SYX A;  3TO1 A;  1XD4 A;  3U7D A;  4HHV A;  1NI2 A;  5C5B B;  1EF1 A;  5DH9 B;  1X1F A;  3AU5 A;  2AEH A;  1WJM A;  1FHO A;  3PEG A;  4F7U P;  2D4Q A;  5FI1 A;  4EJN A;  3ZVR A;  2LOX A;  5D3X A;  2K2U A;  4HAX B;  2YT1 A;  1UNP A;  1XX0 A;  2NZ8 B;  2Z0O A;  2K00 A;  1Y19 B;  3MPX A;  2KCJ A;  1N3H A;  4DBB A;  1FOE A;  2DX5 A;  2XQN M;  3HK0 A;  4HB3 B;  3FM8 C;  2W2X C;  3V5W A;  1KZ7 A;  3KRW A;  3PP2 A;  1PFJ A;  2KUP A;  4D0N B;  4K2O A;  1WJ1 A;  2QKL A;  2K2J A;  2MKR A;  3KRX A;  1EVH A;  2CY5 A;  3PVL A;  1X1G A;  2UZS A;  3FEH A;  5D27 A;  3ULC A;  1P5T A;  2V76 A;  5DI9 B;  1MPH A;  2DA0 A;  2D9X A;  1WVH A;  2Q13 A;  3KSY A;  3ODX A;  2COA A;  4WSF A;  1AQC A;  4Z2N A;  3QWM A;  5J3T A;  2PZ1 A;  3PVU A;  4HB4 B;  3ULB A;  3TVV A;  4A6K A;  1I7A A;  2H7D A;  4CHM A;  4KHO A;  2DHJ A;  3DXD A;  1DRO A;  4HAU B;  3ODO A;  2HTH B;  4GN1 A;  4HDO A;  3BIN A;  2GS0 A;  3AJ4 A;  3BJI A;  1J19 A;  3LJU X;  3PZD A;  4Y94 A;  3NSU A;  2MWN B;  2GCL A;  2UVM A;  3DXE A;  2DYN A;  2JP2 A;  3HW2 B;  1QC6 A;  2YF0 A;  4C0A A;  2J0M A;  5GOW B;  1H10 A;  2LKO A;  2DFK A;  4P7I A;  5KCV A;  1V5U A;  5FI0 A;  1NTY A;  3T06 A;  3WA0 A;  2IFS A;  3UZT A;  2VRW B;  2M38 A;  2DX1 A;  5KQ4 A;  4DXA B;  3F0W A;  2D9W A;  5HE0 A;  4GPT B;  1BTK A;  2ROZ B;  2W2W A;  4GXB A;  1NTV A;  1QQG A;  1IRS A;  1UEF A;  1NU2 A;  4A6F B;  4L6E A;  1M7R A;  4EMO A;  2I1J A;  1X86 A;  5CLQ B;  1KZG A;  2COC A;  1W1D A;  5C16 A;  2YSZ A;  2YS1 A;  2Z0Q A;  4XWX A;  1B55 A;  1GC7 A;  1FGY A;  3ODW A;  5DHA B;  1UPR A;  4NY0 A;  2ZPY A;  5KQ1 A;  1XOD A;  2DHK A;  3OAN A;  3A98 B;  5L81 A;  1ZC4 B;  5D3W A;  2CY4 A;  2YRY A;  1Y5O A;  4Z2M B;  1P6S A;  1ZM0 A;  2RUK B;  1LB1 A;  3QBV B;  1RRP B;  4IOY X;  4HB0 B;  1DDV A;  3RCP A;  2GJY A;  2GCJ A;  2Y8G A;  4GMV A;  5DHF B;  3IVF A;  2R09 A;  5J3Q A;  5JLJ B;  5HE2 A;  1XKE A;  1BWN A;  1V5P A;  2L2I A;  3AU4 A;  3GYO A;  3KZ1 A;  3VIA A;  2D9Z A;  3WYF B;  1V5M A;  2COF A;  3P6A A;  3F5R A;  1V61 A;  2I5F A;  1W1G A;  1FB8 A;  2P8V A;  1OQN A;  1FAO A;  1MIX A;  5JHG A;  3TW1 A;  2J0K A;  3P7Z A;  3TCA A;  2P0F A;  1I2H A;  4ZRI A;  4HAW B;  4K81 A;  3A8Q A;  2EC1 A;  2LG1 A;  3PG7 A;  4KAX B;  1UNR A;  2CRF A;  5D3V A;  4MY6 A;  1UPQ A;  1K5G B;  3X23 A;  3HQC A;  4NSW A;  2D11 A;  5C5B A;  1EAZ A;  2KGX B;  2ELB A;  1GG3 A;  1H4R A;  2RGN B;  1V89 A;  2DKQ A;  5HE1 A;  2RSG A; 
#chains in the Genus database with same CATH topology
 2D9Y A;  1UNQ A;  2N0Y A;  4HB2 B;  1AWE A;  1SGH A;  2P0H A;  2OTX A;  2COD A;  4CYE A;  2E2X A;  1RJ2 A;  2OQB A;  2VSZ A;  2D10 A;  4WVF B;  5C6R A;  4GMX B;  2FJL A;  4GNK B;  4KHB B;  1DBH A;  1DDW A;  3QIJ A;  1U29 A;  2CAY A;  3MDB C;  1M7E A;  2LYD A;  5HE3 A;  1U27 A;  2KR0 A;  4IFS A;  4D6W A;  2Z14 A;  3G9W A;  2DN6 A;  2Z59 A;  3TFM A;  1XR0 B;  4GZU A;  2M14 A;  2R0D A;  4BBK A;  2I5C A;  3NWF A;  3SUZ A;  2HE7 A;  4A5K A;  4QJ4 B;  1X11 A;  1MK7 B;  1WGQ A;  1XCG A;  4A6H A;  4ZRJ A;  5EFX A;  2MFQ A;  1ZYI A;  2EJ8 A;  2RLO A;  1LW3 A;  4KVG B;  4L1R A;  1W1H A;  2D9V A;  2Z0P A;  2H7E A;  4K2P A;  2ROV A;  2K8E A;  4HAY B;  5CLL B;  1PMS A;  1V88 A;  5IRS A;  3D8D A;  5LOP B;  4QJ3 B;  2DHI A;  2Z13 A;  2GUM A;  5JP4 A;  2VKI A;  2X18 A;  2W2X D;  4HAT B;  2BCJ A;  2LUL A;  3ZDT A;  4HDQ A;  2IYB A;  1GC6 A;  2Y8F A;  1Z87 A;  2RNR B;  2J0J A;  4MK0 A;  5D3Y A;  2YT0 A;  4QXA B;  1BAK A;  5LON B;  4A6F A;  2KIE A;  2DYQ A;  1U5E A;  2LOZ A;  2I1K A;  4MT7 A;  1OY2 A;  3VOQ A;  3DXC A;  2DKP A;  1P3R A;  1MAI A;  5C79 A;  1Q67 A;  4WJ7 A;  3CXB B;  3U8Z A;  3A8P A;  3CIK A;  3SV1 A;  2DTC A;  2P0D A;  4DX8 A;  2RVB B;  3D8E A;  4YL8 A;  4F7G A;  1U2B A;  5DIF B;  3SNH A;  2NMB A;  4EKU A;  1SHC A;  1E5W A;  4CHJ A;  4HAV B;  1OMW A;  2J59 M;  4DX9 0;  2MDX A;  2D2Q A;  4K17 A;  1WG7 A;  3O96 A;  4QJ5 B;  3SO6 A;  1X05 A;  2YVC A;  5I2S A;  3M1I B;  1FGZ A;  1TJ6 A;  5J3Y A;  2ELA A;  2EMT A;  1J0W A;  4PQ0 A;  1EGX A;  1FHX A;  2UZR A;  3PSC A;  1DYN A;  1TXD A;  1MKE A;  3GYP A;  1U5D A;  2ADZ A;  3PVW A;  1WI1 A;  4F7H A;  2DLW A;  5JHH A;  2Y7B A;  1ISN A;  2KIG A;  4KHA A;  1DDM A;  3KY9 A;  2YS3 A;  3N7C A;  1PLS A;  2ZKM X;  4HAZ B;  2L1C A;  2G35 A;  3HSA A;  1K5D B;  2EMS A;  1BTN A;  1FHW A;  4GOU A;  1MK9 B;  3ML4 A;  4H8S A;  2AL6 A;  1TQZ A;  4B6H A;  1ZVR A;  4YON A;  2YS5 A;  4ZRK A;  3FSS A;  1ZC3 B;  1ZSQ A;  1WGU A;  4IAP A;  3D8F A;  2QKM A;  2N23 A;  1KI1 B;  1MIZ B;  1U5F A;  4PNK A;  4TYZ A;  1U5G A;  4TKN A;  3SYX A;  3TO1 A;  1XD4 A;  3U7D A;  4HHV A;  1NI2 A;  5C5B B;  1EF1 A;  5DH9 B;  1X1F A;  3AU5 A;  2K49 A;  2AEH A;  1WJM A;  1FHO A;  3PEG A;  4F7U P;  2D4Q A;  5FI1 A;  4EJN A;  3ZVR A;  2LOX A;  5D3X A;  2K2U A;  1MI1 A;  4HAX B;  2YT1 A;  1UNP A;  1XX0 A;  2NZ8 B;  2Z0O A;  3MPX A;  1Y19 B;  2K00 A;  2KCJ A;  1N3H A;  4DBB A;  1FOE A;  2DX5 A;  4HSI A;  2XQN M;  3HK0 A;  4HB3 B;  3FM8 C;  2W2X C;  2R2Y A;  3V5W A;  1KZ7 A;  3KRW A;  3PP2 A;  1PFJ A;  2KUP A;  4D0N B;  4K2O A;  1WJ1 A;  3U12 A;  2QKL A;  3HIE A;  2K2J A;  2MKR A;  3KRX A;  1EVH A;  2CY5 A;  3PVL A;  5M4Y B;  1X1G A;  2UZS A;  3FEH A;  5D27 A;  3ULC A;  1P5T A;  2V76 A;  5DI9 B;  1MPH A;  2DA0 A;  2D9X A;  1WVH A;  2Q13 A;  3KSY A;  3ODX A;  2COA A;  3NWD A;  4WSF A;  1AQC A;  4Z2N A;  3QWM A;  5J3T A;  2PZ1 A;  3PVU A;  2RRF A;  4HB4 B;  3ULB A;  3TVV A;  4A6K A;  1I7A A;  2H7D A;  4CHM A;  4KHO A;  2DHJ A;  3DXD A;  1DRO A;  4HAU B;  3ODO A;  2HTH B;  4GN1 A;  4HDO A;  3BIN A;  2GS0 A;  3AJ4 A;  3BJI A;  1J19 A;  3LJU X;  3PZD A;  4Y94 A;  3NSU A;  2MWN B;  5I2M A;  2GCL A;  2UVM A;  3DXE A;  2DYN A;  2JP2 A;  3HW2 B;  1QC6 A;  2YF0 A;  4C0A A;  2J0M A;  5GOW B;  1H10 A;  4OSN A;  2LKO A;  2DFK A;  4P7I A;  5KCV A;  1V5U A;  5FI0 A;  1NTY A;  3T06 A;  3WA0 A;  2IFS A;  3UZT A;  2VRW B;  2M38 A;  2DX1 A;  4CSQ A;  5KQ4 A;  4DXA B;  3F0W A;  2D9W A;  5HE0 A;  4GPT B;  2FJU B;  1BTK A;  2ROZ B;  2W2W A;  4GXB A;  1NTV A;  1QQG A;  1IRS A;  1UEF A;  1NU2 A;  4A6F B;  4L6E A;  1M7R A;  4EMO A;  2I1J A;  1X86 A;  2NBV A;  3OHM B;  4OT1 A;  5CLQ B;  1KZG A;  2COC A;  1W1D A;  5C16 A;  3B77 A;  2YSZ A;  2YS1 A;  2Z0Q A;  4XWX A;  1B55 A;  1GC7 A;  1FGY A;  2YT2 A;  3ODW A;  5DHA B;  1UPR A;  4NY0 A;  2ZPY A;  5KQ1 A;  1XOD A;  3DCX A;  2DHK A;  3OAN A;  3A98 B;  5L81 A;  1ZC4 B;  5D3W A;  2CY4 A;  2YRY A;  1Y5O A;  4Z2M B;  1P6S A;  1ZM0 A;  2RUK B;  1LB1 A;  3QBV B;  1T77 A;  1RRP B;  4IOY X;  4HB0 B;  1DDV A;  3RCP A;  2GJY A;  2GCJ A;  2Y8G A;  4GMV A;  5DHF B;  3IVF A;  2R09 A;  5J3Q A;  4DIX A;  5JLJ B;  5HE2 A;  5LG4 B;  1XKE A;  2Z4D A;  1BWN A;  1V5P A;  2L2I A;  3AU4 A;  3GYO A;  3KZ1 A;  3VIA A;  2D9Z A;  3A58 A;  3WYF B;  3NWA A;  1V5M A;  2COF A;  3P6A A;  3F5R A;  1V61 A;  2I5F A;  1W1G A;  1FB8 A;  2P8V A;  1OQN A;  1FAO A;  1MIX A;  5JHG A;  3TW1 A;  2J0K A;  3P7Z A;  3TCA A;  2P0F A;  1I2H A;  4ZRI A;  4HAW B;  4K81 A;  4KHB A;  3A8Q A;  2EC1 A;  2LG1 A;  3PG7 A;  4KAX B;  1UNR A;  2KUQ A;  2CRF A;  5D3V A;  4MY6 A;  1UPQ A;  1K5G B;  3X23 A;  3HQC A;  4NSW A;  2D11 A;  5C5B A;  1EAZ A;  2KGX B;  2ELB A;  3FVC A;  3NW8 A;  1GG3 A;  1H4R A;  2RGN B;  1V89 A;  2DKQ A;  5HE1 A;  2RSG A; 
#chains in the Genus database with same CATH homology
 2D9Y A;  1UNQ A;  2N0Y A;  4HB2 B;  1AWE A;  1SGH A;  2P0H A;  2OTX A;  2COD A;  4CYE A;  2E2X A;  1RJ2 A;  2OQB A;  2VSZ A;  2D10 A;  4WVF B;  5C6R A;  4GMX B;  2FJL A;  4KHB B;  1DBH A;  1DDW A;  3QIJ A;  1U29 A;  2CAY A;  3MDB C;  1M7E A;  2LYD A;  5HE3 A;  1U27 A;  4IFS A;  3G9W A;  2DN6 A;  3TFM A;  1XR0 B;  4GZU A;  2M14 A;  2R0D A;  4BBK A;  2I5C A;  3SUZ A;  2HE7 A;  4A5K A;  1X11 A;  1MK7 B;  1WGQ A;  1XCG A;  4A6H A;  4ZRJ A;  5EFX A;  2MFQ A;  2EJ8 A;  2RLO A;  1LW3 A;  4KVG B;  1W1H A;  2D9V A;  2Z0P A;  2H7E A;  4K2P A;  2ROV A;  4HAY B;  5CLL B;  1PMS A;  1V88 A;  3D8D A;  5LOP B;  2DHI A;  5JP4 A;  2VKI A;  2X18 A;  2W2X D;  4HAT B;  2BCJ A;  2LUL A;  3ZDT A;  4HDQ A;  2IYB A;  1GC6 A;  2Y8F A;  1Z87 A;  2RNR B;  2J0J A;  4MK0 A;  5D3Y A;  2YT0 A;  1BAK A;  5LON B;  4A6F A;  2DYQ A;  1U5E A;  2LOZ A;  2I1K A;  4MT7 A;  1OY2 A;  3VOQ A;  3DXC A;  2DKP A;  1P3R A;  1MAI A;  5C79 A;  1Q67 A;  4WJ7 A;  3CXB B;  3U8Z A;  3A8P A;  3CIK A;  3SV1 A;  2DTC A;  2P0D A;  4DX8 A;  2RVB B;  3D8E A;  4YL8 A;  4F7G A;  1U2B A;  5DIF B;  3SNH A;  2NMB A;  4EKU A;  1SHC A;  1E5W A;  4CHJ A;  4HAV B;  1OMW A;  2J59 M;  4DX9 0;  2MDX A;  2D2Q A;  4K17 A;  1WG7 A;  3O96 A;  3SO6 A;  1X05 A;  2YVC A;  3M1I B;  1FGZ A;  1TJ6 A;  5J3Y A;  2ELA A;  2EMT A;  1J0W A;  4PQ0 A;  1EGX A;  1FHX A;  2UZR A;  3PSC A;  1DYN A;  1TXD A;  1MKE A;  3GYP A;  1U5D A;  2ADZ A;  3PVW A;  1WI1 A;  4F7H A;  2DLW A;  5JHH A;  2Y7B A;  1ISN A;  4KHA A;  1DDM A;  3KY9 A;  2YS3 A;  3N7C A;  1PLS A;  4HAZ B;  2L1C A;  2G35 A;  1K5D B;  2EMS A;  1BTN A;  1FHW A;  1MK9 B;  3ML4 A;  4H8S A;  2AL6 A;  1TQZ A;  4B6H A;  1ZVR A;  4YON A;  2YS5 A;  4ZRK A;  3FSS A;  1ZC3 B;  1ZSQ A;  1WGU A;  4IAP A;  3D8F A;  2QKM A;  2N23 A;  1KI1 B;  1MIZ B;  1U5F A;  4PNK A;  4TYZ A;  1U5G A;  4TKN A;  3SYX A;  3TO1 A;  1XD4 A;  3U7D A;  4HHV A;  1NI2 A;  5C5B B;  1EF1 A;  5DH9 B;  1X1F A;  3AU5 A;  2AEH A;  1WJM A;  1FHO A;  3PEG A;  4F7U P;  2D4Q A;  5FI1 A;  4EJN A;  3ZVR A;  2LOX A;  5D3X A;  2K2U A;  4HAX B;  2YT1 A;  1UNP A;  1XX0 A;  2NZ8 B;  2Z0O A;  2K00 A;  1Y19 B;  3MPX A;  2KCJ A;  1N3H A;  4DBB A;  1FOE A;  2DX5 A;  2XQN M;  3HK0 A;  4HB3 B;  3FM8 C;  2W2X C;  3V5W A;  1KZ7 A;  3KRW A;  3PP2 A;  1PFJ A;  2KUP A;  4D0N B;  4K2O A;  1WJ1 A;  2QKL A;  2K2J A;  2MKR A;  3KRX A;  1EVH A;  2CY5 A;  3PVL A;  1X1G A;  2UZS A;  3FEH A;  5D27 A;  3ULC A;  1P5T A;  2V76 A;  5DI9 B;  1MPH A;  2DA0 A;  2D9X A;  1WVH A;  2Q13 A;  3KSY A;  3ODX A;  2COA A;  4WSF A;  1AQC A;  4Z2N A;  3QWM A;  5J3T A;  2PZ1 A;  3PVU A;  4HB4 B;  3ULB A;  3TVV A;  4A6K A;  1I7A A;  2H7D A;  4CHM A;  4KHO A;  2DHJ A;  3DXD A;  1DRO A;  4HAU B;  3ODO A;  2HTH B;  4GN1 A;  4HDO A;  3BIN A;  2GS0 A;  3AJ4 A;  3BJI A;  1J19 A;  3LJU X;  3PZD A;  4Y94 A;  3NSU A;  2MWN B;  2GCL A;  2UVM A;  3DXE A;  2DYN A;  2JP2 A;  3HW2 B;  1QC6 A;  2YF0 A;  4C0A A;  2J0M A;  5GOW B;  1H10 A;  2LKO A;  2DFK A;  4P7I A;  5KCV A;  1V5U A;  5FI0 A;  1NTY A;  3T06 A;  3WA0 A;  2IFS A;  3UZT A;  2VRW B;  2M38 A;  2DX1 A;  5KQ4 A;  4DXA B;  3F0W A;  2D9W A;  5HE0 A;  4GPT B;  1BTK A;  2ROZ B;  2W2W A;  4GXB A;  1NTV A;  1QQG A;  1IRS A;  1UEF A;  1NU2 A;  4A6F B;  4L6E A;  1M7R A;  4EMO A;  2I1J A;  1X86 A;  5CLQ B;  1KZG A;  2COC A;  1W1D A;  5C16 A;  2YSZ A;  2YS1 A;  2Z0Q A;  4XWX A;  1B55 A;  1GC7 A;  1FGY A;  3ODW A;  5DHA B;  1UPR A;  4NY0 A;  2ZPY A;  5KQ1 A;  1XOD A;  2DHK A;  3OAN A;  3A98 B;  5L81 A;  1ZC4 B;  5D3W A;  2CY4 A;  2YRY A;  1Y5O A;  4Z2M B;  1P6S A;  1ZM0 A;  2RUK B;  1LB1 A;  3QBV B;  1RRP B;  4IOY X;  4HB0 B;  1DDV A;  3RCP A;  2GJY A;  2GCJ A;  2Y8G A;  4GMV A;  5DHF B;  3IVF A;  2R09 A;  5J3Q A;  5JLJ B;  5HE2 A;  1XKE A;  1BWN A;  1V5P A;  2L2I A;  3AU4 A;  3GYO A;  3KZ1 A;  3VIA A;  2D9Z A;  3WYF B;  1V5M A;  2COF A;  3P6A A;  3F5R A;  1V61 A;  2I5F A;  1W1G A;  1FB8 A;  2P8V A;  1OQN A;  1FAO A;  1MIX A;  5JHG A;  3TW1 A;  2J0K A;  3P7Z A;  3TCA A;  2P0F A;  1I2H A;  4ZRI A;  4HAW B;  4K81 A;  3A8Q A;  2EC1 A;  2LG1 A;  3PG7 A;  4KAX B;  1UNR A;  2CRF A;  5D3V A;  4MY6 A;  1UPQ A;  1K5G B;  3X23 A;  3HQC A;  4NSW A;  2D11 A;  5C5B A;  1EAZ A;  2KGX B;  2ELB A;  1GG3 A;  1H4R A;  2RGN B;  1V89 A;  2DKQ A;  5HE1 A;  2RSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...