2M14A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna binding protein
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m14A00
3PZDA 2YVCA 2H7EA 4A6FA 2KCJA 1FHWA 4HAYB 3FSSA 3QIJA 3ODWA 5D3XA 2J0MA 1UPQA 1E5WA 5D3YA 5DHAB 1W1HA 4MT7A 1RRPB 5L81A 4K2PA 3HQCA 3PSCA 1FGYA 2OTXA 3D8DA 1Z87A 2J0KA 3A8PA 2Y8FA 2Z0OA 1Q67A 4KHAA 2LKOA 1I7AA 2QKLA 1U5EA 2DA0A 4NSWA 2MDXA 4GXBA 1NU2A 2D9YA 3NSUA 1K5DB 4DXAB 5C6RA 4KVGB 4B6HA 3SYXA 2J0JA 3ODXA 2W2XD 1ISNA 3FEHA 3KRWA 2MKRA 2EMSA 1V5MA 4PQ0A 2NZ8B 1K5GB 2K2UA 3ULBA 3ZDTA 5D27A 2COCA 2YSZA 3LJUX 1PFJA 3MDBC 2N23A 1NI2A 2D9ZA 4NY0A 3X23A 2Q13A 4TYZA 2I5FA 2XQNM 4IFSA 3KY9A 1N3HA 2PZ1A 4WJ7A 1BWNA 2VSZA 4GN1A 3HW2B 2Z0PA 2RUKB 1GC7A 2YS3A 2X18A 5HE3A 2G35A 2I1JA 4DX90 2RSGA 4HAUB 4HDOA 5FI1A 2DHJA 1M7EA 2YS1A 2R09A 1FAOA 1X1GA 1U5FA 2H7DA 4EKUA 3TW1A 4C0AA 5JHHA 4A6KA 1FHXA 2K2JA 3SUZA 3ULCA 1FOEA 2COAA 5JP4A 4YL8A 3KSYA 3AU5A 4Z2NA 5HE1A 3SNHA 3P6AA 2DX1A 1Y19B 1GG3A 1UPRA 2UZSA 1X11A 2P0FA 4HAZB 1M7RA 4HB3B 1IRSA 4DX8A 2RGNB 4K17A 3KRXA 4HB0B 1TQZA 2UVMA 4F7HA 2GCJA 3U8ZA 1WGQA 2N0YA 3PEGA 2R0DA 1DROA 4IAPA 2DLWA 5J3QA 4HHVA 2LOXA 2DYQA 1V5UA 1W1DA 2JP2A 4YONA 2DHIA 2M38A 1XODA 1FHOA 1P3RA 3ZVRA 3U7DA 1U5GA 1ZSQA 2L2IA 3D8EA 2IYBA 3DXDA 1WI1A 1NTVA 2I5CA 2I1KA 5C5BB 1MKEA 1XR0B 3MPXA 2OQBA 4K81A 1OY2A 3G9WA 3TVVA 4HATB 4P7IA 3AJ4A 5J3TA 1SHCA 1WGUA 3VOQA 2L1CA 2KGXB 3PVWA 1LB1A 2IFSA 1WVHA 1XX0A 1J0WA 2GJYA 1UNPA 1EVHA 2CAYA 3ML4A 2AEHA 2LG1A 1EF1A 2D9WA 4WVFB 1DDVA 2LOZA 1EGXA 1PMSA 5JLJB 4TKNA 2MWNB 2MFQA 1U5DA 1P5TA 4MK0A 3FM8C 2DTCA 1WJ1A 3CXBB 4KHBB 2E2XA 5DHFB 5HE0A 3WYFB 2Y8GA 2HE7A 2GCLA 2M14A 2DX5A 2YRYA 3V5WA 2D10A 3SO6A 2Y7BA 1DYNA 4IOYX 2HTHB 4BBKA 2D4QA 1V88A 2DKPA 2KUPA 4EMOA 1LW3A 2ELAA 1X1FA 4K2OA 2RVBB 4GPTB 1QC6A 2YF0A 4ZRKA 3DXCA 1UNQA 3PG7A 3ODOA 3VIAA 5HE2A 2D9VA 2EJ8A 4GMVA 1U27A 2RNRB 1MAIA 3TCAA 1W1GA 1BAKA 2BCJA 3UZTA 3HK0A 1KZGA 5C5BA 2EC1A 1GC6A 5KQ4A 3TO1A 2CODA 4Z2MB 3A8QA 1MPHA 1OMWA 4HB4B 2D2QA 5CLLB 5DH9B 3QBVB 2P0DA 4GZUA 3RCPA 5FI0A 4MY6A 4CHJA 2RLOA 2YT1A 1RJ2A 1U2BA 1DBHA 3F0WA 3KZ1A 4HB2B 4D0NB 4PNKA 2UZRA 3AU4A 4ZRIA 1MK9B 3BJIA 3BINA 1BTNA 2ROZB 4F7UP 2DFKA 1UNRA 2COFA 4XWXA 3WA0A 2D9XA 4EJNA 4GMXB 4HAWB 1H10A 4HAXB 2W2XC 2YT0A 1DDWA 2ELBA 1FB8A 5EFXA 4CYEA 1TJ6A 3PVLA 3PVUA 5GOWB 5C79A 1AWEA 3SV1A 1KZ7A 1J19A 4A6FB 2W2WA 1MIZB 4Y94A 3GYPA 2DKQA 2ZPYA 1U29A 1V61A 1P6SA 3O96A 4WSFA 4HDQA 2NMBA 1XCGA 4HAVB 1ZC3B 1AQCA 5D3WA 3N7CA 3GYOA 1TXDA 1MIXA 1XD4A 2LULA 4CHMA 2P0HA 4KAXB 1I2HA 2P8VA 2AL6A 4ZRJA 5JHGA 1QQGA 3D8FA 2DN6A 2DHKA 3OANA 1WG7A 3A98B 5C16A 2VKIA 2J59M 3P7ZA 3F5RA 4DBBA 1XKEA 2K00A 1H4RA 1Y5OA 3CIKA 1PLSA 1ZVRA 2V76A 3PP2A 2Z0QA 1V89A 5J3YA 1MK7B 1X86A 4A5KA 2YS5A 1ZM0A 5DI9B 2QKMA 3T06A 1NTYA 2CY4A 4KHOA 5DIFB 4H8SA 5D3VA 1X05A 5KCVA 3IVFA 3TFMA 4A6HA 5LOPB 1EAZA 1DDMA 2CY5A 2DYNA 1B55A 2ROVA 1V5PA 3M1IB 2VRWB 1OQNA 2FJLA 1ZC4B 2GS0A 3DXEA 2D11A 2CRFA 1BTKA 5LONB 1UEFA 1KI1B 4F7GA 5KQ1A 2ADZA 2EMTA 3QWMA 5CLQB 1WJMA 2LYDA 4L6EA 1FGZA 1SGHA
chains in the Genus database with same CATH superfamily
3PZDA 2YVCA 2H7EA 4CSQA 4A6FA 2KCJA 1FHWA 4HAYB 3FSSA 3QIJA 3OHMB 3ODWA 5D3XA 2J0MA 1UPQA 1E5WA 5D3YA 5DHAB 1W1HA 4MT7A 1RRPB 5L81A 4K2PA 3HQCA 3PSCA 2KIEA 1FGYA 2OTXA 2ZKMX 4QJ5B 3HSAA 3D8DA 1Z87A 2J0KA 3A8PA 2Y8FA 2Z0OA 1Q67A 4KHAA 2LKOA 1I7AA 2QKLA 1U5EA 2DA0A 4NSWA 2MDXA 4GXBA 1NU2A 2D9YA 3NSUA 1K5DB 4DXAB 5C6RA 4KVGB 4B6HA 3SYXA 2J0JA 3ODXA 2W2XD 1ISNA 3FEHA 3KRWA 2MKRA 2EMSA 1V5MA 4PQ0A 2NZ8B 1K5GB 2K2UA 3ULBA 3ZDTA 5D27A 2COCA 2YSZA 5I2MA 3LJUX 1PFJA 3MDBC 2N23A 1NI2A 2D9ZA 4NY0A 3X23A 2Q13A 4TYZA 2I5FA 2XQNM 4IFSA 3KY9A 1N3HA 2PZ1A 4WJ7A 1BWNA 2VSZA 4GN1A 3HW2B 2Z0PA 2RUKB 1GC7A 2YS3A 2X18A 3NW8A 5HE3A 2G35A 2I1JA 4DX90 2RSGA 5M4YB 4HAUB 4HDOA 5FI1A 2DHJA 1M7EA 4GNKB 2YS1A 2R09A 1FAOA 4D6WA 1X1GA 1U5FA 2H7DA 4EKUA 3TW1A 4C0AA 5JHHA 5IRSA 4A6KA 1FHXA 3NWAA 2K2JA 2Z4DA 3SUZA 3ULCA 2R2YA 1FOEA 2COAA 5JP4A 4YL8A 3KSYA 3AU5A 4Z2NA 5HE1A 3SNHA 3P6AA 2DX1A 1Y19B 1GG3A 1UPRA 2UZSA 1X11A 2P0FA 4HAZB 1M7RA 4HB3B 1IRSA 4DX8A 2RGNB 3U12A 4K17A 3KRXA 4HB0B 1TQZA 2UVMA 4F7HA 2GCJA 3U8ZA 1WGQA 2N0YA 3PEGA 2R0DA 1DROA 4IAPA 2KUQA 2DLWA 5J3QA 4HHVA 2LOXA 2DYQA 1V5UA 1W1DA 2JP2A 4YONA 2DHIA 2M38A 1XODA 1FHOA 1P3RA 3ZVRA 3U7DA 1U5GA 1ZSQA 2L2IA 3D8EA 2IYBA 3DXDA 1WI1A 1NTVA 2I5CA 2I1KA 5C5BB 1MKEA 1XR0B 3MPXA 2OQBA 4K81A 1OY2A 3G9WA 3TVVA 3NWDA 4HATB 4P7IA 3AJ4A 5J3TA 1SHCA 1WGUA 3VOQA 2L1CA 2KGXB 3PVWA 1LB1A 2IFSA 1WVHA 1XX0A 1J0WA 2GJYA 1UNPA 1EVHA 2CAYA 3ML4A 2AEHA 2LG1A 1EF1A 2D9WA 4WVFB 1DDVA 2LOZA 1EGXA 1PMSA 5JLJB 3A58A 4TKNA 2KIGA 2MWNB 5LG4B 2MFQA 1U5DA 1P5TA 4MK0A 3FM8C 2DTCA 4L1RA 1WJ1A 3CXBB 4KHBB 2E2XA 5DHFB 5HE0A 3WYFB 2Y8GA 2HE7A 2GCLA 2M14A 2DX5A 2YRYA 3V5WA 2D10A 2Z13A 2Y7BA 3SO6A 2GUMA 1DYNA 4IOYX 2HTHB 4BBKA 2D4QA 1V88A 2FJUB 2DKPA 2KUPA 4EMOA 1LW3A 2ELAA 1X1FA 4K2OA 2RVBB 4GPTB 1QC6A 2YF0A 4QXAB 4ZRKA 3DXCA 1UNQA 3PG7A 3ODOA 3VIAA 5HE2A 2D9VA 2EJ8A 4GMVA 1U27A 2RNRB 1MAIA 3TCAA 1W1GA 1BAKA 2BCJA 3UZTA 3HK0A 1KZGA 5C5BA 2EC1A 1GC6A 5KQ4A 3TO1A 3HIEA 2CODA 4Z2MB 3A8QA 1MPHA 1OMWA 4HB4B 2D2QA 5CLLB 5DH9B 3QBVB 2P0DA 4GZUA 3RCPA 5FI0A 4MY6A 4HSIA 4CHJA 2RLOA 2YT1A 1RJ2A 1U2BA 1DBHA 3F0WA 3KZ1A 4HB2B 4D0NB 2Z14A 4PNKA 2UZRA 3AU4A 4ZRIA 1MK9B 3BJIA 3BINA 1BTNA 2ROZB 4F7UP 2DFKA 1UNRA 2COFA 4XWXA 4DIXA 3WA0A 2D9XA 1T77A 1ZYIA 4GMXB 4EJNA 4HAWB 1H10A 4HAXB 2W2XC 2YT0A 1DDWA 2ELBA 1FB8A 2RRFA 5EFXA 4CYEA 1TJ6A 4KHBA 3NWFA 3PVLA 3PVUA 5GOWB 5C79A 1AWEA 3SV1A 1KZ7A 1J19A 4QJ3B 4A6FB 2W2WA 1MIZB 4Y94A 3GYPA 2DKQA 2ZPYA 1U29A 1V61A 1P6SA 3O96A 2YT2A 4WSFA 4HDQA 2KR0A 2NMBA 1XCGA 4HAVB 1ZC3B 1AQCA 5D3WA 3N7CA 3GYOA 2Z59A 1TXDA 1MIXA 1XD4A 2LULA 4CHMA 2P0HA 4KAXB 4QJ4B 1I2HA 2P8VA 2AL6A 4ZRJA 4OT1A 5JHGA 1QQGA 3D8FA 2DN6A 2DHKA 3OANA 1WG7A 4GOUA 3A98B 3DCXA 5C16A 2VKIA 2J59M 3P7ZA 3F5RA 4DBBA 1XKEA 2K00A 1H4RA 1Y5OA 3CIKA 1PLSA 5I2SA 1ZVRA 2V76A 3PP2A 2Z0QA 1V89A 5J3YA 1MK7B 1X86A 4A5KA 2YS5A 1ZM0A 3B77A 5DI9B 4OSNA 2QKMA 2K49A 3T06A 1NTYA 2CY4A 4KHOA 5DIFB 4H8SA 5D3VA 1X05A 5KCVA 3IVFA 3TFMA 2NBVA 4A6HA 5LOPB 1EAZA 1DDMA 2CY5A 2DYNA 1B55A 2ROVA 1V5PA 3M1IB 2VRWB 1OQNA 2FJLA 1ZC4B 2GS0A 3DXEA 1MI1A 2D11A 2CRFA 3FVCA 1BTKA 5LONB 1UEFA 1KI1B 4F7GA 5KQ1A 2ADZA 2EMTA 3QWMA 5CLQB 1WJMA 2K8EA 2LYDA 1FGZA 1SGHA 4L6EA
chains in the Genus database with same CATH topology
3PZDA 2YVCA 2H7EA 4A6FA 2KCJA 1FHWA 4HAYB 3FSSA 3QIJA 3ODWA 5D3XA 2J0MA 1UPQA 1E5WA 5D3YA 5DHAB 1W1HA 4MT7A 1RRPB 5L81A 4K2PA 3HQCA 3PSCA 1FGYA 2OTXA 3D8DA 1Z87A 2J0KA 3A8PA 2Y8FA 2Z0OA 1Q67A 4KHAA 2LKOA 1I7AA 2QKLA 1U5EA 2DA0A 4NSWA 2MDXA 4GXBA 1NU2A 2D9YA 3NSUA 1K5DB 4DXAB 5C6RA 4KVGB 4B6HA 3SYXA 2J0JA 3ODXA 2W2XD 1ISNA 3FEHA 3KRWA 2MKRA 2EMSA 1V5MA 4PQ0A 2NZ8B 1K5GB 2K2UA 3ULBA 3ZDTA 5D27A 2COCA 2YSZA 3LJUX 1PFJA 3MDBC 2N23A 1NI2A 2D9ZA 4NY0A 3X23A 2Q13A 4TYZA 2I5FA 2XQNM 4IFSA 3KY9A 1N3HA 2PZ1A 4WJ7A 1BWNA 2VSZA 4GN1A 3HW2B 2Z0PA 2RUKB 1GC7A 2YS3A 2X18A 5HE3A 2G35A 2I1JA 4DX90 2RSGA 4HAUB 4HDOA 5FI1A 2DHJA 1M7EA 2YS1A 2R09A 1FAOA 1X1GA 1U5FA 2H7DA 4EKUA 3TW1A 4C0AA 5JHHA 4A6KA 1FHXA 2K2JA 3SUZA 3ULCA 1FOEA 2COAA 5JP4A 4YL8A 3KSYA 3AU5A 4Z2NA 5HE1A 3SNHA 3P6AA 2DX1A 1Y19B 1GG3A 1UPRA 2UZSA 1X11A 2P0FA 4HAZB 1M7RA 4HB3B 1IRSA 4DX8A 2RGNB 4K17A 3KRXA 4HB0B 1TQZA 2UVMA 4F7HA 2GCJA 3U8ZA 1WGQA 2N0YA 3PEGA 2R0DA 1DROA 4IAPA 2DLWA 5J3QA 4HHVA 2LOXA 2DYQA 1V5UA 1W1DA 2JP2A 4YONA 2DHIA 2M38A 1XODA 1FHOA 1P3RA 3ZVRA 3U7DA 1U5GA 1ZSQA 2L2IA 3D8EA 2IYBA 3DXDA 1WI1A 1NTVA 2I5CA 2I1KA 5C5BB 1MKEA 1XR0B 3MPXA 2OQBA 4K81A 1OY2A 3G9WA 3TVVA 4HATB 4P7IA 3AJ4A 5J3TA 1SHCA 1WGUA 3VOQA 2L1CA 2KGXB 3PVWA 1LB1A 2IFSA 1WVHA 1XX0A 1J0WA 2GJYA 1UNPA 1EVHA 2CAYA 3ML4A 2AEHA 2LG1A 1EF1A 2D9WA 4WVFB 1DDVA 2LOZA 1EGXA 1PMSA 5JLJB 4TKNA 2MWNB 2MFQA 1U5DA 1P5TA 4MK0A 3FM8C 2DTCA 1WJ1A 3CXBB 4KHBB 2E2XA 5DHFB 5HE0A 3WYFB 2Y8GA 2HE7A 2GCLA 2M14A 2DX5A 2YRYA 3V5WA 2D10A 3SO6A 2Y7BA 1DYNA 4IOYX 2HTHB 4BBKA 2D4QA 1V88A 2DKPA 2KUPA 4EMOA 1LW3A 2ELAA 1X1FA 4K2OA 2RVBB 4GPTB 1QC6A 2YF0A 4ZRKA 3DXCA 1UNQA 3PG7A 3ODOA 3VIAA 5HE2A 2D9VA 2EJ8A 4GMVA 1U27A 2RNRB 1MAIA 3TCAA 1W1GA 1BAKA 2BCJA 3UZTA 3HK0A 1KZGA 5C5BA 2EC1A 1GC6A 5KQ4A 3TO1A 2CODA 4Z2MB 3A8QA 1MPHA 1OMWA 4HB4B 2D2QA 5CLLB 5DH9B 3QBVB 2P0DA 4GZUA 3RCPA 5FI0A 4MY6A 4CHJA 2RLOA 2YT1A 1RJ2A 1U2BA 1DBHA 3F0WA 3KZ1A 4HB2B 4D0NB 4PNKA 2UZRA 3AU4A 4ZRIA 1MK9B 3BJIA 3BINA 1BTNA 2ROZB 4F7UP 2DFKA 1UNRA 2COFA 4XWXA 3WA0A 2D9XA 4EJNA 4GMXB 4HAWB 1H10A 4HAXB 2W2XC 2YT0A 1DDWA 2ELBA 1FB8A 5EFXA 4CYEA 1TJ6A 3PVLA 3PVUA 5GOWB 5C79A 1AWEA 3SV1A 1KZ7A 1J19A 4A6FB 2W2WA 1MIZB 4Y94A 3GYPA 2DKQA 2ZPYA 1U29A 1V61A 1P6SA 3O96A 4WSFA 4HDQA 2NMBA 1XCGA 4HAVB 1ZC3B 1AQCA 5D3WA 3N7CA 3GYOA 1TXDA 1MIXA 1XD4A 2LULA 4CHMA 2P0HA 4KAXB 1I2HA 2P8VA 2AL6A 4ZRJA 5JHGA 1QQGA 3D8FA 2DN6A 2DHKA 3OANA 1WG7A 3A98B 5C16A 2VKIA 2J59M 3P7ZA 3F5RA 4DBBA 1XKEA 2K00A 1H4RA 1Y5OA 3CIKA 1PLSA 1ZVRA 2V76A 3PP2A 2Z0QA 1V89A 5J3YA 1MK7B 1X86A 4A5KA 2YS5A 1ZM0A 5DI9B 2QKMA 3T06A 1NTYA 2CY4A 4KHOA 5DIFB 4H8SA 5D3VA 1X05A 5KCVA 3IVFA 3TFMA 4A6HA 5LOPB 1EAZA 1DDMA 2CY5A 2DYNA 1B55A 2ROVA 1V5PA 3M1IB 2VRWB 1OQNA 2FJLA 1ZC4B 2GS0A 3DXEA 2D11A 2CRFA 1BTKA 5LONB 1UEFA 1KI1B 4F7GA 5KQ1A 2ADZA 2EMTA 3QWMA 5CLQB 1WJMA 2LYDA 4L6EA 1FGZA 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  2YVC A;  2H7E A;  4A6F A;  2KCJ A;  1FHW A;  4HAY B;  3FSS A;  3QIJ A;  3ODW A;  5D3X A;  2J0M A;  1UPQ A;  1E5W A;  5D3Y A;  5DHA B;  1W1H A;  4MT7 A;  1RRP B;  5L81 A;  4K2P A;  3HQC A;  3PSC A;  1FGY A;  2OTX A;  3D8D A;  1Z87 A;  2J0K A;  3A8P A;  2Y8F A;  2Z0O A;  1Q67 A;  4KHA A;  2LKO A;  1I7A A;  2QKL A;  1U5E A;  2DA0 A;  4NSW A;  2MDX A;  4GXB A;  1NU2 A;  2D9Y A;  3NSU A;  1K5D B;  4DXA B;  5C6R A;  4KVG B;  4B6H A;  3SYX A;  2J0J A;  3ODX A;  2W2X D;  1ISN A;  3FEH A;  3KRW A;  2MKR A;  2EMS A;  1V5M A;  4PQ0 A;  2NZ8 B;  1K5G B;  2K2U A;  3ULB A;  3ZDT A;  5D27 A;  2COC A;  2YSZ A;  3LJU X;  1PFJ A;  3MDB C;  2N23 A;  1NI2 A;  2D9Z A;  4NY0 A;  3X23 A;  2Q13 A;  4TYZ A;  2I5F A;  2XQN M;  4IFS A;  3KY9 A;  1N3H A;  2PZ1 A;  4WJ7 A;  1BWN A;  2VSZ A;  4GN1 A;  3HW2 B;  2Z0P A;  2RUK B;  1GC7 A;  2YS3 A;  2X18 A;  5HE3 A;  2G35 A;  2I1J A;  4DX9 0;  2RSG A;  4HAU B;  4HDO A;  5FI1 A;  2DHJ A;  1M7E A;  2YS1 A;  2R09 A;  1FAO A;  1X1G A;  1U5F A;  2H7D A;  4EKU A;  3TW1 A;  4C0A A;  5JHH A;  4A6K A;  1FHX A;  2K2J A;  3SUZ A;  3ULC A;  1FOE A;  2COA A;  5JP4 A;  4YL8 A;  3KSY A;  3AU5 A;  4Z2N A;  5HE1 A;  3SNH A;  3P6A A;  2DX1 A;  1Y19 B;  1GG3 A;  1UPR A;  2UZS A;  1X11 A;  2P0F A;  4HAZ B;  1M7R A;  4HB3 B;  1IRS A;  4DX8 A;  2RGN B;  4K17 A;  3KRX A;  4HB0 B;  1TQZ A;  2UVM A;  4F7H A;  2GCJ A;  3U8Z A;  1WGQ A;  2N0Y A;  3PEG A;  2R0D A;  1DRO A;  4IAP A;  2DLW A;  5J3Q A;  4HHV A;  2LOX A;  2DYQ A;  1V5U A;  1W1D A;  2JP2 A;  4YON A;  2DHI A;  2M38 A;  1XOD A;  1FHO A;  1P3R A;  3ZVR A;  3U7D A;  1U5G A;  1ZSQ A;  2L2I A;  3D8E A;  2IYB A;  3DXD A;  1WI1 A;  1NTV A;  2I5C A;  2I1K A;  5C5B B;  1MKE A;  1XR0 B;  3MPX A;  2OQB A;  4K81 A;  1OY2 A;  3G9W A;  3TVV A;  4HAT B;  4P7I A;  3AJ4 A;  5J3T A;  1SHC A;  1WGU A;  3VOQ A;  2L1C A;  2KGX B;  3PVW A;  1LB1 A;  2IFS A;  1WVH A;  1XX0 A;  1J0W A;  2GJY A;  1UNP A;  1EVH A;  2CAY A;  3ML4 A;  2AEH A;  2LG1 A;  1EF1 A;  2D9W A;  4WVF B;  1DDV A;  2LOZ A;  1EGX A;  1PMS A;  5JLJ B;  4TKN A;  2MWN B;  2MFQ A;  1U5D A;  1P5T A;  4MK0 A;  3FM8 C;  2DTC A;  1WJ1 A;  3CXB B;  4KHB B;  2E2X A;  5DHF B;  5HE0 A;  3WYF B;  2Y8G A;  2HE7 A;  2GCL A;  2M14 A;  2DX5 A;  2YRY A;  3V5W A;  2D10 A;  3SO6 A;  2Y7B A;  1DYN A;  4IOY X;  2HTH B;  4BBK A;  2D4Q A;  1V88 A;  2DKP A;  2KUP A;  4EMO A;  1LW3 A;  2ELA A;  1X1F A;  4K2O A;  2RVB B;  4GPT B;  1QC6 A;  2YF0 A;  4ZRK A;  3DXC A;  1UNQ A;  3PG7 A;  3ODO A;  3VIA A;  5HE2 A;  2D9V A;  2EJ8 A;  4GMV A;  1U27 A;  2RNR B;  1MAI A;  3TCA A;  1W1G A;  1BAK A;  2BCJ A;  3UZT A;  3HK0 A;  1KZG A;  5C5B A;  2EC1 A;  1GC6 A;  5KQ4 A;  3TO1 A;  2COD A;  4Z2M B;  3A8Q A;  1MPH A;  1OMW A;  4HB4 B;  2D2Q A;  5CLL B;  5DH9 B;  3QBV B;  2P0D A;  4GZU A;  3RCP A;  5FI0 A;  4MY6 A;  4CHJ A;  2RLO A;  2YT1 A;  1RJ2 A;  1U2B A;  1DBH A;  3F0W A;  3KZ1 A;  4HB2 B;  4D0N B;  4PNK A;  2UZR A;  3AU4 A;  4ZRI A;  1MK9 B;  3BJI A;  3BIN A;  1BTN A;  2ROZ B;  4F7U P;  2DFK A;  1UNR A;  2COF A;  4XWX A;  3WA0 A;  2D9X A;  4EJN A;  4GMX B;  4HAW B;  1H10 A;  4HAX B;  2W2X C;  2YT0 A;  1DDW A;  2ELB A;  1FB8 A;  5EFX A;  4CYE A;  1TJ6 A;  3PVL A;  3PVU A;  5GOW B;  5C79 A;  1AWE A;  3SV1 A;  1KZ7 A;  1J19 A;  4A6F B;  2W2W A;  1MIZ B;  4Y94 A;  3GYP A;  2DKQ A;  2ZPY A;  1U29 A;  1V61 A;  1P6S A;  3O96 A;  4WSF A;  4HDQ A;  2NMB A;  1XCG A;  4HAV B;  1ZC3 B;  1AQC A;  5D3W A;  3N7C A;  3GYO A;  1TXD A;  1MIX A;  1XD4 A;  2LUL A;  4CHM A;  2P0H A;  4KAX B;  1I2H A;  2P8V A;  2AL6 A;  4ZRJ A;  5JHG A;  1QQG A;  3D8F A;  2DN6 A;  2DHK A;  3OAN A;  1WG7 A;  3A98 B;  5C16 A;  2VKI A;  2J59 M;  3P7Z A;  3F5R A;  4DBB A;  1XKE A;  2K00 A;  1H4R A;  1Y5O A;  3CIK A;  1PLS A;  1ZVR A;  2V76 A;  3PP2 A;  2Z0Q A;  1V89 A;  5J3Y A;  1MK7 B;  1X86 A;  4A5K A;  2YS5 A;  1ZM0 A;  5DI9 B;  2QKM A;  3T06 A;  1NTY A;  2CY4 A;  4KHO A;  5DIF B;  4H8S A;  5D3V A;  1X05 A;  5KCV A;  3IVF A;  3TFM A;  4A6H A;  5LOP B;  1EAZ A;  1DDM A;  2CY5 A;  2DYN A;  1B55 A;  2ROV A;  1V5P A;  3M1I B;  2VRW B;  1OQN A;  2FJL A;  1ZC4 B;  2GS0 A;  3DXE A;  2D11 A;  2CRF A;  1BTK A;  5LON B;  1UEF A;  1KI1 B;  4F7G A;  5KQ1 A;  2ADZ A;  2EMT A;  3QWM A;  5CLQ B;  1WJM A;  2LYD A;  4L6E A;  1FGZ A;  1SGH A; 
#chains in the Genus database with same CATH topology
 3PZD A;  2YVC A;  2H7E A;  4CSQ A;  4A6F A;  2KCJ A;  1FHW A;  4HAY B;  3FSS A;  3QIJ A;  3OHM B;  3ODW A;  5D3X A;  2J0M A;  1UPQ A;  1E5W A;  5D3Y A;  5DHA B;  1W1H A;  4MT7 A;  1RRP B;  5L81 A;  4K2P A;  3HQC A;  3PSC A;  2KIE A;  1FGY A;  2OTX A;  2ZKM X;  4QJ5 B;  3HSA A;  3D8D A;  1Z87 A;  2J0K A;  3A8P A;  2Y8F A;  2Z0O A;  1Q67 A;  4KHA A;  2LKO A;  1I7A A;  2QKL A;  1U5E A;  2DA0 A;  4NSW A;  2MDX A;  4GXB A;  1NU2 A;  2D9Y A;  3NSU A;  1K5D B;  4DXA B;  5C6R A;  4KVG B;  4B6H A;  3SYX A;  2J0J A;  3ODX A;  2W2X D;  1ISN A;  3FEH A;  3KRW A;  2MKR A;  2EMS A;  1V5M A;  4PQ0 A;  2NZ8 B;  1K5G B;  2K2U A;  3ULB A;  3ZDT A;  5D27 A;  2COC A;  2YSZ A;  5I2M A;  3LJU X;  1PFJ A;  3MDB C;  2N23 A;  1NI2 A;  2D9Z A;  4NY0 A;  3X23 A;  2Q13 A;  4TYZ A;  2I5F A;  2XQN M;  4IFS A;  3KY9 A;  1N3H A;  2PZ1 A;  4WJ7 A;  1BWN A;  2VSZ A;  4GN1 A;  3HW2 B;  2Z0P A;  2RUK B;  1GC7 A;  2YS3 A;  2X18 A;  3NW8 A;  5HE3 A;  2G35 A;  2I1J A;  4DX9 0;  2RSG A;  5M4Y B;  4HAU B;  4HDO A;  5FI1 A;  2DHJ A;  1M7E A;  4GNK B;  2YS1 A;  2R09 A;  1FAO A;  4D6W A;  1X1G A;  1U5F A;  2H7D A;  4EKU A;  3TW1 A;  4C0A A;  5JHH A;  5IRS A;  4A6K A;  1FHX A;  3NWA A;  2K2J A;  2Z4D A;  3SUZ A;  3ULC A;  2R2Y A;  1FOE A;  2COA A;  5JP4 A;  4YL8 A;  3KSY A;  3AU5 A;  4Z2N A;  5HE1 A;  3SNH A;  3P6A A;  2DX1 A;  1Y19 B;  1GG3 A;  1UPR A;  2UZS A;  1X11 A;  2P0F A;  4HAZ B;  1M7R A;  4HB3 B;  1IRS A;  4DX8 A;  2RGN B;  3U12 A;  4K17 A;  3KRX A;  4HB0 B;  1TQZ A;  2UVM A;  4F7H A;  2GCJ A;  3U8Z A;  1WGQ A;  2N0Y A;  3PEG A;  2R0D A;  1DRO A;  4IAP A;  2KUQ A;  2DLW A;  5J3Q A;  4HHV A;  2LOX A;  2DYQ A;  1V5U A;  1W1D A;  2JP2 A;  4YON A;  2DHI A;  2M38 A;  1XOD A;  1FHO A;  1P3R A;  3ZVR A;  3U7D A;  1U5G A;  1ZSQ A;  2L2I A;  3D8E A;  2IYB A;  3DXD A;  1WI1 A;  1NTV A;  2I5C A;  2I1K A;  5C5B B;  1MKE A;  1XR0 B;  3MPX A;  2OQB A;  4K81 A;  1OY2 A;  3G9W A;  3TVV A;  3NWD A;  4HAT B;  4P7I A;  3AJ4 A;  5J3T A;  1SHC A;  1WGU A;  3VOQ A;  2L1C A;  2KGX B;  3PVW A;  1LB1 A;  2IFS A;  1WVH A;  1XX0 A;  1J0W A;  2GJY A;  1UNP A;  1EVH A;  2CAY A;  3ML4 A;  2AEH A;  2LG1 A;  1EF1 A;  2D9W A;  4WVF B;  1DDV A;  2LOZ A;  1EGX A;  1PMS A;  5JLJ B;  3A58 A;  4TKN A;  2KIG A;  2MWN B;  5LG4 B;  2MFQ A;  1U5D A;  1P5T A;  4MK0 A;  3FM8 C;  2DTC A;  4L1R A;  1WJ1 A;  3CXB B;  4KHB B;  2E2X A;  5DHF B;  5HE0 A;  3WYF B;  2Y8G A;  2HE7 A;  2GCL A;  2M14 A;  2DX5 A;  2YRY A;  3V5W A;  2D10 A;  2Z13 A;  2Y7B A;  3SO6 A;  2GUM A;  1DYN A;  4IOY X;  2HTH B;  4BBK A;  2D4Q A;  1V88 A;  2FJU B;  2DKP A;  2KUP A;  4EMO A;  1LW3 A;  2ELA A;  1X1F A;  4K2O A;  2RVB B;  4GPT B;  1QC6 A;  2YF0 A;  4QXA B;  4ZRK A;  3DXC A;  1UNQ A;  3PG7 A;  3ODO A;  3VIA A;  5HE2 A;  2D9V A;  2EJ8 A;  4GMV A;  1U27 A;  2RNR B;  1MAI A;  3TCA A;  1W1G A;  1BAK A;  2BCJ A;  3UZT A;  3HK0 A;  1KZG A;  5C5B A;  2EC1 A;  1GC6 A;  5KQ4 A;  3TO1 A;  3HIE A;  2COD A;  4Z2M B;  3A8Q A;  1MPH A;  1OMW A;  4HB4 B;  2D2Q A;  5CLL B;  5DH9 B;  3QBV B;  2P0D A;  4GZU A;  3RCP A;  5FI0 A;  4MY6 A;  4HSI A;  4CHJ A;  2RLO A;  2YT1 A;  1RJ2 A;  1U2B A;  1DBH A;  3F0W A;  3KZ1 A;  4HB2 B;  4D0N B;  2Z14 A;  4PNK A;  2UZR A;  3AU4 A;  4ZRI A;  1MK9 B;  3BJI A;  3BIN A;  1BTN A;  2ROZ B;  4F7U P;  2DFK A;  1UNR A;  2COF A;  4XWX A;  4DIX A;  3WA0 A;  2D9X A;  1T77 A;  1ZYI A;  4GMX B;  4EJN A;  4HAW B;  1H10 A;  4HAX B;  2W2X C;  2YT0 A;  1DDW A;  2ELB A;  1FB8 A;  2RRF A;  5EFX A;  4CYE A;  1TJ6 A;  4KHB A;  3NWF A;  3PVL A;  3PVU A;  5GOW B;  5C79 A;  1AWE A;  3SV1 A;  1KZ7 A;  1J19 A;  4QJ3 B;  4A6F B;  2W2W A;  1MIZ B;  4Y94 A;  3GYP A;  2DKQ A;  2ZPY A;  1U29 A;  1V61 A;  1P6S A;  3O96 A;  2YT2 A;  4WSF A;  4HDQ A;  2KR0 A;  2NMB A;  1XCG A;  4HAV B;  1ZC3 B;  1AQC A;  5D3W A;  3N7C A;  3GYO A;  2Z59 A;  1TXD A;  1MIX A;  1XD4 A;  2LUL A;  4CHM A;  2P0H A;  4KAX B;  4QJ4 B;  1I2H A;  2P8V A;  2AL6 A;  4ZRJ A;  4OT1 A;  5JHG A;  1QQG A;  3D8F A;  2DN6 A;  2DHK A;  3OAN A;  1WG7 A;  4GOU A;  3A98 B;  3DCX A;  5C16 A;  2VKI A;  2J59 M;  3P7Z A;  3F5R A;  4DBB A;  1XKE A;  2K00 A;  1H4R A;  1Y5O A;  3CIK A;  1PLS A;  5I2S A;  1ZVR A;  2V76 A;  3PP2 A;  2Z0Q A;  1V89 A;  5J3Y A;  1MK7 B;  1X86 A;  4A5K A;  2YS5 A;  1ZM0 A;  3B77 A;  5DI9 B;  4OSN A;  2QKM A;  2K49 A;  3T06 A;  1NTY A;  2CY4 A;  4KHO A;  5DIF B;  4H8S A;  5D3V A;  1X05 A;  5KCV A;  3IVF A;  3TFM A;  2NBV A;  4A6H A;  5LOP B;  1EAZ A;  1DDM A;  2CY5 A;  2DYN A;  1B55 A;  2ROV A;  1V5P A;  3M1I B;  2VRW B;  1OQN A;  2FJL A;  1ZC4 B;  2GS0 A;  3DXE A;  1MI1 A;  2D11 A;  2CRF A;  3FVC A;  1BTK A;  5LON B;  1UEF A;  1KI1 B;  4F7G A;  5KQ1 A;  2ADZ A;  2EMT A;  3QWM A;  5CLQ B;  1WJM A;  2K8E A;  2LYD A;  1FGZ A;  1SGH A;  4L6E A; 
#chains in the Genus database with same CATH homology
 3PZD A;  2YVC A;  2H7E A;  4A6F A;  2KCJ A;  1FHW A;  4HAY B;  3FSS A;  3QIJ A;  3ODW A;  5D3X A;  2J0M A;  1UPQ A;  1E5W A;  5D3Y A;  5DHA B;  1W1H A;  4MT7 A;  1RRP B;  5L81 A;  4K2P A;  3HQC A;  3PSC A;  1FGY A;  2OTX A;  3D8D A;  1Z87 A;  2J0K A;  3A8P A;  2Y8F A;  2Z0O A;  1Q67 A;  4KHA A;  2LKO A;  1I7A A;  2QKL A;  1U5E A;  2DA0 A;  4NSW A;  2MDX A;  4GXB A;  1NU2 A;  2D9Y A;  3NSU A;  1K5D B;  4DXA B;  5C6R A;  4KVG B;  4B6H A;  3SYX A;  2J0J A;  3ODX A;  2W2X D;  1ISN A;  3FEH A;  3KRW A;  2MKR A;  2EMS A;  1V5M A;  4PQ0 A;  2NZ8 B;  1K5G B;  2K2U A;  3ULB A;  3ZDT A;  5D27 A;  2COC A;  2YSZ A;  3LJU X;  1PFJ A;  3MDB C;  2N23 A;  1NI2 A;  2D9Z A;  4NY0 A;  3X23 A;  2Q13 A;  4TYZ A;  2I5F A;  2XQN M;  4IFS A;  3KY9 A;  1N3H A;  2PZ1 A;  4WJ7 A;  1BWN A;  2VSZ A;  4GN1 A;  3HW2 B;  2Z0P A;  2RUK B;  1GC7 A;  2YS3 A;  2X18 A;  5HE3 A;  2G35 A;  2I1J A;  4DX9 0;  2RSG A;  4HAU B;  4HDO A;  5FI1 A;  2DHJ A;  1M7E A;  2YS1 A;  2R09 A;  1FAO A;  1X1G A;  1U5F A;  2H7D A;  4EKU A;  3TW1 A;  4C0A A;  5JHH A;  4A6K A;  1FHX A;  2K2J A;  3SUZ A;  3ULC A;  1FOE A;  2COA A;  5JP4 A;  4YL8 A;  3KSY A;  3AU5 A;  4Z2N A;  5HE1 A;  3SNH A;  3P6A A;  2DX1 A;  1Y19 B;  1GG3 A;  1UPR A;  2UZS A;  1X11 A;  2P0F A;  4HAZ B;  1M7R A;  4HB3 B;  1IRS A;  4DX8 A;  2RGN B;  4K17 A;  3KRX A;  4HB0 B;  1TQZ A;  2UVM A;  4F7H A;  2GCJ A;  3U8Z A;  1WGQ A;  2N0Y A;  3PEG A;  2R0D A;  1DRO A;  4IAP A;  2DLW A;  5J3Q A;  4HHV A;  2LOX A;  2DYQ A;  1V5U A;  1W1D A;  2JP2 A;  4YON A;  2DHI A;  2M38 A;  1XOD A;  1FHO A;  1P3R A;  3ZVR A;  3U7D A;  1U5G A;  1ZSQ A;  2L2I A;  3D8E A;  2IYB A;  3DXD A;  1WI1 A;  1NTV A;  2I5C A;  2I1K A;  5C5B B;  1MKE A;  1XR0 B;  3MPX A;  2OQB A;  4K81 A;  1OY2 A;  3G9W A;  3TVV A;  4HAT B;  4P7I A;  3AJ4 A;  5J3T A;  1SHC A;  1WGU A;  3VOQ A;  2L1C A;  2KGX B;  3PVW A;  1LB1 A;  2IFS A;  1WVH A;  1XX0 A;  1J0W A;  2GJY A;  1UNP A;  1EVH A;  2CAY A;  3ML4 A;  2AEH A;  2LG1 A;  1EF1 A;  2D9W A;  4WVF B;  1DDV A;  2LOZ A;  1EGX A;  1PMS A;  5JLJ B;  4TKN A;  2MWN B;  2MFQ A;  1U5D A;  1P5T A;  4MK0 A;  3FM8 C;  2DTC A;  1WJ1 A;  3CXB B;  4KHB B;  2E2X A;  5DHF B;  5HE0 A;  3WYF B;  2Y8G A;  2HE7 A;  2GCL A;  2M14 A;  2DX5 A;  2YRY A;  3V5W A;  2D10 A;  3SO6 A;  2Y7B A;  1DYN A;  4IOY X;  2HTH B;  4BBK A;  2D4Q A;  1V88 A;  2DKP A;  2KUP A;  4EMO A;  1LW3 A;  2ELA A;  1X1F A;  4K2O A;  2RVB B;  4GPT B;  1QC6 A;  2YF0 A;  4ZRK A;  3DXC A;  1UNQ A;  3PG7 A;  3ODO A;  3VIA A;  5HE2 A;  2D9V A;  2EJ8 A;  4GMV A;  1U27 A;  2RNR B;  1MAI A;  3TCA A;  1W1G A;  1BAK A;  2BCJ A;  3UZT A;  3HK0 A;  1KZG A;  5C5B A;  2EC1 A;  1GC6 A;  5KQ4 A;  3TO1 A;  2COD A;  4Z2M B;  3A8Q A;  1MPH A;  1OMW A;  4HB4 B;  2D2Q A;  5CLL B;  5DH9 B;  3QBV B;  2P0D A;  4GZU A;  3RCP A;  5FI0 A;  4MY6 A;  4CHJ A;  2RLO A;  2YT1 A;  1RJ2 A;  1U2B A;  1DBH A;  3F0W A;  3KZ1 A;  4HB2 B;  4D0N B;  4PNK A;  2UZR A;  3AU4 A;  4ZRI A;  1MK9 B;  3BJI A;  3BIN A;  1BTN A;  2ROZ B;  4F7U P;  2DFK A;  1UNR A;  2COF A;  4XWX A;  3WA0 A;  2D9X A;  4EJN A;  4GMX B;  4HAW B;  1H10 A;  4HAX B;  2W2X C;  2YT0 A;  1DDW A;  2ELB A;  1FB8 A;  5EFX A;  4CYE A;  1TJ6 A;  3PVL A;  3PVU A;  5GOW B;  5C79 A;  1AWE A;  3SV1 A;  1KZ7 A;  1J19 A;  4A6F B;  2W2W A;  1MIZ B;  4Y94 A;  3GYP A;  2DKQ A;  2ZPY A;  1U29 A;  1V61 A;  1P6S A;  3O96 A;  4WSF A;  4HDQ A;  2NMB A;  1XCG A;  4HAV B;  1ZC3 B;  1AQC A;  5D3W A;  3N7C A;  3GYO A;  1TXD A;  1MIX A;  1XD4 A;  2LUL A;  4CHM A;  2P0H A;  4KAX B;  1I2H A;  2P8V A;  2AL6 A;  4ZRJ A;  5JHG A;  1QQG A;  3D8F A;  2DN6 A;  2DHK A;  3OAN A;  1WG7 A;  3A98 B;  5C16 A;  2VKI A;  2J59 M;  3P7Z A;  3F5R A;  4DBB A;  1XKE A;  2K00 A;  1H4R A;  1Y5O A;  3CIK A;  1PLS A;  1ZVR A;  2V76 A;  3PP2 A;  2Z0Q A;  1V89 A;  5J3Y A;  1MK7 B;  1X86 A;  4A5K A;  2YS5 A;  1ZM0 A;  5DI9 B;  2QKM A;  3T06 A;  1NTY A;  2CY4 A;  4KHO A;  5DIF B;  4H8S A;  5D3V A;  1X05 A;  5KCV A;  3IVF A;  3TFM A;  4A6H A;  5LOP B;  1EAZ A;  1DDM A;  2CY5 A;  2DYN A;  1B55 A;  2ROV A;  1V5P A;  3M1I B;  2VRW B;  1OQN A;  2FJL A;  1ZC4 B;  2GS0 A;  3DXE A;  2D11 A;  2CRF A;  1BTK A;  5LON B;  1UEF A;  1KI1 B;  4F7G A;  5KQ1 A;  2ADZ A;  2EMT A;  3QWM A;  5CLQ B;  1WJM A;  2LYD A;  4L6E A;  1FGZ A;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...