2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
3N7CA 2LKMA 3M1IB 1MIXA 2YT1A 3ML4A 2M38A 2W2XC 3KSYA 2WSFH 4K81A 4YONA 1PLSA 3PP2A 1U2BA 3U8ZA 2COCA 4PNKA 1NTVA 2GS0A 2EJ8A 1PMSA 2YVCA 1U5DA 3PZDA 3HW2B 2I1JA 2KGXB 1FHXA 1SQPK 2RSGA 1BWNA 4L6EA 2ELBA 2XQNM 4HB3B 2CODA 1FOEA 1QQGA 1DDVA 3HQCA 3QWMA 2D9WA 4P7IA 3LW5H 3HK0A 3CIKA 5DIFB 3G3ZA 2KUPA 5FI0A 1WGUA 4HB4B 2YT0A 5J3QA 1UNPA 4HATB 4F7GA 4GN1A 2D9YA 2YS3A 1X1GA 5DI9B 2OQBA 2DYQA 3P6AA 1V5PA 2DTCA 4KHAA 2K2JA 4HDOA 1LW3A 2D4QA 2ELAA 2N23A 2MFQA 2RLOA 2LULA 3SV1A 2CRFA 4HDQA 4WVFB 4GXBA 3T06A 1GC6A 3FM8C 1Q67A 1W1HA 4WSFA 2D9VA 2J0KA 3D8FA 1RJ2A 2EMSA 2PZ1A 1EAZA 2H7EA 2QKLA 3CXBB 5FI1A 2VSZA 1P5TA 5C79A 1KZ7A 1UPQA 5CLQB 3UZTA 2J0JA 1XD4A 2DKQA 4KVGB 1KZGA 1L0LK 4TKNA 3PEGA 2LYDA 3DXEA 1X05A 3MDBC 3FSSA 1B55A 1X11A 2Z0QA 4ZRIA 1NU1K 1V89A 3X23A 1WGQA 2Z0PA 1FHOA 1N3HA 1ZC4B 1ZSQA 2DLWA 1X1FA 3PVUA 3QBVB 4YL8A 3QIJA 4GPTB 5DHFB 2I5FA 4XWXA 4Z2NA 2VRWB 4F7HA 2H7DA 1V88A 2P8VA 3TCAA 4HB2B 2HTHB 4HB0B 1P6SA 1U5FA 2R09A 2DKPA 2OTXA 4IFDK 1RRPB 4A6HA 2D11A 2I5CA 4DXAB 2RUKB 4HHVA 2YS1A 2E2XA 2GCLA 5L81A 2GCJA 3SUZA 5HE0A 1WJMA 2WSEH 4MK0A 4DX90 1TJ6A 3VIAA 2K00A 1K5DB 5HE1A 2COFA 1NTYA 4WJ7A 2LOXA 2AEHA 3TFMA 2D9ZA 3KRXA 3GYOA 2DN6A 1V5MA 2QKMA 4ZRJA 3ZVRA 2DX5A 1V61A 1L0NK 4GMVA 4EMOA 2JP2A 2J0MA 1DDMA 2FYUK 1FGYA 1QC6A 5JP4A 4K2OA 5JHGA 4K17A 3D8EA 1WI1A 5D3XA 2UVMA 4B6HA 3V5WA 2DHKA 2RNRB 1FB8A 2Y8FA 2Y7BA 5JHHA 1M7EA 2P0DA 2Y8GA 3KY9A 3ULBA 3SYXA 4A6FB 2DA0A 4IFSA 2VKIA 5DH9B 3DXCA 1BTKA 2IFSA 2KCJA 1P3RA 2I1KA 4F7UP 1KI1B 3FEHA 5J3TA 2ROVA 3F0WA 5JLJB 2ROZB 2MKRA 3ODWA 1OY2A 3BJIA 3KZ1A 1H4RA 2FJLA 2LOZA 5C5BA 2COAA 2ADZA 3G9WA 1NTMK 2NMBA 2P0FA 2LKOA 1MPHA 2W2XD 3AU4A 5DHAB 1U29A 4A5KA 2DFKA 2MDXA 1GC7A 4HAUB 3RCPA 1OQNA 1Z87A 1NI2A 2DHIA 4Z2MB 1WJ1A 4HAWB 2YRYA 1X86A 2HE7A 2D9XA 3ZDTA 4TYZA 1SQVK 1M7RA 2M14A 1DYNA 3LJUX 3AU5A 2CY5A 2N0YA 1Y19B 2Z0OA 2ZPYA 4CYEA 4EJNA 1FHWA 4Y94A 1OMWA 2CY4A 1GG3A 3WA0A 1H10A 4CHMA 4GMXB 1DBHA 3P7ZA 1W1GA 4MY6A 2O01H 2V76A 3A98B 2OARA 4HAXB 4HAYB 1ZC3B 3GYPA 2L1CA 1XCGA 4KHOA 5HE2A 1LB1A 3VOQA 5C6RA 3ODXA 1TXDA 2NZ8B 2RGNB 3BINA 1NU2A 3ODOA 1MKEA 1SHCA 2D10A 2D2QA 2L2IA 2DX1A 2RVBB 4NY0A 5GOWB 5C5BB 3M9QA 1U5GA 4KHBB 4HAVB 2CAYA 1NTZK 3A8PA 1DROA 3CLQA 4PQ0A 3PVWA 3TVVA 3AJ4A 3F5RA 3NSUA 4IOYX 5C16A 1SQQK 3D8DA 1U27A 2GJYA 1J19A 1EVHA 1MK9B 4K2PA 4A6FA 3PG7A 1UPRA 1AQCA 1U5EA 1EF1A 1WVHA 3PVLA 1MIZB 2EC1A 3KRWA 4MT7A 2UZSA 3TO1A 3SO6A 2G35A 5CLLB 4KAXB 3OANA 5KQ1A 1FAOA 4IAPA 5HE3A 3SNHA 1W1DA 1IRSA 1FGZA 3A8QA 2J59M 4ZRKA 1NTKK 4DBBA 5KCVA 4GZUA 5D3YA 3DXDA 1MK7B 2IYBA 2DHJA 1UNQA 2LG1A 1AWEA 2R0DA 3IVFA 1BTNA 3U7DA 1UEFA 2EMTA 4A6KA 4D0NB 1ISNA 1I7AA 1I2HA 4NSWA 1SQBK 2K2UA 1XR0B 2DYNA 2UZRA 1Y5OA 4EKUA 2P0HA 2MWNB 1E5WA 2AL6A 2YS5A 1XODA 3ULCA 2YSZA 1PFJA 1BAKA 1XKEA 5LONB 1K5GB 5D27A 5KQ4A 1XX0A 2YF0A 2X18A 4HAZB 4H8SA 5LOPB 5EFXA 4DX8A 1J0WA 5KLVK 2W2WA 3MPXA 1EGXA 4CHJA 3TW1A 4C0AA 5D3WA 1ZVRA 1MAIA 4BBKA 3O96A 1ZM0A 1V5UA 2Q13A 1TQZA 2BCJA 3PSCA 1SQXK 1WG7A 1SGHA 1UNRA 5D3VA 5J3YA 3WYFB 2WSCH 1DDWA
chains in the Genus database with same CATH superfamily
1SQPD 1GDTA 2LXBA 2XV5A 3KYQA 2QJYC 4D6TD 1M1KQ 2KLUA 2L5GB 1MUUA 1U2BA 1P84D 2IPPA 1M8OB 1JCDA 4U3FJ 2C0WA 3HW2B 3TSIA 1BWNA 5AVYB 2ELBA 1RQVA 2XNDH 4QMAA 3NWDA 3CCQP 5KLVD 2YMKA 2D9WA 1QX8A 5AW0B 3G3ZA 1R5SA 1H0TA 5FI0A 2HG5D 5J3QA 1S4XA 2WTYA 3M06A 2KIEA 3I55P 2FFDA 4H0LC 1VQMP 4R4LA 3VTPC 2OQBA 3P6AA 2FJUB 2N1TD 3HUSA 4HDOA 1S5LX 2RLOA 4RJTA 1J1DC 1N7SA 4GIFA 2OYHC 1HVVA 3RK3D 3P8MC 3EQ2A 3CWBJ 3FM8C 5GTHE 1RJ2A 1FAVA 2OTJP 2OTLP 2W90A 1SQBE 5C79A 2W83C 1QL2A 1T2KD 4Y99B 5B5EE 3M0DA 1CI6B 1KZGA 1L0LK 1NU1D 3PEGA 3DXEA 2JEEA 1X05A 3IF4A 4XE5B 2Z5IA 1L0LJ 1NU1K 4GOFA 1V89A 2Z0PA 2KNCB 1VQNP 1ZSQA 3T97A 1DIPA 3SFEC 1IFPA 2O01J 3QBVB 4YL8A 3TGUE 5KLVJ 2HR3A 2I5FA 4XWXA 3L73J 1FOSF 2AXTH 3CC2P 1N86A 2P8VA 2BASA 1LWUA 1SQPG 1SVFA 3TF5A 4PD4H 4ZKPA 2FFDC 1VQLP 1SFCB 2G3AA 3KDPB 3RL0B 2ZYDA 2RUKB 2YS1A 1LP1B 1YTZT 3FX0A 3H1JG 1KV4A 2GUVA 1S5LH 1NTKG 3L74G 1S72P 1HGZA 3O8ZA 1WJMA 5HE0A 5KAFH 4MK0A 3IR9A 2O1KA 1TJ6A 3VIAA 4DX90 1K5DB 2COFA 3JCUH 4WJ7A 4GOUA 3II6A 3KRXA 3GYOA 2WSSH 2JWAA 4GMVA 1DDMA 4O9BA 1FGYA 4I7ZC 3L75J 1T2KC 5JHGA 1GU4A 2WQYC 5D3XA 1IFDA 3IAOA 2P0DA 1VQPP 3CC4P 2SPZA 3SYXA 2XU6A 1BCCG 1KYOE 2BCCG 1OX3A 2NBVA 2B89A 2WPQA 2KCJA 3BCCD 2CK3H 1KI1B 3L70D 5JLJB 2OQQA 5KJ7D 4OVNF 3I56P 1M90Q 2CPSA 2MKRA 2RH0A 2WITA 3BJIA 2H88C 1LTJB 1NTZG 1RE3C 2GUMA 2IZ0A 5C5BA 2COAA 3RK3E 2FYNC 1NTMK 1VQ7P 1Q90D 2LKOA 3AU4A 4L73A 4IL6H 2PGDA 4A5KA 3HD7A 4UB6E 4HH2A 3HIEA 1N7SD 2IFNA 4HAUB 1RE3A 1NI2A 3VP9A 2ZT9B 4PD4D 3MIWA 2DHIA 2V7QH 1ZLLA 3B8EB 2A45H 5KLVE 1YJWP 3ZDTA 5TISH 4TYZA 1GW4A 2R3CA 1SQVK 2IYOA 3VYIA 3CXHD 1DYNA 3AU5A 1T6AA 1SLQA 2N0YA 1PP9G 1G2CA 2ZPYA 4CYEA 4EJNA 4EYYQ 4Y94A 2KIGA 2E74B 2PP6A 3U12A 1S2EA 5AVQB 4QJ4B 4MY6A 2O01H 1MFZA 4HAYB 2K3RA 3HD7B 2QJYB 2QJKB 1LB1A 3H1KJ 2VRSA 3N7NA 3SFDC 5B5EH 4A7PA 3ODOA 2H89C 4NY0A 5GOWB 1BDCA 4JPZB 2E74D 3M9QA 1LTJA 2C0XA 1NHLA 2HFED 3A8PA 4EDFA 4H13C 4OH8B 1NGMB 3AJ4A 1GW3A 1SQPE 3L36A 3H1LG 3NSUA 3HD7C 5I2SA 1JTHA 3AE1C 2GJYA 4K2PA 3TK1A 1X22A 4MT7A 1OVUA 3V2RA 2KS1B 3OANA 2R44A 1KB9D 3VN0A 5KKZC 1FAOA 4KT0J 2J58A 1FGZA 1T3JA 2A06D 2NRGA 4L74A 1BE3J 1IC2A 1NTKK 5KCVA 4WB4A 1GMJA 5H2FH 5KAFE 2E5TA 1AQ5A 1UNQA 3UIAA 2R0DA 2R32A 1JY3P 1BTNA 3RBZA 1W5CE 3NWFA 5APQA 1XR0B 1FJKA 2JJLA 1Y5OA 2M3BA 2WZ7A 2P0HA 1L4AC 2NPSD 1GD2E 2YS5A 1BAKA 2M8RA 2NPSC 1L4AD 3SWFA 4H44D 1LTGC 4CPGA 1LWUB 1DX7A 1Q86Q 2LXCB 5D27A 2NPSB 1DH3A 3D6YA 1XX0A 5CJ0A 4HAZB 4KJMA 1R8EA 3H1JJ 1L4AB 4HYTB 3T97B 3OHMB 3SSUA 4DX8A 2KNCA 3LIDA 4CHJA 5GTIE 3GMAA 1HF9A 4C0AA 3EFGA 5TJHA 3TNUA 3O96A 2Q13A 2JO1A 1T3UA 5L8RJ 1NJIQ 3ITKA 2FYZA 1JCCA 1YYCA 2E76B 3HE4B 3M0AA 2Z13A 2LKMA 3CCMP 3ZDMA 4ZKUA 2KLVA 1BSNA 2W2XC 3KSYA 3H1KD 1PLSA 4N78E 4PNKA 1FZGA 2GS0A 2E43A 2WSEJ 1U5DA 1QGKB 2KGXB 1FHXA 3FXDA 4R4MA 2XQNM 2CODA 1L0LD 1LTIC 1KORA 1CSBA 3JSVC 3LW5H 1AA0A 1M56D 1MKMA 5AW5B 5DIFB 3U1AA 3HUSB 2KUPA 2C9LY 4HB4B 1IJDB 1NWQA 3NXSA 4ZMDA 5KAIE 2FFDB 4F7GA 1EDKA 2OYOA 3A0BH 1DEBA 4D6TE 1V5PA 1H0TB 2DTCA 1H88A 2K2JA 1YQ3C 1NO4A 3QWOC 3FWLA 2MFQA 3L74D 2AEJA 2LULA 4Y28J 2KIKA 2CRFA 2W6BA 1IO4A 4HDQA 4WVFB 4GXBA 3T06A 1GC6A 2K9JA 1SQBD 4W7ZA 2OYIB 2W6AA 2D9VA 3NW8A 1GK6A 1KTMA 1BGYD 1NTZE 2J0KA 1HTLC 1TU3F 1JMBA 2O3JA 4KHXA 3G9RA 4LLHA 5CBOA 1EAZA 3MUDA 3RK2B 2KP8A 1JB0J 2D2CC 1PGQA 2VSZA 2QJPC 1DD4A 1KZ7A 3A2AA 3H1LE 1A02J 1SQXG 3TDKA 3KXDA 2CPBA 1EQ7A 2GUSA 4KVGB 3GHGC 2Q6QA 4TKNA 1GZLA 3MTUE 2LYDA 1ZOYC 1NTME 4TT3H 4ZRIA 1KILA 3X23A 4W80A 3B5NA 2OYHB 3D71A 1N3HA 1ZC4B 3PVUA 1KC8Q 3QIJA 4Z2NA 4F7HA 2ZYAA 5K5GB 1FZBA 3CWBG 1MI1A 3TCAA 2HTHB 1P6SA 2R09A 2DKPA 1J1EB 4I6MC 5APVA 4DXAB 3F5HA 4HHVA 3D70A 1ZV8A 3L73E 3H1LJ 1VF5B 3H1KE 2Y9YA 2GCJA 5AVRB 3WUUA 2WSEH 2WVRA 1S9KE 1JTHB 5AW8B 5GTHH 1JMMA 2YXRB 2LOXA 2E76C 3TFMA 1IFNA 4RO0A 4UB8H 1NTZJ 5IRSA 1LNQA 1URQD 2ZXEB 1LTSC 2JP2A 1FE6A 2FYUK 2JR8A 1S1CX 3L37A 2KOGA 1LGHB 3L70E 3PHLA 1LT9A 5CHXA 5APTA 2MJZA 1SS1A 5KTBA 3BASA 3G71P 1KB9H 2BEZF 4W7YA 1SFCC 3V5WA 4H13B 2KUQA 2DHKA 4PV1C 4D6TJ 2Y7BA 2A45G 5CCGA 1M7EA 1NTKE 1W2BO 1FS0E 1G1JA 4A6FB 4IFSA 1WMKA 3MHVA 3P8CD 5APSA 3B77A 3CWBE 2VKIA 3D6ZA 1QLED 2K37A 3DXCA 1BTKA 1LTAC 4GODA 3U59A 1AQTA 5J3TA 3F0WA 4BRYA 4HSIA 2D2CD 3L71G 3I5CA 1ZP0C 1G2CB 1H4RA 2ADZA 1KQFB 2V7QJ 4MN4C 2OGUA 4RKUJ 2NMBA 1NTMJ 1OXZA 3CPWO 2P67A 4NPFX 3AE5C 3Q5SA 1G1IA 3GHGB 5DHAB 2KZIA 1ZW0A 2DFKA 4YTPC 1FU1A 2HODA 3A58A 1N73A 1N73C 1JY3N 1GC7A 2YMYA 1Z87A 2PAJA 2WWWA 4GOEA 2IDBA 2KYVA 2BCCD 2JKVA 1KMIZ 1EXIA 2BCCJ 1X79B 2M14A 1K04A 2CY5A 3L75E 1KQGB 3H1JE 2FKWB 3FVCA 4IFMA 2CY4A 1NH4A 1M1JB 3WA0A 1VQ4P 1DD3A 3PLNA 4CHMA 4GMXB 1DBHA 3P7ZA 2E5YA 2V76A 2OARA 2YKQA 2L1CA 3FGAD 5C39A 3VOQA 3CXHE 5LG4B 3ODXA 1PPJD 1TXDA 3BCCJ 3M0DC 2NZ8B 2RGNB 3BINA 1YJ9P 1NU2A 1MKEA 1SHCA 1AJYA 2L2IA 2RVBB 4XA4A 2QA4P 2XNXA 1U5GA 4KHBB 2CAYA 3CLQA 1KZUB 4IL6X 1RH5B 3CI9A 2YIUC 2UWJE 1SQQG 1Y47A 3B5ND 1NAYA 4NPDA 1SQQK 3D8DA 4EIJA 1RF0C 4A6FA 3CMAP 1UPRA 1AQCA 3AE4C 1MIZB 2EC1A 3RK3B 3KRWA 1L0LG 2W6JH 5CLLB 1N7LA 2KB7P 1LP1A 2PRRA 4H44C 5KQ1A 2Q3EA 1NTMD 4IAPA 3CCJP 1M7LA 1LT9B 1FZCB 3H1HJ 3MZWB 2IYPA 1IFJA 1OFCX 2Z4EA 3DXDA 1Z56A 5CJ4A 3V2NA 3WU2E 3H1KG 3AECC 1ZR2A 1HUCA 2DHJA 4D6TG 2H43A 3VMZA 1VL2A 3IVFA 1RHZB 1UEFA 3PTZA 1L0ND 1GL2C 5AVSB 3NFQA 1I7AA 1NTKJ 4NSWA 2FYUG 1SQBK 5BU8B 1T8ZA 1GTWA 3QH9A 1FDIA 1KILD 1CW5A 1E5WA 2ZFCA 1JNMA 1W2EA 1YTZI 3A0BE 1NKZB 3H1HE 1URQB 5LONB 2IBZE 4GDOA 1LT1A 1M57D 2E74C 4H8SA 1GL2D 3AE8C 5LOPB 4N78D 2M3EA 5CCHA 3EWKA 3B5NB 5KLIB 5D3WA 1ZVRA 1KILB 1MAIA 1BE3E 2FXMA 1VF5C 4U3FE 3RBXA 1K73Q 4H13D 2QIWA 1KYOI 1X0TA 1LTBC 1WG7A 4DOJA 1SGHA 1UNRA 1U7JA 3CC7P 1LWUC 4I1LA 1DDWA 3S1KA 3B71A 3M1IB 3Q5RA 2YT1A 4PD4I 1LJ2A 3ML4A 3U1CA 2P58A 1PP9E 2WSFH 4I7ZB 3HE5B 3PP2A 1ZRTD 2WPRA 2N9YB 2COCA 1NU1E 2FYUE 4EOTA 3LIEA 2YVCA 3MGNA 3PZDA 1SQXJ 2I1JA 4L6EA 4U7JA 1Y8AA 4DCKA 5KAIH 1JM0A 1S9KD 2YT2A 3HQCA 1M1JC 1SQXD 1IK9A 3HK0A 3WMM0 4DZOA 3CIKA 3CX5I 1USEA 3OW2O 1FZAA 1WGUA 3CCEP 2YT0A 1JEKA 1UNPA 4HATB 2JDIH 4PV1D 4HB1A 2AEFA 4JBZA 1YQ4C 2YKPA 1ZR4A 2D9YA 5E79H 1X1GA 2DYQA 1R5LA 3AEGC 1BGYG 2WPSA 2ELAA 4AUWA 1YITP 1H8AA 2Z59A 1K05A 1N7SC 3TYYA 2NZ2A 2K9YA 1FDOA 1UIXA 3V5BA 1EDLA 3JC22 2E76D 1RY3A 3LW5J 1D7MA 4DIXA 3KPEA 3IFMA 5AW3B 2PZ1A 1L0NG 2KZJA 2H7EA 2QKLA 3CWBD 1Q2NA 5FI1A 2QRXA 4Z1MH 1P5TA 2N1TA 5KJ7C 3UZTA 2J0JA 3BATA 3R4YA 5AVXB 1Q81Q 3VP8A 3MUDC 3WUVA 2PFXA 2KR0A 2WT7B 1EDIA 4M3LA 3TNUB 1RQUA 3FSSA 1B55A 1X11A 4ASVA 4QJ3B 1WGQA 1FHOA 2M5AB 3H1HG 5APUA 1X1FA 2QM8A 3B4SA 5DHFB 1BDDA 4C7RA 2H7DA 4YXDC 1FC2C 1V88A 2A45I 1HWTC 2KSEA 3H1LD 2ZT9D 1U5FA 1EC5A 3L70J 3KZIH 5CCGD 1RRPB 4A6HA 2D11A 2E75C 2Z4DA 2R3SA 3M9BA 5CBNA 3EFFK 1SQBG 3NTNA 3L74J 5L81A 3GLMA 1ZYIA 1QEXA 1X9VA 5H2FE 1ZXGA 2QSIA 1JY2O 1SQBJ 1NTYA 3H1IE 4NPEA 2WSFJ 3A0HH 3L72E 1V5MA 5CCGC 2QKMA 4ZRJA 3O6QA 1V61A 2DX5A 2ZT9C 2J0MA 3C8VA 4OGQB 4KHBA 1QC6A 3AEAC 5KLVG 4K2OA 3MD0A 4UB8E 3D8EA 1PGJA 1U57A 1NU1J 2KS1A 5DJUB 2UVMA 3PH0A 2XZRA 2RNRB 1L2PA 2Y8FA 1PPJE 3ULBA 1RF1B 3PRJA 2KK7A 3AEBC 4GT1A 1SQVD 5DH9B 4DJGA 2Z14A 4PJ0E 2IFSA 1HJ0A 3V4QA 2R2YA 1SQQJ 1P3RA 2I1KA 4K3AA 3FEHA 3RK3C 1JOCA 3Q3DA 1X8YA 4GKGA 3ODWA 3KZ1A 1NTMG 2LOZA 1NKNA 2QJPB 3H1JD 1LTTC 1OVVA 4H0LD 2ZXXA 5APYA 2E42A 1Q82Q 3OAKA 2P0FA 1MPHA 2P10A 2W2XD 2XKMA 2O01N 3V2QA 2AEMA 4H44B 1U29A 3L73G 5AW1B 1P84E 2Y9ZA 2MDXA 3RCPA 2HLOA 2FXOA 1GL2A 2N9BA 2HODB 1WJ1A 4HAWB 2YRYA 3V2PA 1OW7A 2B87B 1DEEG 3H32B 3LJUX 4QJ5B 2RRFA 3H32A 2Y0CA 5B66E 1Y19B 2WPVB 2FYUD 2B87A 1FHWA 3G6EP 1GG3A 3L4FA 2W8ZA 3C1LA 1H10A 1FOSE 1KB9E 2ZJSE 3G4SP 3CMEP 2HPCA 1XTGB 1RF0A 1KYOD 1EZVD 3GYPA 1SQVE 1XCGA 4KHOA 4OGQD 4OSNA 5C6RA 1NTKD 2E75B 2D2QA 2RKLA 3AE6C 5I2MA 5C5BB 5M1BA 2RN0A 3SWKA 3NMDA 4HAVB 4WY4D 1KN7A 2P1JA 4PQ0A 3OJAB 2QG4A 3PVWA 3AEFC 3E7KA 3F5RA 1S3JA 3AE2C 1IFIA 4HKZH 3AEDC 5C16A 4L1RA 1SQQD 4DT0A 1U27A 1PL5A 1J19A 1EVHA 1MK9B 1FJPA 3CX5E 1U5EA 3AE9C 1EF1A 2BEQD 3KZIE 4QXAB 2G35A 2K49A 2W27A 4KAXB 1JY3O 1PZQA 3WU2H 3N4XA 4GNKB 5HE3A 3RK2D 1KD1Q 1QL1A 1SQXE 3A8QA 2J59M 4YPCA 4ZRKA 2ZVOB 3BCCG 1S5LE 4GZUA 5D3YA 2FYUJ 4WY4C 4WVZA 2IYBA 2LG1A 2K88A 5AW4B 2K8EA 1BCCD 1PP9J 2EMTA 3IN6A 1HBWA 1PGPA 5AW6B 1OVRA 3A5TA 2ZVNB 3M91A 2BCCE 2G8YA 5AVZB 2DYNA 2UZRA 3BVHA 4EI2A 2L91A 3ABVC 3L75G 1XODA 2Y0DA 3ULCA 2YSZA 1PFJA 2V4HA 2WSCJ 1WT6A 1T77A 1K5GB 5KQ4A 1OZHA 3E1RA 1KYOH 2ZKMX 2X18A 1XTCC 2YO3A 3L73D 5EFXA 2M5AA 1PV3A 4C7NA 1J0WA 1EZVI 3MPXA 3TW1A 5EFWB 2OYIA 4BBKA 2K9JB 1V5UA 3HUSC 1VQKP 1CI6A 1SQPJ 3A7OA 1VDFA 4XFJA 2H7HA 5D3VA 1H89A 5J3YA 2WSCH 2XDJA 3N7CA 2Y0EA 3L70G 2IFMA 1MIXA 4IL6E 2M38A 3L71J 3CXHI 5AVUB 3PP5A 4UB6H 4K81A 4YONA 3GG2A 3HTKB 2O1JA 4YXWH 1BGYE 3U8ZA 1J2JB 1WRGA 1NTVA 2EJ8A 2R5BA 2KSJA 3NWAA 1PMSA 1L0LE 2QM7A 1SQPK 2RSGA 2FY8A 1BSHA 1MFTA 4IFFA 3DCXA 4U3FG 1YI2P 4HB3B 1N7SB 1FOEA 1QQGA 1DDVA 3QWMA 4P7IA 1OW6A 1YBKA 3HTKA 1MV8A 1CZQA 4GN1A 1U7MA 5AVWB 3SWYA 2YS3A 2ZAEB 5DI9B 4HJGH 3GF3A 4KHAA 2D2CB 1K8AQ 1LW3A 3V6IA 1KB9I 3HE4A 2D4QA 5KKZB 2N23A 1N8RQ 3SV1A 2JWDA 1SQQE 4AYCA 4D6WA 1Q67A 2P2UA 1W1HA 4WSFA 3VOPA 1RF1C 3A0HE 1HH0A 2ITAA 3GF7A 3D8FA 4C7NB 4ZNCA 2EMSA 1L4AA 1YIJP 1Y9BA 1EZVG 1USDA 3BCCE 2HYNA 3HE5A 1OW8A 2NPSA 3CXBB 3VMXA 1FZCC 1VQ6P 1BCCE 1SFCD 1JY2N 1UPQA 5CLQB 3S4RA 1XD4A 1P84I 1RE4A 3M9HA 3USSA 2R5DA 1VQ8P 2E75D 3L72J 3TGUD 2DKQA 4PV1B 4U3FD 1E79H 3Q1MA 1BE3G 1NAFA 3MDBC 4BXLA 2YXQB 2JP3A 2Z0QA 3TGUG 1ZRTE 3F89A 1VPCA 5AW2B 5M4YB 2Q3IA 2DLWA 1L0NE 5AVVB 1RE4C 4GPTB 5AVTB 2VRWB 1L0NJ 3K5BA 3VMAA 4HB2B 2QE7H 2KI7B 1HJBA 1N2DC 4Y99C 4HB0B 5CCHD 1URQA 1URQC 4WWIA 4IFDK 2OTXA 4TLFA 5AW7B 2I5CA 1AV1A 3Q5PA 1GU5A 2KUBA 4PD4E 2DW3A 5CCHC 3RGUA 2E2XA 2GCLA 1JO5A 1OMIA 1NTZD 4LGDE 2YIUB 3L71D 1PPJG 3SUZA 4RESB 3CCLP 1PFIA 1PIXA 1GK4A 3R2PA 2K00A 2IBZD 5HE1A 2IX7C 2Q1KA 1SP4A 2AEHA 1SQVG 2D9ZA 3CL3D 2B9BA 2DN6A 3ZVRA 4N3YB 4ASWA 1L0NK 3AE7C 4BWNA 4EMOA 5KJ7A 3JCUE 1OIPA 1FZCA 3L72G 5JP4A 2FBWC 2P7JA 3H6PA 5BU5A 4K17A 3FXEA 1WI1A 2AXCA 1QVFO 2C9NY 1NOHA 2IBZI 4B6HA 3L72D 3TGUJ 1VQ9P 2ZYGA 1FB8A 1Q7YQ 5JHHA 2QEXP 2Y8GA 4OT1A 3KY9A 3HSAA 1AVOA 2DA0A 2YNYA 2GA1A 1EXJA 1KQLA 2HPCB 4F7UP 2FXPA 2ROVA 1IFMA 2ROZB 1IK7A 3BRTB 4JYCA 1JUNA 2GM4A 1OY2A 2KXPB 2OYIC 3CD6P 3L35A 2FJLA 1HGVA 3AE3C 3G9WA 1FZEA 3KHUA 1UIIA 1AVYA 3CX5D 3V4WA 2MKVA 4WY4B 3FWNA 4I2LC 2Q7CA 3L71E 1GL2B 3H25A 1OQNA 1A02F 1LTJC 5CMZA 2M0BA 3W68A 1BCCJ 4Z2MB 1M1JA 1VF5D 3BRVB 3W67A 1X86A 1QVGO 2HE7A 2Z5HA 1FDMA 2D9XA 4LC1A 3L75D 1M7RA 5DJTB 2Q9IA 2Z0OA 1EZVE 1FBMA 1OMWA 3H1IG 4WBAA 2OTKE 3WUTA 1EDJA 5B66H 3H1IJ 2I8DA 1W1GA 2QJKC 2RMZA 1KILC 3A98B 4HAXB 1ZC3B 1N73B 3P7KA 3S9OA 2IBZG 2N1TC 1RF1A 3Q2YA 3H1ID 4WY4A 5HE2A 2WMMA 3GHGA 2A06G 3KQGA 3L74E 1VQ5P 4PJ0H 1J1EC 2D10A 2POHA 1FZFA 2DX1A 2YO2A 1ZN5A 1KILE 2K1AA 1NTZK 1DROA 4BRYB 1K9MQ 2B88A 3O6QB 3TVVA 3OA7A 4C46A 1BGYJ 3PJSK 4IOYX 3CCVP 3RL0D 1KQSO 3AEEC 1AFOA 3PG7A 3H1HD 1P84H 1WVHA 3PVLA 2UZSA 3TO1A 3SO6A 3HRNA 2H8PD 1BE3D 3CX5H 1NU1G 3RL0C 1SFCA 1NYHA 3SNHA 3B5NC 5KLIC 1IRSA 1W1DA 1OWAA 2J5UA 4L75A 4AQRD 5TISE 1ZMEC 4DBBA 2AXTE 1LT9C 1MK7B 5E79E 4B86A 4K35A 1MZ9A 2LR2A 1AWEA 2Q5UA 3C9IA 3U7DA 4IOIH 1YJNP 2A06E 4A6KA 4D0NB 4L76A 1ISNA 3RL0g 1I2HA 3CCSP 2K2UA 4JF7A 1PP9D 4CSQA 5APXA 2WT7A 4JYBA 4EKUA 2IZ1A 3MP7B 2MWNB 3RK2C 4OWFA 2AL6A 5AW9B 1PGOA 5BVZA 3E1IA 1SQVJ 1XKEA 2N1TB 2QVAA 3CCRP 1JY2P 3P32A 1YHQP 1VQOP 2YF0A 1IZNB 3GW6A 4H0LB 5KLVK 3VMYA 2FYNB 2W2WA 1EGXA 3CCUP 2OYHA 3HD7D 4JQ0D 4N6JA 3CXHH 1KFNA 4OGQC 3A3YB 1ZM0A 3P8CE 1J1DB 1NVOA 1TQZA 2BCJA 3PSCA 1KFMA 1SQXK 2YKOA 5GTIH 3WYFB 5APWA
chains in the Genus database with same CATH topology
3N7CA 2LKMA 3M1IB 2IFMA 1GDTA 1MIXA 2YT1A 3KYQA 2XV5A 4ZKUA 3U1CA 2KLVA 2M38A 3ML4A 2W2XC 5AVUB 3KSYA 2WSFH 3PP5A 4K81A 4YONA 1PLSA 3HE5B 2L5GB 3HTKB 2O1JA 4N78E 3PP2A 1MUUA 1U2BA 2WPRA 3U8ZA 1J2JB 1WRGA 2IPPA 2COCA 1FZGA 4PNKA 1NTVA 2GS0A 2E43A 2EJ8A 4EOTA 2R5BA 2KSJA 3LIEA 1PMSA 2YVCA 1JCDA 1U5DA 3MGNA 3PZDA 2C0WA 2I1JA 2KGXB 3HW2B 2QM7A 1FHXA 1SQPK 3TSIA 1BWNA 2RSGA 4IFFA 4L6EA 5AVYB 2ELBA 2XQNM 4HB3B 1S9KD 1N7SB 1FOEA 1QQGA 1DDVA 2CODA 3HQCA 3QWMA 1LTIC 1M1JC 1CSBA 2D9WA 4P7IA 5AW0B 3LW5H 1IK9A 3HK0A 3WMM0 4DZOA 5AW5B 3CIKA 3U1AA 3HUSB 5DIFB 3G3ZA 2KUPA 2C9LY 5FI0A 1FZAA 1WGUA 4HB4B 1IJDB 1NWQA 2HG5D 2YT0A 3HTKA 5J3QA 1MV8A 1UNPA 3NXSA 2FFDB 1CZQA 2WTYA 4HATB 4GN1A 4F7GA 3M06A 5AVWB 2YKPA 1ZR4A 3SWYA 2D9YA 2FFDA 2YS3A 1X1GA 5DI9B 1DEBA 3VTPC 2OQBA 2DYQA 3P6AA 1V5PA 2DTCA 2N1TD 4KHAA 1H88A 2K2JA 3HUSA 4HDOA 1NO4A 2WPSA 1LW3A 3HE4A 4AUWA 2D4QA 2ELAA 2N23A 2MFQA 2RLOA 2LULA 1H8AA 3SV1A 2CRFA 2W6BA 4AYCA 1IO4A 1J1DC 1N7SA 1N7SC 3TYYA 4GIFA 2OYHC 4HDQA 4WVFB 4GXBA 1HVVA 3RK3D 3T06A 3P8MC 3EQ2A 1GC6A 3V5BA 3FM8C 4W7ZA 1Q67A 2OYIB 2P2UA 1W1HA 1RY3A 2W6AA 4WSFA 3VOPA 1RF1C 2D9VA 1GK6A 1HH0A 3KPEA 2J0KA 4C7NB 3IFMA 3D8FA 5AW3B 1HTLC 1L4AA 1RJ2A 2EMSA 2PZ1A 1FAVA 4KHXA 4LLHA 1EAZA 3MUDA 3RK2B 2H7EA 2HYNA 3HE5A 2QKLA 2NPSA 3CXBB 2KP8A 3VMXA 1FZCC 5FI1A 1SFCD 2VSZA 1JY2N 1P5TA 2N1TA 5KJ7C 1KZ7A 5C79A 1UPQA 3A2AA 5CLQB 3UZTA 2J0JA 3BATA 1QL2A 1XD4A 5AVXB 1A02J 1RE4A 3M9HA 1T2KD 4Y99B 2R5DA 2CPBA 3M0DA 3VP8A 2DKQA 2GUSA 1EQ7A 1CI6B 4KVGB 3GHGC 1KZGA 1L0LK 4TKNA 1GZLA 2WT7B 3MTUE 2LYDA 3PEGA 4M3LA 2JEEA 1NAFA 1X05A 3DXEA 3MDBC 3TNUB 3FSSA 4XE5B 2Z5IA 1B55A 1X11A 2Z0QA 4ZRIA 1KILA 1NU1K 1V89A 3X23A 4W80A 3B5NA 1WGQA 2OYHB 2Z0PA 1FHOA 1VPCA 1N3HA 1ZC4B 5AW2B 1ZSQA 2Q3IA 3T97A 2DLWA 5APUA 1X1FA 3PVUA 2QM8A 5AVVB 3QBVB 4YL8A 1RE4C 3QIJA 4GPTB 5DHFB 5AVTB 4C7RA 2I5FA 4XWXA 4Z2NA 2VRWB 1FOSF 4F7HA 2H7DA 1FZBA 1V88A 1N86A 2P8VA 3TCAA 2A45I 4HB2B 1HWTC 1HJBA 2HTHB 2BASA 1LWUA 1N2DC 4Y99C 1P6SA 1U5FA 2R09A 4HB0B 5CCHD 1SVFA 2DKPA 1URQA 1URQC 2OTXA 4IFDK 4ZKPA 5CCGD 2FFDC 1RRPB 4A6HA 2D11A 1J1EB 4I6MC 5APVA 5AW7B 2I5CA 1SFCB 3KDPB 3RL0B 4DXAB 1GU5A 3M9BA 2RUKB 4HHVA 3NTNA 2YS1A 1ZV8A 1YTZT 5CCHC 2E2XA 2GCLA 1JO5A 5L81A 4LGDE 2GUVA 2GCJA 3SUZA 5HE0A 5AVRB 1HGZA 3O8ZA 1X9VA 4RESB 1WJMA 1PFIA 2WSEH 4MK0A 1JY2O 3IR9A 2O1KA 1TJ6A 1GK4A 3VIAA 4DX90 3R2PA 1S9KE 2K00A 1K5DB 5HE1A 1JTHB 2IX7C 2COFA 5AW8B 1NTYA 4WJ7A 3II6A 1JMMA 1SP4A 2LOXA 2AEHA 3TFMA 1IFNA 2D9ZA 3CL3D 3KRXA 3GYOA 2DN6A 1V5MA 2QKMA 5CCGC 4ZRJA 3ZVRA 1URQD 4N3YB 1V61A 2DX5A 1L0NK 2ZXEB 4GMVA 1LTSC 4EMOA 2JP2A 2J0MA 1DDMA 5KJ7A 2FYUK 3L37A 4O9BA 1FGYA 1QC6A 1FZCA 2KOGA 1LGHB 5JP4A 1T2KC 1LT9A 2P7JA 3H6PA 5CHXA 5BU5A 4K2OA 3MD0A 4K17A 5APTA 3D8EA 2MJZA 1GU4A 5JHGA 1WI1A 5KTBA 3BASA 2C9NY 1NOHA 5D3XA 4W7YA 2UVMA 1SFCC 4B6HA 1IFDA 3V5WA 2XZRA 2DHKA 2RNRB 1FB8A 2Y8FA 2Y7BA 5JHHA 2A45G 5CCGA 1M7EA 2P0DA 2Y8GA 3KY9A 3ULBA 1RF1B 3SYXA 1G1JA 2XU6A 2DA0A 4IFSA 3P8CD 4A6FB 2YNYA 5APSA 1KQLA 4GT1A 2HPCB 2VKIA 5DH9B 3DXCA 1BTKA 2IFSA 1LTAC 2WPQA 2KCJA 3V4QA 3U59A 2I1KA 1P3RA 4F7UP 1KI1B 3FEHA 3RK3C 5J3TA 1JOCA 2ROVA 3F0WA 1IFMA 5KJ7D 5JLJB 2ROZB 3BRTB 4JYCA 1JUNA 2CPSA 2MKRA 1X8YA 2WITA 4GKGA 3I5CA 2GM4A 1OY2A 2OYIC 3ODWA 3BJIA 3KZ1A 1LTJB 1RE3C 3L35A 1G2CB 1H4RA 2FJLA 1HGVA 1NKNA 2LOZA 5C5BA 2COAA 2ADZA 3G9WA 1FZEA 1LTTC 1NTMK 2E42A 2NMBA 5APYA 1OXZA 2P0FA 3OAKA 2LKOA 1MPHA 2P67A 3V4WA 2W2XD 3AU4A 1G1IA 2XKMA 3GHGB 3V2QA 5DHAB 4WY4B 1U29A 4A5KA 5AW1B 2DFKA 3HD7A 4HH2A 1FU1A 2HODA 1N73A 1N73C 4I2LC 1JY3N 1N7SD 2IFNA 2Q7CA 1GL2B 2HLOA 2YMYA 1GC7A 2MDXA 4HAUB 1OQNA 1Z87A 2PAJA 3RCPA 1A02F 1RE3A 1LTJC 1NI2A 2WWWA 5CMZA 3VP9A 1GL2A 2N9BA 3MIWA 2DHIA 4Z2MB 2HODB 2KYVA 1M1JA 1WJ1A 4HAWB 2YRYA 3BRVB 1ZLLA 3V2PA 1X86A 3B8EB 2HE7A 2Z5HA 1FDMA 2D9XA 2A45H 4LC1A 3ZDTA 4TYZA 1GW4A 2R3CA 1SQVK 1X79B 3H32B 3VYIA 1M7RA 2M14A 1DYNA 3LJUX 3AU5A 2CY5A 1SLQA 2N0YA 2Q9IA 3H32A 1G2CA 1Y19B 2Z0OA 2ZPYA 4CYEA 2FKWB 1FBMA 4EJNA 1FHWA 4IFMA 4Y94A 1OMWA 2CY4A 1GG3A 3L4FA 2PP6A 1NH4A 4WBAA 1M1JB 3WA0A 1H10A 5AVQB 1FOSE 4CHMA 4GMXB 1DBHA 3P7ZA 1W1GA 4MY6A 2HPCA 2O01H 1KILC 2V76A 3A98B 1XTGB 1MFZA 2OARA 4HAXB 4HAYB 1RF0A 1ZC3B 3P7KA 1N73B 3GYPA 2N1TC 2YKQA 3HD7B 1XCGA 1RF1A 2L1CA 4KHOA 4WY4A 5HE2A 1LB1A 3GHGA 3KQGA 3VOQA 5C6RA 3ODXA 2VRSA 3N7NA 1TXDA 2NZ8B 3M0DC 2RGNB 3BINA 1J1EC 1NU2A 3ODOA 1MKEA 1SHCA 2POHA 2D10A 2D2QA 1FZFA 2L2IA 2DX1A 2RVBB 4NY0A 4XA4A 5GOWB 5C5BB 3M9QA 2XNXA 1U5GA 2YO2A 1LTJA 1ZN5A 2C0XA 4KHBB 3NMDA 2CAYA 4WY4D 1NHLA 1NTZK 2HFED 3CLQA 2P1JA 3A8PA 1KZUB 1DROA 4PQ0A 3CI9A 3OJAB 3PVWA 4OH8B 3TVVA 3AJ4A 3L36A 1GW3A 3OA7A 4C46A 3F5RA 3NSUA 1IFIA 3HD7C 3B5ND 4IOYX 5C16A 3RL0D 1SQQK 1JTHA 3D8DA 1U27A 4EIJA 1AFOA 2GJYA 1J19A 1EVHA 1MK9B 4K2PA 1RF0C 1FJPA 4A6FA 3PG7A 1UPRA 1AQCA 1U5EA 1EF1A 1WVHA 3PVLA 3TK1A 1MIZB 3RK3B 2EC1A 3KRWA 4MT7A 2UZSA 3TO1A 3SO6A 2G35A 5CLLB 3V2RA 1N7LA 2W27A 4KAXB 3HRNA 3OANA 1JY3O 2H8PD 2KB7P 5KQ1A 3VN0A 4HAVB 1FAOA 4IAPA 3RL0C 3N4XA 1M7LA 1LT9B 1SFCA 5HE3A 3SNHA 3B5NC 1IRSA 2J58A 1W1DA 1FGZA 1FZCB 1OWAA 1T3JA 3RK2D 4AQRD 1QL1A 1IC2A 3A8QA 2J59M 4ZRKA 1IFJA 1NTKK 4DBBA 5KCVA 2Z4EA 1LT9C 4GZUA 5D3YA 3DXDA 1Z56A 4WB4A 5CJ4A 3V2NA 4WY4C 1MK7B 1AQ5A 1ZR2A 4B86A 1HUCA 2IYBA 2DHJA 1MZ9A 1UNQA 2H43A 2LG1A 2XDJA 1AWEA 2Q5UA 5AW4B 2R32A 3UIAA 3VMZA 2R0DA 1JY3P 3IVFA 3C9IA 1BTNA 3U7DA 1UEFA 1GL2C 2EMTA 4A6KA 1HBWA 4D0NB 5AVSB 1ISNA 3NFQA 5AW6B 1I7AA 1I2HA 4NSWA 3A5TA 1SQBK 3M91A 5APQA 5BU8B 2K2UA 1XR0B 5AVZB 4JF7A 2DYNA 1T8ZA 1FJKA 2JJLA 5APXA 1GTWA 2UZRA 1Y5OA 2WT7A 4JYBA 3BVHA 2M3BA 4EKUA 2WZ7A 2P0HA 1KILD 1L4AC 2NPSD 2MWNB 1CW5A 3RK2C 1E5WA 2ZFCA 1GD2E 5AW9B 2AL6A 2YS5A 5BVZA 3E1IA 1JNMA 1XODA 1W2EA 3ULCA 1YTZI 2YSZA 1NKZB 1PFJA 1BAKA 2M8RA 2NPSC 1L4AD 1WT6A 3SWFA 1XKEA 1URQB 1LTGC 2N1TB 5LONB 1JY2P 1LWUB 1K5GB 1DX7A 5D27A 2NPSB 1DH3A 5KQ4A 3P32A 1XX0A 2YF0A 2X18A 5CJ0A 4HAZB 4H8SA 1GL2D 1XTCC 5LOPB 2YO3A 1L4AB 4HYTB 5EFXA 4N78D 4C7NA 4DX8A 1J0WA 3VMYA 5KLVK 2W2WA 3MPXA 3LIDA 5CCHA 4CHJA 1EGXA 2OYHA 3TW1A 3B5NB 3HD7D 4C0AA 5D3WA 1ZVRA 3EFGA 1KILB 1MAIA 4N6JA 2OYIA 4BBKA 2FXMA 1KFNA 3TNUA 3O96A 3A3YB 1ZM0A 1V5UA 2Q13A 3P8CE 1T3UA 3HUSC 1J1DB 1TQZA 2BCJA 3PSCA 1KFMA 1CI6A 3A7OA 1LTBC 1SQXK 2FYZA 2YKOA 4DOJA 1WG7A 1JCCA 1VDFA 1YYCA 2H7HA 3HE4B 1SGHA 1H89A 1UNRA 5D3VA 5J3YA 1LWUC 3WYFB 5APWA 2WSCH 4I1LA 1DDWA 3M0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  2LKM A;  3M1I B;  1MIX A;  2YT1 A;  3ML4 A;  2M38 A;  2W2X C;  3KSY A;  2WSF H;  4K81 A;  4YON A;  1PLS A;  3PP2 A;  1U2B A;  3U8Z A;  2COC A;  4PNK A;  1NTV A;  2GS0 A;  2EJ8 A;  1PMS A;  2YVC A;  1U5D A;  3PZD A;  3HW2 B;  2I1J A;  2KGX B;  1FHX A;  1SQP K;  2RSG A;  1BWN A;  4L6E A;  2ELB A;  2XQN M;  4HB3 B;  2COD A;  1FOE A;  1QQG A;  1DDV A;  3HQC A;  3QWM A;  2D9W A;  4P7I A;  3LW5 H;  3HK0 A;  3CIK A;  5DIF B;  3G3Z A;  2KUP A;  5FI0 A;  1WGU A;  4HB4 B;  2YT0 A;  5J3Q A;  1UNP A;  4HAT B;  4F7G A;  4GN1 A;  2D9Y A;  2YS3 A;  1X1G A;  5DI9 B;  2OQB A;  2DYQ A;  3P6A A;  1V5P A;  2DTC A;  4KHA A;  2K2J A;  4HDO A;  1LW3 A;  2D4Q A;  2ELA A;  2N23 A;  2MFQ A;  2RLO A;  2LUL A;  3SV1 A;  2CRF A;  4HDQ A;  4WVF B;  4GXB A;  3T06 A;  1GC6 A;  3FM8 C;  1Q67 A;  1W1H A;  4WSF A;  2D9V A;  2J0K A;  3D8F A;  1RJ2 A;  2EMS A;  2PZ1 A;  1EAZ A;  2H7E A;  2QKL A;  3CXB B;  5FI1 A;  2VSZ A;  1P5T A;  5C79 A;  1KZ7 A;  1UPQ A;  5CLQ B;  3UZT A;  2J0J A;  1XD4 A;  2DKQ A;  4KVG B;  1KZG A;  1L0L K;  4TKN A;  3PEG A;  2LYD A;  3DXE A;  1X05 A;  3MDB C;  3FSS A;  1B55 A;  1X11 A;  2Z0Q A;  4ZRI A;  1NU1 K;  1V89 A;  3X23 A;  1WGQ A;  2Z0P A;  1FHO A;  1N3H A;  1ZC4 B;  1ZSQ A;  2DLW A;  1X1F A;  3PVU A;  3QBV B;  4YL8 A;  3QIJ A;  4GPT B;  5DHF B;  2I5F A;  4XWX A;  4Z2N A;  2VRW B;  4F7H A;  2H7D A;  1V88 A;  2P8V A;  3TCA A;  4HB2 B;  2HTH B;  4HB0 B;  1P6S A;  1U5F A;  2R09 A;  2DKP A;  2OTX A;  4IFD K;  1RRP B;  4A6H A;  2D11 A;  2I5C A;  4DXA B;  2RUK B;  4HHV A;  2YS1 A;  2E2X A;  2GCL A;  5L81 A;  2GCJ A;  3SUZ A;  5HE0 A;  1WJM A;  2WSE H;  4MK0 A;  4DX9 0;  1TJ6 A;  3VIA A;  2K00 A;  1K5D B;  5HE1 A;  2COF A;  1NTY A;  4WJ7 A;  2LOX A;  2AEH A;  3TFM A;  2D9Z A;  3KRX A;  3GYO A;  2DN6 A;  1V5M A;  2QKM A;  4ZRJ A;  3ZVR A;  2DX5 A;  1V61 A;  1L0N K;  4GMV A;  4EMO A;  2JP2 A;  2J0M A;  1DDM A;  2FYU K;  1FGY A;  1QC6 A;  5JP4 A;  4K2O A;  5JHG A;  4K17 A;  3D8E A;  1WI1 A;  5D3X A;  2UVM A;  4B6H A;  3V5W A;  2DHK A;  2RNR B;  1FB8 A;  2Y8F A;  2Y7B A;  5JHH A;  1M7E A;  2P0D A;  2Y8G A;  3KY9 A;  3ULB A;  3SYX A;  4A6F B;  2DA0 A;  4IFS A;  2VKI A;  5DH9 B;  3DXC A;  1BTK A;  2IFS A;  2KCJ A;  1P3R A;  2I1K A;  4F7U P;  1KI1 B;  3FEH A;  5J3T A;  2ROV A;  3F0W A;  5JLJ B;  2ROZ B;  2MKR A;  3ODW A;  1OY2 A;  3BJI A;  3KZ1 A;  1H4R A;  2FJL A;  2LOZ A;  5C5B A;  2COA A;  2ADZ A;  3G9W A;  1NTM K;  2NMB A;  2P0F A;  2LKO A;  1MPH A;  2W2X D;  3AU4 A;  5DHA B;  1U29 A;  4A5K A;  2DFK A;  2MDX A;  1GC7 A;  4HAU B;  3RCP A;  1OQN A;  1Z87 A;  1NI2 A;  2DHI A;  4Z2M B;  1WJ1 A;  4HAW B;  2YRY A;  1X86 A;  2HE7 A;  2D9X A;  3ZDT A;  4TYZ A;  1SQV K;  1M7R A;  2M14 A;  1DYN A;  3LJU X;  3AU5 A;  2CY5 A;  2N0Y A;  1Y19 B;  2Z0O A;  2ZPY A;  4CYE A;  4EJN A;  1FHW A;  4Y94 A;  1OMW A;  2CY4 A;  1GG3 A;  3WA0 A;  1H10 A;  4CHM A;  4GMX B;  1DBH A;  3P7Z A;  1W1G A;  4MY6 A;  2O01 H;  2V76 A;  3A98 B;  2OAR A;  4HAX B;  4HAY B;  1ZC3 B;  3GYP A;  2L1C A;  1XCG A;  4KHO A;  5HE2 A;  1LB1 A;  3VOQ A;  5C6R A;  3ODX A;  1TXD A;  2NZ8 B;  2RGN B;  3BIN A;  1NU2 A;  3ODO A;  1MKE A;  1SHC A;  2D10 A;  2D2Q A;  2L2I A;  2DX1 A;  2RVB B;  4NY0 A;  5GOW B;  5C5B B;  3M9Q A;  1U5G A;  4KHB B;  4HAV B;  2CAY A;  1NTZ K;  3A8P A;  1DRO A;  3CLQ A;  4PQ0 A;  3PVW A;  3TVV A;  3AJ4 A;  3F5R A;  3NSU A;  4IOY X;  5C16 A;  1SQQ K;  3D8D A;  1U27 A;  2GJY A;  1J19 A;  1EVH A;  1MK9 B;  4K2P A;  4A6F A;  3PG7 A;  1UPR A;  1AQC A;  1U5E A;  1EF1 A;  1WVH A;  3PVL A;  1MIZ B;  2EC1 A;  3KRW A;  4MT7 A;  2UZS A;  3TO1 A;  3SO6 A;  2G35 A;  5CLL B;  4KAX B;  3OAN A;  5KQ1 A;  1FAO A;  4IAP A;  5HE3 A;  3SNH A;  1W1D A;  1IRS A;  1FGZ A;  3A8Q A;  2J59 M;  4ZRK A;  1NTK K;  4DBB A;  5KCV A;  4GZU A;  5D3Y A;  3DXD A;  1MK7 B;  2IYB A;  2DHJ A;  1UNQ A;  2LG1 A;  1AWE A;  2R0D A;  3IVF A;  1BTN A;  3U7D A;  1UEF A;  2EMT A;  4A6K A;  4D0N B;  1ISN A;  1I7A A;  1I2H A;  4NSW A;  1SQB K;  2K2U A;  1XR0 B;  2DYN A;  2UZR A;  1Y5O A;  4EKU A;  2P0H A;  2MWN B;  1E5W A;  2AL6 A;  2YS5 A;  1XOD A;  3ULC A;  2YSZ A;  1PFJ A;  1BAK A;  1XKE A;  5LON B;  1K5G B;  5D27 A;  5KQ4 A;  1XX0 A;  2YF0 A;  2X18 A;  4HAZ B;  4H8S A;  5LOP B;  5EFX A;  4DX8 A;  1J0W A;  5KLV K;  2W2W A;  3MPX A;  1EGX A;  4CHJ A;  3TW1 A;  4C0A A;  5D3W A;  1ZVR A;  1MAI A;  4BBK A;  3O96 A;  1ZM0 A;  1V5U A;  2Q13 A;  1TQZ A;  2BCJ A;  3PSC A;  1SQX K;  1WG7 A;  1SGH A;  1UNR A;  5D3V A;  5J3Y A;  3WYF B;  2WSC H;  1DDW A; 
#chains in the Genus database with same CATH topology
 1SQP D;  1GDT A;  2LXB A;  2XV5 A;  3KYQ A;  2QJY C;  4D6T D;  1M1K Q;  2KLU A;  2L5G B;  1MUU A;  1U2B A;  1P84 D;  2IPP A;  1M8O B;  1JCD A;  4U3F J;  2C0W A;  3HW2 B;  3TSI A;  1BWN A;  5AVY B;  2ELB A;  1RQV A;  2XND H;  4QMA A;  3NWD A;  3CCQ P;  5KLV D;  2YMK A;  2D9W A;  1QX8 A;  5AW0 B;  3G3Z A;  1R5S A;  1H0T A;  5FI0 A;  2HG5 D;  5J3Q A;  1S4X A;  2WTY A;  3M06 A;  2KIE A;  3I55 P;  2FFD A;  4H0L C;  1VQM P;  4R4L A;  3VTP C;  2OQB A;  3P6A A;  2FJU B;  2N1T D;  3HUS A;  4HDO A;  1S5L X;  2RLO A;  4RJT A;  1J1D C;  1N7S A;  4GIF A;  2OYH C;  1HVV A;  3RK3 D;  3P8M C;  3EQ2 A;  3CWB J;  3FM8 C;  5GTH E;  1RJ2 A;  1FAV A;  2OTJ P;  2OTL P;  2W90 A;  1SQB E;  5C79 A;  2W83 C;  1QL2 A;  1T2K D;  4Y99 B;  5B5E E;  3M0D A;  1CI6 B;  1KZG A;  1L0L K;  1NU1 D;  3PEG A;  3DXE A;  2JEE A;  1X05 A;  3IF4 A;  4XE5 B;  2Z5I A;  1L0L J;  1NU1 K;  4GOF A;  1V89 A;  2Z0P A;  2KNC B;  1VQN P;  1ZSQ A;  3T97 A;  1DIP A;  3SFE C;  1IFP A;  2O01 J;  3QBV B;  4YL8 A;  3TGU E;  5KLV J;  2HR3 A;  2I5F A;  4XWX A;  3L73 J;  1FOS F;  2AXT H;  3CC2 P;  1N86 A;  2P8V A;  2BAS A;  1LWU A;  1SQP G;  1SVF A;  3TF5 A;  4PD4 H;  4ZKP A;  2FFD C;  1VQL P;  1SFC B;  2G3A A;  3KDP B;  3RL0 B;  2ZYD A;  2RUK B;  2YS1 A;  1LP1 B;  1YTZ T;  3FX0 A;  3H1J G;  1KV4 A;  2GUV A;  1S5L H;  1NTK G;  3L74 G;  1S72 P;  1HGZ A;  3O8Z A;  1WJM A;  5HE0 A;  5KAF H;  4MK0 A;  3IR9 A;  2O1K A;  1TJ6 A;  3VIA A;  4DX9 0;  1K5D B;  2COF A;  3JCU H;  4WJ7 A;  4GOU A;  3II6 A;  3KRX A;  3GYO A;  2WSS H;  2JWA A;  4GMV A;  1DDM A;  4O9B A;  1FGY A;  4I7Z C;  3L75 J;  1T2K C;  5JHG A;  1GU4 A;  2WQY C;  5D3X A;  1IFD A;  3IAO A;  2P0D A;  1VQP P;  3CC4 P;  2SPZ A;  3SYX A;  2XU6 A;  1BCC G;  1KYO E;  2BCC G;  1OX3 A;  2NBV A;  2B89 A;  2WPQ A;  2KCJ A;  3BCC D;  2CK3 H;  1KI1 B;  3L70 D;  5JLJ B;  2OQQ A;  5KJ7 D;  4OVN F;  3I56 P;  1M90 Q;  2CPS A;  2MKR A;  2RH0 A;  2WIT A;  3BJI A;  2H88 C;  1LTJ B;  1NTZ G;  1RE3 C;  2GUM A;  2IZ0 A;  5C5B A;  2COA A;  3RK3 E;  2FYN C;  1NTM K;  1VQ7 P;  1Q90 D;  2LKO A;  3AU4 A;  4L73 A;  4IL6 H;  2PGD A;  4A5K A;  3HD7 A;  4UB6 E;  4HH2 A;  3HIE A;  1N7S D;  2IFN A;  4HAU B;  1RE3 A;  1NI2 A;  3VP9 A;  2ZT9 B;  4PD4 D;  3MIW A;  2DHI A;  2V7Q H;  1ZLL A;  3B8E B;  2A45 H;  5KLV E;  1YJW P;  3ZDT A;  5TIS H;  4TYZ A;  1GW4 A;  2R3C A;  1SQV K;  2IYO A;  3VYI A;  3CXH D;  1DYN A;  3AU5 A;  1T6A A;  1SLQ A;  2N0Y A;  1PP9 G;  1G2C A;  2ZPY A;  4CYE A;  4EJN A;  4EYY Q;  4Y94 A;  2KIG A;  2E74 B;  2PP6 A;  3U12 A;  1S2E A;  5AVQ B;  4QJ4 B;  4MY6 A;  2O01 H;  1MFZ A;  4HAY B;  2K3R A;  3HD7 B;  2QJY B;  2QJK B;  1LB1 A;  3H1K J;  2VRS A;  3N7N A;  3SFD C;  5B5E H;  4A7P A;  3ODO A;  2H89 C;  4NY0 A;  5GOW B;  1BDC A;  4JPZ B;  2E74 D;  3M9Q A;  1LTJ A;  2C0X A;  1NHL A;  2HFE D;  3A8P A;  4EDF A;  4H13 C;  4OH8 B;  1NGM B;  3AJ4 A;  1GW3 A;  1SQP E;  3L36 A;  3H1L G;  3NSU A;  3HD7 C;  5I2S A;  1JTH A;  3AE1 C;  2GJY A;  4K2P A;  3TK1 A;  1X22 A;  4MT7 A;  1OVU A;  3V2R A;  2KS1 B;  3OAN A;  2R44 A;  1KB9 D;  3VN0 A;  5KKZ C;  1FAO A;  4KT0 J;  2J58 A;  1FGZ A;  1T3J A;  2A06 D;  2NRG A;  4L74 A;  1BE3 J;  1IC2 A;  1NTK K;  5KCV A;  4WB4 A;  1GMJ A;  5H2F H;  5KAF E;  2E5T A;  1AQ5 A;  1UNQ A;  3UIA A;  2R0D A;  2R32 A;  1JY3 P;  1BTN A;  3RBZ A;  1W5C E;  3NWF A;  5APQ A;  1XR0 B;  1FJK A;  2JJL A;  1Y5O A;  2M3B A;  2WZ7 A;  2P0H A;  1L4A C;  2NPS D;  1GD2 E;  2YS5 A;  1BAK A;  2M8R A;  2NPS C;  1L4A D;  3SWF A;  4H44 D;  1LTG C;  4CPG A;  1LWU B;  1DX7 A;  1Q86 Q;  2LXC B;  5D27 A;  2NPS B;  1DH3 A;  3D6Y A;  1XX0 A;  5CJ0 A;  4HAZ B;  4KJM A;  1R8E A;  3H1J J;  1L4A B;  4HYT B;  3T97 B;  3OHM B;  3SSU A;  4DX8 A;  2KNC A;  3LID A;  4CHJ A;  5GTI E;  3GMA A;  1HF9 A;  4C0A A;  3EFG A;  5TJH A;  3TNU A;  3O96 A;  2Q13 A;  2JO1 A;  1T3U A;  5L8R J;  1NJI Q;  3ITK A;  2FYZ A;  1JCC A;  1YYC A;  2E76 B;  3HE4 B;  3M0A A;  2Z13 A;  2LKM A;  3CCM P;  3ZDM A;  4ZKU A;  2KLV A;  1BSN A;  2W2X C;  3KSY A;  3H1K D;  1PLS A;  4N78 E;  4PNK A;  1FZG A;  2GS0 A;  2E43 A;  2WSE J;  1U5D A;  1QGK B;  2KGX B;  1FHX A;  3FXD A;  4R4M A;  2XQN M;  2COD A;  1L0L D;  1LTI C;  1KOR A;  1CSB A;  3JSV C;  3LW5 H;  1AA0 A;  1M56 D;  1MKM A;  5AW5 B;  5DIF B;  3U1A A;  3HUS B;  2KUP A;  2C9L Y;  4HB4 B;  1IJD B;  1NWQ A;  3NXS A;  4ZMD A;  5KAI E;  2FFD B;  4F7G A;  1EDK A;  2OYO A;  3A0B H;  1DEB A;  4D6T E;  1V5P A;  1H0T B;  2DTC A;  1H88 A;  2K2J A;  1YQ3 C;  1NO4 A;  3QWO C;  3FWL A;  2MFQ A;  3L74 D;  2AEJ A;  2LUL A;  4Y28 J;  2KIK A;  2CRF A;  2W6B A;  1IO4 A;  4HDQ A;  4WVF B;  4GXB A;  3T06 A;  1GC6 A;  2K9J A;  1SQB D;  4W7Z A;  2OYI B;  2W6A A;  2D9V A;  3NW8 A;  1GK6 A;  1KTM A;  1BGY D;  1NTZ E;  2J0K A;  1HTL C;  1TU3 F;  1JMB A;  2O3J A;  4KHX A;  3G9R A;  4LLH A;  5CBO A;  1EAZ A;  3MUD A;  3RK2 B;  2KP8 A;  1JB0 J;  2D2C C;  1PGQ A;  2VSZ A;  2QJP C;  1DD4 A;  1KZ7 A;  3A2A A;  3H1L E;  1A02 J;  1SQX G;  3TDK A;  3KXD A;  2CPB A;  1EQ7 A;  2GUS A;  4KVG B;  3GHG C;  2Q6Q A;  4TKN A;  1GZL A;  3MTU E;  2LYD A;  1ZOY C;  1NTM E;  4TT3 H;  4ZRI A;  1KIL A;  3X23 A;  4W80 A;  3B5N A;  2OYH B;  3D71 A;  1N3H A;  1ZC4 B;  3PVU A;  1KC8 Q;  3QIJ A;  4Z2N A;  4F7H A;  2ZYA A;  5K5G B;  1FZB A;  3CWB G;  1MI1 A;  3TCA A;  2HTH B;  1P6S A;  2R09 A;  2DKP A;  1J1E B;  4I6M C;  5APV A;  4DXA B;  3F5H A;  4HHV A;  3D70 A;  1ZV8 A;  3L73 E;  3H1L J;  1VF5 B;  3H1K E;  2Y9Y A;  2GCJ A;  5AVR B;  3WUU A;  2WSE H;  2WVR A;  1S9K E;  1JTH B;  5AW8 B;  5GTH H;  1JMM A;  2YXR B;  2LOX A;  2E76 C;  3TFM A;  1IFN A;  4RO0 A;  4UB8 H;  1NTZ J;  5IRS A;  1LNQ A;  1URQ D;  2ZXE B;  1LTS C;  2JP2 A;  1FE6 A;  2FYU K;  2JR8 A;  1S1C X;  3L37 A;  2KOG A;  1LGH B;  3L70 E;  3PHL A;  1LT9 A;  5CHX A;  5APT A;  2MJZ A;  1SS1 A;  5KTB A;  3BAS A;  3G71 P;  1KB9 H;  2BEZ F;  4W7Y A;  1SFC C;  3V5W A;  4H13 B;  2KUQ A;  2DHK A;  4PV1 C;  4D6T J;  2Y7B A;  2A45 G;  5CCG A;  1M7E A;  1NTK E;  1W2B O;  1FS0 E;  1G1J A;  4A6F B;  4IFS A;  1WMK A;  3MHV A;  3P8C D;  5APS A;  3B77 A;  3CWB E;  2VKI A;  3D6Z A;  1QLE D;  2K37 A;  3DXC A;  1BTK A;  1LTA C;  4GOD A;  3U59 A;  1AQT A;  5J3T A;  3F0W A;  4BRY A;  4HSI A;  2D2C D;  3L71 G;  3I5C A;  1ZP0 C;  1G2C B;  1H4R A;  2ADZ A;  1KQF B;  2V7Q J;  4MN4 C;  2OGU A;  4RKU J;  2NMB A;  1NTM J;  1OXZ A;  3CPW O;  2P67 A;  4NPF X;  3AE5 C;  3Q5S A;  1G1I A;  3GHG B;  5DHA B;  2KZI A;  1ZW0 A;  2DFK A;  4YTP C;  1FU1 A;  2HOD A;  3A58 A;  1N73 A;  1N73 C;  1JY3 N;  1GC7 A;  2YMY A;  1Z87 A;  2PAJ A;  2WWW A;  4GOE A;  2IDB A;  2KYV A;  2BCC D;  2JKV A;  1KMI Z;  1EXI A;  2BCC J;  1X79 B;  2M14 A;  1K04 A;  2CY5 A;  3L75 E;  1KQG B;  3H1J E;  2FKW B;  3FVC A;  4IFM A;  2CY4 A;  1NH4 A;  1M1J B;  3WA0 A;  1VQ4 P;  1DD3 A;  3PLN A;  4CHM A;  4GMX B;  1DBH A;  3P7Z A;  2E5Y A;  2V76 A;  2OAR A;  2YKQ A;  2L1C A;  3FGA D;  5C39 A;  3VOQ A;  3CXH E;  5LG4 B;  3ODX A;  1PPJ D;  1TXD A;  3BCC J;  3M0D C;  2NZ8 B;  2RGN B;  3BIN A;  1YJ9 P;  1NU2 A;  1MKE A;  1SHC A;  1AJY A;  2L2I A;  2RVB B;  4XA4 A;  2QA4 P;  2XNX A;  1U5G A;  4KHB B;  2CAY A;  3CLQ A;  1KZU B;  4IL6 X;  1RH5 B;  3CI9 A;  2YIU C;  2UWJ E;  1SQQ G;  1Y47 A;  3B5N D;  1NAY A;  4NPD A;  1SQQ K;  3D8D A;  4EIJ A;  1RF0 C;  4A6F A;  3CMA P;  1UPR A;  1AQC A;  3AE4 C;  1MIZ B;  2EC1 A;  3RK3 B;  3KRW A;  1L0L G;  2W6J H;  5CLL B;  1N7L A;  2KB7 P;  1LP1 A;  2PRR A;  4H44 C;  5KQ1 A;  2Q3E A;  1NTM D;  4IAP A;  3CCJ P;  1M7L A;  1LT9 B;  1FZC B;  3H1H J;  3MZW B;  2IYP A;  1IFJ A;  1OFC X;  2Z4E A;  3DXD A;  1Z56 A;  5CJ4 A;  3V2N A;  3WU2 E;  3H1K G;  3AEC C;  1ZR2 A;  1HUC A;  2DHJ A;  4D6T G;  2H43 A;  3VMZ A;  1VL2 A;  3IVF A;  1RHZ B;  1UEF A;  3PTZ A;  1L0N D;  1GL2 C;  5AVS B;  3NFQ A;  1I7A A;  1NTK J;  4NSW A;  2FYU G;  1SQB K;  5BU8 B;  1T8Z A;  1GTW A;  3QH9 A;  1FDI A;  1KIL D;  1CW5 A;  1E5W A;  2ZFC A;  1JNM A;  1W2E A;  1YTZ I;  3A0B E;  1NKZ B;  3H1H E;  1URQ B;  5LON B;  2IBZ E;  4GDO A;  1LT1 A;  1M57 D;  2E74 C;  4H8S A;  1GL2 D;  3AE8 C;  5LOP B;  4N78 D;  2M3E A;  5CCH A;  3EWK A;  3B5N B;  5KLI B;  5D3W A;  1ZVR A;  1KIL B;  1MAI A;  1BE3 E;  2FXM A;  1VF5 C;  4U3F E;  3RBX A;  1K73 Q;  4H13 D;  2QIW A;  1KYO I;  1X0T A;  1LTB C;  1WG7 A;  4DOJ A;  1SGH A;  1UNR A;  1U7J A;  3CC7 P;  1LWU C;  4I1L A;  1DDW A;  3S1K A;  3B71 A;  3M1I B;  3Q5R A;  2YT1 A;  4PD4 I;  1LJ2 A;  3ML4 A;  3U1C A;  2P58 A;  1PP9 E;  2WSF H;  4I7Z B;  3HE5 B;  3PP2 A;  1ZRT D;  2WPR A;  2N9Y B;  2COC A;  1NU1 E;  2FYU E;  4EOT A;  3LIE A;  2YVC A;  3MGN A;  3PZD A;  1SQX J;  2I1J A;  4L6E A;  4U7J A;  1Y8A A;  4DCK A;  5KAI H;  1JM0 A;  1S9K D;  2YT2 A;  3HQC A;  1M1J C;  1SQX D;  1IK9 A;  3HK0 A;  3WMM 0;  4DZO A;  3CIK A;  3CX5 I;  1USE A;  3OW2 O;  1FZA A;  1WGU A;  3CCE P;  2YT0 A;  1JEK A;  1UNP A;  4HAT B;  2JDI H;  4PV1 D;  4HB1 A;  2AEF A;  4JBZ A;  1YQ4 C;  2YKP A;  1ZR4 A;  2D9Y A;  5E79 H;  1X1G A;  2DYQ A;  1R5L A;  3AEG C;  1BGY G;  2WPS A;  2ELA A;  4AUW A;  1YIT P;  1H8A A;  2Z59 A;  1K05 A;  1N7S C;  3TYY A;  2NZ2 A;  2K9Y A;  1FDO A;  1UIX A;  3V5B A;  1EDL A;  3JC2 2;  2E76 D;  1RY3 A;  3LW5 J;  1D7M A;  4DIX A;  3KPE A;  3IFM A;  5AW3 B;  2PZ1 A;  1L0N G;  2KZJ A;  2H7E A;  2QKL A;  3CWB D;  1Q2N A;  5FI1 A;  2QRX A;  4Z1M H;  1P5T A;  2N1T A;  5KJ7 C;  3UZT A;  2J0J A;  3BAT A;  3R4Y A;  5AVX B;  1Q81 Q;  3VP8 A;  3MUD C;  3WUV A;  2PFX A;  2KR0 A;  2WT7 B;  1EDI A;  4M3L A;  3TNU B;  1RQU A;  3FSS A;  1B55 A;  1X11 A;  4ASV A;  4QJ3 B;  1WGQ A;  1FHO A;  2M5A B;  3H1H G;  5APU A;  1X1F A;  2QM8 A;  3B4S A;  5DHF B;  1BDD A;  4C7R A;  2H7D A;  4YXD C;  1FC2 C;  1V88 A;  2A45 I;  1HWT C;  2KSE A;  3H1L D;  2ZT9 D;  1U5F A;  1EC5 A;  3L70 J;  3KZI H;  5CCG D;  1RRP B;  4A6H A;  2D11 A;  2E75 C;  2Z4D A;  2R3S A;  3M9B A;  5CBN A;  3EFF K;  1SQB G;  3NTN A;  3L74 J;  5L81 A;  3GLM A;  1ZYI A;  1QEX A;  1X9V A;  5H2F E;  1ZXG A;  2QSI A;  1JY2 O;  1SQB J;  1NTY A;  3H1I E;  4NPE A;  2WSF J;  3A0H H;  3L72 E;  1V5M A;  5CCG C;  2QKM A;  4ZRJ A;  3O6Q A;  1V61 A;  2DX5 A;  2ZT9 C;  2J0M A;  3C8V A;  4OGQ B;  4KHB A;  1QC6 A;  3AEA C;  5KLV G;  4K2O A;  3MD0 A;  4UB8 E;  3D8E A;  1PGJ A;  1U57 A;  1NU1 J;  2KS1 A;  5DJU B;  2UVM A;  3PH0 A;  2XZR A;  2RNR B;  1L2P A;  2Y8F A;  1PPJ E;  3ULB A;  1RF1 B;  3PRJ A;  2KK7 A;  3AEB C;  4GT1 A;  1SQV D;  5DH9 B;  4DJG A;  2Z14 A;  4PJ0 E;  2IFS A;  1HJ0 A;  3V4Q A;  2R2Y A;  1SQQ J;  1P3R A;  2I1K A;  4K3A A;  3FEH A;  3RK3 C;  1JOC A;  3Q3D A;  1X8Y A;  4GKG A;  3ODW A;  3KZ1 A;  1NTM G;  2LOZ A;  1NKN A;  2QJP B;  3H1J D;  1LTT C;  1OVV A;  4H0L D;  2ZXX A;  5APY A;  2E42 A;  1Q82 Q;  3OAK A;  2P0F A;  1MPH A;  2P10 A;  2W2X D;  2XKM A;  2O01 N;  3V2Q A;  2AEM A;  4H44 B;  1U29 A;  3L73 G;  5AW1 B;  1P84 E;  2Y9Z A;  2MDX A;  3RCP A;  2HLO A;  2FXO A;  1GL2 A;  2N9B A;  2HOD B;  1WJ1 A;  4HAW B;  2YRY A;  3V2P A;  1OW7 A;  2B87 B;  1DEE G;  3H32 B;  3LJU X;  4QJ5 B;  2RRF A;  3H32 A;  2Y0C A;  5B66 E;  1Y19 B;  2WPV B;  2FYU D;  2B87 A;  1FHW A;  3G6E P;  1GG3 A;  3L4F A;  2W8Z A;  3C1L A;  1H10 A;  1FOS E;  1KB9 E;  2ZJS E;  3G4S P;  3CME P;  2HPC A;  1XTG B;  1RF0 A;  1KYO D;  1EZV D;  3GYP A;  1SQV E;  1XCG A;  4KHO A;  4OGQ D;  4OSN A;  5C6R A;  1NTK D;  2E75 B;  2D2Q A;  2RKL A;  3AE6 C;  5I2M A;  5C5B B;  5M1B A;  2RN0 A;  3SWK A;  3NMD A;  4HAV B;  4WY4 D;  1KN7 A;  2P1J A;  4PQ0 A;  3OJA B;  2QG4 A;  3PVW A;  3AEF C;  3E7K A;  3F5R A;  1S3J A;  3AE2 C;  1IFI A;  4HKZ H;  3AED C;  5C16 A;  4L1R A;  1SQQ D;  4DT0 A;  1U27 A;  1PL5 A;  1J19 A;  1EVH A;  1MK9 B;  1FJP A;  3CX5 E;  1U5E A;  3AE9 C;  1EF1 A;  2BEQ D;  3KZI E;  4QXA B;  2G35 A;  2K49 A;  2W27 A;  4KAX B;  1JY3 O;  1PZQ A;  3WU2 H;  3N4X A;  4GNK B;  5HE3 A;  3RK2 D;  1KD1 Q;  1QL1 A;  1SQX E;  3A8Q A;  2J59 M;  4YPC A;  4ZRK A;  2ZVO B;  3BCC G;  1S5L E;  4GZU A;  5D3Y A;  2FYU J;  4WY4 C;  4WVZ A;  2IYB A;  2LG1 A;  2K88 A;  5AW4 B;  2K8E A;  1BCC D;  1PP9 J;  2EMT A;  3IN6 A;  1HBW A;  1PGP A;  5AW6 B;  1OVR A;  3A5T A;  2ZVN B;  3M91 A;  2BCC E;  2G8Y A;  5AVZ B;  2DYN A;  2UZR A;  3BVH A;  4EI2 A;  2L91 A;  3ABV C;  3L75 G;  1XOD A;  2Y0D A;  3ULC A;  2YSZ A;  1PFJ A;  2V4H A;  2WSC J;  1WT6 A;  1T77 A;  1K5G B;  5KQ4 A;  1OZH A;  3E1R A;  1KYO H;  2ZKM X;  2X18 A;  1XTC C;  2YO3 A;  3L73 D;  5EFX A;  2M5A A;  1PV3 A;  4C7N A;  1J0W A;  1EZV I;  3MPX A;  3TW1 A;  5EFW B;  2OYI A;  4BBK A;  2K9J B;  1V5U A;  3HUS C;  1VQK P;  1CI6 A;  1SQP J;  3A7O A;  1VDF A;  4XFJ A;  2H7H A;  5D3V A;  1H89 A;  5J3Y A;  2WSC H;  2XDJ A;  3N7C A;  2Y0E A;  3L70 G;  2IFM A;  1MIX A;  4IL6 E;  2M38 A;  3L71 J;  3CXH I;  5AVU B;  3PP5 A;  4UB6 H;  4K81 A;  4YON A;  3GG2 A;  3HTK B;  2O1J A;  4YXW H;  1BGY E;  3U8Z A;  1J2J B;  1WRG A;  1NTV A;  2EJ8 A;  2R5B A;  2KSJ A;  3NWA A;  1PMS A;  1L0L E;  2QM7 A;  1SQP K;  2RSG A;  2FY8 A;  1BSH A;  1MFT A;  4IFF A;  3DCX A;  4U3F G;  1YI2 P;  4HB3 B;  1N7S B;  1FOE A;  1QQG A;  1DDV A;  3QWM A;  4P7I A;  1OW6 A;  1YBK A;  3HTK A;  1MV8 A;  1CZQ A;  4GN1 A;  1U7M A;  5AVW B;  3SWY A;  2YS3 A;  2ZAE B;  5DI9 B;  4HJG H;  3GF3 A;  4KHA A;  2D2C B;  1K8A Q;  1LW3 A;  3V6I A;  1KB9 I;  3HE4 A;  2D4Q A;  5KKZ B;  2N23 A;  1N8R Q;  3SV1 A;  2JWD A;  1SQQ E;  4AYC A;  4D6W A;  1Q67 A;  2P2U A;  1W1H A;  4WSF A;  3VOP A;  1RF1 C;  3A0H E;  1HH0 A;  2ITA A;  3GF7 A;  3D8F A;  4C7N B;  4ZNC A;  2EMS A;  1L4A A;  1YIJ P;  1Y9B A;  1EZV G;  1USD A;  3BCC E;  2HYN A;  3HE5 A;  1OW8 A;  2NPS A;  3CXB B;  3VMX A;  1FZC C;  1VQ6 P;  1BCC E;  1SFC D;  1JY2 N;  1UPQ A;  5CLQ B;  3S4R A;  1XD4 A;  1P84 I;  1RE4 A;  3M9H A;  3USS A;  2R5D A;  1VQ8 P;  2E75 D;  3L72 J;  3TGU D;  2DKQ A;  4PV1 B;  4U3F D;  1E79 H;  3Q1M A;  1BE3 G;  1NAF A;  3MDB C;  4BXL A;  2YXQ B;  2JP3 A;  2Z0Q A;  3TGU G;  1ZRT E;  3F89 A;  1VPC A;  5AW2 B;  5M4Y B;  2Q3I A;  2DLW A;  1L0N E;  5AVV B;  1RE4 C;  4GPT B;  5AVT B;  2VRW B;  1L0N J;  3K5B A;  3VMA A;  4HB2 B;  2QE7 H;  2KI7 B;  1HJB A;  1N2D C;  4Y99 C;  4HB0 B;  5CCH D;  1URQ A;  1URQ C;  4WWI A;  4IFD K;  2OTX A;  4TLF A;  5AW7 B;  2I5C A;  1AV1 A;  3Q5P A;  1GU5 A;  2KUB A;  4PD4 E;  2DW3 A;  5CCH C;  3RGU A;  2E2X A;  2GCL A;  1JO5 A;  1OMI A;  1NTZ D;  4LGD E;  2YIU B;  3L71 D;  1PPJ G;  3SUZ A;  4RES B;  3CCL P;  1PFI A;  1PIX A;  1GK4 A;  3R2P A;  2K00 A;  2IBZ D;  5HE1 A;  2IX7 C;  2Q1K A;  1SP4 A;  2AEH A;  1SQV G;  2D9Z A;  3CL3 D;  2B9B A;  2DN6 A;  3ZVR A;  4N3Y B;  4ASW A;  1L0N K;  3AE7 C;  4BWN A;  4EMO A;  5KJ7 A;  3JCU E;  1OIP A;  1FZC A;  3L72 G;  5JP4 A;  2FBW C;  2P7J A;  3H6P A;  5BU5 A;  4K17 A;  3FXE A;  1WI1 A;  2AXC A;  1QVF O;  2C9N Y;  1NOH A;  2IBZ I;  4B6H A;  3L72 D;  3TGU J;  1VQ9 P;  2ZYG A;  1FB8 A;  1Q7Y Q;  5JHH A;  2QEX P;  2Y8G A;  4OT1 A;  3KY9 A;  3HSA A;  1AVO A;  2DA0 A;  2YNY A;  2GA1 A;  1EXJ A;  1KQL A;  2HPC B;  4F7U P;  2FXP A;  2ROV A;  1IFM A;  2ROZ B;  1IK7 A;  3BRT B;  4JYC A;  1JUN A;  2GM4 A;  1OY2 A;  2KXP B;  2OYI C;  3CD6 P;  3L35 A;  2FJL A;  1HGV A;  3AE3 C;  3G9W A;  1FZE A;  3KHU A;  1UII A;  1AVY A;  3CX5 D;  3V4W A;  2MKV A;  4WY4 B;  3FWN A;  4I2L C;  2Q7C A;  3L71 E;  1GL2 B;  3H25 A;  1OQN A;  1A02 F;  1LTJ C;  5CMZ A;  2M0B A;  3W68 A;  1BCC J;  4Z2M B;  1M1J A;  1VF5 D;  3BRV B;  3W67 A;  1X86 A;  1QVG O;  2HE7 A;  2Z5H A;  1FDM A;  2D9X A;  4LC1 A;  3L75 D;  1M7R A;  5DJT B;  2Q9I A;  2Z0O A;  1EZV E;  1FBM A;  1OMW A;  3H1I G;  4WBA A;  2OTK E;  3WUT A;  1EDJ A;  5B66 H;  3H1I J;  2I8D A;  1W1G A;  2QJK C;  2RMZ A;  1KIL C;  3A98 B;  4HAX B;  1ZC3 B;  1N73 B;  3P7K A;  3S9O A;  2IBZ G;  2N1T C;  1RF1 A;  3Q2Y A;  3H1I D;  4WY4 A;  5HE2 A;  2WMM A;  3GHG A;  2A06 G;  3KQG A;  3L74 E;  1VQ5 P;  4PJ0 H;  1J1E C;  2D10 A;  2POH A;  1FZF A;  2DX1 A;  2YO2 A;  1ZN5 A;  1KIL E;  2K1A A;  1NTZ K;  1DRO A;  4BRY B;  1K9M Q;  2B88 A;  3O6Q B;  3TVV A;  3OA7 A;  4C46 A;  1BGY J;  3PJS K;  4IOY X;  3CCV P;  3RL0 D;  1KQS O;  3AEE C;  1AFO A;  3PG7 A;  3H1H D;  1P84 H;  1WVH A;  3PVL A;  2UZS A;  3TO1 A;  3SO6 A;  3HRN A;  2H8P D;  1BE3 D;  3CX5 H;  1NU1 G;  3RL0 C;  1SFC A;  1NYH A;  3SNH A;  3B5N C;  5KLI C;  1IRS A;  1W1D A;  1OWA A;  2J5U A;  4L75 A;  4AQR D;  5TIS E;  1ZME C;  4DBB A;  2AXT E;  1LT9 C;  1MK7 B;  5E79 E;  4B86 A;  4K35 A;  1MZ9 A;  2LR2 A;  1AWE A;  2Q5U A;  3C9I A;  3U7D A;  4IOI H;  1YJN P;  2A06 E;  4A6K A;  4D0N B;  4L76 A;  1ISN A;  3RL0 g;  1I2H A;  3CCS P;  2K2U A;  4JF7 A;  1PP9 D;  4CSQ A;  5APX A;  2WT7 A;  4JYB A;  4EKU A;  2IZ1 A;  3MP7 B;  2MWN B;  3RK2 C;  4OWF A;  2AL6 A;  5AW9 B;  1PGO A;  5BVZ A;  3E1I A;  1SQV J;  1XKE A;  2N1T B;  2QVA A;  3CCR P;  1JY2 P;  3P32 A;  1YHQ P;  1VQO P;  2YF0 A;  1IZN B;  3GW6 A;  4H0L B;  5KLV K;  3VMY A;  2FYN B;  2W2W A;  1EGX A;  3CCU P;  2OYH A;  3HD7 D;  4JQ0 D;  4N6J A;  3CXH H;  1KFN A;  4OGQ C;  3A3Y B;  1ZM0 A;  3P8C E;  1J1D B;  1NVO A;  1TQZ A;  2BCJ A;  3PSC A;  1KFM A;  1SQX K;  2YKO A;  5GTI H;  3WYF B;  5APW A; 
#chains in the Genus database with same CATH homology
 3N7C A;  2LKM A;  3M1I B;  2IFM A;  1GDT A;  1MIX A;  2YT1 A;  3KYQ A;  2XV5 A;  4ZKU A;  3U1C A;  2KLV A;  2M38 A;  3ML4 A;  2W2X C;  5AVU B;  3KSY A;  2WSF H;  3PP5 A;  4K81 A;  4YON A;  1PLS A;  3HE5 B;  2L5G B;  3HTK B;  2O1J A;  4N78 E;  3PP2 A;  1MUU A;  1U2B A;  2WPR A;  3U8Z A;  1J2J B;  1WRG A;  2IPP A;  2COC A;  1FZG A;  4PNK A;  1NTV A;  2GS0 A;  2E43 A;  2EJ8 A;  4EOT A;  2R5B A;  2KSJ A;  3LIE A;  1PMS A;  2YVC A;  1JCD A;  1U5D A;  3MGN A;  3PZD A;  2C0W A;  2I1J A;  2KGX B;  3HW2 B;  2QM7 A;  1FHX A;  1SQP K;  3TSI A;  1BWN A;  2RSG A;  4IFF A;  4L6E A;  5AVY B;  2ELB A;  2XQN M;  4HB3 B;  1S9K D;  1N7S B;  1FOE A;  1QQG A;  1DDV A;  2COD A;  3HQC A;  3QWM A;  1LTI C;  1M1J C;  1CSB A;  2D9W A;  4P7I A;  5AW0 B;  3LW5 H;  1IK9 A;  3HK0 A;  3WMM 0;  4DZO A;  5AW5 B;  3CIK A;  3U1A A;  3HUS B;  5DIF B;  3G3Z A;  2KUP A;  2C9L Y;  5FI0 A;  1FZA A;  1WGU A;  4HB4 B;  1IJD B;  1NWQ A;  2HG5 D;  2YT0 A;  3HTK A;  5J3Q A;  1MV8 A;  1UNP A;  3NXS A;  2FFD B;  1CZQ A;  2WTY A;  4HAT B;  4GN1 A;  4F7G A;  3M06 A;  5AVW B;  2YKP A;  1ZR4 A;  3SWY A;  2D9Y A;  2FFD A;  2YS3 A;  1X1G A;  5DI9 B;  1DEB A;  3VTP C;  2OQB A;  2DYQ A;  3P6A A;  1V5P A;  2DTC A;  2N1T D;  4KHA A;  1H88 A;  2K2J A;  3HUS A;  4HDO A;  1NO4 A;  2WPS A;  1LW3 A;  3HE4 A;  4AUW A;  2D4Q A;  2ELA A;  2N23 A;  2MFQ A;  2RLO A;  2LUL A;  1H8A A;  3SV1 A;  2CRF A;  2W6B A;  4AYC A;  1IO4 A;  1J1D C;  1N7S A;  1N7S C;  3TYY A;  4GIF A;  2OYH C;  4HDQ A;  4WVF B;  4GXB A;  1HVV A;  3RK3 D;  3T06 A;  3P8M C;  3EQ2 A;  1GC6 A;  3V5B A;  3FM8 C;  4W7Z A;  1Q67 A;  2OYI B;  2P2U A;  1W1H A;  1RY3 A;  2W6A A;  4WSF A;  3VOP A;  1RF1 C;  2D9V A;  1GK6 A;  1HH0 A;  3KPE A;  2J0K A;  4C7N B;  3IFM A;  3D8F A;  5AW3 B;  1HTL C;  1L4A A;  1RJ2 A;  2EMS A;  2PZ1 A;  1FAV A;  4KHX A;  4LLH A;  1EAZ A;  3MUD A;  3RK2 B;  2H7E A;  2HYN A;  3HE5 A;  2QKL A;  2NPS A;  3CXB B;  2KP8 A;  3VMX A;  1FZC C;  5FI1 A;  1SFC D;  2VSZ A;  1JY2 N;  1P5T A;  2N1T A;  5KJ7 C;  1KZ7 A;  5C79 A;  1UPQ A;  3A2A A;  5CLQ B;  3UZT A;  2J0J A;  3BAT A;  1QL2 A;  1XD4 A;  5AVX B;  1A02 J;  1RE4 A;  3M9H A;  1T2K D;  4Y99 B;  2R5D A;  2CPB A;  3M0D A;  3VP8 A;  2DKQ A;  2GUS A;  1EQ7 A;  1CI6 B;  4KVG B;  3GHG C;  1KZG A;  1L0L K;  4TKN A;  1GZL A;  2WT7 B;  3MTU E;  2LYD A;  3PEG A;  4M3L A;  2JEE A;  1NAF A;  1X05 A;  3DXE A;  3MDB C;  3TNU B;  3FSS A;  4XE5 B;  2Z5I A;  1B55 A;  1X11 A;  2Z0Q A;  4ZRI A;  1KIL A;  1NU1 K;  1V89 A;  3X23 A;  4W80 A;  3B5N A;  1WGQ A;  2OYH B;  2Z0P A;  1FHO A;  1VPC A;  1N3H A;  1ZC4 B;  5AW2 B;  1ZSQ A;  2Q3I A;  3T97 A;  2DLW A;  5APU A;  1X1F A;  3PVU A;  2QM8 A;  5AVV B;  3QBV B;  4YL8 A;  1RE4 C;  3QIJ A;  4GPT B;  5DHF B;  5AVT B;  4C7R A;  2I5F A;  4XWX A;  4Z2N A;  2VRW B;  1FOS F;  4F7H A;  2H7D A;  1FZB A;  1V88 A;  1N86 A;  2P8V A;  3TCA A;  2A45 I;  4HB2 B;  1HWT C;  1HJB A;  2HTH B;  2BAS A;  1LWU A;  1N2D C;  4Y99 C;  1P6S A;  1U5F A;  2R09 A;  4HB0 B;  5CCH D;  1SVF A;  2DKP A;  1URQ A;  1URQ C;  2OTX A;  4IFD K;  4ZKP A;  5CCG D;  2FFD C;  1RRP B;  4A6H A;  2D11 A;  1J1E B;  4I6M C;  5APV A;  5AW7 B;  2I5C A;  1SFC B;  3KDP B;  3RL0 B;  4DXA B;  1GU5 A;  3M9B A;  2RUK B;  4HHV A;  3NTN A;  2YS1 A;  1ZV8 A;  1YTZ T;  5CCH C;  2E2X A;  2GCL A;  1JO5 A;  5L81 A;  4LGD E;  2GUV A;  2GCJ A;  3SUZ A;  5HE0 A;  5AVR B;  1HGZ A;  3O8Z A;  1X9V A;  4RES B;  1WJM A;  1PFI A;  2WSE H;  4MK0 A;  1JY2 O;  3IR9 A;  2O1K A;  1TJ6 A;  1GK4 A;  3VIA A;  4DX9 0;  3R2P A;  1S9K E;  2K00 A;  1K5D B;  5HE1 A;  1JTH B;  2IX7 C;  2COF A;  5AW8 B;  1NTY A;  4WJ7 A;  3II6 A;  1JMM A;  1SP4 A;  2LOX A;  2AEH A;  3TFM A;  1IFN A;  2D9Z A;  3CL3 D;  3KRX A;  3GYO A;  2DN6 A;  1V5M A;  2QKM A;  5CCG C;  4ZRJ A;  3ZVR A;  1URQ D;  4N3Y B;  1V61 A;  2DX5 A;  1L0N K;  2ZXE B;  4GMV A;  1LTS C;  4EMO A;  2JP2 A;  2J0M A;  1DDM A;  5KJ7 A;  2FYU K;  3L37 A;  4O9B A;  1FGY A;  1QC6 A;  1FZC A;  2KOG A;  1LGH B;  5JP4 A;  1T2K C;  1LT9 A;  2P7J A;  3H6P A;  5CHX A;  5BU5 A;  4K2O A;  3MD0 A;  4K17 A;  5APT A;  3D8E A;  2MJZ A;  1GU4 A;  5JHG A;  1WI1 A;  5KTB A;  3BAS A;  2C9N Y;  1NOH A;  5D3X A;  4W7Y A;  2UVM A;  1SFC C;  4B6H A;  1IFD A;  3V5W A;  2XZR A;  2DHK A;  2RNR B;  1FB8 A;  2Y8F A;  2Y7B A;  5JHH A;  2A45 G;  5CCG A;  1M7E A;  2P0D A;  2Y8G A;  3KY9 A;  3ULB A;  1RF1 B;  3SYX A;  1G1J A;  2XU6 A;  2DA0 A;  4IFS A;  3P8C D;  4A6F B;  2YNY A;  5APS A;  1KQL A;  4GT1 A;  2HPC B;  2VKI A;  5DH9 B;  3DXC A;  1BTK A;  2IFS A;  1LTA C;  2WPQ A;  2KCJ A;  3V4Q A;  3U59 A;  2I1K A;  1P3R A;  4F7U P;  1KI1 B;  3FEH A;  3RK3 C;  5J3T A;  1JOC A;  2ROV A;  3F0W A;  1IFM A;  5KJ7 D;  5JLJ B;  2ROZ B;  3BRT B;  4JYC A;  1JUN A;  2CPS A;  2MKR A;  1X8Y A;  2WIT A;  4GKG A;  3I5C A;  2GM4 A;  1OY2 A;  2OYI C;  3ODW A;  3BJI A;  3KZ1 A;  1LTJ B;  1RE3 C;  3L35 A;  1G2C B;  1H4R A;  2FJL A;  1HGV A;  1NKN A;  2LOZ A;  5C5B A;  2COA A;  2ADZ A;  3G9W A;  1FZE A;  1LTT C;  1NTM K;  2E42 A;  2NMB A;  5APY A;  1OXZ A;  2P0F A;  3OAK A;  2LKO A;  1MPH A;  2P67 A;  3V4W A;  2W2X D;  3AU4 A;  1G1I A;  2XKM A;  3GHG B;  3V2Q A;  5DHA B;  4WY4 B;  1U29 A;  4A5K A;  5AW1 B;  2DFK A;  3HD7 A;  4HH2 A;  1FU1 A;  2HOD A;  1N73 A;  1N73 C;  4I2L C;  1JY3 N;  1N7S D;  2IFN A;  2Q7C A;  1GL2 B;  2HLO A;  2YMY A;  1GC7 A;  2MDX A;  4HAU B;  1OQN A;  1Z87 A;  2PAJ A;  3RCP A;  1A02 F;  1RE3 A;  1LTJ C;  1NI2 A;  2WWW A;  5CMZ A;  3VP9 A;  1GL2 A;  2N9B A;  3MIW A;  2DHI A;  4Z2M B;  2HOD B;  2KYV A;  1M1J A;  1WJ1 A;  4HAW B;  2YRY A;  3BRV B;  1ZLL A;  3V2P A;  1X86 A;  3B8E B;  2HE7 A;  2Z5H A;  1FDM A;  2D9X A;  2A45 H;  4LC1 A;  3ZDT A;  4TYZ A;  1GW4 A;  2R3C A;  1SQV K;  1X79 B;  3H32 B;  3VYI A;  1M7R A;  2M14 A;  1DYN A;  3LJU X;  3AU5 A;  2CY5 A;  1SLQ A;  2N0Y A;  2Q9I A;  3H32 A;  1G2C A;  1Y19 B;  2Z0O A;  2ZPY A;  4CYE A;  2FKW B;  1FBM A;  4EJN A;  1FHW A;  4IFM A;  4Y94 A;  1OMW A;  2CY4 A;  1GG3 A;  3L4F A;  2PP6 A;  1NH4 A;  4WBA A;  1M1J B;  3WA0 A;  1H10 A;  5AVQ B;  1FOS E;  4CHM A;  4GMX B;  1DBH A;  3P7Z A;  1W1G A;  4MY6 A;  2HPC A;  2O01 H;  1KIL C;  2V76 A;  3A98 B;  1XTG B;  1MFZ A;  2OAR A;  4HAX B;  4HAY B;  1RF0 A;  1ZC3 B;  3P7K A;  1N73 B;  3GYP A;  2N1T C;  2YKQ A;  3HD7 B;  1XCG A;  1RF1 A;  2L1C A;  4KHO A;  4WY4 A;  5HE2 A;  1LB1 A;  3GHG A;  3KQG A;  3VOQ A;  5C6R A;  3ODX A;  2VRS A;  3N7N A;  1TXD A;  2NZ8 B;  3M0D C;  2RGN B;  3BIN A;  1J1E C;  1NU2 A;  3ODO A;  1MKE A;  1SHC A;  2POH A;  2D10 A;  2D2Q A;  1FZF A;  2L2I A;  2DX1 A;  2RVB B;  4NY0 A;  4XA4 A;  5GOW B;  5C5B B;  3M9Q A;  2XNX A;  1U5G A;  2YO2 A;  1LTJ A;  1ZN5 A;  2C0X A;  4KHB B;  3NMD A;  2CAY A;  4WY4 D;  1NHL A;  1NTZ K;  2HFE D;  3CLQ A;  2P1J A;  3A8P A;  1KZU B;  1DRO A;  4PQ0 A;  3CI9 A;  3OJA B;  3PVW A;  4OH8 B;  3TVV A;  3AJ4 A;  3L36 A;  1GW3 A;  3OA7 A;  4C46 A;  3F5R A;  3NSU A;  1IFI A;  3HD7 C;  3B5N D;  4IOY X;  5C16 A;  3RL0 D;  1SQQ K;  1JTH A;  3D8D A;  1U27 A;  4EIJ A;  1AFO A;  2GJY A;  1J19 A;  1EVH A;  1MK9 B;  4K2P A;  1RF0 C;  1FJP A;  4A6F A;  3PG7 A;  1UPR A;  1AQC A;  1U5E A;  1EF1 A;  1WVH A;  3PVL A;  3TK1 A;  1MIZ B;  3RK3 B;  2EC1 A;  3KRW A;  4MT7 A;  2UZS A;  3TO1 A;  3SO6 A;  2G35 A;  5CLL B;  3V2R A;  1N7L A;  2W27 A;  4KAX B;  3HRN A;  3OAN A;  1JY3 O;  2H8P D;  2KB7 P;  5KQ1 A;  3VN0 A;  4HAV B;  1FAO A;  4IAP A;  3RL0 C;  3N4X A;  1M7L A;  1LT9 B;  1SFC A;  5HE3 A;  3SNH A;  3B5N C;  1IRS A;  2J58 A;  1W1D A;  1FGZ A;  1FZC B;  1OWA A;  1T3J A;  3RK2 D;  4AQR D;  1QL1 A;  1IC2 A;  3A8Q A;  2J59 M;  4ZRK A;  1IFJ A;  1NTK K;  4DBB A;  5KCV A;  2Z4E A;  1LT9 C;  4GZU A;  5D3Y A;  3DXD A;  1Z56 A;  4WB4 A;  5CJ4 A;  3V2N A;  4WY4 C;  1MK7 B;  1AQ5 A;  1ZR2 A;  4B86 A;  1HUC A;  2IYB A;  2DHJ A;  1MZ9 A;  1UNQ A;  2H43 A;  2LG1 A;  2XDJ A;  1AWE A;  2Q5U A;  5AW4 B;  2R32 A;  3UIA A;  3VMZ A;  2R0D A;  1JY3 P;  3IVF A;  3C9I A;  1BTN A;  3U7D A;  1UEF A;  1GL2 C;  2EMT A;  4A6K A;  1HBW A;  4D0N B;  5AVS B;  1ISN A;  3NFQ A;  5AW6 B;  1I7A A;  1I2H A;  4NSW A;  3A5T A;  1SQB K;  3M91 A;  5APQ A;  5BU8 B;  2K2U A;  1XR0 B;  5AVZ B;  4JF7 A;  2DYN A;  1T8Z A;  1FJK A;  2JJL A;  5APX A;  1GTW A;  2UZR A;  1Y5O A;  2WT7 A;  4JYB A;  3BVH A;  2M3B A;  4EKU A;  2WZ7 A;  2P0H A;  1KIL D;  1L4A C;  2NPS D;  2MWN B;  1CW5 A;  3RK2 C;  1E5W A;  2ZFC A;  1GD2 E;  5AW9 B;  2AL6 A;  2YS5 A;  5BVZ A;  3E1I A;  1JNM A;  1XOD A;  1W2E A;  3ULC A;  1YTZ I;  2YSZ A;  1NKZ B;  1PFJ A;  1BAK A;  2M8R A;  2NPS C;  1L4A D;  1WT6 A;  3SWF A;  1XKE A;  1URQ B;  1LTG C;  2N1T B;  5LON B;  1JY2 P;  1LWU B;  1K5G B;  1DX7 A;  5D27 A;  2NPS B;  1DH3 A;  5KQ4 A;  3P32 A;  1XX0 A;  2YF0 A;  2X18 A;  5CJ0 A;  4HAZ B;  4H8S A;  1GL2 D;  1XTC C;  5LOP B;  2YO3 A;  1L4A B;  4HYT B;  5EFX A;  4N78 D;  4C7N A;  4DX8 A;  1J0W A;  3VMY A;  5KLV K;  2W2W A;  3MPX A;  3LID A;  5CCH A;  4CHJ A;  1EGX A;  2OYH A;  3TW1 A;  3B5N B;  3HD7 D;  4C0A A;  5D3W A;  1ZVR A;  3EFG A;  1KIL B;  1MAI A;  4N6J A;  2OYI A;  4BBK A;  2FXM A;  1KFN A;  3TNU A;  3O96 A;  3A3Y B;  1ZM0 A;  1V5U A;  2Q13 A;  3P8C E;  1T3U A;  3HUS C;  1J1D B;  1TQZ A;  2BCJ A;  3PSC A;  1KFM A;  1CI6 A;  3A7O A;  1LTB C;  1SQX K;  2FYZ A;  2YKO A;  4DOJ A;  1WG7 A;  1JCC A;  1VDF A;  1YYC A;  2H7H A;  3HE4 B;  1SGH A;  1H89 A;  1UNR A;  5D3V A;  5J3Y A;  1LWU C;  3WYF B;  5APW A;  2WSC H;  4I1L A;  1DDW A;  3M0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...