2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
1BWNA 2KUPA 4MT7A 2UVMA 5KCVA 2JP2A 5C6RA 4GPTB 5D3VA 5DHAB 2ROZB 1FHOA 2KGXB 2UZRA 4PNKA 3U7DA 3TFMA 5HE0A 3D8EA 3FEHA 4HAYB 1GG3A 2YS1A 1P5TA 3X23A 5LONB 5CLQB 1K5GB 1UEFA 2P0FA 2EMSA 2DN6A 5D3XA 3WA0A 1XD4A 3ML4A 1BTNA 3GYPA 2WSCH 2I1JA 5HE2A 3A8PA 3ODXA 5C5BB 3DXCA 2MWNB 2L2IA 1J19A 4F7GA 5D3WA 4TKNA 4PQ0A 1EVHA 2ROVA 3SO6A 3M9QA 5D3YA 2N0YA 5JLJB 4MK0A 3MPXA 2HE7A 2K00A 3DXEA 5DH9B 4GXBA 1OQNA 3P7ZA 4HHVA 1SQVK 2X18A 2CY4A 2RSGA 2QKLA 5JHGA 1ZVRA 4HAUB 5KQ1A 1KZ7A 1E5WA 1KI1B 3BINA 4D0NB 5HE3A 2CY5A 1UNRA 1WGQA 2QKMA 4WVFB 1SQPK 4CHMA 1ISNA 2GCJA 3UZTA 3ZDTA 2CAYA 1SQQK 1XCGA 3AJ4A 5FI0A 3F5RA 1M7EA 2N23A 2J0KA 2DYNA 3O96A 2EC1A 4GMVA 4HB3B 3PZDA 4KHBB 2I5CA 3LW5H 2VRWB 1U5FA 3D8FA 3LJUX 2D9YA 2I5FA 3P6AA 2H7DA 2DKQA 3KRWA 1X11A 2GS0A 4WSFA 1ZM0A 1TXDA 2R0DA 5KQ4A 4MY6A 1AQCA 3VOQA 2O01H 3HW2B 1GC6A 2ADZA 4IOYX 1BAKA 2D2QA 3M1IB 1BTKA 2Z0OA 2D11A 4HAZB 1L0LK 4A6HA 2VSZA 1V5MA 2CODA 4DBBA 2MDXA 3KSYA 4HB4B 2NZ8B 3N7CA 1FHWA 4GMXB 1P6SA 1SHCA 3KY9A 1WVHA 2W2XD 2YVCA 2Z0PA 2DLWA 2P8VA 5C16A 2LYDA 2RGNB 4DX8A 2LULA 2DA0A 2DYQA 3KRXA 3T06A 3DXDA 5DI9B 1FGYA 4YONA 2MKRA 1W1GA 2WSEH 2K2JA 4EMOA 2Z0QA 3AU5A 1MIXA 1X1FA 2VKIA 4HAWB 3WYFB 1MIZB 3BJIA 4DXAB 1L0NK 5L81A 3CXBB 4HAXB 3D8DA 2CRFA 2J0JA 2MFQA 3HK0A 3A98B 1NI2A 2YT1A 1UPRA 4F7HA 1Y5OA 4GZUA 1W1DA 3PEGA 1U29A 2D10A 4HAVB 5DHFB 2DHKA 2BCJA 3TVVA 3OANA 3PG7A 1NTVA 1EAZA 2DTCA 4ZRKA 3AU4A 3ULCA 1X1GA 4NY0A 2DFKA 3SUZA 1PLSA 2DHIA 4KHAA 1XX0A 1FAOA 2COCA 4HB0B 2AL6A 1FGZA 3GYOA 4K2OA 2COAA 2D4QA 2FJLA 5HE1A 4IAPA 1WJ1A 1H4RA 2J59M 2R09A 1FHXA 1P3RA 2RVBB 2YS5A 5DIFB 3KZ1A 2P0DA 3PP2A 1U5DA 2LG1A 2H7EA 1TQZA 4Y94A 5EFXA 1DDMA 4Z2MB 1UNPA 1RRPB 2L1CA 1V88A 3MDBC 2DX5A 1UNQA 4NSWA 4L6EA 1I7AA 1QQGA 1V61A 2Q13A 3V5WA 2YRYA 4HDQA 4F7UP 3RCPA 5JP4A 1X86A 2YSZA 3NSUA 4CHJA 1QC6A 2COFA 1TJ6A 1FB8A 2PZ1A 4Z2NA 4YL8A 1XR0B 1LB1A 5FI1A 1MPHA 5JHHA 5KLVK 2NMBA 2UZSA 1K5DB 1U27A 5LOPB 3TCAA 2DHJA 3CIKA 3ODOA 1ZC4B 2RLOA 4K81A 1X05A 1V5PA 3FSSA 4K17A 4P7IA 1NU1K 2V76A 3IVFA 3QBVB 5CLLB 1GC7A 4ZRIA 1AWEA 4H8SA 1EGXA 1ZC3B 1U2BA 3PSCA 2LKOA 2RUKB 1KZGA 1WGUA 1RJ2A 1V89A 3SNHA 2E2XA 1XODA 2OQBA 2ELBA 2D9ZA 2M14A 2ELAA 1NTYA 1DDWA 2I1KA 1XKEA 5J3TA 2Y7BA 5GOWB 1Z87A 1LW3A 2FYUK 3SV1A 1DROA 3ZVRA 3SYXA 3A8QA 1SGHA 3QIJA 2AEHA 4A6FB 2KCJA 1UPQA 4B6HA 1I2HA 1NTKK 2Y8FA 4HATB 3VIAA 2Y8GA 1PMSA 2GJYA 3ODWA 3PVLA 2OTXA 4HB2B 2J0MA 2LKMA 5J3YA 3G9WA 4KAXB 3F0WA 1MK7B 1N3HA 4C0AA 3G3ZA 2YS3A 4GN1A 1WJMA 5C5BA 1WI1A 3CLQA 3ULBA 1SQXK 3HQCA 1W1HA 2D9VA 4IFSA 4KVGB 2GCLA 2D9XA 2LOXA 2M38A 1IRSA 1OY2A 2P0HA 2RNRB 2EMTA 1WG7A 3TW1A 1MK9B 4K2PA 4TYZA 2HTHB 1U5EA 5D27A 2XQNM 2W2WA 1U5GA 2YT0A 4WJ7A 5C79A 2WSFH 2DKPA 2EJ8A 2IFSA 1M7RA 1H10A 4ZRJA 4EJNA 2YF0A 3TO1A 1SQBK 4IFDK 4A5KA 4CYEA 1NTMK 1FOEA 1MAIA 2G35A 2IYBA 3FM8C 3QWMA 3PVWA 1DBHA 4BBKA 4DX90 1J0WA 1EF1A 4EKUA 1MKEA 1OMWA 1Y19B 2DX1A 4KHOA 1V5UA 4HDOA 1DDVA 4XWXA 4A6KA 3U8ZA 2W2XC 1ZSQA 2D9WA 2OARA 1DYNA 1Q67A 5J3QA 3PVUA 2LOZA 1B55A 4A6FA 2K2UA 1PFJA 1NU2A 2ZPYA 1NTZK
chains in the Genus database with same CATH superfamily
1XTGB 4Y28J 2K9JA 5LG4B 1NTZJ 5KCVA 3FXEA 1PP9E 2JP2A 5C6RA 5D3VA 5DHAB 4XFJA 1MUUA 2E43A 1LTGC 3AEDC 1NU1D 3ITKA 3TFMA 3AE2C 4U3FG 1VQ7P 1N73C 1NTKE 2JR8A 3H1KE 3MIWA 2ZJSE 1LTIC 3GMAA 5CLQB 1SQPD 2K9YA 2M8RA 1LNQA 2OYIA 4LGDE 3DXCA 1R8EA 5B5EE 3CCMP 4PJ0H 1H0TB 3L74J 1M57D 3JCUH 4GOEA 4C7NB 3N7NA 2K00A 3L75G 2KUQA 4GXBA 1OQNA 1WT6A 2CY4A 2RSGA 1DD3A 2XNDH 1EZVI 5KQ1A 4HAUB 1E5WA 3BINA 1JCCA 4KHBA 3PTZA 1UNRA 1WGQA 4CHMA 1SQBD 1R5SA 3ZDTA 3MGNA 3A58A 2K3RA 1N73A 1ZV8A 1M7EA 4JYCA 3AE7C 2DYNA 4K35A 3O96A 4GMVA 2IZ1A 5AVTB 1KILD 4HYTB 1CW5A 3P6AA 3MHVA 2N1TA 2NRGA 4WSFA 5KAIH 1LGHB 5KQ4A 2W90A 4I7ZB 1T2KD 3VOQA 1LTAC 2Z14A 1N86A 1JTHA 2NZ2A 2YO2A 2ADZA 1S5LE 2D11A 3BASA 1SQPE 2QM8A 3RK2D 1FOSF 2G8YA 3TDKA 1VQMP 2MDXA 5APWA 2NZ8B 1LJ2A 2M3EA 1FHWA 3N7CA 3KY9A 2W2XD 5H2FE 2P8VA 2YO3A 4NPFX 1Q82Q 4IOIH 2W27A 1JY3P 3T06A 5DI9B 1JY3O 1GL2C 1SQXG 4EMOA 3EFGA 1YHQP 2VKIA 1RH5B 3FVCA 4KHXA 5KLVD 4DXAB 3I55P 2D2CB 2HG5D 2O1KA 3NW8A 4HAXB 2CRFA 3EQ2A 2J0JA 4Z1MH 3L74E 3BCCG 1JMBA 2FYUG 1LP1B 4GZUA 2YMYA 3HE4B 2E74D 3II6A 1KILE 1BSHA 1QL1A 3TGUG 1KYOI 2DHKA 1SQVG 3S4RA 1X0TA 1URQD 1EAZA 4UB8H 3ABVC 5AVXB 3L71G 1OZHA 4C7RA 1E79H 2GM4A 3SUZA 2YXQB 1PLSA 2K88A 3FX0A 4KHAA 2IPPA 4HB0B 1NTKG 3CWBJ 1FGZA 3H1IJ 3HE5B 4U3FE 2FJLA 1LWUA 3H1ID 5CHXA 3CPWO 3HD7B 1FHXA 1M1KQ 2YS5A 3H1IE 5GTHH 2Y9ZA 3LIDA 3PP2A 4OGQC 1X8YA 2AEMA 3CCEP 2QJPB 4NPEA 3H1JD 5B66H 2ZYAA 2ZVOB 2H7EA 4NPDA 1K04A 3L73G 5EFXA 1DDMA 2L5GB 4Z2MB 1UNPA 2L1CA 4UB6E 1FU1A 5AW4B 2B89A 1QQGA 2QM7A 1H0TA 5APVA 2YRYA 4Y99C 1ZP0C 4HDQA 4F7UP 1MFTA 3NSUA 3T97B 2BASA 3B71A 3QH9A 1FDIA 3TGUJ 2KK7A 1LB1A 1VQOP 2OYHB 1L0LE 1N2DC 1P84I 3ODOA 2E75B 1GDTA 1LT9A 2OTKE 2OYIC 1NTMJ 3FSSA 4UB6H 4P7IA 4I7ZC 5AVSB 1NU1K 1DH3A 5E79H 1LWUB 1RE4A 3PSCA 2RUKB 3C9IA 3GF7A 2FY8A 1SQVE 3CC4P 4PD4H 3TNUA 2FYZA 3A3YB 3RK3C 3L71E 1NTYA 1N7SA 2Y7BA 4ASWA 3H1HE 4BWNA 3G6EP 3M0AA 2FYUD 3QIJA 1SQXE 5CJ4A 1UPQA 1I2HA 1JEKA 2GUMA 1BCCE 3U59A 2Y8FA 5KKZB 1L2PA 2Q5UA 2K9JB 2AEFA 3TGUD 1FBMA 4CPGA 2J0MA 2BEQD 5J3YA 4C0AA 4BXLA 4GN1A 4JBZA 2NPSA 1WI1A 2E5YA 1SQXK 1M90Q 2D9VA 2GCLA 1IK7A 1JB0J 1SLQA 1W2EA 2PP6A 1URQA 3M9BA 4I6MC 1K73Q 3TW1A 3E7KA 3AEFC 2QA4P 3NMDA 3RK2B 2K49A 1RQUA 1U5GA 2E42A 5APSA 4WJ7A 5C79A 3HSAA 2DKPA 2ZVNB 5EFWB 1M7RA 1N7SB 2QJYC 4EJNA 4RJTA 1KC8Q 4A5KA 1NTMK 3AE3C 1K8AQ 1FOEA 4GOUA 1BE3E 2G35A 5KAIE 1GZLA 4I2LC 1OW8A 3H1HD 2R3CA 1HWTC 1A02J 5AW5B 1QVFO 1J0WA 5AVYB 4JYBA 1MKEA 2Q7CA 1ZW0A 2UWJE 2DX1A 4KHOA 1V5UA 1DDVA 1RHZB 5B66E 2XZRA 2C9LY 2W2XC 1ZSQA 4KJMA 1M1JC 1ZMEC 5AW3B 2JKVA 4H13C 4AYCA 2D2CC 1VQKP 5TISH 4L73A 2WMMA 1NU2A 2ZPYA 1NTZK 2ZKMX 1BWNA 2WPSA 1KB9D 2KUPA 2UVMA 2MJZA 4PD4E 2HR3A 1YQ4C 1FHOA 3KZIH 3L35A 2UZRA 1IC2A 2N1TD 2Q1KA 1QEXA 5KAFH 1BSNA 1YITP 1S3JA 2CPSA 1URQB 4HAYB 1P5TA 4PJ0E 3X23A 1K5GB 2C0XA 1Q90D 2DN6A 3CCSP 4D6TJ 3ML4A 2V7QH 4OVNF 2Y0DA 2B9BA 1Y9BA 1T3UA 3HRNA 5HE2A 4PD4I 3I56P 1N73B 5C5BB 2L2IA 3DCXA 3O8ZA 3R2PA 5D3WA 2ITAA 3WU2H 2ZYGA 3V4WA 4C46A 3SO6A 5D3YA 3A0HH 3CX5E 2N0YA 4EI2A 3KQGA 2JJLA 5AW6B 3P7ZA 1SQVK 4R4LA 5JHGA 1KZ7A 1PGPA 5HE3A 2Z5IA 2WSFJ 3H1LJ 1KYOD 4CSQA 3H1KJ 3L74D 2CAYA 1XCGA 2WZ7A 3SWKA 2J0KA 2H43A 1EXIA 3P32A 4HB3B 4GOFA 1KILB 3A2AA 3AE5C 1U5FA 3GHGC 3LJUX 2DKQA 3KRWA 3D70A 1TXDA 1VPCA 4JPZB 3CCRP 1SFCD 5AVVB 3O6QB 3CCVP 1AQCA 2O01H 1S1CX 1BAKA 1XTCC 2D2QA 1BTKA 2Z0OA 1GU4A 3AE4C 4HAZB 3HE5A 1PGJA 2VSZA 3WMM0 1RF1C 3KSYA 2POHA 4GMXB 3RK2C 1SHCA 1KB9H 3FWLA 2Z0PA 2DLWA 2V4HA 2LYDA 5C16A 2KIKA 3BRVB 4DX8A 1NTMD 2LULA 1N8RQ 1NTZG 1KQLA 3H1HG 2B87B 4DCKA 3CXHH 4N3YB 1FGYA 2MKRA 2H88C 5CBOA 1T3JA 1S5LX 2WSEH 3RGUA 2FFDB 2E76D 2Z0QA 1H8AA 1MIXA 1LP1A 1HUCA 3L36A 3V2PA 3D8DA 3JSVC 5KLVE 4IFMA 4M3LA 4L76A 1J2JB 2IBZE 4F7HA 4L75A 1Y5OA 2HODB 1W1DA 2MKVA 2YKQA 3L74G 1UIXA 1U29A 1L0LD 2D10A 5DHFB 2AEJA 2OYHA 3WUVA 3HD7D 2BCJA 2QJKB 1MI1A 1JUNA 1LTJA 3ULCA 2JP3A 2O01N 5AW0B 2DFKA 1ZRTE 2K37A 1H88A 1SQQD 3L70D 2KI7B 2YIUB 4U3FD 1XX0A 2W6JH 2AL6A 3GYOA 3LW5J 2D4QA 1Y47A 1SQPG 3G71P 2O3JA 4IAPA 1WJ1A 1H4RA 2R09A 1OW6A 3NFQA 5CCHA 3KZ1A 2P0DA 2LG1A 1Z56A 3A0BE 1ZR4A 1YJNP 3KHUA 1NTME 4IFFA 4L1RA 2PAJA 3H1JG 4RESB 2BEZF 1GU5A 3KYQA 1V88A 1W2BO 3MDBC 2DX5A 1PL5A 1UNQA 4NSWA 4L6EA 2Q13A 1RE4C 3SFDC 1OFCX 5JP4A 5CJ0A 3RBXA 3SSUA 2GUVA 3GHGB 4CHJA 2E5TA 1QC6A 3CWBE 2BCCJ 1BCCJ 1TJ6A 3GG2A 1FB8A 2PZ1A 4Z2NA 1XR0B 1NKZB 5FI1A 5JHHA 4OH8B 5AW9B 5KLVK 4H44D 2KLUA 1NAFA 3CXHI 5LOPB 3CI9A 1FC2C 3CIKA 4DIXA 2YIUC 1A02F 2RLOA 4K81A 3VMXA 3NWAA 5TISE 1HGVA 1FZAA 1N7SC 4L74A 2V76A 1PPJE 1SQQE 3L70E 1GC7A 2FXOA 4ZRIA 5BVZA 2KB7P 1BGYD 4H8SA 1FJPA 3GF3A 5AVRB 2A45H 2KNCB 1SQQG 3L70G 5CCGC 3L73J 1V89A 3L75J 3KPEA 1YIJP 1OW7A 1K05A 3MTUE 3HUSA 2I1KA 2P67A 1XKEA 5J3TA 5H2FH 1SS1A 5GOWB 1T77A 2FYUK 1DROA 1D7MA 1W5CE 1L0LJ 1LTBC 3A8QA 3AEAC 2V7QJ 3MD0A 3HTKA 1G2CB 4C7NA 4QJ3B 1Q7YQ 1NTKK 2M0BA 4PV1C 2IFNA 2Y8GA 2GJYA 4YXDC 1FZBA 1MZ9A 1BE3J 2OYOA 4HB2B 4IL6E 2LKMA 1BDDA 3G9WA 3F0WA 2JWAA 3A0HE 1N3HA 3L72E 4YPCA 1MK7B 3AE1C 4WWIA 3G3ZA 4OSNA 1FZCB 3I5CA 3L72D 1FZEA 3H1KD 1L4AA 3L72J 4IFSA 2D9XA 3AEBC 2LOXA 5KTBA 4B86A 3CCLP 3RK3E 1BGYJ 4KT0J 4D6TD 2P0HA 1KQGB 2EMTA 2WT7B 4K2PA 2HTHB 2Y0EA 3IN6A 3VMAA 2W2WA 2QJYB 3RBZA 3L71J 1KILA 2IFSA 1H10A 1PPJG 1YBKA 3KZIE 2WTYA 3CX5D 3TO1A 1SQBK 4CYEA 2E75C 1H89A 3BRTB 4BRYA 3VYIA 3VN0A 3FM8C 2ZT9B 3QWMA 3PVWA 1DBHA 1PIXA 1SQXJ 2R5BA 1NH4A 3S1KA 4ZMDA 1SVFA 3HUSC 1KB9I 3AE9C 1NU1G 2P10A 3AEGC 1Y19B 4HDOA 2WPQA 3IAOA 1KZUB 3H32B 5J3QA 2WSSH 2WVRA 5KAFE 4H44B 2Q9IA 4A6FA 3F89A 1PFJA 3CXHE 2FXPA 3M9HA 3NTNA 3CCUP 2YXRB 1ZOYC 3KDPB 2HPCB 2HLOA 2KOGA 4MT7A 1NTKJ 3CWBG 2RKLA 1PFIA 3G4SP 1KB9E 1OVRA 3U7DA 3B5NB 1PP9G 3D8EA 3FEHA 2KP8A 1FOSE 3EFFK 1EZVD 5LONB 1RQVA 1IO4A 1GTWA 3U12A 1PGQA 1XD4A 2ZFCA 3O6QA 1S9KD 2I1JA 2AXTH 4WY4A 1L4AB 2K8EA 4H44C 2FFDA 4TT3H 1LTTC 4WY4C 1SQBJ 1M8OB 1TU3F 2Q3IA 1J19A 5BU5A 4TKNA 4PQ0A 3D6ZA 2P58A 2ROVA 4K3AA 3M9QA 4GODA 2W6AA 5JLJB 1T8ZA 4MK0A 1N7SD 4U7JA 2HE7A 1FDOA 1U57A 3DXEA 4HHVA 1M7LA 1IK9A 2LXBA 5APYA 3CC7P 2NPSB 2NPSD 3Q1MA 2CY5A 2QKMA 4WVFB 5CCGD 1SQPK 2GCJA 3UZTA 1SQQK 3AJ4A 1WRGA 1EDIA 3V5BA 1KD1Q 4HJGH 2KYVA 3LIEA 5AVZB 4KHBB 3JCUE 2I5CA 3RL0B 2C0WA 3USSA 3D8FA 5M4YB 2P2UA 3QWOC 2I5FA 3FGAD 1VF5D 3VTPC 2WQYC 1ZM0A 2R5DA 2E74C 2W6BA 1PV3A 2R0DA 3BVHA 1NU1E 1P84E 2RRFA 1AVYA 1MFZA 1JO5A 2AXCA 1NTKD 1GC6A 1URQC 1HBWA 3M1IB 2Z59A 2GA1A 4A6HA 1NGMB 4DBBA 1V5MA 2A45I 2YMKA 3TF5A 1NTZE 3V2NA 4H0LB 3HTKB 2KXPB 3Q2YA 2IBZI 3KRXA 5KJ7C 2A45G 4YONA 2WSEJ 2XDJA 1YJ9P 2L91A 1OIPA 3MUDC 3H1LG 2K2JA 1CI6B 1G1JA 1KFNA 1M1JB 5APXA 4HAWB 2C9NY 4H0LD 1BE3G 2E76C 2QG4A 2KNCA 2Z4EA 1CZQA 1SQBE 2MFQA 3HK0A 2I8DA 5C39A 2R3SA 5AW8B 1NI2A 1HJBA 2M5AA 3IF4A 2E75D 3T97A 3PEGA 2QJKC 1BGYG 5CCHC 3OANA 3PG7A 1NTVA 1VQ6P 2FJUB 3B5ND 2FKWB 1Q81Q 3SFEC 1USEA 3HD7C 3WU2E 3M0DC 1X1GA 3Q3DA 1YI2P 4NY0A 4U3FJ 3NWDA 1DX7A 1IJDB 3CMEP 4IL6H 3G9RA 4LLHA 3P8CE 1VQNP 5IRSA 3CD6P 2LR2A 1L0ND 1S2EA 2H8PD 5HE1A 2XV5A 1VQ8P 3U1CA 1P3RA 3K5BA 3WUUA 2QEXP 2P7JA 3HUSB 1OX3A 2HFED 4WB4A 5APQA 1JY2O 5AVWB 1ZR2A 1KYOH 1IFIA 1TQZA 1L4AC 2YKOA 2WITA 2HODA 2KZIA 1RRPB 1Y8AA 5KKZC 2YKPA 5BU8B 1VDFA 2KSEA 3AE6C 4TLFA 1I7AA 1V61A 2OYHC 1DEEG 1SFCA 3AEEC 5GTIE 2QJPC 3RCPA 4R4MA 1ZLLA 2YSZA 4W7ZA 1VL2A 3MP7B 3CC2P 3V4QA 4YL8A 2IBZD 1MPHA 5DJTB 3IFMA 2QSIA 2UZSA 1K5DB 2YT2A 4EDFA 1IFJA 3TCAA 1HTLC 2DHJA 2Z13A 1AQ5A 3B5NA 3RL0g 4QXAB 2FFDC 1X05A 3H1KG 4K17A 1ZRTD 3QBVB 2H7HA 5CLLB 1AWEA 4D6WA 2OQQA 1OWAA 1U2BA 1ZC3B 1GW3A 2P1JA 2HPCA 1WGUA 3VP9A 1KV4A 1RJ2A 1BGYE 5AW2B 1FZGA 1U7JA 3H1JJ 1OVVA 4O9BA 2FYNB 3CL3D 3Q5RA 2E2XA 3PLNA 3VP8A 2JEEA 2ELBA 3CCJP 2D9ZA 3W67A 3W68A 1BE3D 3H1JE 1NTMG 4DT0A 1ZN5A 1DIPA 1LW3A 3SV1A 4YXWH 3SYXA 4W80A 2WWWA 2AEHA 2KUBA 1JOCA 4D6TG 4B6HA 1X9VA 2BCCE 1FE6A 1YJWP 4HH2A 5I2MA 1QLED 2AXTE 2NBVA 1N7LA 4AQRD 4ASVA 4QJ5B 1NOHA 5TJHA 1FZFA 3ODWA 1VQPP 5KLIC 2OTXA 1JY3N 3TSIA 2IFMA 4PV1D 2ZT9C 2ZXEB 2O1JA 4UB8E 2D2CD 4N78E 1KN7A 2NPSC 2KIEA 1PP9J 5C5BA 2KIGA 4H0LC 2HYNA 1SFCB 2Q3EA 5DJUB 5K5GB 5AVUB 1HJ0A 3P7KA 2B87A 2M38A 2JWDA 2RNRB 1S9KE 1K9MQ 4HB1A 1MK9B 3C8VA 1RE3A 5D27A 1U5EA 3RK3D 1DD4A 2QVAA 2YT0A 2WSFH 5CCHD 3A5TA 3TNUB 4ZRJA 1NAYA 2M3BA 2Z5HA 3RL0C 2YF0A 3HIEA 2RN0A 2CPBA 2WT7A 1MAIA 3TYYA 2IYBA 5B5EH 4BBKA 1EQ7A 2VRSA 4DX90 2FYNC 4EKUA 1EF1A 2FYUE 3B4SA 3V6IA 3BCCE 4GT1A 1HF9A 4A6KA 4XWXA 4DOJA 3U8ZA 2D9WA 2OARA 3CXHD 5APTA 2BCCD 1EZVG 5CCGA 3PVUA 2LOZA 1B55A 3E1IA 2K2UA 4PD4D 1S5LH 5KJ7D 2KZJA 1OXZA 4MN4C 1IFMA 3H1HJ 3S9OA 4GPTB 3L72G 1T6AA 2ROZB 2KGXB 2B88A 4PNKA 2SPZA 1G2CA 4WY4B 5HE0A 2Y9YA 1GG3A 2YS1A 1NHLA 3H1IG 1UEFA 2P0FA 3OHMB 2PRRA 3CCQP 1GK6A 2EMSA 2FXMA 5D3XA 3WA0A 1BTNA 3PHLA 2KSJA 1EZVE 3GYPA 2WSCH 2QIWA 1NO4A 1JY2N 3A8PA 4HSIA 3ODXA 5KJ7A 4GDOA 2MWNB 2W8ZA 3B5NC 4F7GA 1VQ9P 1EVHA 4ZKUA 1LT1A 4WY4D 2IBZG 2IX7C 1GW4A 3MPXA 2PGDA 1KMIZ 5AW1B 3CX5H 1SP4A 2PFXA 5DH9B 1VQ4P 4QMAA 2X18A 2ZXXA 3OA7A 2QKLA 1ZVRA 1Q2NA 1HGZA 3F5HA 1KI1B 4D0NB 1OVUA 1ISNA 1BDCA 3L37A 1FS0E 2Q6QA 5FI0A 1KYOE 3F5RA 2N23A 4WBAA 4QJ4B 2EC1A 1JM0A 1S4XA 3PZDA 2K1AA 2O01J 3LW5H 2VRWB 2N1TC 4BRYB 3VMZA 2RMZA 3IR9A 2D9YA 3GHGA 3OW2O 1U7MA 2H7DA 1X11A 2GS0A 2M5AB 4LC1A 3H1LD 2FBWC 1IFPA 1L0NG 1VF5C 4MY6A 3AE8C 3HW2B 4EYYQ 2WPVB 4IOYX 1P84D 4OT1A 1NTZD 1X79B 1L0LK 3PH0A 3RK3B 2CODA 4HB4B 1KFMA 1IZNB 2BCCG 1P6SA 3M0DA 2Z4DA 4A7PA 1FZCA 1WVHA 1HH0A 1KQSO 2YVCA 3H32A 1LT9B 1G1IA 2RGNB 1VQ5P 3FWNA 4JF7A 2DA0A 3KXDA 4EIJA 3HE4A 2DYQA 1USDA 3DXDA 5AVQB 2KR0A 4OGQB 2IYOA 1W1GA 1AFOA 4I1LA 4RKUJ 4HKZH 2QE7H 2N9BA 3CX5I 2OYIB 1NKNA 3AU5A 3BATA 1X1FA 3WYFB 1MIZB 1NWQA 3BJIA 4GIFA 3D6YA 1HVVA 1NU1J 1LTSC 3CMAP 1L0NK 5L81A 4AUWA 1YQ3C 3CXBB 1SQQJ 3H6PA 3L70J 2IYPA 1MV8A 3A98B 1YTZI 4EOTA 2YT1A 1SQPJ 1UPRA 3A7OA 1OMIA 2R32A 1EDKA 5KLVJ 2E74B 1SQBG 1SFCC 1X22A 4HAVB 3L75E 2R44A 2GUSA 1L0NJ 3TVVA 1BCCG 3D71A 3B8EB 1S72P 1FZCC 2DTCA 1QX8A 4ZRKA 3AU4A 3P8CD 1QVGO 4WVZA 2JO1A 1R5LA 3H1LE 1AJYA 2RH0A 1NJIQ 1L0NE 2DHIA 1AV1A 5GTIH 1RF1B 2COCA 1FAOA 4K2OA 1ZYIA 2WPRA 1AQTA 2COAA 2ZT9D 2G3AA 3PP5A 2J59M 4OGQD 3VOPA 3R4YA 2RVBB 2Y0CA 1GK4A 1IFDA 1U5DA 2W83C 1AA0A 3U1AA 3L73D 4Y94A 5I2SA 4XA4A 2A06E 1AVOA 1KILC 3OAKA 4DZOA 1VQLP 1J1DC 3GW6A 1L4AD 1Q86Q 2A06D 2N9YB 3NXSA 1FDMA 3B77A 1CI6A 3M91A 1BCCD 1PZQA 3V5WA 3CWBD 3TK1A 3OJAB 1GL2A 1L0LG 2YNYA 1X86A 1GMJA 2OTLP 1QGKB 3RL0D 2COFA 2ZYDA 1RF0A 2IDBA 5L8RJ 2R2YA 3V2RA 3VMYA 2NMBA 1FAVA 1M56D 1U27A 3L4FA 3L75D 5KLIB 1JMMA 1ZC4B 1KQFB 1J1DB 3MUDA 4IL6X 1V5PA 2ZAEB 4W7YA 3Q5PA 1RF1A 3IVFA 1FJKA 1SQVD 1RY3A 4Y99B 1EGXA 1GL2D 1CSBA 2LKOA 3MZWB 1KZGA 1NYHA 1J1EC 1VF5B 3SNHA 3GLMA 1KTMA 2KS1B 1XODA 2OGUA 4N6JA 1LWUC 2OQBA 1IFNA 2M14A 2ELAA 3NWFA 1DDWA 3L73E 1LTJB 5KLVG 5APUA 1EC5A 3HD7A 1YTZT 2OTJP 1Z87A 4PV1B 3V2QA 3JC22 3ZVRA 3ZDMA 1QL2A 3SWFA 1SGHA 3BCCD 4H13B 1EXJA 2WSCJ 4A6FB 4RO0A 2KCJA 2QRXA 5CMZA 1T2KC 3PRJA 1J1EB 3TGUE 3FXDA 1LT9C 4XE5B 1UIIA 1P84H 3UIAA 4HATB 3VIAA 1PMSA 3PVLA 1RE3C 2LXCB 3EWKA 2E76B 5M1BA 2J5UA 2A06G 3WUTA 4KAXB 1NVOA 5AW7B 1RF0C 2FYUJ 2XNXA 5E79E 2YS3A 3BCCJ 1WJMA 5CBNA 4OWFA 3PJSK 3CLQA 4N78D 2CK3H 3ULBA 4YTPC 3HQCA 3Q5SA 1W1HA 4GKGA 3SWYA 4KVGB 1PPJD 1IRSA 1SQVJ 3N4XA 1OY2A 3P8MC 4DJGA 3AECC 1JCDA 1WG7A 4TYZA 2XQNM 4D6TE 1M1JA 1GL2B 4JQ0D 2KS1A 4ZKPA 2EJ8A 4ZNCA 1DEBA 2DW3A 4IFDK 3C1LA 2JDIH 3L71D 3E1RA 1JTHB 1MKMA 4GNKB 1EDLA 3M06A 3H25A 1OMWA 1YYCA 2N1TB 1SQXD 1WMKA 3A0BH 2KLVA 1GD2E 4H13D 2XKMA 2IZ0A 1EDJA 1ZXGA 1DYNA 1Q67A 1LTJC 2XU6A 5GTHE 2J58A 1PGOA 1JY2P 1KORA 1PP9D 1JNMA 2H89C 5DIFB
chains in the Genus database with same CATH topology
1OXZA 1XTGB 1BWNA 2WPSA 3KDPB 2HPCB 1IFMA 2HLOA 2KUPA 2KOGA 4MT7A 2UVMA 2MJZA 5KCVA 2JP2A 5C6RA 4GPTB 5D3VA 5DHAB 2ROZB 1PFIA 1MUUA 1FHOA 3L35A 2E43A 2KGXB 1LTGC 2UZRA 4PNKA 1IC2A 2N1TD 3U7DA 3TFMA 3B5NB 1G2CA 1URQB 2CPSA 4WY4B 1N73C 5HE0A 3D8EA 3FEHA 4HAYB 3MIWA 2KP8A 1FOSE 1GG3A 2YS1A 1P5TA 1LTIC 3X23A 5LONB 5CLQB 1K5GB 1NHLA 2C0XA 1UEFA 2P0FA 1GK6A 2EMSA 2DN6A 2FXMA 5D3XA 1IO4A 1GTWA 3WA0A 1XD4A 3ML4A 1BTNA 2KSJA 2ZFCA 3GYPA 2WSCH 1S9KD 2I1JA 2M8RA 1T3UA 3HRNA 1L4AB 1NO4A 4WY4A 5HE2A 1JY2N 2OYIA 2FFDA 3A8PA 3ODXA 5KJ7A 1LTTC 4LGDE 4WY4C 1N73B 3DXCA 5C5BB 2MWNB 2L2IA 2Q3IA 3O8ZA 3R2PA 3B5NC 1J19A 5BU5A 5D3WA 4F7GA 4TKNA 4PQ0A 1EVHA 3V4WA 4ZKUA 2ROVA 4C46A 4WY4D 3M9QA 3SO6A 5D3YA 2IX7C 2W6AA 2N0YA 1GW4A 4C7NB 1T8ZA 4MK0A 5JLJB 3MPXA 1N7SD 2HE7A 3KQGA 2JJLA 5AW1B 3N7NA 2K00A 3DXEA 1SP4A 5DH9B 4GXBA 5AW6B 1OQNA 3P7ZA 4HHVA 1SQVK 1M7LA 1IK9A 2X18A 1WT6A 2CY4A 2RSGA 3OA7A 5APYA 2QKLA 2NPSB 5JHGA 1ZVRA 4HAUB 5KQ1A 2NPSD 1E5WA 1HGZA 1JCCA 1KI1B 1KZ7A 3BINA 5HE3A 4D0NB 2CY5A 1UNRA 2Z5IA 1WGQA 2QKMA 4WVFB 5CCGD 1SQPK 4CHMA 1ISNA 2GCJA 3UZTA 3L37A 3MGNA 3ZDTA 2CAYA 1SQQK 1XCGA 3AJ4A 1WRGA 1N73A 2WZ7A 3V5BA 1ZV8A 5FI0A 3F5RA 1M7EA 2N23A 4JYCA 2KYVA 4WBAA 2H43A 2DYNA 3P32A 2EC1A 2J0KA 3O96A 4GMVA 4HB3B 3LIEA 5AVZB 3PZDA 4KHBB 2I5CA 3RL0B 3LW5H 5AVTB 2VRWB 1KILD 2C0WA 1KILB 2N1TC 3A2AA 1U5FA 3D8FA 3VMZA 4HYTB 3GHGC 3IR9A 3LJUX 2P2UA 2D9YA 3GHGA 2I5FA 1CW5A 3P6AA 2N1TA 2H7DA 2DKQA 3VTPC 1X11A 2GS0A 3KRWA 4WSFA 1ZM0A 2R5DA 3PSCA 4LC1A 1LGHB 1VPCA 2W6BA 1TXDA 3BVHA 2R0DA 5KQ4A 1SFCD 5AVVB 1MFZA 1JO5A 1T2KD 4MY6A 1AQCA 3VOQA 1LTAC 2O01H 1N86A 3HW2B 1GC6A 1JTHA 2ADZA 2YO2A 1URQC 1HBWA 4IOYX 1BAKA 1XTCC 2D2QA 3M1IB 1BTKA 2Z0OA 2D11A 1GU4A 3BASA 2QM8A 4HAZB 1X79B 3RK2D 1L0LK 1FOSF 4A6HA 3HE5A 3RK3B 2VSZA 1V5MA 2CODA 4DBBA 2A45I 3WMM0 1RF1C 2MDXA 3KSYA 2POHA 4HB4B 1KFMA 5APWA 2NZ8B 3N7CA 1FHWA 4GMXB 1P6SA 3RK2C 3M0DA 3V2NA 1SHCA 3KY9A 1FZCA 3HTKB 1HH0A 1WVHA 2W2XD 3H32A 1LT9B 2DLWA 2YVCA 2Z0PA 2P8VA 2YO3A 2LYDA 5C16A 1G1IA 3BRVB 2RGNB 4DX8A 2LULA 2W27A 4JF7A 2DA0A 1KQLA 4EIJA 1JY3P 3HE4A 2DYQA 3KRXA 3T06A 3DXDA 5KJ7C 5DI9B 4N3YB 5AVQB 2A45G 1FGYA 4YONA 2XDJA 2MKRA 1W1GA 1AFOA 1T3JA 1JY3O 4I1LA 1GL2C 2N9BA 2WSEH 2K2JA 4EMOA 1CI6B 1G1JA 1KFNA 1M1JB 1NKNA 3EFGA 3BATA 5APXA 1H8AA 2FFDB 2OYIB 1MIXA 1X1FA 2VKIA 3AU5A 4HAWB 1HUCA 3WYFB 4KHXA 1NWQA 1MIZB 3L36A 3BJIA 4GIFA 3V2PA 1HVVA 4DXAB 1LTSC 2C9NY 1L0NK 5L81A 2HG5D 4AUWA 2O1KA 3CXBB 4HAXB 2Z4EA 1CZQA 3D8DA 2CRFA 3EQ2A 3H6PA 2J0JA 2MFQA 3HK0A 1MV8A 4IFMA 4M3LA 3A98B 1YTZI 4EOTA 5AW8B 1J2JB 1NI2A 1UPRA 2YT1A 4F7HA 1HJBA 3A7OA 1Y5OA 4GZUA 2HODB 2R32A 2YMYA 3T97A 3HE4B 1W1DA 3PEGA 2YKQA 3II6A 1U29A 2D10A 1SFCC 4HAVB 5DHFB 2OYHA 1QL1A 3HD7D 2DHKA 2BCJA 5CCHC 2GUSA 3TVVA 3OANA 3PG7A 3M9HA 1NTVA 1URQD 3B5ND 3B8EB 1EAZA 2FKWB 1JUNA 1FZCC 2DTCA 1LTJA 5AVXB 3AU4A 4ZRKA 3HD7C 3P8CD 3M0DC 1X1GA 5AW0B 4NY0A 3ULCA 2DFKA 4C7RA 1DX7A 1IJDB 2GM4A 1H88A 3SUZA 1PLSA 2DHIA 4KHAA 4LLHA 3P8CE 1RF1B 2IPPA 1XX0A 1FAOA 2COCA 4HB0B 2AL6A 1FGZA 3GYOA 4K2OA 2WPRA 3HE5B 2COAA 2D4QA 2FJLA 1LWUA 2H8PD 5CHXA 5HE1A 4IAPA 2XV5A 1WJ1A 1H4RA 3PP5A 2J59M 2R09A 3HD7B 3U1CA 1FHXA 3VOPA 1P3RA 2RVBB 2YS5A 3NFQA 5DIFB 5CCHA 3KZ1A 1GK4A 3LIDA 2P0DA 2P7JA 3HUSB 1IFDA 3PP2A 1U5DA 2HFED 1X8YA 4WB4A 2LG1A 5APQA 1Z56A 3U1AA 1JY2O 5AVWB 1ZR4A 1ZR2A 4IFFA 2H7EA 1IFIA 2PAJA 1L4AC 1TQZA 4Y94A 2YKOA 4RESB 5EFXA 2WITA 4XA4A 1DDMA 2L5GB 1KILC 3OAKA 1GU5A 4Z2MB 1UNPA 4DZOA 2HODA 1RRPB 3KYQA 2L1CA 1J1DC 1V88A 1L4AD 3MDBC 2DX5A 2YKPA 1UNQA 4NSWA 3NXSA 5BU8B 1VDFA 1FU1A 1FDMA 4L6EA 5AW4B 1I7AA 1QQGA 1V61A 1CI6A 3M91A 2OYHC 2QM7A 1SFCA 2Q13A 5APVA 2YRYA 3V5WA 4Y99C 4HDQA 1RE4C 3TK1A 3OJAB 1GL2A 4F7UP 3RCPA 5JP4A 5CJ0A 2YNYA 1ZLLA 1X86A 2YSZA 3NSUA 2GUVA 3GHGB 4CHJA 3RL0D 2BASA 1QC6A 2COFA 4W7ZA 1TJ6A 1RF0A 1FB8A 2PZ1A 3V4QA 4Z2NA 4YL8A 1XR0B 1NKZB 1LB1A 5FI1A 1MPHA 4OH8B 5JHHA 5AW9B 5KLVK 3V2RA 3VMYA 2NMBA 1FAVA 3IFMA 2OYHB 1NAFA 2UZSA 1K5DB 1U27A 1IFJA 5LOPB 1N2DC 3TCAA 3L4FA 1HTLC 3CI9A 2DHJA 1AQ5A 3B5NA 1JMMA 3CIKA 3ODOA 1ZC4B 1GDTA 1A02F 1LT9A 1J1DB 3MUDA 2RLOA 4K81A 3VMXA 2FFDC 2OYIC 1X05A 1V5PA 3FSSA 1HGVA 1FZAA 1N7SC 4W7YA 4K17A 4P7IA 5AVSB 1NU1K 1RF1A 2V76A 2Z0QA 3IVFA 1DH3A 3QBVB 2H7HA 5CLLB 1LWUB 1RE4A 1GC7A 4ZRIA 1FJKA 5BVZA 2KB7P 1AWEA 1RY3A 4Y99B 4H8SA 1EGXA 1FJPA 1GL2D 1CSBA 1OWAA 5AVRB 1U2BA 1GW3A 1ZC3B 2P1JA 2LKOA 2RUKB 2HPCA 3C9IA 1KZGA 1WGUA 3VP9A 2A45H 1J1EC 1RJ2A 5AW2B 1FZGA 5CCGC 1V89A 3KPEA 3SNHA 3TNUA 2FYZA 4O9BA 3CL3D 2E2XA 1XODA 4N6JA 1LWUC 3VP8A 2JEEA 2ELBA 2OQBA 1IFNA 3A3YB 3MTUE 3RK3C 2D9ZA 3HUSA 2M14A 2ELAA 1NTYA 1DDWA 2I1KA 2P67A 1XKEA 1N7SA 1LTJB 5J3TA 2Y7BA 5APUA 3HD7A 1YTZT 5GOWB 1Z87A 1ZN5A 2FYUK 1LW3A 3SV1A 3V2QA 1DROA 3ZVRA 1QL2A 3M0AA 3SYXA 1LTBC 3A8QA 4W80A 3SWFA 2WWWA 1SGHA 3QIJA 2AEHA 4A6FB 3MD0A 3HTKA 1G2CB 4C7NA 2KCJA 1JOCA 5CMZA 5CJ4A 1UPQA 4B6HA 1T2KC 1I2HA 1X9VA 1NTKK 1J1EB 3U59A 4HH2A 1LT9C 2Y8FA 4XE5B 2IFNA 3UIAA 4HATB 3VIAA 1N7LA 2Y8GA 4AQRD 2Q5UA 1NOHA 1PMSA 2GJYA 1FZFA 3ODWA 1FZBA 1RE3C 2OTXA 3PVLA 1FBMA 1JY3N 1MZ9A 3TSIA 2IFMA 4HB2B 2J0MA 2LKMA 2ZXEB 5J3YA 2O1JA 3G9WA 4KAXB 3F0WA 5AW7B 1MK7B 1N3HA 1RF0C 4N78E 4C0AA 2XNXA 3G3ZA 2YS3A 4GN1A 2NPSC 1WJMA 2NPSA 1FZCB 5C5BA 1WI1A 3I5CA 1FZEA 3CLQA 4N78D 3ULBA 1L4AA 1SQXK 3HQCA 2HYNA 1W1HA 4GKGA 1SFCB 2D9VA 3SWYA 4IFSA 4KVGB 2GCLA 2D9XA 2LOXA 1SLQA 5AVUB 5KTBA 1W2EA 2PP6A 3P7KA 4B86A 1URQA 2M38A 1IRSA 3M9BA 3N4XA 1OY2A 2P0HA 2RNRB 3P8MC 4I6MC 1S9KE 2EMTA 1JCDA 1WG7A 3TW1A 1MK9B 2WT7B 4K2PA 4TYZA 1RE3A 2HTHB 1U5EA 3NMDA 3RK2B 3RK3D 5D27A 2XQNM 2W2WA 1U5GA 2E42A 1M1JA 1GL2B 5APSA 2YT0A 4WJ7A 5C79A 2WSFH 4ZKPA 5CCHD 2DKPA 1KILA 2EJ8A 2IFSA 1M7RA 1N7SB 1DEBA 1H10A 3A5TA 3TNUB 4ZRJA 2M3BA 4EJNA 2Z5HA 2WTYA 3RL0C 2YF0A 3TO1A 1SQBK 4IFDK 4A5KA 4CYEA 1NTMK 2CPBA 1H89A 3BRTB 2WT7A 1FOEA 1MAIA 3VYIA 3TYYA 3VN0A 2G35A 2IYBA 3FM8C 3QWMA 1JTHB 3PVWA 1EQ7A 1DBHA 1GZLA 4I2LC 4BBKA 2R5BA 2VRSA 1HWTC 1NH4A 2R3CA 1A02J 4DX90 5AW5B 1SVFA 1J0WA 1EF1A 4EKUA 5AVYB 4JYBA 3HUSC 3M06A 1MKEA 1OMWA 2Q7CA 4GT1A 1Y19B 2DX1A 4KHOA 1YYCA 2N1TB 1V5UA 4HDOA 2WPQA 1DDVA 4XWXA 4DOJA 4A6KA 3U8ZA 2KLVA 2XZRA 1GD2E 2C9LY 2XKMA 2W2XC 1ZSQA 2D9WA 2OARA 1DYNA 5APTA 1Q67A 5CCGA 1KZUB 1M1JC 3H32B 1LTJC 2XU6A 5J3QA 3PVUA 2LOZA 1B55A 5AW3B 2J58A 3E1IA 4AYCA 1JY2P 2Q9IA 4A6FA 2K2UA 1PFJA 5KJ7D 1JNMA 1NU2A 3NTNA 2ZPYA 1NTZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWN A;  2KUP A;  4MT7 A;  2UVM A;  5KCV A;  2JP2 A;  5C6R A;  4GPT B;  5D3V A;  5DHA B;  2ROZ B;  1FHO A;  2KGX B;  2UZR A;  4PNK A;  3U7D A;  3TFM A;  5HE0 A;  3D8E A;  3FEH A;  4HAY B;  1GG3 A;  2YS1 A;  1P5T A;  3X23 A;  5LON B;  5CLQ B;  1K5G B;  1UEF A;  2P0F A;  2EMS A;  2DN6 A;  5D3X A;  3WA0 A;  1XD4 A;  3ML4 A;  1BTN A;  3GYP A;  2WSC H;  2I1J A;  5HE2 A;  3A8P A;  3ODX A;  5C5B B;  3DXC A;  2MWN B;  2L2I A;  1J19 A;  4F7G A;  5D3W A;  4TKN A;  4PQ0 A;  1EVH A;  2ROV A;  3SO6 A;  3M9Q A;  5D3Y A;  2N0Y A;  5JLJ B;  4MK0 A;  3MPX A;  2HE7 A;  2K00 A;  3DXE A;  5DH9 B;  4GXB A;  1OQN A;  3P7Z A;  4HHV A;  1SQV K;  2X18 A;  2CY4 A;  2RSG A;  2QKL A;  5JHG A;  1ZVR A;  4HAU B;  5KQ1 A;  1KZ7 A;  1E5W A;  1KI1 B;  3BIN A;  4D0N B;  5HE3 A;  2CY5 A;  1UNR A;  1WGQ A;  2QKM A;  4WVF B;  1SQP K;  4CHM A;  1ISN A;  2GCJ A;  3UZT A;  3ZDT A;  2CAY A;  1SQQ K;  1XCG A;  3AJ4 A;  5FI0 A;  3F5R A;  1M7E A;  2N23 A;  2J0K A;  2DYN A;  3O96 A;  2EC1 A;  4GMV A;  4HB3 B;  3PZD A;  4KHB B;  2I5C A;  3LW5 H;  2VRW B;  1U5F A;  3D8F A;  3LJU X;  2D9Y A;  2I5F A;  3P6A A;  2H7D A;  2DKQ A;  3KRW A;  1X11 A;  2GS0 A;  4WSF A;  1ZM0 A;  1TXD A;  2R0D A;  5KQ4 A;  4MY6 A;  1AQC A;  3VOQ A;  2O01 H;  3HW2 B;  1GC6 A;  2ADZ A;  4IOY X;  1BAK A;  2D2Q A;  3M1I B;  1BTK A;  2Z0O A;  2D11 A;  4HAZ B;  1L0L K;  4A6H A;  2VSZ A;  1V5M A;  2COD A;  4DBB A;  2MDX A;  3KSY A;  4HB4 B;  2NZ8 B;  3N7C A;  1FHW A;  4GMX B;  1P6S A;  1SHC A;  3KY9 A;  1WVH A;  2W2X D;  2YVC A;  2Z0P A;  2DLW A;  2P8V A;  5C16 A;  2LYD A;  2RGN B;  4DX8 A;  2LUL A;  2DA0 A;  2DYQ A;  3KRX A;  3T06 A;  3DXD A;  5DI9 B;  1FGY A;  4YON A;  2MKR A;  1W1G A;  2WSE H;  2K2J A;  4EMO A;  2Z0Q A;  3AU5 A;  1MIX A;  1X1F A;  2VKI A;  4HAW B;  3WYF B;  1MIZ B;  3BJI A;  4DXA B;  1L0N K;  5L81 A;  3CXB B;  4HAX B;  3D8D A;  2CRF A;  2J0J A;  2MFQ A;  3HK0 A;  3A98 B;  1NI2 A;  2YT1 A;  1UPR A;  4F7H A;  1Y5O A;  4GZU A;  1W1D A;  3PEG A;  1U29 A;  2D10 A;  4HAV B;  5DHF B;  2DHK A;  2BCJ A;  3TVV A;  3OAN A;  3PG7 A;  1NTV A;  1EAZ A;  2DTC A;  4ZRK A;  3AU4 A;  3ULC A;  1X1G A;  4NY0 A;  2DFK A;  3SUZ A;  1PLS A;  2DHI A;  4KHA A;  1XX0 A;  1FAO A;  2COC A;  4HB0 B;  2AL6 A;  1FGZ A;  3GYO A;  4K2O A;  2COA A;  2D4Q A;  2FJL A;  5HE1 A;  4IAP A;  1WJ1 A;  1H4R A;  2J59 M;  2R09 A;  1FHX A;  1P3R A;  2RVB B;  2YS5 A;  5DIF B;  3KZ1 A;  2P0D A;  3PP2 A;  1U5D A;  2LG1 A;  2H7E A;  1TQZ A;  4Y94 A;  5EFX A;  1DDM A;  4Z2M B;  1UNP A;  1RRP B;  2L1C A;  1V88 A;  3MDB C;  2DX5 A;  1UNQ A;  4NSW A;  4L6E A;  1I7A A;  1QQG A;  1V61 A;  2Q13 A;  3V5W A;  2YRY A;  4HDQ A;  4F7U P;  3RCP A;  5JP4 A;  1X86 A;  2YSZ A;  3NSU A;  4CHJ A;  1QC6 A;  2COF A;  1TJ6 A;  1FB8 A;  2PZ1 A;  4Z2N A;  4YL8 A;  1XR0 B;  1LB1 A;  5FI1 A;  1MPH A;  5JHH A;  5KLV K;  2NMB A;  2UZS A;  1K5D B;  1U27 A;  5LOP B;  3TCA A;  2DHJ A;  3CIK A;  3ODO A;  1ZC4 B;  2RLO A;  4K81 A;  1X05 A;  1V5P A;  3FSS A;  4K17 A;  4P7I A;  1NU1 K;  2V76 A;  3IVF A;  3QBV B;  5CLL B;  1GC7 A;  4ZRI A;  1AWE A;  4H8S A;  1EGX A;  1ZC3 B;  1U2B A;  3PSC A;  2LKO A;  2RUK B;  1KZG A;  1WGU A;  1RJ2 A;  1V89 A;  3SNH A;  2E2X A;  1XOD A;  2OQB A;  2ELB A;  2D9Z A;  2M14 A;  2ELA A;  1NTY A;  1DDW A;  2I1K A;  1XKE A;  5J3T A;  2Y7B A;  5GOW B;  1Z87 A;  1LW3 A;  2FYU K;  3SV1 A;  1DRO A;  3ZVR A;  3SYX A;  3A8Q A;  1SGH A;  3QIJ A;  2AEH A;  4A6F B;  2KCJ A;  1UPQ A;  4B6H A;  1I2H A;  1NTK K;  2Y8F A;  4HAT B;  3VIA A;  2Y8G A;  1PMS A;  2GJY A;  3ODW A;  3PVL A;  2OTX A;  4HB2 B;  2J0M A;  2LKM A;  5J3Y A;  3G9W A;  4KAX B;  3F0W A;  1MK7 B;  1N3H A;  4C0A A;  3G3Z A;  2YS3 A;  4GN1 A;  1WJM A;  5C5B A;  1WI1 A;  3CLQ A;  3ULB A;  1SQX K;  3HQC A;  1W1H A;  2D9V A;  4IFS A;  4KVG B;  2GCL A;  2D9X A;  2LOX A;  2M38 A;  1IRS A;  1OY2 A;  2P0H A;  2RNR B;  2EMT A;  1WG7 A;  3TW1 A;  1MK9 B;  4K2P A;  4TYZ A;  2HTH B;  1U5E A;  5D27 A;  2XQN M;  2W2W A;  1U5G A;  2YT0 A;  4WJ7 A;  5C79 A;  2WSF H;  2DKP A;  2EJ8 A;  2IFS A;  1M7R A;  1H10 A;  4ZRJ A;  4EJN A;  2YF0 A;  3TO1 A;  1SQB K;  4IFD K;  4A5K A;  4CYE A;  1NTM K;  1FOE A;  1MAI A;  2G35 A;  2IYB A;  3FM8 C;  3QWM A;  3PVW A;  1DBH A;  4BBK A;  4DX9 0;  1J0W A;  1EF1 A;  4EKU A;  1MKE A;  1OMW A;  1Y19 B;  2DX1 A;  4KHO A;  1V5U A;  4HDO A;  1DDV A;  4XWX A;  4A6K A;  3U8Z A;  2W2X C;  1ZSQ A;  2D9W A;  2OAR A;  1DYN A;  1Q67 A;  5J3Q A;  3PVU A;  2LOZ A;  1B55 A;  4A6F A;  2K2U A;  1PFJ A;  1NU2 A;  2ZPY A;  1NTZ K; 
#chains in the Genus database with same CATH topology
 1XTG B;  4Y28 J;  2K9J A;  5LG4 B;  1NTZ J;  5KCV A;  3FXE A;  1PP9 E;  2JP2 A;  5C6R A;  5D3V A;  5DHA B;  4XFJ A;  1MUU A;  2E43 A;  1LTG C;  3AED C;  1NU1 D;  3ITK A;  3TFM A;  3AE2 C;  4U3F G;  1VQ7 P;  1N73 C;  1NTK E;  2JR8 A;  3H1K E;  3MIW A;  2ZJS E;  1LTI C;  3GMA A;  5CLQ B;  1SQP D;  2K9Y A;  2M8R A;  1LNQ A;  2OYI A;  4LGD E;  3DXC A;  1R8E A;  5B5E E;  3CCM P;  4PJ0 H;  1H0T B;  3L74 J;  1M57 D;  3JCU H;  4GOE A;  4C7N B;  3N7N A;  2K00 A;  3L75 G;  2KUQ A;  4GXB A;  1OQN A;  1WT6 A;  2CY4 A;  2RSG A;  1DD3 A;  2XND H;  1EZV I;  5KQ1 A;  4HAU B;  1E5W A;  3BIN A;  1JCC A;  4KHB A;  3PTZ A;  1UNR A;  1WGQ A;  4CHM A;  1SQB D;  1R5S A;  3ZDT A;  3MGN A;  3A58 A;  2K3R A;  1N73 A;  1ZV8 A;  1M7E A;  4JYC A;  3AE7 C;  2DYN A;  4K35 A;  3O96 A;  4GMV A;  2IZ1 A;  5AVT B;  1KIL D;  4HYT B;  1CW5 A;  3P6A A;  3MHV A;  2N1T A;  2NRG A;  4WSF A;  5KAI H;  1LGH B;  5KQ4 A;  2W90 A;  4I7Z B;  1T2K D;  3VOQ A;  1LTA C;  2Z14 A;  1N86 A;  1JTH A;  2NZ2 A;  2YO2 A;  2ADZ A;  1S5L E;  2D11 A;  3BAS A;  1SQP E;  2QM8 A;  3RK2 D;  1FOS F;  2G8Y A;  3TDK A;  1VQM P;  2MDX A;  5APW A;  2NZ8 B;  1LJ2 A;  2M3E A;  1FHW A;  3N7C A;  3KY9 A;  2W2X D;  5H2F E;  2P8V A;  2YO3 A;  4NPF X;  1Q82 Q;  4IOI H;  2W27 A;  1JY3 P;  3T06 A;  5DI9 B;  1JY3 O;  1GL2 C;  1SQX G;  4EMO A;  3EFG A;  1YHQ P;  2VKI A;  1RH5 B;  3FVC A;  4KHX A;  5KLV D;  4DXA B;  3I55 P;  2D2C B;  2HG5 D;  2O1K A;  3NW8 A;  4HAX B;  2CRF A;  3EQ2 A;  2J0J A;  4Z1M H;  3L74 E;  3BCC G;  1JMB A;  2FYU G;  1LP1 B;  4GZU A;  2YMY A;  3HE4 B;  2E74 D;  3II6 A;  1KIL E;  1BSH A;  1QL1 A;  3TGU G;  1KYO I;  2DHK A;  1SQV G;  3S4R A;  1X0T A;  1URQ D;  1EAZ A;  4UB8 H;  3ABV C;  5AVX B;  3L71 G;  1OZH A;  4C7R A;  1E79 H;  2GM4 A;  3SUZ A;  2YXQ B;  1PLS A;  2K88 A;  3FX0 A;  4KHA A;  2IPP A;  4HB0 B;  1NTK G;  3CWB J;  1FGZ A;  3H1I J;  3HE5 B;  4U3F E;  2FJL A;  1LWU A;  3H1I D;  5CHX A;  3CPW O;  3HD7 B;  1FHX A;  1M1K Q;  2YS5 A;  3H1I E;  5GTH H;  2Y9Z A;  3LID A;  3PP2 A;  4OGQ C;  1X8Y A;  2AEM A;  3CCE P;  2QJP B;  4NPE A;  3H1J D;  5B66 H;  2ZYA A;  2ZVO B;  2H7E A;  4NPD A;  1K04 A;  3L73 G;  5EFX A;  1DDM A;  2L5G B;  4Z2M B;  1UNP A;  2L1C A;  4UB6 E;  1FU1 A;  5AW4 B;  2B89 A;  1QQG A;  2QM7 A;  1H0T A;  5APV A;  2YRY A;  4Y99 C;  1ZP0 C;  4HDQ A;  4F7U P;  1MFT A;  3NSU A;  3T97 B;  2BAS A;  3B71 A;  3QH9 A;  1FDI A;  3TGU J;  2KK7 A;  1LB1 A;  1VQO P;  2OYH B;  1L0L E;  1N2D C;  1P84 I;  3ODO A;  2E75 B;  1GDT A;  1LT9 A;  2OTK E;  2OYI C;  1NTM J;  3FSS A;  4UB6 H;  4P7I A;  4I7Z C;  5AVS B;  1NU1 K;  1DH3 A;  5E79 H;  1LWU B;  1RE4 A;  3PSC A;  2RUK B;  3C9I A;  3GF7 A;  2FY8 A;  1SQV E;  3CC4 P;  4PD4 H;  3TNU A;  2FYZ A;  3A3Y B;  3RK3 C;  3L71 E;  1NTY A;  1N7S A;  2Y7B A;  4ASW A;  3H1H E;  4BWN A;  3G6E P;  3M0A A;  2FYU D;  3QIJ A;  1SQX E;  5CJ4 A;  1UPQ A;  1I2H A;  1JEK A;  2GUM A;  1BCC E;  3U59 A;  2Y8F A;  5KKZ B;  1L2P A;  2Q5U A;  2K9J B;  2AEF A;  3TGU D;  1FBM A;  4CPG A;  2J0M A;  2BEQ D;  5J3Y A;  4C0A A;  4BXL A;  4GN1 A;  4JBZ A;  2NPS A;  1WI1 A;  2E5Y A;  1SQX K;  1M90 Q;  2D9V A;  2GCL A;  1IK7 A;  1JB0 J;  1SLQ A;  1W2E A;  2PP6 A;  1URQ A;  3M9B A;  4I6M C;  1K73 Q;  3TW1 A;  3E7K A;  3AEF C;  2QA4 P;  3NMD A;  3RK2 B;  2K49 A;  1RQU A;  1U5G A;  2E42 A;  5APS A;  4WJ7 A;  5C79 A;  3HSA A;  2DKP A;  2ZVN B;  5EFW B;  1M7R A;  1N7S B;  2QJY C;  4EJN A;  4RJT A;  1KC8 Q;  4A5K A;  1NTM K;  3AE3 C;  1K8A Q;  1FOE A;  4GOU A;  1BE3 E;  2G35 A;  5KAI E;  1GZL A;  4I2L C;  1OW8 A;  3H1H D;  2R3C A;  1HWT C;  1A02 J;  5AW5 B;  1QVF O;  1J0W A;  5AVY B;  4JYB A;  1MKE A;  2Q7C A;  1ZW0 A;  2UWJ E;  2DX1 A;  4KHO A;  1V5U A;  1DDV A;  1RHZ B;  5B66 E;  2XZR A;  2C9L Y;  2W2X C;  1ZSQ A;  4KJM A;  1M1J C;  1ZME C;  5AW3 B;  2JKV A;  4H13 C;  4AYC A;  2D2C C;  1VQK P;  5TIS H;  4L73 A;  2WMM A;  1NU2 A;  2ZPY A;  1NTZ K;  2ZKM X;  1BWN A;  2WPS A;  1KB9 D;  2KUP A;  2UVM A;  2MJZ A;  4PD4 E;  2HR3 A;  1YQ4 C;  1FHO A;  3KZI H;  3L35 A;  2UZR A;  1IC2 A;  2N1T D;  2Q1K A;  1QEX A;  5KAF H;  1BSN A;  1YIT P;  1S3J A;  2CPS A;  1URQ B;  4HAY B;  1P5T A;  4PJ0 E;  3X23 A;  1K5G B;  2C0X A;  1Q90 D;  2DN6 A;  3CCS P;  4D6T J;  3ML4 A;  2V7Q H;  4OVN F;  2Y0D A;  2B9B A;  1Y9B A;  1T3U A;  3HRN A;  5HE2 A;  4PD4 I;  3I56 P;  1N73 B;  5C5B B;  2L2I A;  3DCX A;  3O8Z A;  3R2P A;  5D3W A;  2ITA A;  3WU2 H;  2ZYG A;  3V4W A;  4C46 A;  3SO6 A;  5D3Y A;  3A0H H;  3CX5 E;  2N0Y A;  4EI2 A;  3KQG A;  2JJL A;  5AW6 B;  3P7Z A;  1SQV K;  4R4L A;  5JHG A;  1KZ7 A;  1PGP A;  5HE3 A;  2Z5I A;  2WSF J;  3H1L J;  1KYO D;  4CSQ A;  3H1K J;  3L74 D;  2CAY A;  1XCG A;  2WZ7 A;  3SWK A;  2J0K A;  2H43 A;  1EXI A;  3P32 A;  4HB3 B;  4GOF A;  1KIL B;  3A2A A;  3AE5 C;  1U5F A;  3GHG C;  3LJU X;  2DKQ A;  3KRW A;  3D70 A;  1TXD A;  1VPC A;  4JPZ B;  3CCR P;  1SFC D;  5AVV B;  3O6Q B;  3CCV P;  1AQC A;  2O01 H;  1S1C X;  1BAK A;  1XTC C;  2D2Q A;  1BTK A;  2Z0O A;  1GU4 A;  3AE4 C;  4HAZ B;  3HE5 A;  1PGJ A;  2VSZ A;  3WMM 0;  1RF1 C;  3KSY A;  2POH A;  4GMX B;  3RK2 C;  1SHC A;  1KB9 H;  3FWL A;  2Z0P A;  2DLW A;  2V4H A;  2LYD A;  5C16 A;  2KIK A;  3BRV B;  4DX8 A;  1NTM D;  2LUL A;  1N8R Q;  1NTZ G;  1KQL A;  3H1H G;  2B87 B;  4DCK A;  3CXH H;  4N3Y B;  1FGY A;  2MKR A;  2H88 C;  5CBO A;  1T3J A;  1S5L X;  2WSE H;  3RGU A;  2FFD B;  2E76 D;  2Z0Q A;  1H8A A;  1MIX A;  1LP1 A;  1HUC A;  3L36 A;  3V2P A;  3D8D A;  3JSV C;  5KLV E;  4IFM A;  4M3L A;  4L76 A;  1J2J B;  2IBZ E;  4F7H A;  4L75 A;  1Y5O A;  2HOD B;  1W1D A;  2MKV A;  2YKQ A;  3L74 G;  1UIX A;  1U29 A;  1L0L D;  2D10 A;  5DHF B;  2AEJ A;  2OYH A;  3WUV A;  3HD7 D;  2BCJ A;  2QJK B;  1MI1 A;  1JUN A;  1LTJ A;  3ULC A;  2JP3 A;  2O01 N;  5AW0 B;  2DFK A;  1ZRT E;  2K37 A;  1H88 A;  1SQQ D;  3L70 D;  2KI7 B;  2YIU B;  4U3F D;  1XX0 A;  2W6J H;  2AL6 A;  3GYO A;  3LW5 J;  2D4Q A;  1Y47 A;  1SQP G;  3G71 P;  2O3J A;  4IAP A;  1WJ1 A;  1H4R A;  2R09 A;  1OW6 A;  3NFQ A;  5CCH A;  3KZ1 A;  2P0D A;  2LG1 A;  1Z56 A;  3A0B E;  1ZR4 A;  1YJN P;  3KHU A;  1NTM E;  4IFF A;  4L1R A;  2PAJ A;  3H1J G;  4RES B;  2BEZ F;  1GU5 A;  3KYQ A;  1V88 A;  1W2B O;  3MDB C;  2DX5 A;  1PL5 A;  1UNQ A;  4NSW A;  4L6E A;  2Q13 A;  1RE4 C;  3SFD C;  1OFC X;  5JP4 A;  5CJ0 A;  3RBX A;  3SSU A;  2GUV A;  3GHG B;  4CHJ A;  2E5T A;  1QC6 A;  3CWB E;  2BCC J;  1BCC J;  1TJ6 A;  3GG2 A;  1FB8 A;  2PZ1 A;  4Z2N A;  1XR0 B;  1NKZ B;  5FI1 A;  5JHH A;  4OH8 B;  5AW9 B;  5KLV K;  4H44 D;  2KLU A;  1NAF A;  3CXH I;  5LOP B;  3CI9 A;  1FC2 C;  3CIK A;  4DIX A;  2YIU C;  1A02 F;  2RLO A;  4K81 A;  3VMX A;  3NWA A;  5TIS E;  1HGV A;  1FZA A;  1N7S C;  4L74 A;  2V76 A;  1PPJ E;  1SQQ E;  3L70 E;  1GC7 A;  2FXO A;  4ZRI A;  5BVZ A;  2KB7 P;  1BGY D;  4H8S A;  1FJP A;  3GF3 A;  5AVR B;  2A45 H;  2KNC B;  1SQQ G;  3L70 G;  5CCG C;  3L73 J;  1V89 A;  3L75 J;  3KPE A;  1YIJ P;  1OW7 A;  1K05 A;  3MTU E;  3HUS A;  2I1K A;  2P67 A;  1XKE A;  5J3T A;  5H2F H;  1SS1 A;  5GOW B;  1T77 A;  2FYU K;  1DRO A;  1D7M A;  1W5C E;  1L0L J;  1LTB C;  3A8Q A;  3AEA C;  2V7Q J;  3MD0 A;  3HTK A;  1G2C B;  4C7N A;  4QJ3 B;  1Q7Y Q;  1NTK K;  2M0B A;  4PV1 C;  2IFN A;  2Y8G A;  2GJY A;  4YXD C;  1FZB A;  1MZ9 A;  1BE3 J;  2OYO A;  4HB2 B;  4IL6 E;  2LKM A;  1BDD A;  3G9W A;  3F0W A;  2JWA A;  3A0H E;  1N3H A;  3L72 E;  4YPC A;  1MK7 B;  3AE1 C;  4WWI A;  3G3Z A;  4OSN A;  1FZC B;  3I5C A;  3L72 D;  1FZE A;  3H1K D;  1L4A A;  3L72 J;  4IFS A;  2D9X A;  3AEB C;  2LOX A;  5KTB A;  4B86 A;  3CCL P;  3RK3 E;  1BGY J;  4KT0 J;  4D6T D;  2P0H A;  1KQG B;  2EMT A;  2WT7 B;  4K2P A;  2HTH B;  2Y0E A;  3IN6 A;  3VMA A;  2W2W A;  2QJY B;  3RBZ A;  3L71 J;  1KIL A;  2IFS A;  1H10 A;  1PPJ G;  1YBK A;  3KZI E;  2WTY A;  3CX5 D;  3TO1 A;  1SQB K;  4CYE A;  2E75 C;  1H89 A;  3BRT B;  4BRY A;  3VYI A;  3VN0 A;  3FM8 C;  2ZT9 B;  3QWM A;  3PVW A;  1DBH A;  1PIX A;  1SQX J;  2R5B A;  1NH4 A;  3S1K A;  4ZMD A;  1SVF A;  3HUS C;  1KB9 I;  3AE9 C;  1NU1 G;  2P10 A;  3AEG C;  1Y19 B;  4HDO A;  2WPQ A;  3IAO A;  1KZU B;  3H32 B;  5J3Q A;  2WSS H;  2WVR A;  5KAF E;  4H44 B;  2Q9I A;  4A6F A;  3F89 A;  1PFJ A;  3CXH E;  2FXP A;  3M9H A;  3NTN A;  3CCU P;  2YXR B;  1ZOY C;  3KDP B;  2HPC B;  2HLO A;  2KOG A;  4MT7 A;  1NTK J;  3CWB G;  2RKL A;  1PFI A;  3G4S P;  1KB9 E;  1OVR A;  3U7D A;  3B5N B;  1PP9 G;  3D8E A;  3FEH A;  2KP8 A;  1FOS E;  3EFF K;  1EZV D;  5LON B;  1RQV A;  1IO4 A;  1GTW A;  3U12 A;  1PGQ A;  1XD4 A;  2ZFC A;  3O6Q A;  1S9K D;  2I1J A;  2AXT H;  4WY4 A;  1L4A B;  2K8E A;  4H44 C;  2FFD A;  4TT3 H;  1LTT C;  4WY4 C;  1SQB J;  1M8O B;  1TU3 F;  2Q3I A;  1J19 A;  5BU5 A;  4TKN A;  4PQ0 A;  3D6Z A;  2P58 A;  2ROV A;  4K3A A;  3M9Q A;  4GOD A;  2W6A A;  5JLJ B;  1T8Z A;  4MK0 A;  1N7S D;  4U7J A;  2HE7 A;  1FDO A;  1U57 A;  3DXE A;  4HHV A;  1M7L A;  1IK9 A;  2LXB A;  5APY A;  3CC7 P;  2NPS B;  2NPS D;  3Q1M A;  2CY5 A;  2QKM A;  4WVF B;  5CCG D;  1SQP K;  2GCJ A;  3UZT A;  1SQQ K;  3AJ4 A;  1WRG A;  1EDI A;  3V5B A;  1KD1 Q;  4HJG H;  2KYV A;  3LIE A;  5AVZ B;  4KHB B;  3JCU E;  2I5C A;  3RL0 B;  2C0W A;  3USS A;  3D8F A;  5M4Y B;  2P2U A;  3QWO C;  2I5F A;  3FGA D;  1VF5 D;  3VTP C;  2WQY C;  1ZM0 A;  2R5D A;  2E74 C;  2W6B A;  1PV3 A;  2R0D A;  3BVH A;  1NU1 E;  1P84 E;  2RRF A;  1AVY A;  1MFZ A;  1JO5 A;  2AXC A;  1NTK D;  1GC6 A;  1URQ C;  1HBW A;  3M1I B;  2Z59 A;  2GA1 A;  4A6H A;  1NGM B;  4DBB A;  1V5M A;  2A45 I;  2YMK A;  3TF5 A;  1NTZ E;  3V2N A;  4H0L B;  3HTK B;  2KXP B;  3Q2Y A;  2IBZ I;  3KRX A;  5KJ7 C;  2A45 G;  4YON A;  2WSE J;  2XDJ A;  1YJ9 P;  2L91 A;  1OIP A;  3MUD C;  3H1L G;  2K2J A;  1CI6 B;  1G1J A;  1KFN A;  1M1J B;  5APX A;  4HAW B;  2C9N Y;  4H0L D;  1BE3 G;  2E76 C;  2QG4 A;  2KNC A;  2Z4E A;  1CZQ A;  1SQB E;  2MFQ A;  3HK0 A;  2I8D A;  5C39 A;  2R3S A;  5AW8 B;  1NI2 A;  1HJB A;  2M5A A;  3IF4 A;  2E75 D;  3T97 A;  3PEG A;  2QJK C;  1BGY G;  5CCH C;  3OAN A;  3PG7 A;  1NTV A;  1VQ6 P;  2FJU B;  3B5N D;  2FKW B;  1Q81 Q;  3SFE C;  1USE A;  3HD7 C;  3WU2 E;  3M0D C;  1X1G A;  3Q3D A;  1YI2 P;  4NY0 A;  4U3F J;  3NWD A;  1DX7 A;  1IJD B;  3CME P;  4IL6 H;  3G9R A;  4LLH A;  3P8C E;  1VQN P;  5IRS A;  3CD6 P;  2LR2 A;  1L0N D;  1S2E A;  2H8P D;  5HE1 A;  2XV5 A;  1VQ8 P;  3U1C A;  1P3R A;  3K5B A;  3WUU A;  2QEX P;  2P7J A;  3HUS B;  1OX3 A;  2HFE D;  4WB4 A;  5APQ A;  1JY2 O;  5AVW B;  1ZR2 A;  1KYO H;  1IFI A;  1TQZ A;  1L4A C;  2YKO A;  2WIT A;  2HOD A;  2KZI A;  1RRP B;  1Y8A A;  5KKZ C;  2YKP A;  5BU8 B;  1VDF A;  2KSE A;  3AE6 C;  4TLF A;  1I7A A;  1V61 A;  2OYH C;  1DEE G;  1SFC A;  3AEE C;  5GTI E;  2QJP C;  3RCP A;  4R4M A;  1ZLL A;  2YSZ A;  4W7Z A;  1VL2 A;  3MP7 B;  3CC2 P;  3V4Q A;  4YL8 A;  2IBZ D;  1MPH A;  5DJT B;  3IFM A;  2QSI A;  2UZS A;  1K5D B;  2YT2 A;  4EDF A;  1IFJ A;  3TCA A;  1HTL C;  2DHJ A;  2Z13 A;  1AQ5 A;  3B5N A;  3RL0 g;  4QXA B;  2FFD C;  1X05 A;  3H1K G;  4K17 A;  1ZRT D;  3QBV B;  2H7H A;  5CLL B;  1AWE A;  4D6W A;  2OQQ A;  1OWA A;  1U2B A;  1ZC3 B;  1GW3 A;  2P1J A;  2HPC A;  1WGU A;  3VP9 A;  1KV4 A;  1RJ2 A;  1BGY E;  5AW2 B;  1FZG A;  1U7J A;  3H1J J;  1OVV A;  4O9B A;  2FYN B;  3CL3 D;  3Q5R A;  2E2X A;  3PLN A;  3VP8 A;  2JEE A;  2ELB A;  3CCJ P;  2D9Z A;  3W67 A;  3W68 A;  1BE3 D;  3H1J E;  1NTM G;  4DT0 A;  1ZN5 A;  1DIP A;  1LW3 A;  3SV1 A;  4YXW H;  3SYX A;  4W80 A;  2WWW A;  2AEH A;  2KUB A;  1JOC A;  4D6T G;  4B6H A;  1X9V A;  2BCC E;  1FE6 A;  1YJW P;  4HH2 A;  5I2M A;  1QLE D;  2AXT E;  2NBV A;  1N7L A;  4AQR D;  4ASV A;  4QJ5 B;  1NOH A;  5TJH A;  1FZF A;  3ODW A;  1VQP P;  5KLI C;  2OTX A;  1JY3 N;  3TSI A;  2IFM A;  4PV1 D;  2ZT9 C;  2ZXE B;  2O1J A;  4UB8 E;  2D2C D;  4N78 E;  1KN7 A;  2NPS C;  2KIE A;  1PP9 J;  5C5B A;  2KIG A;  4H0L C;  2HYN A;  1SFC B;  2Q3E A;  5DJU B;  5K5G B;  5AVU B;  1HJ0 A;  3P7K A;  2B87 A;  2M38 A;  2JWD A;  2RNR B;  1S9K E;  1K9M Q;  4HB1 A;  1MK9 B;  3C8V A;  1RE3 A;  5D27 A;  1U5E A;  3RK3 D;  1DD4 A;  2QVA A;  2YT0 A;  2WSF H;  5CCH D;  3A5T A;  3TNU B;  4ZRJ A;  1NAY A;  2M3B A;  2Z5H A;  3RL0 C;  2YF0 A;  3HIE A;  2RN0 A;  2CPB A;  2WT7 A;  1MAI A;  3TYY A;  2IYB A;  5B5E H;  4BBK A;  1EQ7 A;  2VRS A;  4DX9 0;  2FYN C;  4EKU A;  1EF1 A;  2FYU E;  3B4S A;  3V6I A;  3BCC E;  4GT1 A;  1HF9 A;  4A6K A;  4XWX A;  4DOJ A;  3U8Z A;  2D9W A;  2OAR A;  3CXH D;  5APT A;  2BCC D;  1EZV G;  5CCG A;  3PVU A;  2LOZ A;  1B55 A;  3E1I A;  2K2U A;  4PD4 D;  1S5L H;  5KJ7 D;  2KZJ A;  1OXZ A;  4MN4 C;  1IFM A;  3H1H J;  3S9O A;  4GPT B;  3L72 G;  1T6A A;  2ROZ B;  2KGX B;  2B88 A;  4PNK A;  2SPZ A;  1G2C A;  4WY4 B;  5HE0 A;  2Y9Y A;  1GG3 A;  2YS1 A;  1NHL A;  3H1I G;  1UEF A;  2P0F A;  3OHM B;  2PRR A;  3CCQ P;  1GK6 A;  2EMS A;  2FXM A;  5D3X A;  3WA0 A;  1BTN A;  3PHL A;  2KSJ A;  1EZV E;  3GYP A;  2WSC H;  2QIW A;  1NO4 A;  1JY2 N;  3A8P A;  4HSI A;  3ODX A;  5KJ7 A;  4GDO A;  2MWN B;  2W8Z A;  3B5N C;  4F7G A;  1VQ9 P;  1EVH A;  4ZKU A;  1LT1 A;  4WY4 D;  2IBZ G;  2IX7 C;  1GW4 A;  3MPX A;  2PGD A;  1KMI Z;  5AW1 B;  3CX5 H;  1SP4 A;  2PFX A;  5DH9 B;  1VQ4 P;  4QMA A;  2X18 A;  2ZXX A;  3OA7 A;  2QKL A;  1ZVR A;  1Q2N A;  1HGZ A;  3F5H A;  1KI1 B;  4D0N B;  1OVU A;  1ISN A;  1BDC A;  3L37 A;  1FS0 E;  2Q6Q A;  5FI0 A;  1KYO E;  3F5R A;  2N23 A;  4WBA A;  4QJ4 B;  2EC1 A;  1JM0 A;  1S4X A;  3PZD A;  2K1A A;  2O01 J;  3LW5 H;  2VRW B;  2N1T C;  4BRY B;  3VMZ A;  2RMZ A;  3IR9 A;  2D9Y A;  3GHG A;  3OW2 O;  1U7M A;  2H7D A;  1X11 A;  2GS0 A;  2M5A B;  4LC1 A;  3H1L D;  2FBW C;  1IFP A;  1L0N G;  1VF5 C;  4MY6 A;  3AE8 C;  3HW2 B;  4EYY Q;  2WPV B;  4IOY X;  1P84 D;  4OT1 A;  1NTZ D;  1X79 B;  1L0L K;  3PH0 A;  3RK3 B;  2COD A;  4HB4 B;  1KFM A;  1IZN B;  2BCC G;  1P6S A;  3M0D A;  2Z4D A;  4A7P A;  1FZC A;  1WVH A;  1HH0 A;  1KQS O;  2YVC A;  3H32 A;  1LT9 B;  1G1I A;  2RGN B;  1VQ5 P;  3FWN A;  4JF7 A;  2DA0 A;  3KXD A;  4EIJ A;  3HE4 A;  2DYQ A;  1USD A;  3DXD A;  5AVQ B;  2KR0 A;  4OGQ B;  2IYO A;  1W1G A;  1AFO A;  4I1L A;  4RKU J;  4HKZ H;  2QE7 H;  2N9B A;  3CX5 I;  2OYI B;  1NKN A;  3AU5 A;  3BAT A;  1X1F A;  3WYF B;  1MIZ B;  1NWQ A;  3BJI A;  4GIF A;  3D6Y A;  1HVV A;  1NU1 J;  1LTS C;  3CMA P;  1L0N K;  5L81 A;  4AUW A;  1YQ3 C;  3CXB B;  1SQQ J;  3H6P A;  3L70 J;  2IYP A;  1MV8 A;  3A98 B;  1YTZ I;  4EOT A;  2YT1 A;  1SQP J;  1UPR A;  3A7O A;  1OMI A;  2R32 A;  1EDK A;  5KLV J;  2E74 B;  1SQB G;  1SFC C;  1X22 A;  4HAV B;  3L75 E;  2R44 A;  2GUS A;  1L0N J;  3TVV A;  1BCC G;  3D71 A;  3B8E B;  1S72 P;  1FZC C;  2DTC A;  1QX8 A;  4ZRK A;  3AU4 A;  3P8C D;  1QVG O;  4WVZ A;  2JO1 A;  1R5L A;  3H1L E;  1AJY A;  2RH0 A;  1NJI Q;  1L0N E;  2DHI A;  1AV1 A;  5GTI H;  1RF1 B;  2COC A;  1FAO A;  4K2O A;  1ZYI A;  2WPR A;  1AQT A;  2COA A;  2ZT9 D;  2G3A A;  3PP5 A;  2J59 M;  4OGQ D;  3VOP A;  3R4Y A;  2RVB B;  2Y0C A;  1GK4 A;  1IFD A;  1U5D A;  2W83 C;  1AA0 A;  3U1A A;  3L73 D;  4Y94 A;  5I2S A;  4XA4 A;  2A06 E;  1AVO A;  1KIL C;  3OAK A;  4DZO A;  1VQL P;  1J1D C;  3GW6 A;  1L4A D;  1Q86 Q;  2A06 D;  2N9Y B;  3NXS A;  1FDM A;  3B77 A;  1CI6 A;  3M91 A;  1BCC D;  1PZQ A;  3V5W A;  3CWB D;  3TK1 A;  3OJA B;  1GL2 A;  1L0L G;  2YNY A;  1X86 A;  1GMJ A;  2OTL P;  1QGK B;  3RL0 D;  2COF A;  2ZYD A;  1RF0 A;  2IDB A;  5L8R J;  2R2Y A;  3V2R A;  3VMY A;  2NMB A;  1FAV A;  1M56 D;  1U27 A;  3L4F A;  3L75 D;  5KLI B;  1JMM A;  1ZC4 B;  1KQF B;  1J1D B;  3MUD A;  4IL6 X;  1V5P A;  2ZAE B;  4W7Y A;  3Q5P A;  1RF1 A;  3IVF A;  1FJK A;  1SQV D;  1RY3 A;  4Y99 B;  1EGX A;  1GL2 D;  1CSB A;  2LKO A;  3MZW B;  1KZG A;  1NYH A;  1J1E C;  1VF5 B;  3SNH A;  3GLM A;  1KTM A;  2KS1 B;  1XOD A;  2OGU A;  4N6J A;  1LWU C;  2OQB A;  1IFN A;  2M14 A;  2ELA A;  3NWF A;  1DDW A;  3L73 E;  1LTJ B;  5KLV G;  5APU A;  1EC5 A;  3HD7 A;  1YTZ T;  2OTJ P;  1Z87 A;  4PV1 B;  3V2Q A;  3JC2 2;  3ZVR A;  3ZDM A;  1QL2 A;  3SWF A;  1SGH A;  3BCC D;  4H13 B;  1EXJ A;  2WSC J;  4A6F B;  4RO0 A;  2KCJ A;  2QRX A;  5CMZ A;  1T2K C;  3PRJ A;  1J1E B;  3TGU E;  3FXD A;  1LT9 C;  4XE5 B;  1UII A;  1P84 H;  3UIA A;  4HAT B;  3VIA A;  1PMS A;  3PVL A;  1RE3 C;  2LXC B;  3EWK A;  2E76 B;  5M1B A;  2J5U A;  2A06 G;  3WUT A;  4KAX B;  1NVO A;  5AW7 B;  1RF0 C;  2FYU J;  2XNX A;  5E79 E;  2YS3 A;  3BCC J;  1WJM A;  5CBN A;  4OWF A;  3PJS K;  3CLQ A;  4N78 D;  2CK3 H;  3ULB A;  4YTP C;  3HQC A;  3Q5S A;  1W1H A;  4GKG A;  3SWY A;  4KVG B;  1PPJ D;  1IRS A;  1SQV J;  3N4X A;  1OY2 A;  3P8M C;  4DJG A;  3AEC C;  1JCD A;  1WG7 A;  4TYZ A;  2XQN M;  4D6T E;  1M1J A;  1GL2 B;  4JQ0 D;  2KS1 A;  4ZKP A;  2EJ8 A;  4ZNC A;  1DEB A;  2DW3 A;  4IFD K;  3C1L A;  2JDI H;  3L71 D;  3E1R A;  1JTH B;  1MKM A;  4GNK B;  1EDL A;  3M06 A;  3H25 A;  1OMW A;  1YYC A;  2N1T B;  1SQX D;  1WMK A;  3A0B H;  2KLV A;  1GD2 E;  4H13 D;  2XKM A;  2IZ0 A;  1EDJ A;  1ZXG A;  1DYN A;  1Q67 A;  1LTJ C;  2XU6 A;  5GTH E;  2J58 A;  1PGO A;  1JY2 P;  1KOR A;  1PP9 D;  1JNM A;  2H89 C;  5DIF B; 
#chains in the Genus database with same CATH homology
 1OXZ A;  1XTG B;  1BWN A;  2WPS A;  3KDP B;  2HPC B;  1IFM A;  2HLO A;  2KUP A;  2KOG A;  4MT7 A;  2UVM A;  2MJZ A;  5KCV A;  2JP2 A;  5C6R A;  4GPT B;  5D3V A;  5DHA B;  2ROZ B;  1PFI A;  1MUU A;  1FHO A;  3L35 A;  2E43 A;  2KGX B;  1LTG C;  2UZR A;  4PNK A;  1IC2 A;  2N1T D;  3U7D A;  3TFM A;  3B5N B;  1G2C A;  1URQ B;  2CPS A;  4WY4 B;  1N73 C;  5HE0 A;  3D8E A;  3FEH A;  4HAY B;  3MIW A;  2KP8 A;  1FOS E;  1GG3 A;  2YS1 A;  1P5T A;  1LTI C;  3X23 A;  5LON B;  5CLQ B;  1K5G B;  1NHL A;  2C0X A;  1UEF A;  2P0F A;  1GK6 A;  2EMS A;  2DN6 A;  2FXM A;  5D3X A;  1IO4 A;  1GTW A;  3WA0 A;  1XD4 A;  3ML4 A;  1BTN A;  2KSJ A;  2ZFC A;  3GYP A;  2WSC H;  1S9K D;  2I1J A;  2M8R A;  1T3U A;  3HRN A;  1L4A B;  1NO4 A;  4WY4 A;  5HE2 A;  1JY2 N;  2OYI A;  2FFD A;  3A8P A;  3ODX A;  5KJ7 A;  1LTT C;  4LGD E;  4WY4 C;  1N73 B;  3DXC A;  5C5B B;  2MWN B;  2L2I A;  2Q3I A;  3O8Z A;  3R2P A;  3B5N C;  1J19 A;  5BU5 A;  5D3W A;  4F7G A;  4TKN A;  4PQ0 A;  1EVH A;  3V4W A;  4ZKU A;  2ROV A;  4C46 A;  4WY4 D;  3M9Q A;  3SO6 A;  5D3Y A;  2IX7 C;  2W6A A;  2N0Y A;  1GW4 A;  4C7N B;  1T8Z A;  4MK0 A;  5JLJ B;  3MPX A;  1N7S D;  2HE7 A;  3KQG A;  2JJL A;  5AW1 B;  3N7N A;  2K00 A;  3DXE A;  1SP4 A;  5DH9 B;  4GXB A;  5AW6 B;  1OQN A;  3P7Z A;  4HHV A;  1SQV K;  1M7L A;  1IK9 A;  2X18 A;  1WT6 A;  2CY4 A;  2RSG A;  3OA7 A;  5APY A;  2QKL A;  2NPS B;  5JHG A;  1ZVR A;  4HAU B;  5KQ1 A;  2NPS D;  1E5W A;  1HGZ A;  1JCC A;  1KI1 B;  1KZ7 A;  3BIN A;  5HE3 A;  4D0N B;  2CY5 A;  1UNR A;  2Z5I A;  1WGQ A;  2QKM A;  4WVF B;  5CCG D;  1SQP K;  4CHM A;  1ISN A;  2GCJ A;  3UZT A;  3L37 A;  3MGN A;  3ZDT A;  2CAY A;  1SQQ K;  1XCG A;  3AJ4 A;  1WRG A;  1N73 A;  2WZ7 A;  3V5B A;  1ZV8 A;  5FI0 A;  3F5R A;  1M7E A;  2N23 A;  4JYC A;  2KYV A;  4WBA A;  2H43 A;  2DYN A;  3P32 A;  2EC1 A;  2J0K A;  3O96 A;  4GMV A;  4HB3 B;  3LIE A;  5AVZ B;  3PZD A;  4KHB B;  2I5C A;  3RL0 B;  3LW5 H;  5AVT B;  2VRW B;  1KIL D;  2C0W A;  1KIL B;  2N1T C;  3A2A A;  1U5F A;  3D8F A;  3VMZ A;  4HYT B;  3GHG C;  3IR9 A;  3LJU X;  2P2U A;  2D9Y A;  3GHG A;  2I5F A;  1CW5 A;  3P6A A;  2N1T A;  2H7D A;  2DKQ A;  3VTP C;  1X11 A;  2GS0 A;  3KRW A;  4WSF A;  1ZM0 A;  2R5D A;  3PSC A;  4LC1 A;  1LGH B;  1VPC A;  2W6B A;  1TXD A;  3BVH A;  2R0D A;  5KQ4 A;  1SFC D;  5AVV B;  1MFZ A;  1JO5 A;  1T2K D;  4MY6 A;  1AQC A;  3VOQ A;  1LTA C;  2O01 H;  1N86 A;  3HW2 B;  1GC6 A;  1JTH A;  2ADZ A;  2YO2 A;  1URQ C;  1HBW A;  4IOY X;  1BAK A;  1XTC C;  2D2Q A;  3M1I B;  1BTK A;  2Z0O A;  2D11 A;  1GU4 A;  3BAS A;  2QM8 A;  4HAZ B;  1X79 B;  3RK2 D;  1L0L K;  1FOS F;  4A6H A;  3HE5 A;  3RK3 B;  2VSZ A;  1V5M A;  2COD A;  4DBB A;  2A45 I;  3WMM 0;  1RF1 C;  2MDX A;  3KSY A;  2POH A;  4HB4 B;  1KFM A;  5APW A;  2NZ8 B;  3N7C A;  1FHW A;  4GMX B;  1P6S A;  3RK2 C;  3M0D A;  3V2N A;  1SHC A;  3KY9 A;  1FZC A;  3HTK B;  1HH0 A;  1WVH A;  2W2X D;  3H32 A;  1LT9 B;  2DLW A;  2YVC A;  2Z0P A;  2P8V A;  2YO3 A;  2LYD A;  5C16 A;  1G1I A;  3BRV B;  2RGN B;  4DX8 A;  2LUL A;  2W27 A;  4JF7 A;  2DA0 A;  1KQL A;  4EIJ A;  1JY3 P;  3HE4 A;  2DYQ A;  3KRX A;  3T06 A;  3DXD A;  5KJ7 C;  5DI9 B;  4N3Y B;  5AVQ B;  2A45 G;  1FGY A;  4YON A;  2XDJ A;  2MKR A;  1W1G A;  1AFO A;  1T3J A;  1JY3 O;  4I1L A;  1GL2 C;  2N9B A;  2WSE H;  2K2J A;  4EMO A;  1CI6 B;  1G1J A;  1KFN A;  1M1J B;  1NKN A;  3EFG A;  3BAT A;  5APX A;  1H8A A;  2FFD B;  2OYI B;  1MIX A;  1X1F A;  2VKI A;  3AU5 A;  4HAW B;  1HUC A;  3WYF B;  4KHX A;  1NWQ A;  1MIZ B;  3L36 A;  3BJI A;  4GIF A;  3V2P A;  1HVV A;  4DXA B;  1LTS C;  2C9N Y;  1L0N K;  5L81 A;  2HG5 D;  4AUW A;  2O1K A;  3CXB B;  4HAX B;  2Z4E A;  1CZQ A;  3D8D A;  2CRF A;  3EQ2 A;  3H6P A;  2J0J A;  2MFQ A;  3HK0 A;  1MV8 A;  4IFM A;  4M3L A;  3A98 B;  1YTZ I;  4EOT A;  5AW8 B;  1J2J B;  1NI2 A;  1UPR A;  2YT1 A;  4F7H A;  1HJB A;  3A7O A;  1Y5O A;  4GZU A;  2HOD B;  2R32 A;  2YMY A;  3T97 A;  3HE4 B;  1W1D A;  3PEG A;  2YKQ A;  3II6 A;  1U29 A;  2D10 A;  1SFC C;  4HAV B;  5DHF B;  2OYH A;  1QL1 A;  3HD7 D;  2DHK A;  2BCJ A;  5CCH C;  2GUS A;  3TVV A;  3OAN A;  3PG7 A;  3M9H A;  1NTV A;  1URQ D;  3B5N D;  3B8E B;  1EAZ A;  2FKW B;  1JUN A;  1FZC C;  2DTC A;  1LTJ A;  5AVX B;  3AU4 A;  4ZRK A;  3HD7 C;  3P8C D;  3M0D C;  1X1G A;  5AW0 B;  4NY0 A;  3ULC A;  2DFK A;  4C7R A;  1DX7 A;  1IJD B;  2GM4 A;  1H88 A;  3SUZ A;  1PLS A;  2DHI A;  4KHA A;  4LLH A;  3P8C E;  1RF1 B;  2IPP A;  1XX0 A;  1FAO A;  2COC A;  4HB0 B;  2AL6 A;  1FGZ A;  3GYO A;  4K2O A;  2WPR A;  3HE5 B;  2COA A;  2D4Q A;  2FJL A;  1LWU A;  2H8P D;  5CHX A;  5HE1 A;  4IAP A;  2XV5 A;  1WJ1 A;  1H4R A;  3PP5 A;  2J59 M;  2R09 A;  3HD7 B;  3U1C A;  1FHX A;  3VOP A;  1P3R A;  2RVB B;  2YS5 A;  3NFQ A;  5DIF B;  5CCH A;  3KZ1 A;  1GK4 A;  3LID A;  2P0D A;  2P7J A;  3HUS B;  1IFD A;  3PP2 A;  1U5D A;  2HFE D;  1X8Y A;  4WB4 A;  2LG1 A;  5APQ A;  1Z56 A;  3U1A A;  1JY2 O;  5AVW B;  1ZR4 A;  1ZR2 A;  4IFF A;  2H7E A;  1IFI A;  2PAJ A;  1L4A C;  1TQZ A;  4Y94 A;  2YKO A;  4RES B;  5EFX A;  2WIT A;  4XA4 A;  1DDM A;  2L5G B;  1KIL C;  3OAK A;  1GU5 A;  4Z2M B;  1UNP A;  4DZO A;  2HOD A;  1RRP B;  3KYQ A;  2L1C A;  1J1D C;  1V88 A;  1L4A D;  3MDB C;  2DX5 A;  2YKP A;  1UNQ A;  4NSW A;  3NXS A;  5BU8 B;  1VDF A;  1FU1 A;  1FDM A;  4L6E A;  5AW4 B;  1I7A A;  1QQG A;  1V61 A;  1CI6 A;  3M91 A;  2OYH C;  2QM7 A;  1SFC A;  2Q13 A;  5APV A;  2YRY A;  3V5W A;  4Y99 C;  4HDQ A;  1RE4 C;  3TK1 A;  3OJA B;  1GL2 A;  4F7U P;  3RCP A;  5JP4 A;  5CJ0 A;  2YNY A;  1ZLL A;  1X86 A;  2YSZ A;  3NSU A;  2GUV A;  3GHG B;  4CHJ A;  3RL0 D;  2BAS A;  1QC6 A;  2COF A;  4W7Z A;  1TJ6 A;  1RF0 A;  1FB8 A;  2PZ1 A;  3V4Q A;  4Z2N A;  4YL8 A;  1XR0 B;  1NKZ B;  1LB1 A;  5FI1 A;  1MPH A;  4OH8 B;  5JHH A;  5AW9 B;  5KLV K;  3V2R A;  3VMY A;  2NMB A;  1FAV A;  3IFM A;  2OYH B;  1NAF A;  2UZS A;  1K5D B;  1U27 A;  1IFJ A;  5LOP B;  1N2D C;  3TCA A;  3L4F A;  1HTL C;  3CI9 A;  2DHJ A;  1AQ5 A;  3B5N A;  1JMM A;  3CIK A;  3ODO A;  1ZC4 B;  1GDT A;  1A02 F;  1LT9 A;  1J1D B;  3MUD A;  2RLO A;  4K81 A;  3VMX A;  2FFD C;  2OYI C;  1X05 A;  1V5P A;  3FSS A;  1HGV A;  1FZA A;  1N7S C;  4W7Y A;  4K17 A;  4P7I A;  5AVS B;  1NU1 K;  1RF1 A;  2V76 A;  2Z0Q A;  3IVF A;  1DH3 A;  3QBV B;  2H7H A;  5CLL B;  1LWU B;  1RE4 A;  1GC7 A;  4ZRI A;  1FJK A;  5BVZ A;  2KB7 P;  1AWE A;  1RY3 A;  4Y99 B;  4H8S A;  1EGX A;  1FJP A;  1GL2 D;  1CSB A;  1OWA A;  5AVR B;  1U2B A;  1GW3 A;  1ZC3 B;  2P1J A;  2LKO A;  2RUK B;  2HPC A;  3C9I A;  1KZG A;  1WGU A;  3VP9 A;  2A45 H;  1J1E C;  1RJ2 A;  5AW2 B;  1FZG A;  5CCG C;  1V89 A;  3KPE A;  3SNH A;  3TNU A;  2FYZ A;  4O9B A;  3CL3 D;  2E2X A;  1XOD A;  4N6J A;  1LWU C;  3VP8 A;  2JEE A;  2ELB A;  2OQB A;  1IFN A;  3A3Y B;  3MTU E;  3RK3 C;  2D9Z A;  3HUS A;  2M14 A;  2ELA A;  1NTY A;  1DDW A;  2I1K A;  2P67 A;  1XKE A;  1N7S A;  1LTJ B;  5J3T A;  2Y7B A;  5APU A;  3HD7 A;  1YTZ T;  5GOW B;  1Z87 A;  1ZN5 A;  2FYU K;  1LW3 A;  3SV1 A;  3V2Q A;  1DRO A;  3ZVR A;  1QL2 A;  3M0A A;  3SYX A;  1LTB C;  3A8Q A;  4W80 A;  3SWF A;  2WWW A;  1SGH A;  3QIJ A;  2AEH A;  4A6F B;  3MD0 A;  3HTK A;  1G2C B;  4C7N A;  2KCJ A;  1JOC A;  5CMZ A;  5CJ4 A;  1UPQ A;  4B6H A;  1T2K C;  1I2H A;  1X9V A;  1NTK K;  1J1E B;  3U59 A;  4HH2 A;  1LT9 C;  2Y8F A;  4XE5 B;  2IFN A;  3UIA A;  4HAT B;  3VIA A;  1N7L A;  2Y8G A;  4AQR D;  2Q5U A;  1NOH A;  1PMS A;  2GJY A;  1FZF A;  3ODW A;  1FZB A;  1RE3 C;  2OTX A;  3PVL A;  1FBM A;  1JY3 N;  1MZ9 A;  3TSI A;  2IFM A;  4HB2 B;  2J0M A;  2LKM A;  2ZXE B;  5J3Y A;  2O1J A;  3G9W A;  4KAX B;  3F0W A;  5AW7 B;  1MK7 B;  1N3H A;  1RF0 C;  4N78 E;  4C0A A;  2XNX A;  3G3Z A;  2YS3 A;  4GN1 A;  2NPS C;  1WJM A;  2NPS A;  1FZC B;  5C5B A;  1WI1 A;  3I5C A;  1FZE A;  3CLQ A;  4N78 D;  3ULB A;  1L4A A;  1SQX K;  3HQC A;  2HYN A;  1W1H A;  4GKG A;  1SFC B;  2D9V A;  3SWY A;  4IFS A;  4KVG B;  2GCL A;  2D9X A;  2LOX A;  1SLQ A;  5AVU B;  5KTB A;  1W2E A;  2PP6 A;  3P7K A;  4B86 A;  1URQ A;  2M38 A;  1IRS A;  3M9B A;  3N4X A;  1OY2 A;  2P0H A;  2RNR B;  3P8M C;  4I6M C;  1S9K E;  2EMT A;  1JCD A;  1WG7 A;  3TW1 A;  1MK9 B;  2WT7 B;  4K2P A;  4TYZ A;  1RE3 A;  2HTH B;  1U5E A;  3NMD A;  3RK2 B;  3RK3 D;  5D27 A;  2XQN M;  2W2W A;  1U5G A;  2E42 A;  1M1J A;  1GL2 B;  5APS A;  2YT0 A;  4WJ7 A;  5C79 A;  2WSF H;  4ZKP A;  5CCH D;  2DKP A;  1KIL A;  2EJ8 A;  2IFS A;  1M7R A;  1N7S B;  1DEB A;  1H10 A;  3A5T A;  3TNU B;  4ZRJ A;  2M3B A;  4EJN A;  2Z5H A;  2WTY A;  3RL0 C;  2YF0 A;  3TO1 A;  1SQB K;  4IFD K;  4A5K A;  4CYE A;  1NTM K;  2CPB A;  1H89 A;  3BRT B;  2WT7 A;  1FOE A;  1MAI A;  3VYI A;  3TYY A;  3VN0 A;  2G35 A;  2IYB A;  3FM8 C;  3QWM A;  1JTH B;  3PVW A;  1EQ7 A;  1DBH A;  1GZL A;  4I2L C;  4BBK A;  2R5B A;  2VRS A;  1HWT C;  1NH4 A;  2R3C A;  1A02 J;  4DX9 0;  5AW5 B;  1SVF A;  1J0W A;  1EF1 A;  4EKU A;  5AVY B;  4JYB A;  3HUS C;  3M06 A;  1MKE A;  1OMW A;  2Q7C A;  4GT1 A;  1Y19 B;  2DX1 A;  4KHO A;  1YYC A;  2N1T B;  1V5U A;  4HDO A;  2WPQ A;  1DDV A;  4XWX A;  4DOJ A;  4A6K A;  3U8Z A;  2KLV A;  2XZR A;  1GD2 E;  2C9L Y;  2XKM A;  2W2X C;  1ZSQ A;  2D9W A;  2OAR A;  1DYN A;  5APT A;  1Q67 A;  5CCG A;  1KZU B;  1M1J C;  3H32 B;  1LTJ C;  2XU6 A;  5J3Q A;  3PVU A;  2LOZ A;  1B55 A;  5AW3 B;  2J58 A;  3E1I A;  4AYC A;  1JY2 P;  2Q9I A;  4A6F A;  2K2U A;  1PFJ A;  5KJ7 D;  1JNM A;  1NU2 A;  3NTN A;  2ZPY A;  1NTZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...