2M14A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna binding protein
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m14A00
2Q13A 2L2IA 4ZRJA 1PFJA 4HATB 2LKOA 1MK9B 4TKNA 1MKEA 1BWNA 5CLLB 1LB1A 3KSYA 2N23A 1FGYA 1V5UA 4GXBA 1X11A 3WYFB 1DDWA 2HTHB 4A5KA 4HAVB 4EKUA 2DYQA 3ML4A 3X23A 3D8FA 2DFKA 3SO6A 4DX90 3QIJA 1UNQA 1NTVA 1EF1A 3NSUA 3ULCA 1ZC3B 4WJ7A 4F7GA 1WGUA 1PMSA 2Y8FA 4Z2MB 3PZDA 4KAXB 2COCA 3SUZA 5CLQB 2X18A 3ODOA 2LYDA 4MY6A 2K00A 1WVHA 1LW3A 2M14A 2Y7BA 3TFMA 4TYZA 1U27A 3A8QA 4KHBB 2M38A 2XQNM 1QC6A 5KQ1A 3MDBC 3TCAA 3M1IB 2D9WA 4HB4B 3HW2B 3G9WA 4B6HA 2DN6A 2D9XA 5DH9B 4HAZB 5C79A 1KZ7A 1DDVA 2J0MA 1J0WA 2ZPYA 4DBBA 2DYNA 1GC7A 2CY4A 5D3XA 2JP2A 3P7ZA 2D9ZA 2R0DA 2UZSA 4Z2NA 2NMBA 4ZRKA 1H4RA 5C5BA 4NY0A 5D3WA 1MAIA 5HE0A 2CY5A 2EJ8A 3HK0A 4C0AA 4MK0A 3TO1A 5J3YA 1I7AA 1BTKA 1ZC4B 3PEGA 1UPRA 4A6FB 4KHOA 1KZGA 3GYPA 1RJ2A 3F0WA 2ADZA 2QKLA 3QBVB 1XCGA 1Y19B 5KCVA 2W2XC 3AU5A 3V5WA 5JLJB 3QWMA 2D10A 2DKPA 4K2OA 5FI1A 2KUPA 5C5BB 3VIAA 2QKMA 1V61A 3IVFA 1U5EA 3N7CA 4MT7A 2MDXA 2ROVA 4KVGB 2DHJA 4HAXB 1V88A 1UPQA 3ULBA 5GOWB 2HE7A 2AL6A 1GC6A 1M7EA 3UZTA 3D8EA 1MK7B 1FOEA 3PVUA 4DX8A 3ZDTA 4HAYB 1E5WA 3AU4A 2YS5A 3ODXA 2Z0PA 1MIZB 4PNKA 3SNHA 2YSZA 2Z0OA 2MKRA 1DROA 2I5CA 1M7RA 3U8ZA 3KY9A 1ZM0A 1V5MA 1N3HA 3LJUX 2DX1A 4HB2B 1IRSA 5FI0A 2R09A 4Y94A 2RUKB 1TJ6A 3MPXA 2P0DA 2FJLA 2VSZA 3WA0A 1U2BA 1WJ1A 4D0NB 4XWXA 1ISNA 2DTCA 2BCJA 5DHAB 3CIKA 2G35A 1EAZA 1V5PA 2J0KA 2LOZA 5DIFB 1UNPA 4GPTB 2KGXB 2E2XA 2YF0A 3U7DA 5D27A 1FAOA 5EFXA 1ZVRA 2P8VA 3GYOA 5JP4A 2D2QA 1FHOA 3TW1A 3AJ4A 5L81A 2H7DA 5D3YA 4GN1A 1SGHA 2H7EA 3DXEA 3SYXA 2N0YA 3ODWA 1BAKA 2IYBA 1KI1B 2OTXA 2GCLA 4K17A 5JHGA 1XODA 3PP2A 2I5FA 4K81A 5DI9B 1FGZA 1UNRA 1Y5OA 1TXDA 1EGXA 4DXAB 1X05A 1EVHA 2W2XD 3FEHA 1FB8A 2CODA 1FHXA 1K5DB 4GMVA 2LG1A 1GG3A 1J19A 2K2UA 3HQCA 3SV1A 2DKQA 1DDMA 2GS0A 1NI2A 1NU2A 2YS1A 1Z87A 4HB3B 3P6AA 5C16A 1XKEA 1MPHA 2RGNB 3FSSA 2VKIA 3OANA 4F7UP 3T06A 3PVWA 4ZRIA 2L1CA 2D9YA 4L6EA 4IFSA 2P0HA 1WI1A 3KZ1A 1U5FA 4H8SA 4A6HA 2J59M 5LONB 3BJIA 2YT1A 3FM8C 3ZVRA 2Y8GA 3PVLA 2D9VA 1W1GA 2MFQA 2D4QA 2COAA 1U5GA 3O96A 4CHJA 2YRYA 1P5TA 4CYEA 3PSCA 2RVBB 4NSWA 2VRWB 3KRXA 4KHAA 2LULA 2GJYA 2W2WA 1PLSA 3VOQA 2EMTA 1P6SA 1WJMA 2ROZB 5HE1A 4F7HA 2RSGA 1SHCA 1Q67A 3A8PA 1OY2A 2DHKA 2CAYA 2Z0QA 2DX5A 4BBKA 2UZRA 4EJNA 1K5GB 5DHFB 4EMOA 1AQCA 3D8DA 2UVMA 1BTNA 4IAPA 2COFA 2J0JA 1P3RA 5J3QA 4GMXB 5LOPB 1X86A 1W1DA 2K2JA 3CXBB 2DA0A 3DXDA 3KRWA 2YVCA 1X1GA 1XX0A 4IOYX 1W1HA 2CRFA 4K2PA 4HHVA 2MWNB 1MIXA 4P7IA 3TVVA 5C6RA 2KCJA 2ELAA 2D11A 2YT0A 2EC1A 1XD4A 2I1KA 2P0FA 1H10A 2DHIA 2ELBA 2GCJA 4CHMA 1FHWA 1OMWA 4A6FA 2V76A 1WGQA 3A98B 4HB0B 3RCPA 2OQBA 3PG7A 5JHHA 2I1JA 1U29A 1OQNA 2YS3A 1DYNA 1NTYA 1ZSQA 1B55A 4GZUA 3DXCA 5D3VA 1UEFA 4WSFA 4YONA 4YL8A 4A6KA 1DBHA 2EMSA 2NZ8B 2RLOA 1QQGA 5KQ4A 1X1FA 1XR0B 4HAWB 2LOXA 1AWEA 1TQZA 1WG7A 5J3TA 5HE2A 4WVFB 4HDOA 3BINA 3F5RA 5HE3A 1RRPB 4HDQA 1V89A 2DLWA 4HAUB 4PQ0A 2RNRB 2AEHA 1U5DA 2IFSA 1I2HA 2PZ1A
chains in the Genus database with same CATH superfamily
2Q13A 2L2IA 4ZRJA 1PFJA 2FJUB 4HATB 2LKOA 1MK9B 4TKNA 1MKEA 1BWNA 5CLLB 1LB1A 3KSYA 2N23A 1FGYA 1V5UA 4GXBA 1X11A 3WYFB 1DDWA 2HTHB 4A5KA 4HAVB 4EKUA 2DYQA 3ML4A 3X23A 3D8FA 2DFKA 3SO6A 4DX90 2KR0A 3QIJA 3OHMB 2GUMA 1UNQA 1NTVA 1EF1A 3NSUA 3ULCA 1ZC3B 4WJ7A 4F7GA 1WGUA 1PMSA 2Y8FA 4Z2MB 3PZDA 4KAXB 2COCA 3SUZA 5CLQB 2X18A 3ODOA 2LYDA 4MY6A 2K00A 1WVHA 1LW3A 2M14A 2Y7BA 3TFMA 3HSAA 3FVCA 4TYZA 1U27A 3A8QA 4KHBB 2M38A 2XQNM 1QC6A 5KQ1A 3MDBC 3TCAA 3M1IB 4HSIA 2D9WA 4HB4B 3HW2B 3G9WA 4B6HA 2DN6A 2D9XA 5DH9B 4HAZB 5C79A 1KZ7A 1DDVA 2J0MA 1J0WA 2ZPYA 4DBBA 2DYNA 4QJ3B 1GC7A 4GNKB 2CY4A 5D3XA 2JP2A 3P7ZA 2D9ZA 2R0DA 2UZSA 4Z2NA 2NMBA 2KUQA 4ZRKA 1H4RA 5C5BA 4NY0A 5D3WA 1MAIA 5HE0A 2CY5A 2Z14A 2EJ8A 3HK0A 4C0AA 4MK0A 3TO1A 5J3YA 1I7AA 1BTKA 1ZC4B 3PEGA 1UPRA 4A6FB 4KHOA 1KZGA 3GYPA 1RJ2A 3F0WA 2ADZA 2QKLA 5M4YB 3QBVB 1XCGA 1Y19B 5KCVA 2W2XC 3AU5A 3V5WA 5JLJB 3QWMA 2D10A 2DKPA 4K2OA 5FI1A 2KUPA 5C5BB 3VIAA 4DIXA 2QKMA 1V61A 3IVFA 1U5EA 3N7CA 4MT7A 2MDXA 2ROVA 4KVGB 5I2SA 2DHJA 4HAXB 1V88A 1UPQA 3ULBA 5GOWB 2HE7A 2AL6A 1GC6A 1M7EA 3UZTA 3D8EA 1MK7B 1FOEA 3PVUA 4DX8A 4QJ4B 1T77A 3ZDTA 4HAYB 1E5WA 3AU4A 2YS5A 3ODXA 2Z0PA 1MIZB 4PNKA 3SNHA 2YSZA 2Z0OA 2MKRA 1DROA 2I5CA 1M7RA 3U8ZA 3KY9A 1ZM0A 1V5MA 1N3HA 3LJUX 2DX1A 4HB2B 1IRSA 5FI0A 2R09A 4Y94A 3B77A 2RUKB 4OSNA 1TJ6A 3MPXA 2P0DA 2FJLA 2VSZA 3WA0A 1U2BA 1ZYIA 1WJ1A 4D0NB 2KIGA 4XWXA 2RRFA 5I2MA 1ISNA 2DTCA 2BCJA 5DHAB 2Z13A 4OT1A 3CIKA 2G35A 1EAZA 1V5PA 2J0KA 2K8EA 1MI1A 2LOZA 5DIFB 1UNPA 4GPTB 2KGXB 2E2XA 2YF0A 3U7DA 5D27A 1FAOA 5EFXA 1ZVRA 2P8VA 3GYOA 5JP4A 2D2QA 1FHOA 2R2YA 3TW1A 3AJ4A 5L81A 2K49A 2H7DA 5D3YA 4GN1A 1SGHA 2H7EA 3DXEA 3SYXA 2N0YA 3ODWA 1BAKA 2IYBA 1KI1B 2OTXA 2GCLA 4K17A 5JHGA 1XODA 3PP2A 2I5FA 4K81A 5DI9B 1FGZA 1UNRA 4CSQA 1Y5OA 1TXDA 1EGXA 4DXAB 3A58A 1X05A 3FEHA 1EVHA 2W2XD 2Z59A 1FB8A 2CODA 1FHXA 1K5DB 4GMVA 2LG1A 1GG3A 1J19A 2K2UA 3HQCA 3SV1A 2DKQA 1DDMA 2GS0A 1NI2A 1NU2A 2YS1A 1Z87A 4HB3B 2ZKMX 3P6AA 5C16A 1XKEA 1MPHA 2RGNB 3FSSA 2VKIA 3OANA 4F7UP 4L1RA 3T06A 3PVWA 4ZRIA 2L1CA 2D9YA 4L6EA 4IFSA 2P0HA 1WI1A 3KZ1A 1U5FA 4H8SA 4A6HA 2J59M 5LONB 3BJIA 2YT1A 3FM8C 3ZVRA 2Y8GA 3PVLA 2D9VA 1W1GA 2MFQA 2D4QA 2COAA 1U5GA 3O96A 4CHJA 2YRYA 1P5TA 4CYEA 3PSCA 2RVBB 3NWDA 4NSWA 2VRWB 2YT2A 3NW8A 3KRXA 4KHAA 2LULA 2GJYA 2W2WA 1PLSA 4D6WA 3VOQA 2EMTA 4KHBA 1P6SA 1WJMA 2ROZB 5HE1A 4F7HA 2RSGA 1SHCA 1Q67A 3A8PA 1OY2A 2DHKA 2CAYA 2Z0QA 2DX5A 4BBKA 2UZRA 4EJNA 1K5GB 5DHFB 4EMOA 1AQCA 3D8DA 2UVMA 1BTNA 4IAPA 2COFA 2J0JA 1P3RA 5J3QA 4GMXB 5LOPB 1X86A 1W1DA 2Z4DA 2K2JA 3CXBB 2DA0A 3DXDA 3KRWA 2YVCA 1X1GA 4QXAB 3HIEA 1XX0A 4IOYX 1W1HA 2CRFA 4K2PA 4HHVA 2MWNB 1MIXA 4P7IA 3TVVA 5C6RA 2KCJA 2ELAA 2D11A 2YT0A 5IRSA 2P0FA 1XD4A 2EC1A 2I1KA 2NBVA 1H10A 2DHIA 2ELBA 2GCJA 4CHMA 1FHWA 4GOUA 1OMWA 4A6FA 3NWFA 2V76A 1WGQA 3A98B 4HB0B 3RCPA 5LG4B 2OQBA 3PG7A 3DCXA 2KIEA 5JHHA 2I1JA 1U29A 1OQNA 2YS3A 1DYNA 1NTYA 1ZSQA 1B55A 4GZUA 3DXCA 5D3VA 1UEFA 4WSFA 4YONA 4YL8A 4A6KA 1DBHA 2EMSA 2NZ8B 2RLOA 1QQGA 5KQ4A 1X1FA 1XR0B 4HAWB 2LOXA 1AWEA 1TQZA 4QJ5B 1WG7A 5J3TA 5HE2A 4WVFB 4HDOA 3BINA 3F5RA 3NWAA 5HE3A 1RRPB 4HDQA 1V89A 2DLWA 4HAUB 4PQ0A 2RNRB 2AEHA 1U5DA 2IFSA 3U12A 1I2HA 2PZ1A
chains in the Genus database with same CATH topology
2Q13A 2L2IA 4ZRJA 1PFJA 4HATB 2LKOA 1MK9B 4TKNA 1MKEA 1BWNA 5CLLB 1LB1A 3KSYA 2N23A 1FGYA 1V5UA 4GXBA 1X11A 3WYFB 1DDWA 2HTHB 4A5KA 4HAVB 4EKUA 2DYQA 3ML4A 3X23A 3D8FA 2DFKA 3SO6A 4DX90 3QIJA 1UNQA 1NTVA 1EF1A 3NSUA 3ULCA 1ZC3B 4WJ7A 4F7GA 1WGUA 1PMSA 2Y8FA 4Z2MB 3PZDA 4KAXB 2COCA 3SUZA 5CLQB 2X18A 3ODOA 2LYDA 4MY6A 2K00A 1WVHA 1LW3A 2M14A 2Y7BA 3TFMA 4TYZA 1U27A 3A8QA 4KHBB 2M38A 2XQNM 1QC6A 5KQ1A 3MDBC 3TCAA 3M1IB 2D9WA 4HB4B 3HW2B 3G9WA 4B6HA 2DN6A 2D9XA 5DH9B 4HAZB 5C79A 1KZ7A 1DDVA 2J0MA 1J0WA 2ZPYA 4DBBA 2DYNA 1GC7A 2CY4A 5D3XA 2JP2A 3P7ZA 2D9ZA 2R0DA 2UZSA 4Z2NA 2NMBA 4ZRKA 1H4RA 5C5BA 4NY0A 5D3WA 1MAIA 5HE0A 2CY5A 2EJ8A 3HK0A 4C0AA 4MK0A 3TO1A 5J3YA 1I7AA 1BTKA 1ZC4B 3PEGA 1UPRA 4A6FB 4KHOA 1KZGA 3GYPA 1RJ2A 3F0WA 2ADZA 2QKLA 3QBVB 1XCGA 1Y19B 5KCVA 2W2XC 3AU5A 3V5WA 5JLJB 3QWMA 2D10A 2DKPA 4K2OA 5FI1A 2KUPA 5C5BB 3VIAA 2QKMA 1V61A 3IVFA 1U5EA 3N7CA 4MT7A 2MDXA 2ROVA 4KVGB 2DHJA 4HAXB 1V88A 1UPQA 3ULBA 5GOWB 2HE7A 2AL6A 1GC6A 1M7EA 3UZTA 3D8EA 1MK7B 1FOEA 3PVUA 4DX8A 3ZDTA 4HAYB 1E5WA 3AU4A 2YS5A 3ODXA 2Z0PA 1MIZB 4PNKA 3SNHA 2YSZA 2Z0OA 2MKRA 1DROA 2I5CA 1M7RA 3U8ZA 3KY9A 1ZM0A 1V5MA 1N3HA 3LJUX 2DX1A 4HB2B 1IRSA 5FI0A 2R09A 4Y94A 2RUKB 1TJ6A 3MPXA 2P0DA 2FJLA 2VSZA 3WA0A 1U2BA 1WJ1A 4D0NB 4XWXA 1ISNA 2DTCA 2BCJA 5DHAB 3CIKA 2G35A 1EAZA 1V5PA 2J0KA 2LOZA 5DIFB 1UNPA 4GPTB 2KGXB 2E2XA 2YF0A 3U7DA 5D27A 1FAOA 5EFXA 1ZVRA 2P8VA 3GYOA 5JP4A 2D2QA 1FHOA 3TW1A 3AJ4A 5L81A 2H7DA 5D3YA 4GN1A 1SGHA 2H7EA 3DXEA 3SYXA 2N0YA 3ODWA 1BAKA 2IYBA 1KI1B 2OTXA 2GCLA 4K17A 5JHGA 1XODA 3PP2A 2I5FA 4K81A 5DI9B 1FGZA 1UNRA 1Y5OA 1TXDA 1EGXA 4DXAB 1X05A 1EVHA 2W2XD 3FEHA 1FB8A 2CODA 1FHXA 1K5DB 4GMVA 2LG1A 1GG3A 1J19A 2K2UA 3HQCA 3SV1A 2DKQA 1DDMA 2GS0A 1NI2A 1NU2A 2YS1A 1Z87A 4HB3B 3P6AA 5C16A 1XKEA 1MPHA 2RGNB 3FSSA 2VKIA 3OANA 4F7UP 3T06A 3PVWA 4ZRIA 2L1CA 2D9YA 4L6EA 4IFSA 2P0HA 1WI1A 3KZ1A 1U5FA 4H8SA 4A6HA 2J59M 5LONB 3BJIA 2YT1A 3FM8C 3ZVRA 2Y8GA 3PVLA 2D9VA 1W1GA 2MFQA 2D4QA 2COAA 1U5GA 3O96A 4CHJA 2YRYA 1P5TA 4CYEA 3PSCA 2RVBB 4NSWA 2VRWB 3KRXA 4KHAA 2LULA 2GJYA 2W2WA 1PLSA 3VOQA 2EMTA 1P6SA 1WJMA 2ROZB 5HE1A 4F7HA 2RSGA 1SHCA 1Q67A 3A8PA 1OY2A 2DHKA 2CAYA 2Z0QA 2DX5A 4BBKA 2UZRA 4EJNA 1K5GB 5DHFB 4EMOA 1AQCA 3D8DA 2UVMA 1BTNA 4IAPA 2COFA 2J0JA 1P3RA 5J3QA 4GMXB 5LOPB 1X86A 1W1DA 2K2JA 3CXBB 2DA0A 3DXDA 3KRWA 2YVCA 1X1GA 1XX0A 4IOYX 1W1HA 2CRFA 4K2PA 4HHVA 2MWNB 1MIXA 4P7IA 3TVVA 5C6RA 2KCJA 2ELAA 2D11A 2YT0A 2EC1A 1XD4A 2I1KA 2P0FA 1H10A 2DHIA 2ELBA 2GCJA 4CHMA 1FHWA 1OMWA 4A6FA 2V76A 1WGQA 3A98B 4HB0B 3RCPA 2OQBA 3PG7A 5JHHA 2I1JA 1U29A 1OQNA 2YS3A 1DYNA 1NTYA 1ZSQA 1B55A 4GZUA 3DXCA 5D3VA 1UEFA 4WSFA 4YONA 4YL8A 4A6KA 1DBHA 2EMSA 2NZ8B 2RLOA 1QQGA 5KQ4A 1X1FA 1XR0B 4HAWB 2LOXA 1AWEA 1TQZA 1WG7A 5J3TA 5HE2A 4WVFB 4HDOA 3BINA 3F5RA 5HE3A 1RRPB 4HDQA 1V89A 2DLWA 4HAUB 4PQ0A 2RNRB 2AEHA 1U5DA 2IFSA 1I2HA 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q13 A;  2L2I A;  4ZRJ A;  1PFJ A;  4HAT B;  2LKO A;  1MK9 B;  4TKN A;  1MKE A;  1BWN A;  5CLL B;  1LB1 A;  3KSY A;  2N23 A;  1FGY A;  1V5U A;  4GXB A;  1X11 A;  3WYF B;  1DDW A;  2HTH B;  4A5K A;  4HAV B;  4EKU A;  2DYQ A;  3ML4 A;  3X23 A;  3D8F A;  2DFK A;  3SO6 A;  4DX9 0;  3QIJ A;  1UNQ A;  1NTV A;  1EF1 A;  3NSU A;  3ULC A;  1ZC3 B;  4WJ7 A;  4F7G A;  1WGU A;  1PMS A;  2Y8F A;  4Z2M B;  3PZD A;  4KAX B;  2COC A;  3SUZ A;  5CLQ B;  2X18 A;  3ODO A;  2LYD A;  4MY6 A;  2K00 A;  1WVH A;  1LW3 A;  2M14 A;  2Y7B A;  3TFM A;  4TYZ A;  1U27 A;  3A8Q A;  4KHB B;  2M38 A;  2XQN M;  1QC6 A;  5KQ1 A;  3MDB C;  3TCA A;  3M1I B;  2D9W A;  4HB4 B;  3HW2 B;  3G9W A;  4B6H A;  2DN6 A;  2D9X A;  5DH9 B;  4HAZ B;  5C79 A;  1KZ7 A;  1DDV A;  2J0M A;  1J0W A;  2ZPY A;  4DBB A;  2DYN A;  1GC7 A;  2CY4 A;  5D3X A;  2JP2 A;  3P7Z A;  2D9Z A;  2R0D A;  2UZS A;  4Z2N A;  2NMB A;  4ZRK A;  1H4R A;  5C5B A;  4NY0 A;  5D3W A;  1MAI A;  5HE0 A;  2CY5 A;  2EJ8 A;  3HK0 A;  4C0A A;  4MK0 A;  3TO1 A;  5J3Y A;  1I7A A;  1BTK A;  1ZC4 B;  3PEG A;  1UPR A;  4A6F B;  4KHO A;  1KZG A;  3GYP A;  1RJ2 A;  3F0W A;  2ADZ A;  2QKL A;  3QBV B;  1XCG A;  1Y19 B;  5KCV A;  2W2X C;  3AU5 A;  3V5W A;  5JLJ B;  3QWM A;  2D10 A;  2DKP A;  4K2O A;  5FI1 A;  2KUP A;  5C5B B;  3VIA A;  2QKM A;  1V61 A;  3IVF A;  1U5E A;  3N7C A;  4MT7 A;  2MDX A;  2ROV A;  4KVG B;  2DHJ A;  4HAX B;  1V88 A;  1UPQ A;  3ULB A;  5GOW B;  2HE7 A;  2AL6 A;  1GC6 A;  1M7E A;  3UZT A;  3D8E A;  1MK7 B;  1FOE A;  3PVU A;  4DX8 A;  3ZDT A;  4HAY B;  1E5W A;  3AU4 A;  2YS5 A;  3ODX A;  2Z0P A;  1MIZ B;  4PNK A;  3SNH A;  2YSZ A;  2Z0O A;  2MKR A;  1DRO A;  2I5C A;  1M7R A;  3U8Z A;  3KY9 A;  1ZM0 A;  1V5M A;  1N3H A;  3LJU X;  2DX1 A;  4HB2 B;  1IRS A;  5FI0 A;  2R09 A;  4Y94 A;  2RUK B;  1TJ6 A;  3MPX A;  2P0D A;  2FJL A;  2VSZ A;  3WA0 A;  1U2B A;  1WJ1 A;  4D0N B;  4XWX A;  1ISN A;  2DTC A;  2BCJ A;  5DHA B;  3CIK A;  2G35 A;  1EAZ A;  1V5P A;  2J0K A;  2LOZ A;  5DIF B;  1UNP A;  4GPT B;  2KGX B;  2E2X A;  2YF0 A;  3U7D A;  5D27 A;  1FAO A;  5EFX A;  1ZVR A;  2P8V A;  3GYO A;  5JP4 A;  2D2Q A;  1FHO A;  3TW1 A;  3AJ4 A;  5L81 A;  2H7D A;  5D3Y A;  4GN1 A;  1SGH A;  2H7E A;  3DXE A;  3SYX A;  2N0Y A;  3ODW A;  1BAK A;  2IYB A;  1KI1 B;  2OTX A;  2GCL A;  4K17 A;  5JHG A;  1XOD A;  3PP2 A;  2I5F A;  4K81 A;  5DI9 B;  1FGZ A;  1UNR A;  1Y5O A;  1TXD A;  1EGX A;  4DXA B;  1X05 A;  1EVH A;  2W2X D;  3FEH A;  1FB8 A;  2COD A;  1FHX A;  1K5D B;  4GMV A;  2LG1 A;  1GG3 A;  1J19 A;  2K2U A;  3HQC A;  3SV1 A;  2DKQ A;  1DDM A;  2GS0 A;  1NI2 A;  1NU2 A;  2YS1 A;  1Z87 A;  4HB3 B;  3P6A A;  5C16 A;  1XKE A;  1MPH A;  2RGN B;  3FSS A;  2VKI A;  3OAN A;  4F7U P;  3T06 A;  3PVW A;  4ZRI A;  2L1C A;  2D9Y A;  4L6E A;  4IFS A;  2P0H A;  1WI1 A;  3KZ1 A;  1U5F A;  4H8S A;  4A6H A;  2J59 M;  5LON B;  3BJI A;  2YT1 A;  3FM8 C;  3ZVR A;  2Y8G A;  3PVL A;  2D9V A;  1W1G A;  2MFQ A;  2D4Q A;  2COA A;  1U5G A;  3O96 A;  4CHJ A;  2YRY A;  1P5T A;  4CYE A;  3PSC A;  2RVB B;  4NSW A;  2VRW B;  3KRX A;  4KHA A;  2LUL A;  2GJY A;  2W2W A;  1PLS A;  3VOQ A;  2EMT A;  1P6S A;  1WJM A;  2ROZ B;  5HE1 A;  4F7H A;  2RSG A;  1SHC A;  1Q67 A;  3A8P A;  1OY2 A;  2DHK A;  2CAY A;  2Z0Q A;  2DX5 A;  4BBK A;  2UZR A;  4EJN A;  1K5G B;  5DHF B;  4EMO A;  1AQC A;  3D8D A;  2UVM A;  1BTN A;  4IAP A;  2COF A;  2J0J A;  1P3R A;  5J3Q A;  4GMX B;  5LOP B;  1X86 A;  1W1D A;  2K2J A;  3CXB B;  2DA0 A;  3DXD A;  3KRW A;  2YVC A;  1X1G A;  1XX0 A;  4IOY X;  1W1H A;  2CRF A;  4K2P A;  4HHV A;  2MWN B;  1MIX A;  4P7I A;  3TVV A;  5C6R A;  2KCJ A;  2ELA A;  2D11 A;  2YT0 A;  2EC1 A;  1XD4 A;  2I1K A;  2P0F A;  1H10 A;  2DHI A;  2ELB A;  2GCJ A;  4CHM A;  1FHW A;  1OMW A;  4A6F A;  2V76 A;  1WGQ A;  3A98 B;  4HB0 B;  3RCP A;  2OQB A;  3PG7 A;  5JHH A;  2I1J A;  1U29 A;  1OQN A;  2YS3 A;  1DYN A;  1NTY A;  1ZSQ A;  1B55 A;  4GZU A;  3DXC A;  5D3V A;  1UEF A;  4WSF A;  4YON A;  4YL8 A;  4A6K A;  1DBH A;  2EMS A;  2NZ8 B;  2RLO A;  1QQG A;  5KQ4 A;  1X1F A;  1XR0 B;  4HAW B;  2LOX A;  1AWE A;  1TQZ A;  1WG7 A;  5J3T A;  5HE2 A;  4WVF B;  4HDO A;  3BIN A;  3F5R A;  5HE3 A;  1RRP B;  4HDQ A;  1V89 A;  2DLW A;  4HAU B;  4PQ0 A;  2RNR B;  2AEH A;  1U5D A;  2IFS A;  1I2H A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 2Q13 A;  2L2I A;  4ZRJ A;  1PFJ A;  2FJU B;  4HAT B;  2LKO A;  1MK9 B;  4TKN A;  1MKE A;  1BWN A;  5CLL B;  1LB1 A;  3KSY A;  2N23 A;  1FGY A;  1V5U A;  4GXB A;  1X11 A;  3WYF B;  1DDW A;  2HTH B;  4A5K A;  4HAV B;  4EKU A;  2DYQ A;  3ML4 A;  3X23 A;  3D8F A;  2DFK A;  3SO6 A;  4DX9 0;  2KR0 A;  3QIJ A;  3OHM B;  2GUM A;  1UNQ A;  1NTV A;  1EF1 A;  3NSU A;  3ULC A;  1ZC3 B;  4WJ7 A;  4F7G A;  1WGU A;  1PMS A;  2Y8F A;  4Z2M B;  3PZD A;  4KAX B;  2COC A;  3SUZ A;  5CLQ B;  2X18 A;  3ODO A;  2LYD A;  4MY6 A;  2K00 A;  1WVH A;  1LW3 A;  2M14 A;  2Y7B A;  3TFM A;  3HSA A;  3FVC A;  4TYZ A;  1U27 A;  3A8Q A;  4KHB B;  2M38 A;  2XQN M;  1QC6 A;  5KQ1 A;  3MDB C;  3TCA A;  3M1I B;  4HSI A;  2D9W A;  4HB4 B;  3HW2 B;  3G9W A;  4B6H A;  2DN6 A;  2D9X A;  5DH9 B;  4HAZ B;  5C79 A;  1KZ7 A;  1DDV A;  2J0M A;  1J0W A;  2ZPY A;  4DBB A;  2DYN A;  4QJ3 B;  1GC7 A;  4GNK B;  2CY4 A;  5D3X A;  2JP2 A;  3P7Z A;  2D9Z A;  2R0D A;  2UZS A;  4Z2N A;  2NMB A;  2KUQ A;  4ZRK A;  1H4R A;  5C5B A;  4NY0 A;  5D3W A;  1MAI A;  5HE0 A;  2CY5 A;  2Z14 A;  2EJ8 A;  3HK0 A;  4C0A A;  4MK0 A;  3TO1 A;  5J3Y A;  1I7A A;  1BTK A;  1ZC4 B;  3PEG A;  1UPR A;  4A6F B;  4KHO A;  1KZG A;  3GYP A;  1RJ2 A;  3F0W A;  2ADZ A;  2QKL A;  5M4Y B;  3QBV B;  1XCG A;  1Y19 B;  5KCV A;  2W2X C;  3AU5 A;  3V5W A;  5JLJ B;  3QWM A;  2D10 A;  2DKP A;  4K2O A;  5FI1 A;  2KUP A;  5C5B B;  3VIA A;  4DIX A;  2QKM A;  1V61 A;  3IVF A;  1U5E A;  3N7C A;  4MT7 A;  2MDX A;  2ROV A;  4KVG B;  5I2S A;  2DHJ A;  4HAX B;  1V88 A;  1UPQ A;  3ULB A;  5GOW B;  2HE7 A;  2AL6 A;  1GC6 A;  1M7E A;  3UZT A;  3D8E A;  1MK7 B;  1FOE A;  3PVU A;  4DX8 A;  4QJ4 B;  1T77 A;  3ZDT A;  4HAY B;  1E5W A;  3AU4 A;  2YS5 A;  3ODX A;  2Z0P A;  1MIZ B;  4PNK A;  3SNH A;  2YSZ A;  2Z0O A;  2MKR A;  1DRO A;  2I5C A;  1M7R A;  3U8Z A;  3KY9 A;  1ZM0 A;  1V5M A;  1N3H A;  3LJU X;  2DX1 A;  4HB2 B;  1IRS A;  5FI0 A;  2R09 A;  4Y94 A;  3B77 A;  2RUK B;  4OSN A;  1TJ6 A;  3MPX A;  2P0D A;  2FJL A;  2VSZ A;  3WA0 A;  1U2B A;  1ZYI A;  1WJ1 A;  4D0N B;  2KIG A;  4XWX A;  2RRF A;  5I2M A;  1ISN A;  2DTC A;  2BCJ A;  5DHA B;  2Z13 A;  4OT1 A;  3CIK A;  2G35 A;  1EAZ A;  1V5P A;  2J0K A;  2K8E A;  1MI1 A;  2LOZ A;  5DIF B;  1UNP A;  4GPT B;  2KGX B;  2E2X A;  2YF0 A;  3U7D A;  5D27 A;  1FAO A;  5EFX A;  1ZVR A;  2P8V A;  3GYO A;  5JP4 A;  2D2Q A;  1FHO A;  2R2Y A;  3TW1 A;  3AJ4 A;  5L81 A;  2K49 A;  2H7D A;  5D3Y A;  4GN1 A;  1SGH A;  2H7E A;  3DXE A;  3SYX A;  2N0Y A;  3ODW A;  1BAK A;  2IYB A;  1KI1 B;  2OTX A;  2GCL A;  4K17 A;  5JHG A;  1XOD A;  3PP2 A;  2I5F A;  4K81 A;  5DI9 B;  1FGZ A;  1UNR A;  4CSQ A;  1Y5O A;  1TXD A;  1EGX A;  4DXA B;  3A58 A;  1X05 A;  3FEH A;  1EVH A;  2W2X D;  2Z59 A;  1FB8 A;  2COD A;  1FHX A;  1K5D B;  4GMV A;  2LG1 A;  1GG3 A;  1J19 A;  2K2U A;  3HQC A;  3SV1 A;  2DKQ A;  1DDM A;  2GS0 A;  1NI2 A;  1NU2 A;  2YS1 A;  1Z87 A;  4HB3 B;  2ZKM X;  3P6A A;  5C16 A;  1XKE A;  1MPH A;  2RGN B;  3FSS A;  2VKI A;  3OAN A;  4F7U P;  4L1R A;  3T06 A;  3PVW A;  4ZRI A;  2L1C A;  2D9Y A;  4L6E A;  4IFS A;  2P0H A;  1WI1 A;  3KZ1 A;  1U5F A;  4H8S A;  4A6H A;  2J59 M;  5LON B;  3BJI A;  2YT1 A;  3FM8 C;  3ZVR A;  2Y8G A;  3PVL A;  2D9V A;  1W1G A;  2MFQ A;  2D4Q A;  2COA A;  1U5G A;  3O96 A;  4CHJ A;  2YRY A;  1P5T A;  4CYE A;  3PSC A;  2RVB B;  3NWD A;  4NSW A;  2VRW B;  2YT2 A;  3NW8 A;  3KRX A;  4KHA A;  2LUL A;  2GJY A;  2W2W A;  1PLS A;  4D6W A;  3VOQ A;  2EMT A;  4KHB A;  1P6S A;  1WJM A;  2ROZ B;  5HE1 A;  4F7H A;  2RSG A;  1SHC A;  1Q67 A;  3A8P A;  1OY2 A;  2DHK A;  2CAY A;  2Z0Q A;  2DX5 A;  4BBK A;  2UZR A;  4EJN A;  1K5G B;  5DHF B;  4EMO A;  1AQC A;  3D8D A;  2UVM A;  1BTN A;  4IAP A;  2COF A;  2J0J A;  1P3R A;  5J3Q A;  4GMX B;  5LOP B;  1X86 A;  1W1D A;  2Z4D A;  2K2J A;  3CXB B;  2DA0 A;  3DXD A;  3KRW A;  2YVC A;  1X1G A;  4QXA B;  3HIE A;  1XX0 A;  4IOY X;  1W1H A;  2CRF A;  4K2P A;  4HHV A;  2MWN B;  1MIX A;  4P7I A;  3TVV A;  5C6R A;  2KCJ A;  2ELA A;  2D11 A;  2YT0 A;  5IRS A;  2P0F A;  1XD4 A;  2EC1 A;  2I1K A;  2NBV A;  1H10 A;  2DHI A;  2ELB A;  2GCJ A;  4CHM A;  1FHW A;  4GOU A;  1OMW A;  4A6F A;  3NWF A;  2V76 A;  1WGQ A;  3A98 B;  4HB0 B;  3RCP A;  5LG4 B;  2OQB A;  3PG7 A;  3DCX A;  2KIE A;  5JHH A;  2I1J A;  1U29 A;  1OQN A;  2YS3 A;  1DYN A;  1NTY A;  1ZSQ A;  1B55 A;  4GZU A;  3DXC A;  5D3V A;  1UEF A;  4WSF A;  4YON A;  4YL8 A;  4A6K A;  1DBH A;  2EMS A;  2NZ8 B;  2RLO A;  1QQG A;  5KQ4 A;  1X1F A;  1XR0 B;  4HAW B;  2LOX A;  1AWE A;  1TQZ A;  4QJ5 B;  1WG7 A;  5J3T A;  5HE2 A;  4WVF B;  4HDO A;  3BIN A;  3F5R A;  3NWA A;  5HE3 A;  1RRP B;  4HDQ A;  1V89 A;  2DLW A;  4HAU B;  4PQ0 A;  2RNR B;  2AEH A;  1U5D A;  2IFS A;  3U12 A;  1I2H A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 2Q13 A;  2L2I A;  4ZRJ A;  1PFJ A;  4HAT B;  2LKO A;  1MK9 B;  4TKN A;  1MKE A;  1BWN A;  5CLL B;  1LB1 A;  3KSY A;  2N23 A;  1FGY A;  1V5U A;  4GXB A;  1X11 A;  3WYF B;  1DDW A;  2HTH B;  4A5K A;  4HAV B;  4EKU A;  2DYQ A;  3ML4 A;  3X23 A;  3D8F A;  2DFK A;  3SO6 A;  4DX9 0;  3QIJ A;  1UNQ A;  1NTV A;  1EF1 A;  3NSU A;  3ULC A;  1ZC3 B;  4WJ7 A;  4F7G A;  1WGU A;  1PMS A;  2Y8F A;  4Z2M B;  3PZD A;  4KAX B;  2COC A;  3SUZ A;  5CLQ B;  2X18 A;  3ODO A;  2LYD A;  4MY6 A;  2K00 A;  1WVH A;  1LW3 A;  2M14 A;  2Y7B A;  3TFM A;  4TYZ A;  1U27 A;  3A8Q A;  4KHB B;  2M38 A;  2XQN M;  1QC6 A;  5KQ1 A;  3MDB C;  3TCA A;  3M1I B;  2D9W A;  4HB4 B;  3HW2 B;  3G9W A;  4B6H A;  2DN6 A;  2D9X A;  5DH9 B;  4HAZ B;  5C79 A;  1KZ7 A;  1DDV A;  2J0M A;  1J0W A;  2ZPY A;  4DBB A;  2DYN A;  1GC7 A;  2CY4 A;  5D3X A;  2JP2 A;  3P7Z A;  2D9Z A;  2R0D A;  2UZS A;  4Z2N A;  2NMB A;  4ZRK A;  1H4R A;  5C5B A;  4NY0 A;  5D3W A;  1MAI A;  5HE0 A;  2CY5 A;  2EJ8 A;  3HK0 A;  4C0A A;  4MK0 A;  3TO1 A;  5J3Y A;  1I7A A;  1BTK A;  1ZC4 B;  3PEG A;  1UPR A;  4A6F B;  4KHO A;  1KZG A;  3GYP A;  1RJ2 A;  3F0W A;  2ADZ A;  2QKL A;  3QBV B;  1XCG A;  1Y19 B;  5KCV A;  2W2X C;  3AU5 A;  3V5W A;  5JLJ B;  3QWM A;  2D10 A;  2DKP A;  4K2O A;  5FI1 A;  2KUP A;  5C5B B;  3VIA A;  2QKM A;  1V61 A;  3IVF A;  1U5E A;  3N7C A;  4MT7 A;  2MDX A;  2ROV A;  4KVG B;  2DHJ A;  4HAX B;  1V88 A;  1UPQ A;  3ULB A;  5GOW B;  2HE7 A;  2AL6 A;  1GC6 A;  1M7E A;  3UZT A;  3D8E A;  1MK7 B;  1FOE A;  3PVU A;  4DX8 A;  3ZDT A;  4HAY B;  1E5W A;  3AU4 A;  2YS5 A;  3ODX A;  2Z0P A;  1MIZ B;  4PNK A;  3SNH A;  2YSZ A;  2Z0O A;  2MKR A;  1DRO A;  2I5C A;  1M7R A;  3U8Z A;  3KY9 A;  1ZM0 A;  1V5M A;  1N3H A;  3LJU X;  2DX1 A;  4HB2 B;  1IRS A;  5FI0 A;  2R09 A;  4Y94 A;  2RUK B;  1TJ6 A;  3MPX A;  2P0D A;  2FJL A;  2VSZ A;  3WA0 A;  1U2B A;  1WJ1 A;  4D0N B;  4XWX A;  1ISN A;  2DTC A;  2BCJ A;  5DHA B;  3CIK A;  2G35 A;  1EAZ A;  1V5P A;  2J0K A;  2LOZ A;  5DIF B;  1UNP A;  4GPT B;  2KGX B;  2E2X A;  2YF0 A;  3U7D A;  5D27 A;  1FAO A;  5EFX A;  1ZVR A;  2P8V A;  3GYO A;  5JP4 A;  2D2Q A;  1FHO A;  3TW1 A;  3AJ4 A;  5L81 A;  2H7D A;  5D3Y A;  4GN1 A;  1SGH A;  2H7E A;  3DXE A;  3SYX A;  2N0Y A;  3ODW A;  1BAK A;  2IYB A;  1KI1 B;  2OTX A;  2GCL A;  4K17 A;  5JHG A;  1XOD A;  3PP2 A;  2I5F A;  4K81 A;  5DI9 B;  1FGZ A;  1UNR A;  1Y5O A;  1TXD A;  1EGX A;  4DXA B;  1X05 A;  1EVH A;  2W2X D;  3FEH A;  1FB8 A;  2COD A;  1FHX A;  1K5D B;  4GMV A;  2LG1 A;  1GG3 A;  1J19 A;  2K2U A;  3HQC A;  3SV1 A;  2DKQ A;  1DDM A;  2GS0 A;  1NI2 A;  1NU2 A;  2YS1 A;  1Z87 A;  4HB3 B;  3P6A A;  5C16 A;  1XKE A;  1MPH A;  2RGN B;  3FSS A;  2VKI A;  3OAN A;  4F7U P;  3T06 A;  3PVW A;  4ZRI A;  2L1C A;  2D9Y A;  4L6E A;  4IFS A;  2P0H A;  1WI1 A;  3KZ1 A;  1U5F A;  4H8S A;  4A6H A;  2J59 M;  5LON B;  3BJI A;  2YT1 A;  3FM8 C;  3ZVR A;  2Y8G A;  3PVL A;  2D9V A;  1W1G A;  2MFQ A;  2D4Q A;  2COA A;  1U5G A;  3O96 A;  4CHJ A;  2YRY A;  1P5T A;  4CYE A;  3PSC A;  2RVB B;  4NSW A;  2VRW B;  3KRX A;  4KHA A;  2LUL A;  2GJY A;  2W2W A;  1PLS A;  3VOQ A;  2EMT A;  1P6S A;  1WJM A;  2ROZ B;  5HE1 A;  4F7H A;  2RSG A;  1SHC A;  1Q67 A;  3A8P A;  1OY2 A;  2DHK A;  2CAY A;  2Z0Q A;  2DX5 A;  4BBK A;  2UZR A;  4EJN A;  1K5G B;  5DHF B;  4EMO A;  1AQC A;  3D8D A;  2UVM A;  1BTN A;  4IAP A;  2COF A;  2J0J A;  1P3R A;  5J3Q A;  4GMX B;  5LOP B;  1X86 A;  1W1D A;  2K2J A;  3CXB B;  2DA0 A;  3DXD A;  3KRW A;  2YVC A;  1X1G A;  1XX0 A;  4IOY X;  1W1H A;  2CRF A;  4K2P A;  4HHV A;  2MWN B;  1MIX A;  4P7I A;  3TVV A;  5C6R A;  2KCJ A;  2ELA A;  2D11 A;  2YT0 A;  2EC1 A;  1XD4 A;  2I1K A;  2P0F A;  1H10 A;  2DHI A;  2ELB A;  2GCJ A;  4CHM A;  1FHW A;  1OMW A;  4A6F A;  2V76 A;  1WGQ A;  3A98 B;  4HB0 B;  3RCP A;  2OQB A;  3PG7 A;  5JHH A;  2I1J A;  1U29 A;  1OQN A;  2YS3 A;  1DYN A;  1NTY A;  1ZSQ A;  1B55 A;  4GZU A;  3DXC A;  5D3V A;  1UEF A;  4WSF A;  4YON A;  4YL8 A;  4A6K A;  1DBH A;  2EMS A;  2NZ8 B;  2RLO A;  1QQG A;  5KQ4 A;  1X1F A;  1XR0 B;  4HAW B;  2LOX A;  1AWE A;  1TQZ A;  1WG7 A;  5J3T A;  5HE2 A;  4WVF B;  4HDO A;  3BIN A;  3F5R A;  5HE3 A;  1RRP B;  4HDQ A;  1V89 A;  2DLW A;  4HAU B;  4PQ0 A;  2RNR B;  2AEH A;  1U5D A;  2IFS A;  1I2H A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...