2M14A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna binding protein
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m14A00
1NTYA 2EMSA 4GMVA 2LKOA 2GCJA 5CLLB 4GZUA 5D3VA 3MPXA 2MWNB 4CHMA 3TVVA 4PQ0A 2LOZA 3SNHA 2W2XC 1MAIA 4ZRKA 3HK0A 2X18A 2DHIA 1DYNA 2H7DA 4MK0A 3PVLA 1WGUA 1Z87A 3A8QA 1DBHA 1NU2A 2ELAA 5KQ4A 2EC1A 2NZ8B 2V76A 3D8EA 1U2BA 1UNPA 3F0WA 1IRSA 2CY5A 1RRPB 3FEHA 2RUKB 2FJLA 2J0JA 2DA0A 5CLQB 1ZVRA 5DI9B 3AU4A 5DH9B 3ULBA 5JHHA 5LOPB 1W1HA 4XWXA 2H7EA 1BTNA 4HAZB 1FHWA 5KCVA 2D9YA 5C5BA 1ZC3B 2YT1A 5C79A 3KRWA 5J3QA 1EVHA 5KQ1A 3U8ZA 3WYFB 2I5FA 4HB4B 2LG1A 1U29A 2HTHB 5JLJB 3GYPA 2I1KA 3BINA 2UZRA 3FM8C 2MDXA 2YF0A 2COAA 2YS5A 1J19A 1K5GB 1MK7B 2YS1A 1W1DA 2J0KA 1P3RA 2DKPA 5J3YA 2ROZB 4BBKA 2DX5A 4HB3B 2DHJA 3TO1A 1DDMA 1RJ2A 3M1IB 3HW2B 4A5KA 3WA0A 1FHXA 2JP2A 1XR0B 4CYEA 1AWEA 1V5MA 2YT0A 3PEGA 4HAWB 1X1GA 2YRYA 2LYDA 1XCGA 1X05A 2CY4A 2ROVA 3N7CA 5HE2A 2OTXA 1J0WA 1H4RA 2P0HA 2P0FA 4WJ7A 5HE1A 1WJ1A 5D27A 3ODWA 3KZ1A 2UVMA 2DHKA 2GS0A 2KUPA 2D9ZA 4K2PA 4ZRJA 3NSUA 5C16A 4HAXB 1WVHA 2J0MA 1TQZA 3FSSA 4F7HA 1DROA 1XODA 1V89A 5C6RA 3UZTA 1X11A 2K2JA 4KHOA 3CIKA 2G35A 5FI1A 2K00A 1BTKA 3PVWA 2D4QA 3PP2A 2RLOA 1EGXA 3TW1A 4PNKA 3RCPA 2D10A 1GC7A 3SV1A 4MT7A 1QQGA 1SHCA 2GJYA 2DLWA 1E5WA 2W2XD 1UNQA 2GCLA 1FOEA 4HB2B 4HATB 3MDBC 4GXBA 2R09A 1KI1B 4K17A 2AL6A 1MK9B 2AEHA 1Q67A 4HDOA 2RVBB 4IFSA 1MKEA 2DYNA 3X23A 2VSZA 3ULCA 1GC6A 5GOWB 3KY9A 1Y5OA 1DDWA 1MIXA 3SYXA 4A6FA 4HHVA 2YSZA 2J59M 1WI1A 2D9WA 1MIZB 1FGYA 4C0AA 2Y8GA 3V5WA 2Z0PA 4CHJA 4YL8A 2IYBA 4L6EA 5JHGA 4HAYB 2M38A 2YVCA 3ZVRA 5D3XA 3LJUX 3KSYA 2MKRA 3PSCA 2QKLA 3DXDA 3SUZA 5DHFB 1LW3A 1ZSQA 4HAUB 2N0YA 2MFQA 2DTCA 2RNRB 2OQBA 1N3HA 3SO6A 2YS3A 4HDQA 1ISNA 1Y19B 2EJ8A 1XX0A 1TXDA 2EMTA 1WGQA 3PVUA 4HAVB 4F7UP 2XQNM 5C5BB 4F7GA 1W1GA 2DKQA 2RSGA 4MY6A 4YONA 3KRXA 1BWNA 1EAZA 1U5FA 4D0NB 5DHAB 4WVFB 2ELBA 3A8PA 1BAKA 5L81A 2LULA 2VRWB 4ZRIA 5EFXA 3BJIA 1FHOA 1ZM0A 1V5PA 1X86A 1OMWA 4HB0B 5FI0A 2ADZA 3VOQA 1I7AA 2CRFA 4P7IA 2Q13A 1P6SA 1XKEA 2D11A 2D9VA 4DX8A 3G9WA 4KHBB 1TJ6A 2COFA 3DXEA 2DFKA 2HE7A 4KHAA 2KCJA 3ML4A 2M14A 1OY2A 3DXCA 1DDVA 4EJNA 1PFJA 1LB1A 2D9XA 3A98B 5HE3A 1U27A 3HQCA 3AJ4A 4DX90 4K2OA 1U5EA 1X1FA 2BCJA 1MPHA 4TKNA 3VIAA 3ODOA 1AQCA 1UNRA 3CXBB 3P7ZA 1UPQA 2Z0OA 2ZPYA 3TFMA 3D8DA 1PMSA 4K81A 2LOXA 3IVFA 2DX1A 4IOYX 2DN6A 3GYOA 1M7RA 1SGHA 4GPTB 4DXAB 2I1JA 4Z2MB 2CAYA 2P0DA 1V88A 4NSWA 1FB8A 2N23A 4B6HA 1K5DB 5D3YA 4A6HA 1KZGA 1OQNA 2UZSA 1PLSA 1U5DA 1GG3A 1WG7A 3QIJA 4EMOA 2I5CA 4WSFA 2Z0QA 3ZDTA 4GMXB 4A6KA 5HE0A 1UPRA 3ODXA 4EKUA 5J3TA 4KVGB 5JP4A 4GN1A 4NY0A 1I2HA 2L2IA 2L1CA 2R0DA 4IAPA 3QWMA 1P5TA 3D8FA 5LONB 1XD4A 4TYZA 3QBVB 2RGNB 3PG7A 1FAOA 1B55A 1M7EA 1EF1A 2D2QA 5DIFB 3P6AA 2PZ1A 1ZC4B 2K2UA 2Y7BA 2Y8FA 4A6FB 4KAXB 2W2WA 1QC6A 1H10A 4H8SA 2E2XA 1V5UA 4Z2NA 3U7DA 3PZDA 1NI2A 1V61A 3TCAA 3F5RA 2COCA 5D3WA 2DYQA 1U5GA 4Y94A 2CODA 3T06A 2VKIA 1FGZA 2NMBA 4DBBA 2IFSA 2KGXB 2QKMA 3AU5A 3O96A 1WJMA 1UEFA 1KZ7A 3OANA 2P8VA 1NTVA
chains in the Genus database with same CATH superfamily
1ZYIA 1NTYA 2EMSA 4GMVA 4QJ3B 2LKOA 2GCJA 5CLLB 4GZUA 5D3VA 3MPXA 2MWNB 4CHMA 3TVVA 4PQ0A 2LOZA 3SNHA 2W2XC 1MAIA 4ZRKA 3HK0A 2X18A 2DHIA 1DYNA 2H7DA 4MK0A 3PVLA 1WGUA 1Z87A 3A8QA 1DBHA 1NU2A 2ELAA 5KQ4A 2EC1A 2NZ8B 2V76A 3D8EA 1U2BA 1UNPA 3F0WA 1IRSA 2CY5A 1RRPB 3FEHA 2RUKB 2FJLA 2J0JA 2DA0A 5CLQB 1ZVRA 5DI9B 3AU4A 5DH9B 3ULBA 5JHHA 5LOPB 1W1HA 4XWXA 5I2SA 2H7EA 1BTNA 4HAZB 1FHWA 4HSIA 5KCVA 2D9YA 5C5BA 1ZC3B 2YT1A 5C79A 3KRWA 5J3QA 1EVHA 5KQ1A 4QJ4B 3U8ZA 3WYFB 2I5FA 4GOUA 4HB4B 2LG1A 4DIXA 1U29A 2HTHB 5JLJB 3GYPA 2I1KA 3BINA 2UZRA 3FM8C 2KIGA 2MDXA 2YF0A 2COAA 2YS5A 3B77A 1J19A 1K5GB 1MK7B 2YS1A 1W1DA 2J0KA 3DCXA 1P3RA 2DKPA 5J3YA 2ROZB 4BBKA 2DX5A 4HB3B 2DHJA 3TO1A 1DDMA 1RJ2A 3M1IB 3HW2B 3NW8A 4A5KA 3WA0A 1T77A 1FHXA 2JP2A 1XR0B 2Z13A 4CYEA 1AWEA 1V5MA 2YT0A 3PEGA 4HAWB 1X1GA 2YRYA 2LYDA 1MI1A 2FJUB 1XCGA 1X05A 2CY4A 2ROVA 3N7CA 5HE2A 2OTXA 1J0WA 1H4RA 2P0HA 2P0FA 4WJ7A 5HE1A 1WJ1A 5D27A 3ODWA 3KZ1A 2ZKMX 2UVMA 2DHKA 2GS0A 2KUPA 2D9ZA 4K2PA 4ZRJA 3NSUA 5C16A 4HAXB 1WVHA 2J0MA 1TQZA 3FVCA 3FSSA 4F7HA 3OHMB 1DROA 1XODA 1V89A 5C6RA 3UZTA 1X11A 2K2JA 4KHOA 3CIKA 2G35A 5FI1A 2K00A 1BTKA 3PVWA 2D4QA 3PP2A 2RLOA 1EGXA 3TW1A 4PNKA 3RCPA 2D10A 1GC7A 3SV1A 4MT7A 4D6WA 1QQGA 1SHCA 2GJYA 2DLWA 1E5WA 2W2XD 1UNQA 2GCLA 1FOEA 2K8EA 4HB2B 4HATB 3MDBC 4GXBA 2R09A 1KI1B 4K17A 2AL6A 1MK9B 2AEHA 1Q67A 4HDOA 2RVBB 4IFSA 1MKEA 2DYNA 3X23A 2NBVA 2VSZA 3ULCA 2Z4DA 1GC6A 5GOWB 3KY9A 1Y5OA 2K49A 1DDWA 1MIXA 3A58A 3SYXA 4A6FA 4HHVA 2YSZA 2J59M 1WI1A 2D9WA 1MIZB 2Z59A 1FGYA 4C0AA 2Y8GA 3V5WA 2Z0PA 5LG4B 4CHJA 4YL8A 2IYBA 4L6EA 5JHGA 4HAYB 2M38A 2YVCA 3ZVRA 5D3XA 3LJUX 4OT1A 4OSNA 3KSYA 2MKRA 3PSCA 2QKLA 3DXDA 3SUZA 5DHFB 1LW3A 1ZSQA 4HAUB 2N0YA 2MFQA 2DTCA 2RNRB 2OQBA 1N3HA 3SO6A 2YS3A 4HDQA 1ISNA 1Y19B 2EJ8A 2KIEA 1XX0A 1TXDA 2EMTA 1WGQA 3PVUA 4HAVB 4F7UP 2XQNM 5C5BB 4F7GA 1W1GA 2DKQA 2R2YA 2RSGA 4MY6A 4YONA 3KRXA 1BWNA 1EAZA 1U5FA 4D0NB 5DHAB 4WVFB 2ELBA 3A8PA 1BAKA 5L81A 2LULA 2VRWB 4ZRIA 5EFXA 3BJIA 1FHOA 3NWAA 1ZM0A 5M4YB 1V5PA 1X86A 1OMWA 4HB0B 5FI0A 2ADZA 3VOQA 1I7AA 2CRFA 4P7IA 2Q13A 1P6SA 1XKEA 2D11A 2D9VA 4DX8A 3G9WA 4KHBB 1TJ6A 2COFA 3DXEA 2DFKA 2HE7A 4KHAA 2KCJA 3ML4A 2M14A 1OY2A 3DXCA 1DDVA 4EJNA 1PFJA 1LB1A 2D9XA 3A98B 5HE3A 2YT2A 1U27A 3HQCA 3AJ4A 4DX90 4K2OA 1U5EA 1X1FA 2BCJA 1MPHA 4TKNA 3VIAA 3ODOA 5I2MA 1AQCA 1UNRA 3CXBB 3P7ZA 1UPQA 2Z0OA 2ZPYA 2KR0A 3TFMA 3D8DA 1PMSA 4K81A 2LOXA 3IVFA 2DX1A 4IOYX 2DN6A 3GYOA 1M7RA 1SGHA 4GPTB 4DXAB 2I1JA 4Z2MB 2CAYA 2P0DA 1V88A 4NSWA 1FB8A 2N23A 4B6HA 1K5DB 5D3YA 4A6HA 1KZGA 1OQNA 2UZSA 1PLSA 1U5DA 1GG3A 1WG7A 3QIJA 4EMOA 2I5CA 3NWDA 2GUMA 2RRFA 4WSFA 2Z0QA 3ZDTA 4GMXB 4CSQA 4A6KA 5HE0A 4GNKB 1UPRA 3ODXA 4EKUA 5J3TA 4KVGB 5JP4A 4GN1A 2KUQA 4NY0A 1I2HA 2L2IA 2L1CA 2R0DA 3OANA 4IAPA 3QWMA 1P5TA 3D8FA 5LONB 1XD4A 4TYZA 3QBVB 4L1RA 2RGNB 4KHBA 3U12A 3HSAA 1FAOA 1B55A 3PG7A 1M7EA 1EF1A 2D2QA 5DIFB 3P6AA 2PZ1A 4QXAB 1ZC4B 2K2UA 2Y7BA 3NWFA 2Y8FA 4A6FB 4QJ5B 4KAXB 2W2WA 1QC6A 1H10A 4H8SA 2E2XA 1V5UA 4Z2NA 3U7DA 3PZDA 1NI2A 1V61A 3TCAA 3F5RA 2COCA 5D3WA 2DYQA 1U5GA 4Y94A 2CODA 3T06A 2VKIA 1FGZA 2Z14A 2NMBA 4DBBA 2IFSA 2KGXB 2QKMA 3AU5A 3O96A 1WJMA 1UEFA 1KZ7A 3HIEA 5IRSA 2P8VA 1NTVA
chains in the Genus database with same CATH topology
1NTYA 2EMSA 4GMVA 2LKOA 2GCJA 5CLLB 4GZUA 5D3VA 3MPXA 2MWNB 4CHMA 3TVVA 4PQ0A 2LOZA 3SNHA 2W2XC 1MAIA 4ZRKA 3HK0A 2X18A 2DHIA 1DYNA 2H7DA 4MK0A 3PVLA 1WGUA 1Z87A 3A8QA 1DBHA 1NU2A 2ELAA 5KQ4A 2EC1A 2NZ8B 2V76A 3D8EA 1U2BA 1UNPA 3F0WA 1IRSA 2CY5A 1RRPB 3FEHA 2RUKB 2FJLA 2J0JA 2DA0A 5CLQB 1ZVRA 5DI9B 3AU4A 5DH9B 3ULBA 5JHHA 5LOPB 1W1HA 4XWXA 2H7EA 1BTNA 4HAZB 1FHWA 5KCVA 2D9YA 5C5BA 1ZC3B 2YT1A 5C79A 3KRWA 5J3QA 1EVHA 5KQ1A 3U8ZA 3WYFB 2I5FA 4HB4B 2LG1A 1U29A 2HTHB 5JLJB 3GYPA 2I1KA 3BINA 2UZRA 3FM8C 2MDXA 2YF0A 2COAA 2YS5A 1J19A 1K5GB 1MK7B 2YS1A 1W1DA 2J0KA 1P3RA 2DKPA 5J3YA 2ROZB 4BBKA 2DX5A 4HB3B 2DHJA 3TO1A 1DDMA 1RJ2A 3M1IB 3HW2B 4A5KA 3WA0A 1FHXA 2JP2A 1XR0B 4CYEA 1AWEA 1V5MA 2YT0A 3PEGA 4HAWB 1X1GA 2YRYA 2LYDA 1XCGA 1X05A 2CY4A 2ROVA 3N7CA 5HE2A 2OTXA 1J0WA 1H4RA 2P0HA 2P0FA 4WJ7A 5HE1A 1WJ1A 5D27A 3ODWA 3KZ1A 2UVMA 2DHKA 2GS0A 2KUPA 2D9ZA 4K2PA 4ZRJA 3NSUA 5C16A 4HAXB 1WVHA 2J0MA 1TQZA 3FSSA 4F7HA 1DROA 1XODA 1V89A 5C6RA 3UZTA 1X11A 2K2JA 4KHOA 3CIKA 2G35A 5FI1A 2K00A 1BTKA 3PVWA 2D4QA 3PP2A 2RLOA 1EGXA 3TW1A 4PNKA 3RCPA 2D10A 1GC7A 3SV1A 4MT7A 1QQGA 1SHCA 2GJYA 2DLWA 1E5WA 2W2XD 1UNQA 2GCLA 1FOEA 4HB2B 4HATB 3MDBC 4GXBA 2R09A 1KI1B 4K17A 2AL6A 1MK9B 2AEHA 1Q67A 4HDOA 2RVBB 4IFSA 1MKEA 2DYNA 3X23A 2VSZA 3ULCA 1GC6A 5GOWB 3KY9A 1Y5OA 1DDWA 1MIXA 3SYXA 4A6FA 4HHVA 2YSZA 2J59M 1WI1A 2D9WA 1MIZB 1FGYA 4C0AA 2Y8GA 3V5WA 2Z0PA 4CHJA 4YL8A 2IYBA 4L6EA 5JHGA 4HAYB 2M38A 2YVCA 3ZVRA 5D3XA 3LJUX 3KSYA 2MKRA 3PSCA 2QKLA 3DXDA 3SUZA 5DHFB 1LW3A 1ZSQA 4HAUB 2N0YA 2MFQA 2DTCA 2RNRB 2OQBA 1N3HA 3SO6A 2YS3A 4HDQA 1ISNA 1Y19B 2EJ8A 1XX0A 1TXDA 2EMTA 1WGQA 3PVUA 4HAVB 4F7UP 2XQNM 5C5BB 4F7GA 1W1GA 2DKQA 2RSGA 4MY6A 4YONA 3KRXA 1BWNA 1EAZA 1U5FA 4D0NB 5DHAB 4WVFB 2ELBA 3A8PA 1BAKA 5L81A 2LULA 2VRWB 4ZRIA 5EFXA 3BJIA 1FHOA 1ZM0A 1V5PA 1X86A 1OMWA 4HB0B 5FI0A 2ADZA 3VOQA 1I7AA 2CRFA 4P7IA 2Q13A 1P6SA 1XKEA 2D11A 2D9VA 4DX8A 3G9WA 4KHBB 1TJ6A 2COFA 3DXEA 2DFKA 2HE7A 4KHAA 2KCJA 3ML4A 2M14A 1OY2A 3DXCA 1DDVA 4EJNA 1PFJA 1LB1A 2D9XA 3A98B 5HE3A 1U27A 3HQCA 3AJ4A 4DX90 4K2OA 1U5EA 1X1FA 2BCJA 1MPHA 4TKNA 3VIAA 3ODOA 1AQCA 1UNRA 3CXBB 3P7ZA 1UPQA 2Z0OA 2ZPYA 3TFMA 3D8DA 1PMSA 4K81A 2LOXA 3IVFA 2DX1A 4IOYX 2DN6A 3GYOA 1M7RA 1SGHA 4GPTB 4DXAB 2I1JA 4Z2MB 2CAYA 2P0DA 1V88A 4NSWA 1FB8A 2N23A 4B6HA 1K5DB 5D3YA 4A6HA 1KZGA 1OQNA 2UZSA 1PLSA 1U5DA 1GG3A 1WG7A 3QIJA 4EMOA 2I5CA 4WSFA 2Z0QA 3ZDTA 4GMXB 4A6KA 5HE0A 1UPRA 3ODXA 4EKUA 5J3TA 4KVGB 5JP4A 4GN1A 4NY0A 1I2HA 2L2IA 2L1CA 2R0DA 4IAPA 3QWMA 1P5TA 3D8FA 5LONB 1XD4A 4TYZA 3QBVB 2RGNB 3PG7A 1FAOA 1B55A 1M7EA 1EF1A 2D2QA 5DIFB 3P6AA 2PZ1A 1ZC4B 2K2UA 2Y7BA 2Y8FA 4A6FB 4KAXB 2W2WA 1QC6A 1H10A 4H8SA 2E2XA 1V5UA 4Z2NA 3U7DA 3PZDA 1NI2A 1V61A 3TCAA 3F5RA 2COCA 5D3WA 2DYQA 1U5GA 4Y94A 2CODA 3T06A 2VKIA 1FGZA 2NMBA 4DBBA 2IFSA 2KGXB 2QKMA 3AU5A 3O96A 1WJMA 1UEFA 1KZ7A 3OANA 2P8VA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTY A;  2EMS A;  4GMV A;  2LKO A;  2GCJ A;  5CLL B;  4GZU A;  5D3V A;  3MPX A;  2MWN B;  4CHM A;  3TVV A;  4PQ0 A;  2LOZ A;  3SNH A;  2W2X C;  1MAI A;  4ZRK A;  3HK0 A;  2X18 A;  2DHI A;  1DYN A;  2H7D A;  4MK0 A;  3PVL A;  1WGU A;  1Z87 A;  3A8Q A;  1DBH A;  1NU2 A;  2ELA A;  5KQ4 A;  2EC1 A;  2NZ8 B;  2V76 A;  3D8E A;  1U2B A;  1UNP A;  3F0W A;  1IRS A;  2CY5 A;  1RRP B;  3FEH A;  2RUK B;  2FJL A;  2J0J A;  2DA0 A;  5CLQ B;  1ZVR A;  5DI9 B;  3AU4 A;  5DH9 B;  3ULB A;  5JHH A;  5LOP B;  1W1H A;  4XWX A;  2H7E A;  1BTN A;  4HAZ B;  1FHW A;  5KCV A;  2D9Y A;  5C5B A;  1ZC3 B;  2YT1 A;  5C79 A;  3KRW A;  5J3Q A;  1EVH A;  5KQ1 A;  3U8Z A;  3WYF B;  2I5F A;  4HB4 B;  2LG1 A;  1U29 A;  2HTH B;  5JLJ B;  3GYP A;  2I1K A;  3BIN A;  2UZR A;  3FM8 C;  2MDX A;  2YF0 A;  2COA A;  2YS5 A;  1J19 A;  1K5G B;  1MK7 B;  2YS1 A;  1W1D A;  2J0K A;  1P3R A;  2DKP A;  5J3Y A;  2ROZ B;  4BBK A;  2DX5 A;  4HB3 B;  2DHJ A;  3TO1 A;  1DDM A;  1RJ2 A;  3M1I B;  3HW2 B;  4A5K A;  3WA0 A;  1FHX A;  2JP2 A;  1XR0 B;  4CYE A;  1AWE A;  1V5M A;  2YT0 A;  3PEG A;  4HAW B;  1X1G A;  2YRY A;  2LYD A;  1XCG A;  1X05 A;  2CY4 A;  2ROV A;  3N7C A;  5HE2 A;  2OTX A;  1J0W A;  1H4R A;  2P0H A;  2P0F A;  4WJ7 A;  5HE1 A;  1WJ1 A;  5D27 A;  3ODW A;  3KZ1 A;  2UVM A;  2DHK A;  2GS0 A;  2KUP A;  2D9Z A;  4K2P A;  4ZRJ A;  3NSU A;  5C16 A;  4HAX B;  1WVH A;  2J0M A;  1TQZ A;  3FSS A;  4F7H A;  1DRO A;  1XOD A;  1V89 A;  5C6R A;  3UZT A;  1X11 A;  2K2J A;  4KHO A;  3CIK A;  2G35 A;  5FI1 A;  2K00 A;  1BTK A;  3PVW A;  2D4Q A;  3PP2 A;  2RLO A;  1EGX A;  3TW1 A;  4PNK A;  3RCP A;  2D10 A;  1GC7 A;  3SV1 A;  4MT7 A;  1QQG A;  1SHC A;  2GJY A;  2DLW A;  1E5W A;  2W2X D;  1UNQ A;  2GCL A;  1FOE A;  4HB2 B;  4HAT B;  3MDB C;  4GXB A;  2R09 A;  1KI1 B;  4K17 A;  2AL6 A;  1MK9 B;  2AEH A;  1Q67 A;  4HDO A;  2RVB B;  4IFS A;  1MKE A;  2DYN A;  3X23 A;  2VSZ A;  3ULC A;  1GC6 A;  5GOW B;  3KY9 A;  1Y5O A;  1DDW A;  1MIX A;  3SYX A;  4A6F A;  4HHV A;  2YSZ A;  2J59 M;  1WI1 A;  2D9W A;  1MIZ B;  1FGY A;  4C0A A;  2Y8G A;  3V5W A;  2Z0P A;  4CHJ A;  4YL8 A;  2IYB A;  4L6E A;  5JHG A;  4HAY B;  2M38 A;  2YVC A;  3ZVR A;  5D3X A;  3LJU X;  3KSY A;  2MKR A;  3PSC A;  2QKL A;  3DXD A;  3SUZ A;  5DHF B;  1LW3 A;  1ZSQ A;  4HAU B;  2N0Y A;  2MFQ A;  2DTC A;  2RNR B;  2OQB A;  1N3H A;  3SO6 A;  2YS3 A;  4HDQ A;  1ISN A;  1Y19 B;  2EJ8 A;  1XX0 A;  1TXD A;  2EMT A;  1WGQ A;  3PVU A;  4HAV B;  4F7U P;  2XQN M;  5C5B B;  4F7G A;  1W1G A;  2DKQ A;  2RSG A;  4MY6 A;  4YON A;  3KRX A;  1BWN A;  1EAZ A;  1U5F A;  4D0N B;  5DHA B;  4WVF B;  2ELB A;  3A8P A;  1BAK A;  5L81 A;  2LUL A;  2VRW B;  4ZRI A;  5EFX A;  3BJI A;  1FHO A;  1ZM0 A;  1V5P A;  1X86 A;  1OMW A;  4HB0 B;  5FI0 A;  2ADZ A;  3VOQ A;  1I7A A;  2CRF A;  4P7I A;  2Q13 A;  1P6S A;  1XKE A;  2D11 A;  2D9V A;  4DX8 A;  3G9W A;  4KHB B;  1TJ6 A;  2COF A;  3DXE A;  2DFK A;  2HE7 A;  4KHA A;  2KCJ A;  3ML4 A;  2M14 A;  1OY2 A;  3DXC A;  1DDV A;  4EJN A;  1PFJ A;  1LB1 A;  2D9X A;  3A98 B;  5HE3 A;  1U27 A;  3HQC A;  3AJ4 A;  4DX9 0;  4K2O A;  1U5E A;  1X1F A;  2BCJ A;  1MPH A;  4TKN A;  3VIA A;  3ODO A;  1AQC A;  1UNR A;  3CXB B;  3P7Z A;  1UPQ A;  2Z0O A;  2ZPY A;  3TFM A;  3D8D A;  1PMS A;  4K81 A;  2LOX A;  3IVF A;  2DX1 A;  4IOY X;  2DN6 A;  3GYO A;  1M7R A;  1SGH A;  4GPT B;  4DXA B;  2I1J A;  4Z2M B;  2CAY A;  2P0D A;  1V88 A;  4NSW A;  1FB8 A;  2N23 A;  4B6H A;  1K5D B;  5D3Y A;  4A6H A;  1KZG A;  1OQN A;  2UZS A;  1PLS A;  1U5D A;  1GG3 A;  1WG7 A;  3QIJ A;  4EMO A;  2I5C A;  4WSF A;  2Z0Q A;  3ZDT A;  4GMX B;  4A6K A;  5HE0 A;  1UPR A;  3ODX A;  4EKU A;  5J3T A;  4KVG B;  5JP4 A;  4GN1 A;  4NY0 A;  1I2H A;  2L2I A;  2L1C A;  2R0D A;  4IAP A;  3QWM A;  1P5T A;  3D8F A;  5LON B;  1XD4 A;  4TYZ A;  3QBV B;  2RGN B;  3PG7 A;  1FAO A;  1B55 A;  1M7E A;  1EF1 A;  2D2Q A;  5DIF B;  3P6A A;  2PZ1 A;  1ZC4 B;  2K2U A;  2Y7B A;  2Y8F A;  4A6F B;  4KAX B;  2W2W A;  1QC6 A;  1H10 A;  4H8S A;  2E2X A;  1V5U A;  4Z2N A;  3U7D A;  3PZD A;  1NI2 A;  1V61 A;  3TCA A;  3F5R A;  2COC A;  5D3W A;  2DYQ A;  1U5G A;  4Y94 A;  2COD A;  3T06 A;  2VKI A;  1FGZ A;  2NMB A;  4DBB A;  2IFS A;  2KGX B;  2QKM A;  3AU5 A;  3O96 A;  1WJM A;  1UEF A;  1KZ7 A;  3OAN A;  2P8V A;  1NTV A; 
#chains in the Genus database with same CATH topology
 1ZYI A;  1NTY A;  2EMS A;  4GMV A;  4QJ3 B;  2LKO A;  2GCJ A;  5CLL B;  4GZU A;  5D3V A;  3MPX A;  2MWN B;  4CHM A;  3TVV A;  4PQ0 A;  2LOZ A;  3SNH A;  2W2X C;  1MAI A;  4ZRK A;  3HK0 A;  2X18 A;  2DHI A;  1DYN A;  2H7D A;  4MK0 A;  3PVL A;  1WGU A;  1Z87 A;  3A8Q A;  1DBH A;  1NU2 A;  2ELA A;  5KQ4 A;  2EC1 A;  2NZ8 B;  2V76 A;  3D8E A;  1U2B A;  1UNP A;  3F0W A;  1IRS A;  2CY5 A;  1RRP B;  3FEH A;  2RUK B;  2FJL A;  2J0J A;  2DA0 A;  5CLQ B;  1ZVR A;  5DI9 B;  3AU4 A;  5DH9 B;  3ULB A;  5JHH A;  5LOP B;  1W1H A;  4XWX A;  5I2S A;  2H7E A;  1BTN A;  4HAZ B;  1FHW A;  4HSI A;  5KCV A;  2D9Y A;  5C5B A;  1ZC3 B;  2YT1 A;  5C79 A;  3KRW A;  5J3Q A;  1EVH A;  5KQ1 A;  4QJ4 B;  3U8Z A;  3WYF B;  2I5F A;  4GOU A;  4HB4 B;  2LG1 A;  4DIX A;  1U29 A;  2HTH B;  5JLJ B;  3GYP A;  2I1K A;  3BIN A;  2UZR A;  3FM8 C;  2KIG A;  2MDX A;  2YF0 A;  2COA A;  2YS5 A;  3B77 A;  1J19 A;  1K5G B;  1MK7 B;  2YS1 A;  1W1D A;  2J0K A;  3DCX A;  1P3R A;  2DKP A;  5J3Y A;  2ROZ B;  4BBK A;  2DX5 A;  4HB3 B;  2DHJ A;  3TO1 A;  1DDM A;  1RJ2 A;  3M1I B;  3HW2 B;  3NW8 A;  4A5K A;  3WA0 A;  1T77 A;  1FHX A;  2JP2 A;  1XR0 B;  2Z13 A;  4CYE A;  1AWE A;  1V5M A;  2YT0 A;  3PEG A;  4HAW B;  1X1G A;  2YRY A;  2LYD A;  1MI1 A;  2FJU B;  1XCG A;  1X05 A;  2CY4 A;  2ROV A;  3N7C A;  5HE2 A;  2OTX A;  1J0W A;  1H4R A;  2P0H A;  2P0F A;  4WJ7 A;  5HE1 A;  1WJ1 A;  5D27 A;  3ODW A;  3KZ1 A;  2ZKM X;  2UVM A;  2DHK A;  2GS0 A;  2KUP A;  2D9Z A;  4K2P A;  4ZRJ A;  3NSU A;  5C16 A;  4HAX B;  1WVH A;  2J0M A;  1TQZ A;  3FVC A;  3FSS A;  4F7H A;  3OHM B;  1DRO A;  1XOD A;  1V89 A;  5C6R A;  3UZT A;  1X11 A;  2K2J A;  4KHO A;  3CIK A;  2G35 A;  5FI1 A;  2K00 A;  1BTK A;  3PVW A;  2D4Q A;  3PP2 A;  2RLO A;  1EGX A;  3TW1 A;  4PNK A;  3RCP A;  2D10 A;  1GC7 A;  3SV1 A;  4MT7 A;  4D6W A;  1QQG A;  1SHC A;  2GJY A;  2DLW A;  1E5W A;  2W2X D;  1UNQ A;  2GCL A;  1FOE A;  2K8E A;  4HB2 B;  4HAT B;  3MDB C;  4GXB A;  2R09 A;  1KI1 B;  4K17 A;  2AL6 A;  1MK9 B;  2AEH A;  1Q67 A;  4HDO A;  2RVB B;  4IFS A;  1MKE A;  2DYN A;  3X23 A;  2NBV A;  2VSZ A;  3ULC A;  2Z4D A;  1GC6 A;  5GOW B;  3KY9 A;  1Y5O A;  2K49 A;  1DDW A;  1MIX A;  3A58 A;  3SYX A;  4A6F A;  4HHV A;  2YSZ A;  2J59 M;  1WI1 A;  2D9W A;  1MIZ B;  2Z59 A;  1FGY A;  4C0A A;  2Y8G A;  3V5W A;  2Z0P A;  5LG4 B;  4CHJ A;  4YL8 A;  2IYB A;  4L6E A;  5JHG A;  4HAY B;  2M38 A;  2YVC A;  3ZVR A;  5D3X A;  3LJU X;  4OT1 A;  4OSN A;  3KSY A;  2MKR A;  3PSC A;  2QKL A;  3DXD A;  3SUZ A;  5DHF B;  1LW3 A;  1ZSQ A;  4HAU B;  2N0Y A;  2MFQ A;  2DTC A;  2RNR B;  2OQB A;  1N3H A;  3SO6 A;  2YS3 A;  4HDQ A;  1ISN A;  1Y19 B;  2EJ8 A;  2KIE A;  1XX0 A;  1TXD A;  2EMT A;  1WGQ A;  3PVU A;  4HAV B;  4F7U P;  2XQN M;  5C5B B;  4F7G A;  1W1G A;  2DKQ A;  2R2Y A;  2RSG A;  4MY6 A;  4YON A;  3KRX A;  1BWN A;  1EAZ A;  1U5F A;  4D0N B;  5DHA B;  4WVF B;  2ELB A;  3A8P A;  1BAK A;  5L81 A;  2LUL A;  2VRW B;  4ZRI A;  5EFX A;  3BJI A;  1FHO A;  3NWA A;  1ZM0 A;  5M4Y B;  1V5P A;  1X86 A;  1OMW A;  4HB0 B;  5FI0 A;  2ADZ A;  3VOQ A;  1I7A A;  2CRF A;  4P7I A;  2Q13 A;  1P6S A;  1XKE A;  2D11 A;  2D9V A;  4DX8 A;  3G9W A;  4KHB B;  1TJ6 A;  2COF A;  3DXE A;  2DFK A;  2HE7 A;  4KHA A;  2KCJ A;  3ML4 A;  2M14 A;  1OY2 A;  3DXC A;  1DDV A;  4EJN A;  1PFJ A;  1LB1 A;  2D9X A;  3A98 B;  5HE3 A;  2YT2 A;  1U27 A;  3HQC A;  3AJ4 A;  4DX9 0;  4K2O A;  1U5E A;  1X1F A;  2BCJ A;  1MPH A;  4TKN A;  3VIA A;  3ODO A;  5I2M A;  1AQC A;  1UNR A;  3CXB B;  3P7Z A;  1UPQ A;  2Z0O A;  2ZPY A;  2KR0 A;  3TFM A;  3D8D A;  1PMS A;  4K81 A;  2LOX A;  3IVF A;  2DX1 A;  4IOY X;  2DN6 A;  3GYO A;  1M7R A;  1SGH A;  4GPT B;  4DXA B;  2I1J A;  4Z2M B;  2CAY A;  2P0D A;  1V88 A;  4NSW A;  1FB8 A;  2N23 A;  4B6H A;  1K5D B;  5D3Y A;  4A6H A;  1KZG A;  1OQN A;  2UZS A;  1PLS A;  1U5D A;  1GG3 A;  1WG7 A;  3QIJ A;  4EMO A;  2I5C A;  3NWD A;  2GUM A;  2RRF A;  4WSF A;  2Z0Q A;  3ZDT A;  4GMX B;  4CSQ A;  4A6K A;  5HE0 A;  4GNK B;  1UPR A;  3ODX A;  4EKU A;  5J3T A;  4KVG B;  5JP4 A;  4GN1 A;  2KUQ A;  4NY0 A;  1I2H A;  2L2I A;  2L1C A;  2R0D A;  3OAN A;  4IAP A;  3QWM A;  1P5T A;  3D8F A;  5LON B;  1XD4 A;  4TYZ A;  3QBV B;  4L1R A;  2RGN B;  4KHB A;  3U12 A;  3HSA A;  1FAO A;  1B55 A;  3PG7 A;  1M7E A;  1EF1 A;  2D2Q A;  5DIF B;  3P6A A;  2PZ1 A;  4QXA B;  1ZC4 B;  2K2U A;  2Y7B A;  3NWF A;  2Y8F A;  4A6F B;  4QJ5 B;  4KAX B;  2W2W A;  1QC6 A;  1H10 A;  4H8S A;  2E2X A;  1V5U A;  4Z2N A;  3U7D A;  3PZD A;  1NI2 A;  1V61 A;  3TCA A;  3F5R A;  2COC A;  5D3W A;  2DYQ A;  1U5G A;  4Y94 A;  2COD A;  3T06 A;  2VKI A;  1FGZ A;  2Z14 A;  2NMB A;  4DBB A;  2IFS A;  2KGX B;  2QKM A;  3AU5 A;  3O96 A;  1WJM A;  1UEF A;  1KZ7 A;  3HIE A;  5IRS A;  2P8V A;  1NTV A; 
#chains in the Genus database with same CATH homology
 1NTY A;  2EMS A;  4GMV A;  2LKO A;  2GCJ A;  5CLL B;  4GZU A;  5D3V A;  3MPX A;  2MWN B;  4CHM A;  3TVV A;  4PQ0 A;  2LOZ A;  3SNH A;  2W2X C;  1MAI A;  4ZRK A;  3HK0 A;  2X18 A;  2DHI A;  1DYN A;  2H7D A;  4MK0 A;  3PVL A;  1WGU A;  1Z87 A;  3A8Q A;  1DBH A;  1NU2 A;  2ELA A;  5KQ4 A;  2EC1 A;  2NZ8 B;  2V76 A;  3D8E A;  1U2B A;  1UNP A;  3F0W A;  1IRS A;  2CY5 A;  1RRP B;  3FEH A;  2RUK B;  2FJL A;  2J0J A;  2DA0 A;  5CLQ B;  1ZVR A;  5DI9 B;  3AU4 A;  5DH9 B;  3ULB A;  5JHH A;  5LOP B;  1W1H A;  4XWX A;  2H7E A;  1BTN A;  4HAZ B;  1FHW A;  5KCV A;  2D9Y A;  5C5B A;  1ZC3 B;  2YT1 A;  5C79 A;  3KRW A;  5J3Q A;  1EVH A;  5KQ1 A;  3U8Z A;  3WYF B;  2I5F A;  4HB4 B;  2LG1 A;  1U29 A;  2HTH B;  5JLJ B;  3GYP A;  2I1K A;  3BIN A;  2UZR A;  3FM8 C;  2MDX A;  2YF0 A;  2COA A;  2YS5 A;  1J19 A;  1K5G B;  1MK7 B;  2YS1 A;  1W1D A;  2J0K A;  1P3R A;  2DKP A;  5J3Y A;  2ROZ B;  4BBK A;  2DX5 A;  4HB3 B;  2DHJ A;  3TO1 A;  1DDM A;  1RJ2 A;  3M1I B;  3HW2 B;  4A5K A;  3WA0 A;  1FHX A;  2JP2 A;  1XR0 B;  4CYE A;  1AWE A;  1V5M A;  2YT0 A;  3PEG A;  4HAW B;  1X1G A;  2YRY A;  2LYD A;  1XCG A;  1X05 A;  2CY4 A;  2ROV A;  3N7C A;  5HE2 A;  2OTX A;  1J0W A;  1H4R A;  2P0H A;  2P0F A;  4WJ7 A;  5HE1 A;  1WJ1 A;  5D27 A;  3ODW A;  3KZ1 A;  2UVM A;  2DHK A;  2GS0 A;  2KUP A;  2D9Z A;  4K2P A;  4ZRJ A;  3NSU A;  5C16 A;  4HAX B;  1WVH A;  2J0M A;  1TQZ A;  3FSS A;  4F7H A;  1DRO A;  1XOD A;  1V89 A;  5C6R A;  3UZT A;  1X11 A;  2K2J A;  4KHO A;  3CIK A;  2G35 A;  5FI1 A;  2K00 A;  1BTK A;  3PVW A;  2D4Q A;  3PP2 A;  2RLO A;  1EGX A;  3TW1 A;  4PNK A;  3RCP A;  2D10 A;  1GC7 A;  3SV1 A;  4MT7 A;  1QQG A;  1SHC A;  2GJY A;  2DLW A;  1E5W A;  2W2X D;  1UNQ A;  2GCL A;  1FOE A;  4HB2 B;  4HAT B;  3MDB C;  4GXB A;  2R09 A;  1KI1 B;  4K17 A;  2AL6 A;  1MK9 B;  2AEH A;  1Q67 A;  4HDO A;  2RVB B;  4IFS A;  1MKE A;  2DYN A;  3X23 A;  2VSZ A;  3ULC A;  1GC6 A;  5GOW B;  3KY9 A;  1Y5O A;  1DDW A;  1MIX A;  3SYX A;  4A6F A;  4HHV A;  2YSZ A;  2J59 M;  1WI1 A;  2D9W A;  1MIZ B;  1FGY A;  4C0A A;  2Y8G A;  3V5W A;  2Z0P A;  4CHJ A;  4YL8 A;  2IYB A;  4L6E A;  5JHG A;  4HAY B;  2M38 A;  2YVC A;  3ZVR A;  5D3X A;  3LJU X;  3KSY A;  2MKR A;  3PSC A;  2QKL A;  3DXD A;  3SUZ A;  5DHF B;  1LW3 A;  1ZSQ A;  4HAU B;  2N0Y A;  2MFQ A;  2DTC A;  2RNR B;  2OQB A;  1N3H A;  3SO6 A;  2YS3 A;  4HDQ A;  1ISN A;  1Y19 B;  2EJ8 A;  1XX0 A;  1TXD A;  2EMT A;  1WGQ A;  3PVU A;  4HAV B;  4F7U P;  2XQN M;  5C5B B;  4F7G A;  1W1G A;  2DKQ A;  2RSG A;  4MY6 A;  4YON A;  3KRX A;  1BWN A;  1EAZ A;  1U5F A;  4D0N B;  5DHA B;  4WVF B;  2ELB A;  3A8P A;  1BAK A;  5L81 A;  2LUL A;  2VRW B;  4ZRI A;  5EFX A;  3BJI A;  1FHO A;  1ZM0 A;  1V5P A;  1X86 A;  1OMW A;  4HB0 B;  5FI0 A;  2ADZ A;  3VOQ A;  1I7A A;  2CRF A;  4P7I A;  2Q13 A;  1P6S A;  1XKE A;  2D11 A;  2D9V A;  4DX8 A;  3G9W A;  4KHB B;  1TJ6 A;  2COF A;  3DXE A;  2DFK A;  2HE7 A;  4KHA A;  2KCJ A;  3ML4 A;  2M14 A;  1OY2 A;  3DXC A;  1DDV A;  4EJN A;  1PFJ A;  1LB1 A;  2D9X A;  3A98 B;  5HE3 A;  1U27 A;  3HQC A;  3AJ4 A;  4DX9 0;  4K2O A;  1U5E A;  1X1F A;  2BCJ A;  1MPH A;  4TKN A;  3VIA A;  3ODO A;  1AQC A;  1UNR A;  3CXB B;  3P7Z A;  1UPQ A;  2Z0O A;  2ZPY A;  3TFM A;  3D8D A;  1PMS A;  4K81 A;  2LOX A;  3IVF A;  2DX1 A;  4IOY X;  2DN6 A;  3GYO A;  1M7R A;  1SGH A;  4GPT B;  4DXA B;  2I1J A;  4Z2M B;  2CAY A;  2P0D A;  1V88 A;  4NSW A;  1FB8 A;  2N23 A;  4B6H A;  1K5D B;  5D3Y A;  4A6H A;  1KZG A;  1OQN A;  2UZS A;  1PLS A;  1U5D A;  1GG3 A;  1WG7 A;  3QIJ A;  4EMO A;  2I5C A;  4WSF A;  2Z0Q A;  3ZDT A;  4GMX B;  4A6K A;  5HE0 A;  1UPR A;  3ODX A;  4EKU A;  5J3T A;  4KVG B;  5JP4 A;  4GN1 A;  4NY0 A;  1I2H A;  2L2I A;  2L1C A;  2R0D A;  4IAP A;  3QWM A;  1P5T A;  3D8F A;  5LON B;  1XD4 A;  4TYZ A;  3QBV B;  2RGN B;  3PG7 A;  1FAO A;  1B55 A;  1M7E A;  1EF1 A;  2D2Q A;  5DIF B;  3P6A A;  2PZ1 A;  1ZC4 B;  2K2U A;  2Y7B A;  2Y8F A;  4A6F B;  4KAX B;  2W2W A;  1QC6 A;  1H10 A;  4H8S A;  2E2X A;  1V5U A;  4Z2N A;  3U7D A;  3PZD A;  1NI2 A;  1V61 A;  3TCA A;  3F5R A;  2COC A;  5D3W A;  2DYQ A;  1U5G A;  4Y94 A;  2COD A;  3T06 A;  2VKI A;  1FGZ A;  2NMB A;  4DBB A;  2IFS A;  2KGX B;  2QKM A;  3AU5 A;  3O96 A;  1WJM A;  1UEF A;  1KZ7 A;  3OAN A;  2P8V A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...