2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
2VSZA 3BJIA 1U29A 2WSCH 1V5MA 5CLQB 2D9YA 4H8SA 2P0DA 4F7HA 2Q13A 4PQ0A 1FHWA 4HAUB 1V88A 2COFA 2LG1A 2CODA 3PEGA 4GXBA 2I1KA 4KHOA 3ZVRA 2DHKA 2DN6A 1E5WA 2LOXA 2AEHA 5FI1A 2IYBA 2D9VA 1X11A 1KZ7A 1MIXA 1FHOA 3PP2A 1WI1A 2DHIA 1DYNA 4GMXB 5JHHA 5C5BB 2Y8GA 1J0WA 2D11A 3U7DA 1NU1K 1MKEA 2DKPA 3SYXA 1EAZA 1OQNA 3QBVB 2QKLA 2E2XA 4HDQA 1UNQA 2WSFH 2P0FA 3KZ1A 1W1GA 1X1GA 5C16A 2KGXB 1BAKA 1WG7A 2LYDA 1MK9B 4XWXA 2O01H 5C5BA 4F7UP 1FGYA 1K5GB 1ZM0A 2CY4A 3MDBC 1UPRA 2YS5A 1QQGA 3ODWA 1XODA 2YRYA 4WSFA 3HQCA 1DBHA 2HTHB 3DXDA 1OMWA 4KVGB 3A8PA 2KUPA 4B6HA 1LB1A 1WGQA 2HE7A 2DKQA 3CIKA 4TKNA 3F0WA 2L2IA 4K81A 2QKMA 2RUKB 3KSYA 1AQCA 1I7AA 4HAXB 4KHBB 2PZ1A 5JLJB 1X86A 2ZPYA 4GMVA 1PMSA 4IFDK 2RNRB 4A6FB 1RRPB 3D8DA 4WVFB 2D9XA 4NSWA 1DDWA 5HE1A 4A5KA 5DHFB 4Z2NA 4A6HA 5LONB 4CHJA 1U5EA 4PNKA 3PVLA 4HB3B 4ZRIA 4IFSA 1SQXK 2VKIA 2YS1A 5JP4A 3DXCA 5KCVA 2L1CA 3ODXA 4Z2MB 3LJUX 1AWEA 1SQPK 1W1HA 2I5CA 4HATB 1XX0A 4F7GA 5LOPB 1WJMA 5J3YA 1U2BA 4D0NB 1OY2A 3P6AA 2K2JA 3QWMA 4NY0A 1TJ6A 3X23A 2GCJA 3PSCA 1U27A 2D9ZA 2W2XD 2DHJA 1XR0B 3GYOA 3PVWA 2OQBA 2RGNB 4GPTB 4MY6A 2M38A 5D3XA 1DROA 2CY5A 2D10A 1Y5OA 5HE2A 2P8VA 4HB2B 2I1JA 1K5DB 4HAZB 3O96A 2X18A 4DX90 1XCGA 2YF0A 4A6KA 4MK0A 2RLOA 1UEFA 1L0NK 3T06A 3V5WA 1I2HA 3SNHA 3G3ZA 4ZRKA 2Z0PA 3P7ZA 1BWNA 2GS0A 1SQVK 2UZRA 3RCPA 2R0DA 2COCA 1U5GA 2EMTA 2JP2A 1ZC3B 3OANA 3AU4A 3D8EA 1UNRA 2J0JA 1Z87A 5CLLB 4HDOA 3F5RA 1GC6A 3N7CA 1P5TA 1SHCA 5DH9B 4CHMA 1MK7B 1FHXA 3PZDA 1P3RA 2G35A 2H7EA 1H4RA 5DIFB 2K00A 3U8ZA 1LW3A 2XQNM 1EVHA 1NTVA 1Y19B 2Z0QA 2WSEH 2MFQA 4K2PA 1KZGA 4YONA 3TCAA 2COAA 1FB8A 2CRFA 2DA0A 2P0HA 1WVHA 2YS3A 2M14A 5JHGA 4Y94A 5J3QA 1ISNA 1MPHA 2FJLA 1ZC4B 2UZSA 3SV1A 3D8FA 2GJYA 5KLVK 3WYFB 2FYUK 2BCJA 5KQ4A 2DFKA 4GZUA 4CYEA 2W2WA 1BTNA 2NZ8B 3GYPA 3M9QA 1WJ1A 5D3WA 4DX8A 1M7EA 1ZVRA 1TXDA 1MIZB 2MWNB 1V5PA 1V5UA 2R09A 5FI0A 1GC7A 4DXAB 3CLQA 1NU2A 3LW5H 4A6FA 3PVUA 3VIAA 2EMSA 2LOZA 2LULA 2Y7BA 3CXBB 4KAXB 2YVCA 3SUZA 4K2OA 1MAIA 3BINA 3M1IB 1NTYA 5DHAB 1B55A 3DXEA 3TFMA 3A8QA 4TYZA 2ROVA 2DTCA 1J19A 1XKEA 1X1FA 4HB0B 1ZSQA 4HAWB 1H10A 2DX1A 2H7DA 3PG7A 1FOEA 1UNPA 5DI9B 5J3TA 2UVMA 3FM8C 5L81A 1SQBK 3KRWA 2MDXA 3SO6A 1L0LK 2YSZA 4C0AA 1XD4A 5EFXA 5GOWB 3ULBA 4WJ7A 3QIJA 1FAOA 2KCJA 3HW2B 4KHAA 3HK0A 1U5FA 2I5FA 2GCLA 2LKMA 1IRSA 1NI2A 3MPXA 3ODOA 1BTKA 4HB4B 2NMBA 5C6RA 4ZRJA 5C79A 4HHVA 2D2QA 1GG3A 1SGHA 3VOQA 2J59M 2N0YA 2D9WA 1TQZA 2YT0A 1UPQA 1QC6A 1NTKK 4BBKA 3G9WA 2RSGA 4HAYB 1NTMK 2EC1A 2DYNA 2ELBA 2RVBB 4GN1A 4P7IA 2LKOA 2YT1A 1W1DA 3AU5A 5HE3A 3WA0A 4EMOA 1M7RA 1NTZK 2J0KA 2K2UA 4EJNA 1V89A 5KQ1A 2J0MA 1SQQK 1P6SA 3ULCA 4HAVB 5D3YA 5HE0A 2Y8FA 3UZTA 1V61A 5D27A 2ROZB 1RJ2A 1N3HA 2DX5A 4K17A 3IVFA 4YL8A 2DYQA 3A98B 3ZDTA 4DBBA 1DDMA 2VRWB 1EGXA 1U5DA 3TO1A 1DDVA 3TW1A 2Z0OA 2OARA 4MT7A 3FSSA 1X05A 3ML4A 4EKUA 2DLWA 4IOYX 2MKRA 2EJ8A 1PFJA 2AL6A 2ELAA 4L6EA 2CAYA 4IAPA 2V76A 1FGZA 1Q67A 3KY9A 1PLSA 2N23A 3NSUA 2ADZA 3TVVA 3KRXA 2OTXA 1WGUA 2IFSA 1EF1A 5D3VA 2D4QA 2W2XC 1KI1B 3FEHA 3AJ4A
chains in the Genus database with same CATH superfamily
1JCCA 4PJ0E 3BJIA 1NHLA 1U29A 3P7KA 5KAFH 3M9BA 1M90Q 5AW4B 3BVHA 2ZXXA 2OGUA 1KTMA 2Q13A 3KQGA 2WVRA 1FDOA 2C0XA 2LG1A 3U12A 5KLVE 3GF3A 1LP1A 3RGUA 1T2KD 4M3LA 1FZGA 3PEGA 2I1KA 4KHOA 4L1RA 3ZVRA 4W7ZA 1RY3A 1U7MA 2E5YA 1S5LH 2AEHA 5FI1A 1PP9G 2D9VA 1ZR4A 1X11A 1KZ7A 1RQVA 4NPEA 1FHOA 3CCRP 3PP2A 3L70J 5APVA 2IZ1A 1NU1K 1SQXJ 1MKEA 1NTKG 2R5DA 1SQVD 3TDKA 1KILC 4OSNA 1OQNA 2N1TB 2K8EA 4LGDE 2QKLA 1BE3D 3O6QB 3WU2H 2E75D 2LXCB 1UNQA 1GZLA 4GT1A 3L36A 1N7SC 1MKMA 4R4LA 3VP9A 1WG7A 1MK9B 4XWXA 2P67A 3AE1C 1KYOE 4F7UP 1JO5A 4L74A 1ZM0A 2R2YA 3MIWA 1QX8A 4PV1B 1QQGA 1XODA 2YRYA 2N1TA 1VQKP 3RBXA 5B66H 4H13B 1OMWA 4BRYB 4H0LC 1LT9B 1VQLP 4B6HA 1GW4A 4XA4A 2HE7A 3CIKA 2GM4A 4EDFA 1YJ9P 1LT1A 3V2NA 4HAXB 1VQ9P 1S5LX 3AE3C 2PZ1A 2KLVA 2YXRB 2ZYGA 1UIXA 3GHGC 4U3FG 1VQ8P 2RNRB 3GG2A 3B4SA 5HE1A 2IBZG 2FFDC 4N78D 1U5EA 5AW2B 1KN7A 3PVLA 3L75G 4HB3B 2KK7A 2R32A 2ZXEB 3ITKA 2KZIA 5JP4A 2N9YB 3VMAA 2L1CA 2QJYC 3V2RA 2I5CA 4DIXA 4N6JA 1XX0A 4I6MC 1WJMA 3TNUA 4IFFA 2QM7A 2POHA 2E74D 4PD4D 4D0NB 3QWMA 1FZFA 3PSCA 1U27A 1AQTA 1OVUA 2WSFJ 1K05A 2DHJA 1VQ4P 1KILB 3GYOA 5DJTB 1LTGC 4D6TG 1SQBD 4BXLA 1M8OB 3H1IE 1N7SB 1AJYA 2O01J 2M38A 5D3XA 4QJ4B 3H1HG 2D10A 1KQSO 2P8VA 2FYUJ 3L74J 3HD7D 4U3FE 3FX0A 3MUDC 5AVTB 1J1EC 2WPQA 2ZYAA 2YF0A 3L73E 2C9LY 4LLHA 1KILA 4MK0A 1UEFA 1L0NK 2Q6QA 2KP8A 3SNHA 5B66E 1CI6A 1N7SA 5GTIE 1BCCD 4UB6E 4N3YB 3EFFK 2HLOA 1HBWA 3OANA 3HRNA 4CPGA 3U1CA 2QEXP 1NTMD 5CLLB 2XNXA 1GC6A 3L72G 2WMMA 2L91A 1P5TA 3JSVC 1SHCA 3A5TA 2C9NY 2AEJA 2K3RA 2BCCD 2FFDB 2KUQA 2HPCA 2K00A 1LW3A 2XQNM 1EVHA 1NTVA 1Y19B 2WSEH 1PGJA 1AVYA 1IFNA 1PZQA 5GTHE 2QJYB 2COAA 3HUSC 3I55P 4IOIH 5APYA 1BSHA 1FB8A 1GL2A 2CRFA 2DA0A 2NBVA 1ZYIA 3GHGA 2KS1B 1U57A 1WVHA 3M91A 4QXAB 3PP5A 4Y94A 5J3QA 1R5SA 2LXBA 1MPHA 2P58A 3H1KJ 1VQPP 2UZSA 1NO4A 3CXHH 2FFDA 1SQVE 5KLVK 4GIFA 1OFCX 3WYFB 3D6ZA 4YTPC 1BE3E 3MD0A 3L70G 4HH2A 5CMZA 2NZ8B 4PD4I 3M9QA 2YKOA 4HKZH 3Q5PA 2Q1KA 1SQXG 3AEBC 1TXDA 2H88C 4IL6E 4OGQC 4KHBA 2XDJA 1H88A 3E7KA 3RK3C 1VF5C 1GC7A 1KC8Q 2QA4P 4DXAB 1NU2A 3CXBB 2YVCA 1RE4A 1K9MQ 4K2OA 1SQQJ 1B55A 2W83C 1SFCC 1H0TB 2PFXA 2B9BA 1J19A 1CSBA 1QL2A 2DX1A 2ZT9D 3AE9C 5APQA 2E75B 3MUDA 3C9IA 1PL5A 2R5BA 1T77A 3OJAB 2YXQB 3WUTA 3H25A 2IZ0A 2K9YA 2GUMA 2HFED 4H44C 4WJ7A 3QIJA 2XKMA 1NU1G 5CCHD 1H0TA 4N78E 4OWFA 3IN6A 1T6AA 4ZRJA 2I8DA 2WPRA 1GG3A 3RK3E 1J1DB 1W2BO 2N0YA 5AW0B 2YT0A 1UPQA 3HUSB 1NTKK 2YKQA 1LTJC 3KZIE 3G9WA 1EC5A 4L75A 3H6PA 4PD4E 4HAYB 3I56P 2DYNA 1AA0A 4KJMA 2ELBA 4GN1A 3M0DC 1WRGA 2NRGA 3RL0g 1KQFB 4Z1MH 2O3JA 1PPJG 4EMOA 2K2UA 1SQBE 3H1LD 1V89A 3G71P 2WITA 1NAFA 5KTBA 4HJGH 3SSUA 5CCGC 4OGQB 2Q3IA 5D27A 3RK3B 1IO4A 2KIEA 2BEQD 2NPSA 1DD3A 4RJTA 2SPZA 2M8RA 4YL8A 2Z59A 1DDMA 1KD1Q 5KAIH 4NPDA 3E1RA 2Z14A 2VRWB 2FYUG 1SFCB 3H1JD 3LIEA 3HE5A 2JWAA 3L74G 1BCCE 3TW1A 2OARA 3A0HH 4MT7A 2QJPC 4JYCA 4C7RA 2DLWA 2KLUA 1VQ5P 1FJKA 1NTME 3GF7A 3FXDA 2A45H 2JR8A 5APXA 2ELAA 3HD7B 5KKZC 1ZN5A 1KORA 1PLSA 1Q90D 3G4SP 1SFCA 3KRXA 2BCCE 1SQPD 1VDFA 2W2XC 2H43A 2A06G 3FEHA 2ZVNB 1CZQA 2VSZA 4WY4A 2FJUB 1USDA 2XZRA 5AW6B 2D9YA 2KIGA 1FHWA 1VQNP 1LGHB 1LTJB 2COFA 3DCXA 3WMM0 1SLQA 3TGUG 3H1IJ 3V2QA 4GXBA 4AUWA 2DHKA 2DN6A 1EDLA 2LOXA 3AE4C 1BDCA 2JO1A 4GOEA 3SWKA 3H1KG 1K73Q 2CPBA 3L73J 1MIXA 1VQMP 3CMAP 4GMXB 1HVVA 1YQ4C 1YITP 1J0WA 2D11A 3U7DA 3BCCJ 1EAZA 3M0DA 1EXJA 1GTWA 1X8YA 5APTA 1AV1A 3KZ1A 1X1GA 1E79H 1FAVA 2KGXB 5CCGA 2G3AA 3A58A 5KLIC 3A7OA 3MTUE 3CC2P 1SQQG 1PGPA 2QSIA 2WZ7A 2CY4A 3EFGA 1WT6A 5E79E 2FXOA 2YS5A 3V2PA 4C7NB 1CW5A 3ODWA 4GOFA 1HWTC 1A02J 3DXDA 5KKZB 1JM0A 2HR3A 2KSJA 1YI2P 1RH5B 2E76C 2XU6A 4KVGB 2Q3EA 2WSCJ 4TKNA 4K81A 4GODA 3KSYA 1AQCA 3B8EB 2IYOA 1SQVJ 2ZT9B 4GMVA 5AVYB 4IFDK 4WVFB 2D9XA 1BE3J 2RN0A 4DOJA 1Q86Q 5DHFB 2R3SA 4YXWH 4A6HA 3CC4P 5CJ4A 3BCCD 4PNKA 1LT9C 1GL2D 1SQXK 2YS1A 2QE7H 3DXCA 1LTIC 3H1LE 5H2FE 4Z2MB 3CCEP 1W1HA 1G1JA 1GMJA 1K04A 4HATB 2P10A 2M0BA 5LOPB 5J3YA 2M5AA 1EXIA 1BDDA 1JMMA 3V4WA 1GU5A 1NGMB 4NY0A 4BWNA 2D9ZA 3CWBD 1R8EA 1MZ9A 2Z5HA 5KJ7C 2OYIC 3H1JE 3CX5D 2D2CD 1L0LD 2CY5A 3UIAA 5TJHA 4GDOA 5HE2A 5KLIB 1OW8A 1JY2N 2KNCB 1UIIA 3P8CD 4Y99B 2ZKMX 2Y0CA 2M3BA 3O96A 4DX90 1Y8AA 3GMAA 3CCMP 4AQRD 4RO0A 2RLOA 1OW6A 4I7ZC 1QVFO 3MZWB 4XFJA 1JY3N 3P7ZA 3FGAD 1S9KD 1BWNA 2E76B 1KB9H 4R4MA 2UZRA 3S9OA 1SQPE 3RCPA 2COCA 5LG4B 1ZC3B 2JP3A 3AU4A 2KI7B 3VMXA 1N7LA 1Z87A 4HDOA 2Z13A 3QH9A 4CHMA 3ZDMA 1SQBJ 2L5GB 4ASVA 3O6QA 2B89A 2MKVA 2YKPA 3D71A 1YTZI 4K2PA 1JTHB 1U7JA 2ZJSE 4WWIA 4UB8E 3EWKA 2V4HA 3TCAA 3H1IG 1L4AD 1VQ6P 2YO3A 5KAFE 3RK2C 2YS3A 2M14A 5JHGA 2FJLA 3SV1A 3HE4B 1BCCJ 1TU3F 3AEDC 4BRYA 4DJGA 2FYUK 2QIWA 2QRXA 2BCJA 4CSQA 4GOUA 1LT9A 1GK4A 3L73G 1JTHA 1LTTC 2OYIB 1FZBA 3GYPA 1WJ1A 4C46A 3CX5H 4DX8A 1NTMJ 1X22A 1S5LE 1YQ3C 2NPSD 1Y47A 3RL0D 1V5UA 2R09A 5FI0A 1N73B 1QLED 1XTGB 3LW5H 1NTZJ 2EMSA 3L71D 5AVSB 2BCCJ 3CX5I 3SUZA 1NTYA 3CXHD 5KJ7A 3DXEA 2OYIA 1IK9A 2QJKC 4I7ZB 3TFMA 3A8QA 3KYQA 4EI2A 5BVZA 1T2KC 3WU2E 1X1FA 4HB0B 3KPEA 3ABVC 3PG7A 4JYBA 3B5ND 1OXZA 5J3TA 2UVMA 3FM8C 5L81A 1JY3P 1RF1C 2MDXA 3IR9A 2B88A 4JPZB 2YSZA 1A02F 5AW8B 4C0AA 5CHXA 5EFXA 1FOSE 1EDJA 1X9VA 1HJBA 2W8ZA 2KCJA 1Q82Q 4KHAA 1SS1A 1U5FA 2GCLA 1KMIZ 2VRSA 1ZP0C 3MPXA 3BCCE 2O01N 4WY4D 1SQVG 4JF7A 1ZLLA 2E75C 1BE3G 3CCUP 2IFNA 2MJZA 2RSGA 3RK2B 2Z4EA 2RVBB 2LKOA 3CWBE 1GDTA 1NTZD 1URQD 2J0KA 4EJNA 5KQ1A 3CX5E 1JEKA 3VOPA 1SQQK 2Q7CA 1J1DC 4HAVB 5D3YA 1RE3C 1V61A 1S4XA 3P8CE 5BU8B 4D6WA 1J2JB 4K17A 4RKUJ 2IX7C 3M06A 2FY8A 3IVFA 3ZDTA 3A98B 1OX3A 1M1JB 1G2CB 4MN4C 1EGXA 2QJKB 1S9KE 1OVRA 2Z0OA 5AVRB 3FSSA 2YO2A 5M1BA 1NVOA 3CXHI 3TYYA 4EKUA 1ZR2A 2KS1A 2KZJA 1RF1B 2MKRA 3II6A 2EJ8A 1DX7A 5AW3B 3Q5RA 2R44A 2GA1A 1Q67A 2N23A 1G2CA 3H1LJ 2ADZA 2E74C 2OTXA 4A7PA 1EF1A 5D3VA 1IC2A 5TISH 1IFMA 1KI1B 3AJ4A 1JCDA 2AEMA 1RF1A 1H8AA 3P32A 5CLQB 1SQBG 4H8SA 4F7HA 3PHLA 3R4YA 4PQ0A 4HAUB 2XNDH 3HD7C 2OYHC 3H1JJ 3VYIA 3V5BA 1OIPA 2IYBA 1ZV8A 1JNMA 1BCCG 3JC22 1H89A 1WI1A 3NW8A 4U7JA 5JHHA 1L0ND 5C5BB 4EOTA 2PP6A 2W90A 3L71E 3M9HA 2WT7B 3OAKA 2R3CA 1SQPJ 1NTMG 3QBVB 1JY3O 3CXHE 2E2XA 4HDQA 2KOGA 2WSFH 3CL3D 1W1GA 3USSA 5C16A 2IFMA 2LYDA 1IFPA 3V6IA 2Q5UA 2BCCG 2O01H 4ZKUA 5C5BA 1Y9BA 3PJSK 3Q1MA 3HUSA 2GUSA 2WT7A 3Q2YA 3RL0B 4WSFA 3HQCA 3T97B 2ZVOB 4ASWA 1DBHA 5B5EH 3CPWO 4B86A 1HGVA 2B87B 3FVCA 3Q3DA 2E74B 4K3AA 2KUPA 1EZVD 1Q81Q 3SWFA 4YPCA 1MFTA 1SVFA 1LB1A 5TISE 1IFDA 3IFMA 2L2IA 2QKMA 4XE5B 2RUKB 3A0BH 1MI1A 1G1IA 2N1TD 2KR0A 3T97A 2ZPYA 2OTKE 3B5NB 4A6FB 5AVXB 3D8DA 2Y9ZA 2DW3A 4A5KA 4Z2NA 3HTKB 1K8AQ 1OWAA 3E1IA 2OYHB 5LONB 3JCUH 2HG5D 4CHJA 2K37A 1NTZE 3I5CA 1FZCB 2A45I 4DCKA 4PV1D 3S4RA 3ODXA 3LJUX 1AWEA 2Q9IA 2M3EA 4H13D 2ZT9C 3HTKA 4TLFA 3W68A 3HD7A 2OYHA 1OY2A 2K2JA 2H8PD 3HIEA 5EFWB 4KHXA 2RH0A 1XR0B 2K9JB 1BGYJ 2Y0DA 4HSIA 2OQBA 2LR2A 1ZXGA 1JMBA 2RGNB 5CCHC 4GPTB 4MY6A 1FU1A 1PGOA 5APWA 4EYYQ 1W2EA 1AQ5A 1K5DB 1LTJA 4HAZB 1VPCA 2X18A 1XCGA 5AVUB 1YJNP 5CJ0A 2K9JA 3Q5SA 1KZUB 3KDPB 3T06A 3V5WA 1PP9D 2P1JA 1I2HA 3NMDA 3AECC 3G3ZA 4ZRKA 2Z0PA 1SQVK 3KXDA 5KAIE 2R0DA 4IFMA 1NTKD 5DJUB 3D8EA 3A0HE 2Y0EA 2J0JA 1KILD 1P84D 5AW1B 3H1LG 3F5RA 1EZVI 3CWBJ 1IFIA 4Y99C 5K5GB 2HYNA 5DH9B 3VN0A 1N7SD 2ITAA 1HJ0A 2IYPA 3PZDA 1P3RA 1EQ7A 2FXMA 2G35A 2H7EA 1Q7YQ 1H4RA 5DIFB 3U8ZA 1L0LJ 4OH8B 3PTZA 2Z0QA 1KB9D 2MFQA 4D6TJ 1BGYD 1USEA 3LW5J 1KZGA 4O9BA 4YONA 3OW2O 3H1JG 4C7NA 3VMYA 3AE8C 4K35A 4H0LD 3WUUA 1ISNA 1ZC4B 5BU5A 3D8FA 4ZMDA 2P7JA 5KQ4A 4W80A 4GZUA 3M0AA 4CYEA 1BTNA 5IRSA 1NYHA 5D3WA 1KYOH 1DIPA 5C39A 1PV3A 2IBZD 1V5PA 1SQPG 3CLQA 3CCVP 2LOZA 3L75D 4KAXB 1NKZB 1JOCA 1S3JA 2N9BA 3BINA 1LTSC 3M1IB 2RKLA 2W6JH 5CBOA 3FXEA 5CCHA 1EZVE 1M1KQ 4I2LC 4HAWB 1H10A 2H7DA 1FOEA 1UNPA 5DI9B 3NTNA 1SQBK 3C8VA 3GW6A 1P84H 1N73C 2FYNB 4QJ3B 3NWAA 4D6TD 1N2DC 3AEAC 1XD4A 3BASA 1RQUA 2PRRA 3ULBA 1NWQA 3HW2B 3H1HD 3HK0A 2LKMA 2WSEJ 1NI2A 1P84I 4WB4A 3ODOA 1ZRTD 2H7HA 4HB4B 1T8ZA 4HHVA 1SP4A 2K1AA 3BATA 3L71J 1R5LA 5AW5B 2KNCA 2D9WA 1TQZA 1QC6A 1NJIQ 4BBKA 3L4FA 1KB9I 1NTMK 2EC1A 3TF5A 3D70A 2BASA 1YBKA 1W1DA 1Z56A 3AU5A 3CD6P 1HUCA 1DEBA 3QWOC 5HE3A 1LTAC 2E42A 1NTZK 1QL1A 1QGKB 1YJWP 2KXPB 3L72D 2J0MA 3PRJA 1ZW0A 1P6SA 2PGDA 2WQYC 3ULCA 3UZTA 1GW3A 2W6AA 1BGYG 2ROZB 2FBWC 3EQ2A 2H89C 1N3HA 2DX5A 3S1KA 1FDMA 4RESB 1S2EA 4JQ0D 5GTIH 4UB6H 1PP9E 2IBZI 2DYQA 2FXPA 1NU1J 5CBNA 1DH3A 2V7QH 1FJPA 1FOSF 2AXTH 1X05A 1NTKE 1DD4A 3BCCG 4IOYX 1GL2C 1KILE 1P84E 3TNUB 4L6EA 3P8MC 3HE4A 3L70D 4QJ5B 1MV8A 2JKVA 3SWYA 3NSUA 1SQXD 1JY2P 3TVVA 4GNKB 1WGUA 2GUVA 4OGQD 1M1JC 2D4QA 3RK3D 1VF5D 5GTHH 1KB9E 3R2PA 3CWBG 3U1AA 2IPPA 2OTJP 4EIJA 3AE2C 1BGYE 2WSCH 1V5MA 1N73A 2Z5IA 3CCJP 3F89A 2P0DA 3BRTB 2D2CC 1SFCD 1V88A 3O8ZA 1KFMA 1LWUC 1L0LG 1RE4C 1GU4A 2CODA 3AE7C 2W27A 1RF0C 1E5WA 1CI6B 1LNQA 2XV5A 1WMKA 3OHMB 4IL6H 1PFIA 5M4YB 3A3YB 4H44D 2DHIA 1NU1D 1DYNA 2IBZE 2YT2A 1RHZB 2O1KA 2Y8GA 2RRFA 2DKPA 3SYXA 3L75E 2W6BA 2HODB 3PLNA 4NPFX 4H0LB 2QM8A 2P0FA 1FDIA 2WTYA 2HPCB 2G8YA 2JJLA 1BAKA 1PGQA 2AXTE 1FGYA 4ZNCA 1S1CX 1K5GB 1L0LE 3G9RA 3MDBC 1GL2B 1UPRA 3GHGB 2HODA 1PPJD 4D6TE 1IJDB 2FYZA 2HTHB 2WPSA 1L4AC 3H1HE 3L37A 3A8PA 5CCGD 3TGUJ 1ZRTE 1HF9A 1WGQA 2DKQA 1L0NJ 3F0WA 1X0TA 4JBZA 1I7AA 3KZIH 4KHBB 5JLJB 4IL6X 1NOHA 1X86A 4PD4H 1PMSA 3AEEC 2E5TA 2Z4DA 2NPSC 2FYUD 2KSEA 1RRPB 3L74D 3RL0C 4AYCA 2D2CB 1DDWA 4NSWA 1GK6A 1T3JA 1LWUB 1M56D 1QVGO 3CCLP 1OZHA 1M1JA 3N4XA 3V4QA 3TSIA 3L71G 1QEXA 3U59A 4ZRIA 1IZNB 5AVWB 4IFSA 2VKIA 2C0WA 2ZAEB 5KCVA 3MGNA 3TK1A 3L72E 3H32B 1SQPK 1JUNA 1OVVA 2YMYA 4F7GA 1J1EB 1PIXA 1IK7A 1HGZA 1VQ7P 1LWUA 3B5NC 3VMZA 4DT0A 1U2BA 1YYCA 3P6AA 5I2MA 1TJ6A 3X23A 1L2PA 2GCJA 2K88A 1LTBC 2A06D 5AVVB 2W2XD 1VL2A 2IDBA 3D6YA 1IFJA 1RF0A 3CCQP 3PVWA 5L8RJ 3H32A 1FZCC 1VQOP 4DZOA 1DROA 1N86A 5KLVJ 1Y5OA 4OT1A 4WY4C 4HB2B 3TGUD 2UWJE 1JY2O 2CK3H 2I1JA 1NKNA 4A6KA 4I1LA 1JB0J 1FZEA 1MUUA 3L70E 4ZKPA 2FKWB 2JWDA 1L4AB 3H1KD 1SQXE 3C1LA 2GS0A 2P2UA 2KYVA 3CMEP 1U5GA 2EMTA 2JP2A 1YIJP 1URQC 1KV4A 1NTZG 3IF4A 1UNRA 3K5BA 1RE3A 1AVOA 3MP7B 3AEGC 2J58A 3A2AA 3MHVA 2AEFA 3N7CA 2NPSB 1L4AA 1HTLC 1MK7B 1FHXA 2ZFCA 2YIUC 3PH0A 1SQQD 4TT3H 3HE5B 1XTCC 4HYTB 1KQLA 1VF5B 1NU1E 2P0HA 1PP9J 3KHUA 3NXSA 2E76D 5KLVD 1FS0E 3AEFC 2OTLP 3SFDC 2B87A 4W7YA 1EDIA 2GJYA 3BRVB 2DFKA 1NTKJ 2W2WA 4WVZA 2OYOA 1LJ2A 1M7EA 1ZOYC 1ZVRA 1GD2E 1MIZB 2MWNB 3FWLA 5E79H 1OW7A 4WY4B 3B5NA 1BSNA 4A6FA 3PVUA 3VIAA 2CPSA 3VTPC 2LULA 2Y7BA 2Y9YA 3HSAA 2QVAA 1PPJE 4H44B 1MAIA 4KT0J 5DHAB 2J5UA 1FZCA 2A45G 4WBAA 4TYZA 2ROVA 2DTCA 5I2SA 4LC1A 1XKEA 1ZSQA 2YMKA 2JDIH 1AFOA 1KYOD 1FBMA 1D7MA 1URQB 3AE5C 1KFNA 1FC2C 3KRWA 3SO6A 3CCSP 1L0LK 5KJ7D 1S72P 5AW9B 2FYUE 3B71A 3L74E 5GOWB 2O1JA 1FAOA 2ZYDA 4Y28J 2I5FA 2JEEA 1L0NG 5B5EE 1W5CE 1IRSA 4U3FJ 1EDKA 5H2FH 1BTKA 2YIUB 2NMBA 5C6RA 1M7LA 5APSA 1DEEG 5C79A 1URQA 4L73A 4PJ0H 2D2QA 3NFQA 1NAYA 1SGHA 3VOQA 3L75J 3WUVA 2J59M 1NH4A 1MFZA 3A0BE 5AW7B 3NWFA 2FYNC 2OQQA 3L35A 5AVZB 3LIDA 4P7IA 4GKGA 2A06E 1OMIA 2YT1A 1YHQP 2K49A 2V7QJ 2YNYA 3JCUE 3WA0A 1M7RA 2QG4A 3IAOA 2WWWA 2QJPB 1FZAA 1YTZT 1N8RQ 2BEZF 5HE0A 3G6EP 2Y8FA 1EZVG 3TGUE 3H1HJ 3RBZA 1RJ2A 1L0NE 4OVNF 3F5HA 2N1TC 4QMAA 3CI9A 1X79B 5AVQB 3SFEC 3CC7P 4DBBA 1Q2NA 5KLVG 3H1KE 1KQGB 2E43A 1U5DA 3TO1A 2WPVB 3H1ID 1DDVA 3W67A 3AE6C 3RK2D 2PAJA 1M57D 3ML4A 4U3FD 2KB7P 3NWDA 3B77A 3VP8A 5APUA 4PV1C 2RMZA 1PFJA 2AL6A 2M5AB 3L73D 3FWNA 2CAYA 4IAPA 1FE6A 2V76A 1FGZA 3GLMA 4HB1A 1T3UA 3OA7A 4H13C 1ZMEC 1KYOI 3KY9A 2KUBA 2NZ2A 2AXCA 1HH0A 1LP1B 4L76A 3L72J 4YXDC 3N7NA 2IFSA 2WSSH 1SQQE 4UB8H 2KIKA
chains in the Genus database with same CATH topology
1JCCA 4EIJA 1RF1A 2VSZA 3BJIA 1NHLA 1U29A 3P7KA 4WY4A 2WSCH 1H8AA 3M9BA 3P32A 1V5MA 5CLQB 1N73A 5AW4B 3BVHA 2XZRA 5AW6B 2Z5IA 2D9YA 2P0DA 4H8SA 4F7HA 2Q13A 3BRTB 4PQ0A 1FHWA 4HAUB 1SFCD 1V88A 1LGHB 1LTJB 3KQGA 3O8ZA 2COFA 1KFMA 1LWUC 1RE4C 2C0XA 1GU4A 2LG1A 3HD7C 2OYHC 3WMM0 3VYIA 1T2KD 1SLQA 4M3LA 1FZGA 2CODA 3V2QA 3PEGA 2W27A 4GXBA 2I1KA 4KHOA 4AUWA 3ZVRA 4W7ZA 3V5BA 2DHKA 1RF0C 1E5WA 1CI6B 1RY3A 2DN6A 2XV5A 2LOXA 2AEHA 5FI1A 2IYBA 1PFIA 2D9VA 1ZR4A 1X11A 1ZV8A 1KZ7A 2CPBA 1MIXA 1FHOA 1JNMA 3PP2A 3A3YB 1H89A 1WI1A 2DHIA 1DYNA 4GMXB 1HVVA 5JHHA 5APVA 5C5BB 2O1KA 2Y8GA 4EOTA 1J0WA 2PP6A 2D11A 3U7DA 1NU1K 1MKEA 2R5DA 2DKPA 3SYXA 3M9HA 2W6BA 2WT7B 1EAZA 3M0DA 3OAKA 2HODB 2R3CA 1KILC 1OQNA 2N1TB 3QBVB 1JY3O 4LGDE 2QKLA 1GTWA 2E2XA 4HDQA 2QM8A 2KOGA 1X8YA 2WSFH 1GZLA 5APTA 3CL3D 4GT1A 1UNQA 2P0FA 3KZ1A 2WTYA 3L36A 1N7SC 2HPCB 1W1GA 3VP9A 1X1GA 2JJLA 5C16A 1FAVA 2KGXB 1BAKA 2IFMA 1WG7A 2LYDA 1MK9B 5CCGA 2Q5UA 4XWXA 2O01H 2P67A 3A7OA 3MTUE 4ZKUA 5C5BA 4F7UP 1FGYA 2WZ7A 1JO5A 1K5GB 3HUSA 1ZM0A 2GUSA 2CY4A 3EFGA 3MDBC 1WT6A 3MIWA 2WT7A 1GL2B 1UPRA 3GHGB 2YS5A 3V2PA 4C7NB 2HODA 1CW5A 3RL0B 1QQGA 1XODA 3ODWA 1HWTC 2YRYA 4WSFA 2N1TA 3HQCA 1DBHA 1IJDB 2FYZA 2HTHB 4B86A 1HGVA 1A02J 3DXDA 2WPSA 1L4AC 2KSJA 1OMWA 3L37A 2XU6A 4KVGB 3A8PA 2KUPA 1LT9B 5CCGD 4B6HA 1GW4A 3SWFA 4XA4A 1SVFA 1LB1A 1WGQA 2DKQA 2HE7A 1IFDA 3CIKA 4TKNA 3F0WA 3IFMA 2GM4A 2L2IA 4K81A 2QKMA 4XE5B 2RUKB 3V2NA 3KSYA 1AQCA 1I7AA 4HAXB 3B8EB 4KHBB 2N1TD 1G1IA 2PZ1A 5JLJB 2KLVA 1NOHA 3T97A 1X86A 3B5NB 2ZPYA 4GMVA 1PMSA 2NPSC 5AVYB 3GHGC 4IFDK 2RNRB 4A6FB 5AVXB 1RRPB 3RL0C 3D8DA 4AYCA 2D9XA 4WVFB 4NSWA 1DDWA 1GK6A 5HE1A 4DOJA 1T3JA 1LWUB 4A5KA 5DHFB 3HTKB 4Z2NA 1OWAA 3E1IA 2OYHB 4A6HA 2FFDC 5LONB 4N78D 1M1JA 2HG5D 4CHJA 3N4XA 5AW2B 3V4QA 5CJ4A 1U5EA 3TSIA 3PVLA 4PNKA 3I5CA 3U59A 3AJ4A 4HB3B 1LT9C 2R32A 1FZCB 4ZRIA 5AVWB 4IFSA 2ZXEB 1GL2D 1SQXK 2A45I 2VKIA 2YS1A 5JP4A 3DXCA 1LTIC 2C0WA 5KCVA 2L1CA 3ODXA 3MGNA 3TK1A 3V2RA 3H32B 3LJUX 4Z2MB 1AWEA 1SQPK 2Q9IA 1JUNA 1W1HA 2I5CA 4N6JA 1G1JA 4HATB 1XX0A 2YMYA 4I6MC 4F7GA 5LOPB 1J1EB 1WJMA 5J3YA 1HGZA 3TNUA 4IFFA 1LWUA 3B5NC 1JMMA 2QM7A 3V4WA 2POHA 3HTKA 3VMZA 1U2BA 3HD7A 4D0NB 2OYHA 1YYCA 1OY2A 1GU5A 2K2JA 3P6AA 3QWMA 4NY0A 1TJ6A 2H8PD 3X23A 1FZFA 2GCJA 3PSCA 1U27A 1LTBC 5AVVB 2D9ZA 2W2XD 4KHXA 2DHJA 1XR0B 1KILB 1MZ9A 1IFJA 1RF0A 3GYOA 1LTGC 2Z5HA 5KJ7C 2OYIC 2OQBA 3PVWA 3H32A 1FZCC 2RGNB 1N7SB 5CCHC 4DZOA 4GPTB 4MY6A 2M38A 1FU1A 5D3XA 5APWA 1DROA 1N86A 2CY5A 2D10A 3UIAA 1Y5OA 5HE2A 4WY4C 2P8VA 3HD7D 4HB2B 1W2EA 1JY2N 5AVTB 1JY2O 1J1EC 2I1JA 3P8CD 1AQ5A 4Y99B 1NKNA 1K5DB 1LTJA 4HAZB 1VPCA 2M3BA 2WPQA 3O96A 2X18A 4DX90 1XCGA 5AVUB 2YF0A 4A6KA 4I1LA 5CJ0A 4AQRD 2C9LY 4LLHA 1KILA 4MK0A 2RLOA 1KZUB 1FZEA 1MUUA 3KDPB 1UEFA 4ZKPA 1L0NK 2FKWB 3T06A 3V5WA 2P1JA 1I2HA 2KP8A 3NMDA 3SNHA 1L4AB 3G3ZA 1CI6A 1JY3N 2Z0PA 3P7ZA 1N7SA 1S9KD 1BWNA 2GS0A 1SQVK 4ZRKA 4N3YB 2UZRA 3RCPA 2P2UA 2R0DA 2KYVA 2COCA 4IFMA 1U5GA 2EMTA 2HLOA 2JP2A 1HBWA 1ZC3B 3OANA 3HRNA 3AU4A 1URQC 3D8EA 3U1CA 3VMXA 1UNRA 1N7LA 2J0JA 1RE3A 1KILD 1Z87A 5AW1B 4HDOA 2J58A 3F5RA 2XNXA 5CLLB 4Y99C 1IFIA 3A2AA 1GC6A 3N7CA 2HYNA 2NPSB 1P5TA 1SHCA 5DH9B 4CHMA 1L4AA 1HTLC 3VN0A 1MK7B 1N7SD 3A5TA 1FHXA 2C9NY 2ZFCA 2L5GB 3PZDA 1P3RA 1EQ7A 2FXMA 2G35A 2H7EA 2FFDB 2HPCA 1H4RA 2K00A 5DIFB 1LW3A 2XQNM 3U8ZA 1EVHA 1NTVA 2YKPA 4OH8B 3HE5B 1Y19B 2Z0QA 2WSEH 2MFQA 1YTZI 1IFNA 4K2PA 1JTHB 1XTCC 1KZGA 4O9BA 4HYTB 1KQLA 4YONA 3TCAA 2COAA 3HUSC 1FB8A 5APYA 2CRFA 1GL2A 2DA0A 1L4AD 3GHGA 2YO3A 4C7NA 1WVHA 3RK2C 3M91A 3VMYA 2P0HA 3PP5A 2M14A 2YS3A 3NXSA 5JHGA 4Y94A 5J3QA 1ISNA 1MPHA 2FJLA 1ZC4B 2UZSA 3SV1A 1NO4A 4W7YA 3HE4B 2FFDA 5BU5A 3D8FA 2GJYA 5KLVK 4GIFA 3WYFB 2FYUK 2P7JA 3BRVB 2BCJA 5KQ4A 1LT9A 1GK4A 2DFKA 4W80A 4GZUA 3M0AA 3MD0A 4CYEA 2W2WA 1BTNA 1JTHA 1LTTC 2OYIB 4HH2A 1FZBA 5CMZA 2NZ8B 3GYPA 3M9QA 1WJ1A 2YKOA 4C46A 5D3WA 4DX8A 1M7EA 2NPSD 1ZVRA 1TXDA 3RL0D 1GD2E 1MIZB 2MWNB 1V5PA 2XDJA 1H88A 1V5UA 4WY4B 3RK3C 3B5NA 2R09A 1GC7A 5FI0A 4DXAB 3CLQA 1NU2A 1N73B 3LW5H 1XTGB 4A6FA 3PVUA 3VIAA 2CPSA 3VTPC 2EMSA 2LOZA 2LULA 2Y7BA 3CXBB 4KAXB 1NKZB 2YVCA 5AVSB 1RE4A 3SUZA 1JOCA 2N9BA 4K2OA 1MAIA 3BINA 1LTSC 3M1IB 1NTYA 5DHAB 5KJ7A 1B55A 2OYIA 3DXEA 1IK9A 1SFCC 3TFMA 3A8QA 1FZCA 2A45G 3KYQA 4WBAA 4TYZA 2ROVA 5CCHA 2DTCA 5BVZA 1T2KC 1J19A 4LC1A 1X1FA 1XKEA 1CSBA 4HB0B 1ZSQA 1QL2A 3KPEA 4I2LC 4HAWB 1H10A 2DX1A 4JYBA 2H7DA 3B5ND 5APQA 1FOEA 1OXZA 1UNPA 3NTNA 5DI9B 1AFOA 5J3TA 1FBMA 2UVMA 3FM8C 5L81A 1JY3P 1SQBK 3MUDA 3C9IA 1RF1C 1URQB 1KFNA 3KRWA 2MDXA 2R5BA 3IR9A 3SO6A 1N73C 1L0LK 3OJAB 2YSZA 1A02F 1N2DC 5AW8B 5KJ7D 5CHXA 4C0AA 5AW9B 1XD4A 5EFXA 2HFED 5GOWB 3BASA 1FOSE 3ULBA 1X9VA 2O1JA 4WJ7A 1NWQA 1HJBA 3QIJA 2XKMA 1FAOA 2KCJA 5CCHD 3HK0A 3HW2B 4KHAA 1U5FA 2I5FA 2GCLA 2JEEA 2LKMA 4N78E 2VRSA 1IRSA 1NI2A 4WB4A 3MPXA 3ODOA 4WY4D 1BTKA 2H7HA 4HB4B 2NMBA 5C6RA 1M7LA 5APSA 4ZRJA 5C79A 1T8ZA 4HHVA 1SP4A 1URQA 2WPRA 4JF7A 2D2QA 3NFQA 1GG3A 1ZLLA 3BATA 1SGHA 1J1DB 3VOQA 2J59M 2N0YA 1NH4A 5AW0B 5AW5B 2D9WA 1MFZA 1TQZA 2IFNA 3HUSB 1QC6A 1NTKK 1UPQA 2YKQA 2YT0A 2MJZA 1LTJC 5AW7B 4BBKA 3G9WA 2RSGA 3RK2B 3L4FA 3H6PA 4HAYB 2Z4EA 1NTMK 3L35A 5AVZB 3LIDA 2DYNA 2EC1A 2ELBA 2RVBB 4GN1A 2BASA 4GKGA 4P7IA 3M0DC 2LKOA 1WRGA 1GDTA 2YT1A 1W1DA 1Z56A 3AU5A 1HUCA 1DEBA 1URQD 2YNYA 5HE3A 1LTAC 3WA0A 4EMOA 2E42A 1M7RA 1NTZK 1QL1A 2J0KA 2K2UA 4EJNA 1V89A 5KQ1A 2J0MA 2WWWA 2WITA 1NAFA 3VOPA 1FZAA 5KTBA 1SQQK 2Q7CA 1YTZT 1P6SA 3ULCA 5CCGC 1J1DC 4HAVB 5D3YA 5HE0A 2Y8FA 3UZTA 1RE3C 1GW3A 2Q3IA 1V61A 2W6AA 5D27A 3RK3B 2ROZB 1IO4A 3P8CE 5BU8B 3PG7A 2NPSA 3EQ2A 1RJ2A 1N3HA 2DX5A 1J2JB 4K17A 1FDMA 2IX7C 2N1TC 4RESB 3CI9A 2M8RA 3M06A 1X79B 5AVQB 3IVFA 4YL8A 2DYQA 3A98B 3ZDTA 4DBBA 1DDMA 2VRWB 1M1JB 1G2CB 1SFCB 2E43A 3HE5A 3LIEA 1S9KE 1U5DA 3TO1A 1EGXA 1DDVA 3TW1A 2Z0OA 2OARA 1DH3A 5AVRB 4MT7A 3RK2D 1FJPA 1FOSF 3FSSA 1X05A 4JYCA 2PAJA 2YO2A 4C7RA 3ML4A 2KB7P 3TYYA 4EKUA 2DLWA 4IOYX 1ZR2A 3VP8A 2MKRA 1GL2C 1RF1B 1FJKA 3II6A 5APUA 2EJ8A 1DX7A 2A45H 1PFJA 2AL6A 3TNUB 5APXA 2ELAA 5AW3B 4L6EA 3P8MC 2CAYA 3HE4A 4IAPA 3HD7B 2V76A 1MV8A 1FGZA 1ZN5A 1Q67A 1T3UA 3OA7A 3KY9A 1PLSA 3SWYA 2N23A 1G2CA 1SFCA 3NSUA 2ADZA 1HH0A 1JY2P 3TVVA 3KRXA 2OTXA 1WGUA 3N7NA 2IFSA 2GUVA 1M1JC 1EF1A 5D3VA 1VDFA 2D4QA 3RK3D 2W2XC 1IC2A 1IFMA 2H43A 1KI1B 3FEHA 3R2PA 3U1AA 1JCDA 2IPPA 1CZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSZ A;  3BJI A;  1U29 A;  2WSC H;  1V5M A;  5CLQ B;  2D9Y A;  4H8S A;  2P0D A;  4F7H A;  2Q13 A;  4PQ0 A;  1FHW A;  4HAU B;  1V88 A;  2COF A;  2LG1 A;  2COD A;  3PEG A;  4GXB A;  2I1K A;  4KHO A;  3ZVR A;  2DHK A;  2DN6 A;  1E5W A;  2LOX A;  2AEH A;  5FI1 A;  2IYB A;  2D9V A;  1X11 A;  1KZ7 A;  1MIX A;  1FHO A;  3PP2 A;  1WI1 A;  2DHI A;  1DYN A;  4GMX B;  5JHH A;  5C5B B;  2Y8G A;  1J0W A;  2D11 A;  3U7D A;  1NU1 K;  1MKE A;  2DKP A;  3SYX A;  1EAZ A;  1OQN A;  3QBV B;  2QKL A;  2E2X A;  4HDQ A;  1UNQ A;  2WSF H;  2P0F A;  3KZ1 A;  1W1G A;  1X1G A;  5C16 A;  2KGX B;  1BAK A;  1WG7 A;  2LYD A;  1MK9 B;  4XWX A;  2O01 H;  5C5B A;  4F7U P;  1FGY A;  1K5G B;  1ZM0 A;  2CY4 A;  3MDB C;  1UPR A;  2YS5 A;  1QQG A;  3ODW A;  1XOD A;  2YRY A;  4WSF A;  3HQC A;  1DBH A;  2HTH B;  3DXD A;  1OMW A;  4KVG B;  3A8P A;  2KUP A;  4B6H A;  1LB1 A;  1WGQ A;  2HE7 A;  2DKQ A;  3CIK A;  4TKN A;  3F0W A;  2L2I A;  4K81 A;  2QKM A;  2RUK B;  3KSY A;  1AQC A;  1I7A A;  4HAX B;  4KHB B;  2PZ1 A;  5JLJ B;  1X86 A;  2ZPY A;  4GMV A;  1PMS A;  4IFD K;  2RNR B;  4A6F B;  1RRP B;  3D8D A;  4WVF B;  2D9X A;  4NSW A;  1DDW A;  5HE1 A;  4A5K A;  5DHF B;  4Z2N A;  4A6H A;  5LON B;  4CHJ A;  1U5E A;  4PNK A;  3PVL A;  4HB3 B;  4ZRI A;  4IFS A;  1SQX K;  2VKI A;  2YS1 A;  5JP4 A;  3DXC A;  5KCV A;  2L1C A;  3ODX A;  4Z2M B;  3LJU X;  1AWE A;  1SQP K;  1W1H A;  2I5C A;  4HAT B;  1XX0 A;  4F7G A;  5LOP B;  1WJM A;  5J3Y A;  1U2B A;  4D0N B;  1OY2 A;  3P6A A;  2K2J A;  3QWM A;  4NY0 A;  1TJ6 A;  3X23 A;  2GCJ A;  3PSC A;  1U27 A;  2D9Z A;  2W2X D;  2DHJ A;  1XR0 B;  3GYO A;  3PVW A;  2OQB A;  2RGN B;  4GPT B;  4MY6 A;  2M38 A;  5D3X A;  1DRO A;  2CY5 A;  2D10 A;  1Y5O A;  5HE2 A;  2P8V A;  4HB2 B;  2I1J A;  1K5D B;  4HAZ B;  3O96 A;  2X18 A;  4DX9 0;  1XCG A;  2YF0 A;  4A6K A;  4MK0 A;  2RLO A;  1UEF A;  1L0N K;  3T06 A;  3V5W A;  1I2H A;  3SNH A;  3G3Z A;  4ZRK A;  2Z0P A;  3P7Z A;  1BWN A;  2GS0 A;  1SQV K;  2UZR A;  3RCP A;  2R0D A;  2COC A;  1U5G A;  2EMT A;  2JP2 A;  1ZC3 B;  3OAN A;  3AU4 A;  3D8E A;  1UNR A;  2J0J A;  1Z87 A;  5CLL B;  4HDO A;  3F5R A;  1GC6 A;  3N7C A;  1P5T A;  1SHC A;  5DH9 B;  4CHM A;  1MK7 B;  1FHX A;  3PZD A;  1P3R A;  2G35 A;  2H7E A;  1H4R A;  5DIF B;  2K00 A;  3U8Z A;  1LW3 A;  2XQN M;  1EVH A;  1NTV A;  1Y19 B;  2Z0Q A;  2WSE H;  2MFQ A;  4K2P A;  1KZG A;  4YON A;  3TCA A;  2COA A;  1FB8 A;  2CRF A;  2DA0 A;  2P0H A;  1WVH A;  2YS3 A;  2M14 A;  5JHG A;  4Y94 A;  5J3Q A;  1ISN A;  1MPH A;  2FJL A;  1ZC4 B;  2UZS A;  3SV1 A;  3D8F A;  2GJY A;  5KLV K;  3WYF B;  2FYU K;  2BCJ A;  5KQ4 A;  2DFK A;  4GZU A;  4CYE A;  2W2W A;  1BTN A;  2NZ8 B;  3GYP A;  3M9Q A;  1WJ1 A;  5D3W A;  4DX8 A;  1M7E A;  1ZVR A;  1TXD A;  1MIZ B;  2MWN B;  1V5P A;  1V5U A;  2R09 A;  5FI0 A;  1GC7 A;  4DXA B;  3CLQ A;  1NU2 A;  3LW5 H;  4A6F A;  3PVU A;  3VIA A;  2EMS A;  2LOZ A;  2LUL A;  2Y7B A;  3CXB B;  4KAX B;  2YVC A;  3SUZ A;  4K2O A;  1MAI A;  3BIN A;  3M1I B;  1NTY A;  5DHA B;  1B55 A;  3DXE A;  3TFM A;  3A8Q A;  4TYZ A;  2ROV A;  2DTC A;  1J19 A;  1XKE A;  1X1F A;  4HB0 B;  1ZSQ A;  4HAW B;  1H10 A;  2DX1 A;  2H7D A;  3PG7 A;  1FOE A;  1UNP A;  5DI9 B;  5J3T A;  2UVM A;  3FM8 C;  5L81 A;  1SQB K;  3KRW A;  2MDX A;  3SO6 A;  1L0L K;  2YSZ A;  4C0A A;  1XD4 A;  5EFX A;  5GOW B;  3ULB A;  4WJ7 A;  3QIJ A;  1FAO A;  2KCJ A;  3HW2 B;  4KHA A;  3HK0 A;  1U5F A;  2I5F A;  2GCL A;  2LKM A;  1IRS A;  1NI2 A;  3MPX A;  3ODO A;  1BTK A;  4HB4 B;  2NMB A;  5C6R A;  4ZRJ A;  5C79 A;  4HHV A;  2D2Q A;  1GG3 A;  1SGH A;  3VOQ A;  2J59 M;  2N0Y A;  2D9W A;  1TQZ A;  2YT0 A;  1UPQ A;  1QC6 A;  1NTK K;  4BBK A;  3G9W A;  2RSG A;  4HAY B;  1NTM K;  2EC1 A;  2DYN A;  2ELB A;  2RVB B;  4GN1 A;  4P7I A;  2LKO A;  2YT1 A;  1W1D A;  3AU5 A;  5HE3 A;  3WA0 A;  4EMO A;  1M7R A;  1NTZ K;  2J0K A;  2K2U A;  4EJN A;  1V89 A;  5KQ1 A;  2J0M A;  1SQQ K;  1P6S A;  3ULC A;  4HAV B;  5D3Y A;  5HE0 A;  2Y8F A;  3UZT A;  1V61 A;  5D27 A;  2ROZ B;  1RJ2 A;  1N3H A;  2DX5 A;  4K17 A;  3IVF A;  4YL8 A;  2DYQ A;  3A98 B;  3ZDT A;  4DBB A;  1DDM A;  2VRW B;  1EGX A;  1U5D A;  3TO1 A;  1DDV A;  3TW1 A;  2Z0O A;  2OAR A;  4MT7 A;  3FSS A;  1X05 A;  3ML4 A;  4EKU A;  2DLW A;  4IOY X;  2MKR A;  2EJ8 A;  1PFJ A;  2AL6 A;  2ELA A;  4L6E A;  2CAY A;  4IAP A;  2V76 A;  1FGZ A;  1Q67 A;  3KY9 A;  1PLS A;  2N23 A;  3NSU A;  2ADZ A;  3TVV A;  3KRX A;  2OTX A;  1WGU A;  2IFS A;  1EF1 A;  5D3V A;  2D4Q A;  2W2X C;  1KI1 B;  3FEH A;  3AJ4 A; 
#chains in the Genus database with same CATH topology
 1JCC A;  4PJ0 E;  3BJI A;  1NHL A;  1U29 A;  3P7K A;  5KAF H;  3M9B A;  1M90 Q;  5AW4 B;  3BVH A;  2ZXX A;  2OGU A;  1KTM A;  2Q13 A;  3KQG A;  2WVR A;  1FDO A;  2C0X A;  2LG1 A;  3U12 A;  5KLV E;  3GF3 A;  1LP1 A;  3RGU A;  1T2K D;  4M3L A;  1FZG A;  3PEG A;  2I1K A;  4KHO A;  4L1R A;  3ZVR A;  4W7Z A;  1RY3 A;  1U7M A;  2E5Y A;  1S5L H;  2AEH A;  5FI1 A;  1PP9 G;  2D9V A;  1ZR4 A;  1X11 A;  1KZ7 A;  1RQV A;  4NPE A;  1FHO A;  3CCR P;  3PP2 A;  3L70 J;  5APV A;  2IZ1 A;  1NU1 K;  1SQX J;  1MKE A;  1NTK G;  2R5D A;  1SQV D;  3TDK A;  1KIL C;  4OSN A;  1OQN A;  2N1T B;  2K8E A;  4LGD E;  2QKL A;  1BE3 D;  3O6Q B;  3WU2 H;  2E75 D;  2LXC B;  1UNQ A;  1GZL A;  4GT1 A;  3L36 A;  1N7S C;  1MKM A;  4R4L A;  3VP9 A;  1WG7 A;  1MK9 B;  4XWX A;  2P67 A;  3AE1 C;  1KYO E;  4F7U P;  1JO5 A;  4L74 A;  1ZM0 A;  2R2Y A;  3MIW A;  1QX8 A;  4PV1 B;  1QQG A;  1XOD A;  2YRY A;  2N1T A;  1VQK P;  3RBX A;  5B66 H;  4H13 B;  1OMW A;  4BRY B;  4H0L C;  1LT9 B;  1VQL P;  4B6H A;  1GW4 A;  4XA4 A;  2HE7 A;  3CIK A;  2GM4 A;  4EDF A;  1YJ9 P;  1LT1 A;  3V2N A;  4HAX B;  1VQ9 P;  1S5L X;  3AE3 C;  2PZ1 A;  2KLV A;  2YXR B;  2ZYG A;  1UIX A;  3GHG C;  4U3F G;  1VQ8 P;  2RNR B;  3GG2 A;  3B4S A;  5HE1 A;  2IBZ G;  2FFD C;  4N78 D;  1U5E A;  5AW2 B;  1KN7 A;  3PVL A;  3L75 G;  4HB3 B;  2KK7 A;  2R32 A;  2ZXE B;  3ITK A;  2KZI A;  5JP4 A;  2N9Y B;  3VMA A;  2L1C A;  2QJY C;  3V2R A;  2I5C A;  4DIX A;  4N6J A;  1XX0 A;  4I6M C;  1WJM A;  3TNU A;  4IFF A;  2QM7 A;  2POH A;  2E74 D;  4PD4 D;  4D0N B;  3QWM A;  1FZF A;  3PSC A;  1U27 A;  1AQT A;  1OVU A;  2WSF J;  1K05 A;  2DHJ A;  1VQ4 P;  1KIL B;  3GYO A;  5DJT B;  1LTG C;  4D6T G;  1SQB D;  4BXL A;  1M8O B;  3H1I E;  1N7S B;  1AJY A;  2O01 J;  2M38 A;  5D3X A;  4QJ4 B;  3H1H G;  2D10 A;  1KQS O;  2P8V A;  2FYU J;  3L74 J;  3HD7 D;  4U3F E;  3FX0 A;  3MUD C;  5AVT B;  1J1E C;  2WPQ A;  2ZYA A;  2YF0 A;  3L73 E;  2C9L Y;  4LLH A;  1KIL A;  4MK0 A;  1UEF A;  1L0N K;  2Q6Q A;  2KP8 A;  3SNH A;  5B66 E;  1CI6 A;  1N7S A;  5GTI E;  1BCC D;  4UB6 E;  4N3Y B;  3EFF K;  2HLO A;  1HBW A;  3OAN A;  3HRN A;  4CPG A;  3U1C A;  2QEX P;  1NTM D;  5CLL B;  2XNX A;  1GC6 A;  3L72 G;  2WMM A;  2L91 A;  1P5T A;  3JSV C;  1SHC A;  3A5T A;  2C9N Y;  2AEJ A;  2K3R A;  2BCC D;  2FFD B;  2KUQ A;  2HPC A;  2K00 A;  1LW3 A;  2XQN M;  1EVH A;  1NTV A;  1Y19 B;  2WSE H;  1PGJ A;  1AVY A;  1IFN A;  1PZQ A;  5GTH E;  2QJY B;  2COA A;  3HUS C;  3I55 P;  4IOI H;  5APY A;  1BSH A;  1FB8 A;  1GL2 A;  2CRF A;  2DA0 A;  2NBV A;  1ZYI A;  3GHG A;  2KS1 B;  1U57 A;  1WVH A;  3M91 A;  4QXA B;  3PP5 A;  4Y94 A;  5J3Q A;  1R5S A;  2LXB A;  1MPH A;  2P58 A;  3H1K J;  1VQP P;  2UZS A;  1NO4 A;  3CXH H;  2FFD A;  1SQV E;  5KLV K;  4GIF A;  1OFC X;  3WYF B;  3D6Z A;  4YTP C;  1BE3 E;  3MD0 A;  3L70 G;  4HH2 A;  5CMZ A;  2NZ8 B;  4PD4 I;  3M9Q A;  2YKO A;  4HKZ H;  3Q5P A;  2Q1K A;  1SQX G;  3AEB C;  1TXD A;  2H88 C;  4IL6 E;  4OGQ C;  4KHB A;  2XDJ A;  1H88 A;  3E7K A;  3RK3 C;  1VF5 C;  1GC7 A;  1KC8 Q;  2QA4 P;  4DXA B;  1NU2 A;  3CXB B;  2YVC A;  1RE4 A;  1K9M Q;  4K2O A;  1SQQ J;  1B55 A;  2W83 C;  1SFC C;  1H0T B;  2PFX A;  2B9B A;  1J19 A;  1CSB A;  1QL2 A;  2DX1 A;  2ZT9 D;  3AE9 C;  5APQ A;  2E75 B;  3MUD A;  3C9I A;  1PL5 A;  2R5B A;  1T77 A;  3OJA B;  2YXQ B;  3WUT A;  3H25 A;  2IZ0 A;  2K9Y A;  2GUM A;  2HFE D;  4H44 C;  4WJ7 A;  3QIJ A;  2XKM A;  1NU1 G;  5CCH D;  1H0T A;  4N78 E;  4OWF A;  3IN6 A;  1T6A A;  4ZRJ A;  2I8D A;  2WPR A;  1GG3 A;  3RK3 E;  1J1D B;  1W2B O;  2N0Y A;  5AW0 B;  2YT0 A;  1UPQ A;  3HUS B;  1NTK K;  2YKQ A;  1LTJ C;  3KZI E;  3G9W A;  1EC5 A;  4L75 A;  3H6P A;  4PD4 E;  4HAY B;  3I56 P;  2DYN A;  1AA0 A;  4KJM A;  2ELB A;  4GN1 A;  3M0D C;  1WRG A;  2NRG A;  3RL0 g;  1KQF B;  4Z1M H;  2O3J A;  1PPJ G;  4EMO A;  2K2U A;  1SQB E;  3H1L D;  1V89 A;  3G71 P;  2WIT A;  1NAF A;  5KTB A;  4HJG H;  3SSU A;  5CCG C;  4OGQ B;  2Q3I A;  5D27 A;  3RK3 B;  1IO4 A;  2KIE A;  2BEQ D;  2NPS A;  1DD3 A;  4RJT A;  2SPZ A;  2M8R A;  4YL8 A;  2Z59 A;  1DDM A;  1KD1 Q;  5KAI H;  4NPD A;  3E1R A;  2Z14 A;  2VRW B;  2FYU G;  1SFC B;  3H1J D;  3LIE A;  3HE5 A;  2JWA A;  3L74 G;  1BCC E;  3TW1 A;  2OAR A;  3A0H H;  4MT7 A;  2QJP C;  4JYC A;  4C7R A;  2DLW A;  2KLU A;  1VQ5 P;  1FJK A;  1NTM E;  3GF7 A;  3FXD A;  2A45 H;  2JR8 A;  5APX A;  2ELA A;  3HD7 B;  5KKZ C;  1ZN5 A;  1KOR A;  1PLS A;  1Q90 D;  3G4S P;  1SFC A;  3KRX A;  2BCC E;  1SQP D;  1VDF A;  2W2X C;  2H43 A;  2A06 G;  3FEH A;  2ZVN B;  1CZQ A;  2VSZ A;  4WY4 A;  2FJU B;  1USD A;  2XZR A;  5AW6 B;  2D9Y A;  2KIG A;  1FHW A;  1VQN P;  1LGH B;  1LTJ B;  2COF A;  3DCX A;  3WMM 0;  1SLQ A;  3TGU G;  3H1I J;  3V2Q A;  4GXB A;  4AUW A;  2DHK A;  2DN6 A;  1EDL A;  2LOX A;  3AE4 C;  1BDC A;  2JO1 A;  4GOE A;  3SWK A;  3H1K G;  1K73 Q;  2CPB A;  3L73 J;  1MIX A;  1VQM P;  3CMA P;  4GMX B;  1HVV A;  1YQ4 C;  1YIT P;  1J0W A;  2D11 A;  3U7D A;  3BCC J;  1EAZ A;  3M0D A;  1EXJ A;  1GTW A;  1X8Y A;  5APT A;  1AV1 A;  3KZ1 A;  1X1G A;  1E79 H;  1FAV A;  2KGX B;  5CCG A;  2G3A A;  3A58 A;  5KLI C;  3A7O A;  3MTU E;  3CC2 P;  1SQQ G;  1PGP A;  2QSI A;  2WZ7 A;  2CY4 A;  3EFG A;  1WT6 A;  5E79 E;  2FXO A;  2YS5 A;  3V2P A;  4C7N B;  1CW5 A;  3ODW A;  4GOF A;  1HWT C;  1A02 J;  3DXD A;  5KKZ B;  1JM0 A;  2HR3 A;  2KSJ A;  1YI2 P;  1RH5 B;  2E76 C;  2XU6 A;  4KVG B;  2Q3E A;  2WSC J;  4TKN A;  4K81 A;  4GOD A;  3KSY A;  1AQC A;  3B8E B;  2IYO A;  1SQV J;  2ZT9 B;  4GMV A;  5AVY B;  4IFD K;  4WVF B;  2D9X A;  1BE3 J;  2RN0 A;  4DOJ A;  1Q86 Q;  5DHF B;  2R3S A;  4YXW H;  4A6H A;  3CC4 P;  5CJ4 A;  3BCC D;  4PNK A;  1LT9 C;  1GL2 D;  1SQX K;  2YS1 A;  2QE7 H;  3DXC A;  1LTI C;  3H1L E;  5H2F E;  4Z2M B;  3CCE P;  1W1H A;  1G1J A;  1GMJ A;  1K04 A;  4HAT B;  2P10 A;  2M0B A;  5LOP B;  5J3Y A;  2M5A A;  1EXI A;  1BDD A;  1JMM A;  3V4W A;  1GU5 A;  1NGM B;  4NY0 A;  4BWN A;  2D9Z A;  3CWB D;  1R8E A;  1MZ9 A;  2Z5H A;  5KJ7 C;  2OYI C;  3H1J E;  3CX5 D;  2D2C D;  1L0L D;  2CY5 A;  3UIA A;  5TJH A;  4GDO A;  5HE2 A;  5KLI B;  1OW8 A;  1JY2 N;  2KNC B;  1UII A;  3P8C D;  4Y99 B;  2ZKM X;  2Y0C A;  2M3B A;  3O96 A;  4DX9 0;  1Y8A A;  3GMA A;  3CCM P;  4AQR D;  4RO0 A;  2RLO A;  1OW6 A;  4I7Z C;  1QVF O;  3MZW B;  4XFJ A;  1JY3 N;  3P7Z A;  3FGA D;  1S9K D;  1BWN A;  2E76 B;  1KB9 H;  4R4M A;  2UZR A;  3S9O A;  1SQP E;  3RCP A;  2COC A;  5LG4 B;  1ZC3 B;  2JP3 A;  3AU4 A;  2KI7 B;  3VMX A;  1N7L A;  1Z87 A;  4HDO A;  2Z13 A;  3QH9 A;  4CHM A;  3ZDM A;  1SQB J;  2L5G B;  4ASV A;  3O6Q A;  2B89 A;  2MKV A;  2YKP A;  3D71 A;  1YTZ I;  4K2P A;  1JTH B;  1U7J A;  2ZJS E;  4WWI A;  4UB8 E;  3EWK A;  2V4H A;  3TCA A;  3H1I G;  1L4A D;  1VQ6 P;  2YO3 A;  5KAF E;  3RK2 C;  2YS3 A;  2M14 A;  5JHG A;  2FJL A;  3SV1 A;  3HE4 B;  1BCC J;  1TU3 F;  3AED C;  4BRY A;  4DJG A;  2FYU K;  2QIW A;  2QRX A;  2BCJ A;  4CSQ A;  4GOU A;  1LT9 A;  1GK4 A;  3L73 G;  1JTH A;  1LTT C;  2OYI B;  1FZB A;  3GYP A;  1WJ1 A;  4C46 A;  3CX5 H;  4DX8 A;  1NTM J;  1X22 A;  1S5L E;  1YQ3 C;  2NPS D;  1Y47 A;  3RL0 D;  1V5U A;  2R09 A;  5FI0 A;  1N73 B;  1QLE D;  1XTG B;  3LW5 H;  1NTZ J;  2EMS A;  3L71 D;  5AVS B;  2BCC J;  3CX5 I;  3SUZ A;  1NTY A;  3CXH D;  5KJ7 A;  3DXE A;  2OYI A;  1IK9 A;  2QJK C;  4I7Z B;  3TFM A;  3A8Q A;  3KYQ A;  4EI2 A;  5BVZ A;  1T2K C;  3WU2 E;  1X1F A;  4HB0 B;  3KPE A;  3ABV C;  3PG7 A;  4JYB A;  3B5N D;  1OXZ A;  5J3T A;  2UVM A;  3FM8 C;  5L81 A;  1JY3 P;  1RF1 C;  2MDX A;  3IR9 A;  2B88 A;  4JPZ B;  2YSZ A;  1A02 F;  5AW8 B;  4C0A A;  5CHX A;  5EFX A;  1FOS E;  1EDJ A;  1X9V A;  1HJB A;  2W8Z A;  2KCJ A;  1Q82 Q;  4KHA A;  1SS1 A;  1U5F A;  2GCL A;  1KMI Z;  2VRS A;  1ZP0 C;  3MPX A;  3BCC E;  2O01 N;  4WY4 D;  1SQV G;  4JF7 A;  1ZLL A;  2E75 C;  1BE3 G;  3CCU P;  2IFN A;  2MJZ A;  2RSG A;  3RK2 B;  2Z4E A;  2RVB B;  2LKO A;  3CWB E;  1GDT A;  1NTZ D;  1URQ D;  2J0K A;  4EJN A;  5KQ1 A;  3CX5 E;  1JEK A;  3VOP A;  1SQQ K;  2Q7C A;  1J1D C;  4HAV B;  5D3Y A;  1RE3 C;  1V61 A;  1S4X A;  3P8C E;  5BU8 B;  4D6W A;  1J2J B;  4K17 A;  4RKU J;  2IX7 C;  3M06 A;  2FY8 A;  3IVF A;  3ZDT A;  3A98 B;  1OX3 A;  1M1J B;  1G2C B;  4MN4 C;  1EGX A;  2QJK B;  1S9K E;  1OVR A;  2Z0O A;  5AVR B;  3FSS A;  2YO2 A;  5M1B A;  1NVO A;  3CXH I;  3TYY A;  4EKU A;  1ZR2 A;  2KS1 A;  2KZJ A;  1RF1 B;  2MKR A;  3II6 A;  2EJ8 A;  1DX7 A;  5AW3 B;  3Q5R A;  2R44 A;  2GA1 A;  1Q67 A;  2N23 A;  1G2C A;  3H1L J;  2ADZ A;  2E74 C;  2OTX A;  4A7P A;  1EF1 A;  5D3V A;  1IC2 A;  5TIS H;  1IFM A;  1KI1 B;  3AJ4 A;  1JCD A;  2AEM A;  1RF1 A;  1H8A A;  3P32 A;  5CLQ B;  1SQB G;  4H8S A;  4F7H A;  3PHL A;  3R4Y A;  4PQ0 A;  4HAU B;  2XND H;  3HD7 C;  2OYH C;  3H1J J;  3VYI A;  3V5B A;  1OIP A;  2IYB A;  1ZV8 A;  1JNM A;  1BCC G;  3JC2 2;  1H89 A;  1WI1 A;  3NW8 A;  4U7J A;  5JHH A;  1L0N D;  5C5B B;  4EOT A;  2PP6 A;  2W90 A;  3L71 E;  3M9H A;  2WT7 B;  3OAK A;  2R3C A;  1SQP J;  1NTM G;  3QBV B;  1JY3 O;  3CXH E;  2E2X A;  4HDQ A;  2KOG A;  2WSF H;  3CL3 D;  1W1G A;  3USS A;  5C16 A;  2IFM A;  2LYD A;  1IFP A;  3V6I A;  2Q5U A;  2BCC G;  2O01 H;  4ZKU A;  5C5B A;  1Y9B A;  3PJS K;  3Q1M A;  3HUS A;  2GUS A;  2WT7 A;  3Q2Y A;  3RL0 B;  4WSF A;  3HQC A;  3T97 B;  2ZVO B;  4ASW A;  1DBH A;  5B5E H;  3CPW O;  4B86 A;  1HGV A;  2B87 B;  3FVC A;  3Q3D A;  2E74 B;  4K3A A;  2KUP A;  1EZV D;  1Q81 Q;  3SWF A;  4YPC A;  1MFT A;  1SVF A;  1LB1 A;  5TIS E;  1IFD A;  3IFM A;  2L2I A;  2QKM A;  4XE5 B;  2RUK B;  3A0B H;  1MI1 A;  1G1I A;  2N1T D;  2KR0 A;  3T97 A;  2ZPY A;  2OTK E;  3B5N B;  4A6F B;  5AVX B;  3D8D A;  2Y9Z A;  2DW3 A;  4A5K A;  4Z2N A;  3HTK B;  1K8A Q;  1OWA A;  3E1I A;  2OYH B;  5LON B;  3JCU H;  2HG5 D;  4CHJ A;  2K37 A;  1NTZ E;  3I5C A;  1FZC B;  2A45 I;  4DCK A;  4PV1 D;  3S4R A;  3ODX A;  3LJU X;  1AWE A;  2Q9I A;  2M3E A;  4H13 D;  2ZT9 C;  3HTK A;  4TLF A;  3W68 A;  3HD7 A;  2OYH A;  1OY2 A;  2K2J A;  2H8P D;  3HIE A;  5EFW B;  4KHX A;  2RH0 A;  1XR0 B;  2K9J B;  1BGY J;  2Y0D A;  4HSI A;  2OQB A;  2LR2 A;  1ZXG A;  1JMB A;  2RGN B;  5CCH C;  4GPT B;  4MY6 A;  1FU1 A;  1PGO A;  5APW A;  4EYY Q;  1W2E A;  1AQ5 A;  1K5D B;  1LTJ A;  4HAZ B;  1VPC A;  2X18 A;  1XCG A;  5AVU B;  1YJN P;  5CJ0 A;  2K9J A;  3Q5S A;  1KZU B;  3KDP B;  3T06 A;  3V5W A;  1PP9 D;  2P1J A;  1I2H A;  3NMD A;  3AEC C;  3G3Z A;  4ZRK A;  2Z0P A;  1SQV K;  3KXD A;  5KAI E;  2R0D A;  4IFM A;  1NTK D;  5DJU B;  3D8E A;  3A0H E;  2Y0E A;  2J0J A;  1KIL D;  1P84 D;  5AW1 B;  3H1L G;  3F5R A;  1EZV I;  3CWB J;  1IFI A;  4Y99 C;  5K5G B;  2HYN A;  5DH9 B;  3VN0 A;  1N7S D;  2ITA A;  1HJ0 A;  2IYP A;  3PZD A;  1P3R A;  1EQ7 A;  2FXM A;  2G35 A;  2H7E A;  1Q7Y Q;  1H4R A;  5DIF B;  3U8Z A;  1L0L J;  4OH8 B;  3PTZ A;  2Z0Q A;  1KB9 D;  2MFQ A;  4D6T J;  1BGY D;  1USE A;  3LW5 J;  1KZG A;  4O9B A;  4YON A;  3OW2 O;  3H1J G;  4C7N A;  3VMY A;  3AE8 C;  4K35 A;  4H0L D;  3WUU A;  1ISN A;  1ZC4 B;  5BU5 A;  3D8F A;  4ZMD A;  2P7J A;  5KQ4 A;  4W80 A;  4GZU A;  3M0A A;  4CYE A;  1BTN A;  5IRS A;  1NYH A;  5D3W A;  1KYO H;  1DIP A;  5C39 A;  1PV3 A;  2IBZ D;  1V5P A;  1SQP G;  3CLQ A;  3CCV P;  2LOZ A;  3L75 D;  4KAX B;  1NKZ B;  1JOC A;  1S3J A;  2N9B A;  3BIN A;  1LTS C;  3M1I B;  2RKL A;  2W6J H;  5CBO A;  3FXE A;  5CCH A;  1EZV E;  1M1K Q;  4I2L C;  4HAW B;  1H10 A;  2H7D A;  1FOE A;  1UNP A;  5DI9 B;  3NTN A;  1SQB K;  3C8V A;  3GW6 A;  1P84 H;  1N73 C;  2FYN B;  4QJ3 B;  3NWA A;  4D6T D;  1N2D C;  3AEA C;  1XD4 A;  3BAS A;  1RQU A;  2PRR A;  3ULB A;  1NWQ A;  3HW2 B;  3H1H D;  3HK0 A;  2LKM A;  2WSE J;  1NI2 A;  1P84 I;  4WB4 A;  3ODO A;  1ZRT D;  2H7H A;  4HB4 B;  1T8Z A;  4HHV A;  1SP4 A;  2K1A A;  3BAT A;  3L71 J;  1R5L A;  5AW5 B;  2KNC A;  2D9W A;  1TQZ A;  1QC6 A;  1NJI Q;  4BBK A;  3L4F A;  1KB9 I;  1NTM K;  2EC1 A;  3TF5 A;  3D70 A;  2BAS A;  1YBK A;  1W1D A;  1Z56 A;  3AU5 A;  3CD6 P;  1HUC A;  1DEB A;  3QWO C;  5HE3 A;  1LTA C;  2E42 A;  1NTZ K;  1QL1 A;  1QGK B;  1YJW P;  2KXP B;  3L72 D;  2J0M A;  3PRJ A;  1ZW0 A;  1P6S A;  2PGD A;  2WQY C;  3ULC A;  3UZT A;  1GW3 A;  2W6A A;  1BGY G;  2ROZ B;  2FBW C;  3EQ2 A;  2H89 C;  1N3H A;  2DX5 A;  3S1K A;  1FDM A;  4RES B;  1S2E A;  4JQ0 D;  5GTI H;  4UB6 H;  1PP9 E;  2IBZ I;  2DYQ A;  2FXP A;  1NU1 J;  5CBN A;  1DH3 A;  2V7Q H;  1FJP A;  1FOS F;  2AXT H;  1X05 A;  1NTK E;  1DD4 A;  3BCC G;  4IOY X;  1GL2 C;  1KIL E;  1P84 E;  3TNU B;  4L6E A;  3P8M C;  3HE4 A;  3L70 D;  4QJ5 B;  1MV8 A;  2JKV A;  3SWY A;  3NSU A;  1SQX D;  1JY2 P;  3TVV A;  4GNK B;  1WGU A;  2GUV A;  4OGQ D;  1M1J C;  2D4Q A;  3RK3 D;  1VF5 D;  5GTH H;  1KB9 E;  3R2P A;  3CWB G;  3U1A A;  2IPP A;  2OTJ P;  4EIJ A;  3AE2 C;  1BGY E;  2WSC H;  1V5M A;  1N73 A;  2Z5I A;  3CCJ P;  3F89 A;  2P0D A;  3BRT B;  2D2C C;  1SFC D;  1V88 A;  3O8Z A;  1KFM A;  1LWU C;  1L0L G;  1RE4 C;  1GU4 A;  2COD A;  3AE7 C;  2W27 A;  1RF0 C;  1E5W A;  1CI6 B;  1LNQ A;  2XV5 A;  1WMK A;  3OHM B;  4IL6 H;  1PFI A;  5M4Y B;  3A3Y B;  4H44 D;  2DHI A;  1NU1 D;  1DYN A;  2IBZ E;  2YT2 A;  1RHZ B;  2O1K A;  2Y8G A;  2RRF A;  2DKP A;  3SYX A;  3L75 E;  2W6B A;  2HOD B;  3PLN A;  4NPF X;  4H0L B;  2QM8 A;  2P0F A;  1FDI A;  2WTY A;  2HPC B;  2G8Y A;  2JJL A;  1BAK A;  1PGQ A;  2AXT E;  1FGY A;  4ZNC A;  1S1C X;  1K5G B;  1L0L E;  3G9R A;  3MDB C;  1GL2 B;  1UPR A;  3GHG B;  2HOD A;  1PPJ D;  4D6T E;  1IJD B;  2FYZ A;  2HTH B;  2WPS A;  1L4A C;  3H1H E;  3L37 A;  3A8P A;  5CCG D;  3TGU J;  1ZRT E;  1HF9 A;  1WGQ A;  2DKQ A;  1L0N J;  3F0W A;  1X0T A;  4JBZ A;  1I7A A;  3KZI H;  4KHB B;  5JLJ B;  4IL6 X;  1NOH A;  1X86 A;  4PD4 H;  1PMS A;  3AEE C;  2E5T A;  2Z4D A;  2NPS C;  2FYU D;  2KSE A;  1RRP B;  3L74 D;  3RL0 C;  4AYC A;  2D2C B;  1DDW A;  4NSW A;  1GK6 A;  1T3J A;  1LWU B;  1M56 D;  1QVG O;  3CCL P;  1OZH A;  1M1J A;  3N4X A;  3V4Q A;  3TSI A;  3L71 G;  1QEX A;  3U59 A;  4ZRI A;  1IZN B;  5AVW B;  4IFS A;  2VKI A;  2C0W A;  2ZAE B;  5KCV A;  3MGN A;  3TK1 A;  3L72 E;  3H32 B;  1SQP K;  1JUN A;  1OVV A;  2YMY A;  4F7G A;  1J1E B;  1PIX A;  1IK7 A;  1HGZ A;  1VQ7 P;  1LWU A;  3B5N C;  3VMZ A;  4DT0 A;  1U2B A;  1YYC A;  3P6A A;  5I2M A;  1TJ6 A;  3X23 A;  1L2P A;  2GCJ A;  2K88 A;  1LTB C;  2A06 D;  5AVV B;  2W2X D;  1VL2 A;  2IDB A;  3D6Y A;  1IFJ A;  1RF0 A;  3CCQ P;  3PVW A;  5L8R J;  3H32 A;  1FZC C;  1VQO P;  4DZO A;  1DRO A;  1N86 A;  5KLV J;  1Y5O A;  4OT1 A;  4WY4 C;  4HB2 B;  3TGU D;  2UWJ E;  1JY2 O;  2CK3 H;  2I1J A;  1NKN A;  4A6K A;  4I1L A;  1JB0 J;  1FZE A;  1MUU A;  3L70 E;  4ZKP A;  2FKW B;  2JWD A;  1L4A B;  3H1K D;  1SQX E;  3C1L A;  2GS0 A;  2P2U A;  2KYV A;  3CME P;  1U5G A;  2EMT A;  2JP2 A;  1YIJ P;  1URQ C;  1KV4 A;  1NTZ G;  3IF4 A;  1UNR A;  3K5B A;  1RE3 A;  1AVO A;  3MP7 B;  3AEG C;  2J58 A;  3A2A A;  3MHV A;  2AEF A;  3N7C A;  2NPS B;  1L4A A;  1HTL C;  1MK7 B;  1FHX A;  2ZFC A;  2YIU C;  3PH0 A;  1SQQ D;  4TT3 H;  3HE5 B;  1XTC C;  4HYT B;  1KQL A;  1VF5 B;  1NU1 E;  2P0H A;  1PP9 J;  3KHU A;  3NXS A;  2E76 D;  5KLV D;  1FS0 E;  3AEF C;  2OTL P;  3SFD C;  2B87 A;  4W7Y A;  1EDI A;  2GJY A;  3BRV B;  2DFK A;  1NTK J;  2W2W A;  4WVZ A;  2OYO A;  1LJ2 A;  1M7E A;  1ZOY C;  1ZVR A;  1GD2 E;  1MIZ B;  2MWN B;  3FWL A;  5E79 H;  1OW7 A;  4WY4 B;  3B5N A;  1BSN A;  4A6F A;  3PVU A;  3VIA A;  2CPS A;  3VTP C;  2LUL A;  2Y7B A;  2Y9Y A;  3HSA A;  2QVA A;  1PPJ E;  4H44 B;  1MAI A;  4KT0 J;  5DHA B;  2J5U A;  1FZC A;  2A45 G;  4WBA A;  4TYZ A;  2ROV A;  2DTC A;  5I2S A;  4LC1 A;  1XKE A;  1ZSQ A;  2YMK A;  2JDI H;  1AFO A;  1KYO D;  1FBM A;  1D7M A;  1URQ B;  3AE5 C;  1KFN A;  1FC2 C;  3KRW A;  3SO6 A;  3CCS P;  1L0L K;  5KJ7 D;  1S72 P;  5AW9 B;  2FYU E;  3B71 A;  3L74 E;  5GOW B;  2O1J A;  1FAO A;  2ZYD A;  4Y28 J;  2I5F A;  2JEE A;  1L0N G;  5B5E E;  1W5C E;  1IRS A;  4U3F J;  1EDK A;  5H2F H;  1BTK A;  2YIU B;  2NMB A;  5C6R A;  1M7L A;  5APS A;  1DEE G;  5C79 A;  1URQ A;  4L73 A;  4PJ0 H;  2D2Q A;  3NFQ A;  1NAY A;  1SGH A;  3VOQ A;  3L75 J;  3WUV A;  2J59 M;  1NH4 A;  1MFZ A;  3A0B E;  5AW7 B;  3NWF A;  2FYN C;  2OQQ A;  3L35 A;  5AVZ B;  3LID A;  4P7I A;  4GKG A;  2A06 E;  1OMI A;  2YT1 A;  1YHQ P;  2K49 A;  2V7Q J;  2YNY A;  3JCU E;  3WA0 A;  1M7R A;  2QG4 A;  3IAO A;  2WWW A;  2QJP B;  1FZA A;  1YTZ T;  1N8R Q;  2BEZ F;  5HE0 A;  3G6E P;  2Y8F A;  1EZV G;  3TGU E;  3H1H J;  3RBZ A;  1RJ2 A;  1L0N E;  4OVN F;  3F5H A;  2N1T C;  4QMA A;  3CI9 A;  1X79 B;  5AVQ B;  3SFE C;  3CC7 P;  4DBB A;  1Q2N A;  5KLV G;  3H1K E;  1KQG B;  2E43 A;  1U5D A;  3TO1 A;  2WPV B;  3H1I D;  1DDV A;  3W67 A;  3AE6 C;  3RK2 D;  2PAJ A;  1M57 D;  3ML4 A;  4U3F D;  2KB7 P;  3NWD A;  3B77 A;  3VP8 A;  5APU A;  4PV1 C;  2RMZ A;  1PFJ A;  2AL6 A;  2M5A B;  3L73 D;  3FWN A;  2CAY A;  4IAP A;  1FE6 A;  2V76 A;  1FGZ A;  3GLM A;  4HB1 A;  1T3U A;  3OA7 A;  4H13 C;  1ZME C;  1KYO I;  3KY9 A;  2KUB A;  2NZ2 A;  2AXC A;  1HH0 A;  1LP1 B;  4L76 A;  3L72 J;  4YXD C;  3N7N A;  2IFS A;  2WSS H;  1SQQ E;  4UB8 H;  2KIK A; 
#chains in the Genus database with same CATH homology
 1JCC A;  4EIJ A;  1RF1 A;  2VSZ A;  3BJI A;  1NHL A;  1U29 A;  3P7K A;  4WY4 A;  2WSC H;  1H8A A;  3M9B A;  3P32 A;  1V5M A;  5CLQ B;  1N73 A;  5AW4 B;  3BVH A;  2XZR A;  5AW6 B;  2Z5I A;  2D9Y A;  2P0D A;  4H8S A;  4F7H A;  2Q13 A;  3BRT B;  4PQ0 A;  1FHW A;  4HAU B;  1SFC D;  1V88 A;  1LGH B;  1LTJ B;  3KQG A;  3O8Z A;  2COF A;  1KFM A;  1LWU C;  1RE4 C;  2C0X A;  1GU4 A;  2LG1 A;  3HD7 C;  2OYH C;  3WMM 0;  3VYI A;  1T2K D;  1SLQ A;  4M3L A;  1FZG A;  2COD A;  3V2Q A;  3PEG A;  2W27 A;  4GXB A;  2I1K A;  4KHO A;  4AUW A;  3ZVR A;  4W7Z A;  3V5B A;  2DHK A;  1RF0 C;  1E5W A;  1CI6 B;  1RY3 A;  2DN6 A;  2XV5 A;  2LOX A;  2AEH A;  5FI1 A;  2IYB A;  1PFI A;  2D9V A;  1ZR4 A;  1X11 A;  1ZV8 A;  1KZ7 A;  2CPB A;  1MIX A;  1FHO A;  1JNM A;  3PP2 A;  3A3Y B;  1H89 A;  1WI1 A;  2DHI A;  1DYN A;  4GMX B;  1HVV A;  5JHH A;  5APV A;  5C5B B;  2O1K A;  2Y8G A;  4EOT A;  1J0W A;  2PP6 A;  2D11 A;  3U7D A;  1NU1 K;  1MKE A;  2R5D A;  2DKP A;  3SYX A;  3M9H A;  2W6B A;  2WT7 B;  1EAZ A;  3M0D A;  3OAK A;  2HOD B;  2R3C A;  1KIL C;  1OQN A;  2N1T B;  3QBV B;  1JY3 O;  4LGD E;  2QKL A;  1GTW A;  2E2X A;  4HDQ A;  2QM8 A;  2KOG A;  1X8Y A;  2WSF H;  1GZL A;  5APT A;  3CL3 D;  4GT1 A;  1UNQ A;  2P0F A;  3KZ1 A;  2WTY A;  3L36 A;  1N7S C;  2HPC B;  1W1G A;  3VP9 A;  1X1G A;  2JJL A;  5C16 A;  1FAV A;  2KGX B;  1BAK A;  2IFM A;  1WG7 A;  2LYD A;  1MK9 B;  5CCG A;  2Q5U A;  4XWX A;  2O01 H;  2P67 A;  3A7O A;  3MTU E;  4ZKU A;  5C5B A;  4F7U P;  1FGY A;  2WZ7 A;  1JO5 A;  1K5G B;  3HUS A;  1ZM0 A;  2GUS A;  2CY4 A;  3EFG A;  3MDB C;  1WT6 A;  3MIW A;  2WT7 A;  1GL2 B;  1UPR A;  3GHG B;  2YS5 A;  3V2P A;  4C7N B;  2HOD A;  1CW5 A;  3RL0 B;  1QQG A;  1XOD A;  3ODW A;  1HWT C;  2YRY A;  4WSF A;  2N1T A;  3HQC A;  1DBH A;  1IJD B;  2FYZ A;  2HTH B;  4B86 A;  1HGV A;  1A02 J;  3DXD A;  2WPS A;  1L4A C;  2KSJ A;  1OMW A;  3L37 A;  2XU6 A;  4KVG B;  3A8P A;  2KUP A;  1LT9 B;  5CCG D;  4B6H A;  1GW4 A;  3SWF A;  4XA4 A;  1SVF A;  1LB1 A;  1WGQ A;  2DKQ A;  2HE7 A;  1IFD A;  3CIK A;  4TKN A;  3F0W A;  3IFM A;  2GM4 A;  2L2I A;  4K81 A;  2QKM A;  4XE5 B;  2RUK B;  3V2N A;  3KSY A;  1AQC A;  1I7A A;  4HAX B;  3B8E B;  4KHB B;  2N1T D;  1G1I A;  2PZ1 A;  5JLJ B;  2KLV A;  1NOH A;  3T97 A;  1X86 A;  3B5N B;  2ZPY A;  4GMV A;  1PMS A;  2NPS C;  5AVY B;  3GHG C;  4IFD K;  2RNR B;  4A6F B;  5AVX B;  1RRP B;  3RL0 C;  3D8D A;  4AYC A;  2D9X A;  4WVF B;  4NSW A;  1DDW A;  1GK6 A;  5HE1 A;  4DOJ A;  1T3J A;  1LWU B;  4A5K A;  5DHF B;  3HTK B;  4Z2N A;  1OWA A;  3E1I A;  2OYH B;  4A6H A;  2FFD C;  5LON B;  4N78 D;  1M1J A;  2HG5 D;  4CHJ A;  3N4X A;  5AW2 B;  3V4Q A;  5CJ4 A;  1U5E A;  3TSI A;  3PVL A;  4PNK A;  3I5C A;  3U59 A;  3AJ4 A;  4HB3 B;  1LT9 C;  2R32 A;  1FZC B;  4ZRI A;  5AVW B;  4IFS A;  2ZXE B;  1GL2 D;  1SQX K;  2A45 I;  2VKI A;  2YS1 A;  5JP4 A;  3DXC A;  1LTI C;  2C0W A;  5KCV A;  2L1C A;  3ODX A;  3MGN A;  3TK1 A;  3V2R A;  3H32 B;  3LJU X;  4Z2M B;  1AWE A;  1SQP K;  2Q9I A;  1JUN A;  1W1H A;  2I5C A;  4N6J A;  1G1J A;  4HAT B;  1XX0 A;  2YMY A;  4I6M C;  4F7G A;  5LOP B;  1J1E B;  1WJM A;  5J3Y A;  1HGZ A;  3TNU A;  4IFF A;  1LWU A;  3B5N C;  1JMM A;  2QM7 A;  3V4W A;  2POH A;  3HTK A;  3VMZ A;  1U2B A;  3HD7 A;  4D0N B;  2OYH A;  1YYC A;  1OY2 A;  1GU5 A;  2K2J A;  3P6A A;  3QWM A;  4NY0 A;  1TJ6 A;  2H8P D;  3X23 A;  1FZF A;  2GCJ A;  3PSC A;  1U27 A;  1LTB C;  5AVV B;  2D9Z A;  2W2X D;  4KHX A;  2DHJ A;  1XR0 B;  1KIL B;  1MZ9 A;  1IFJ A;  1RF0 A;  3GYO A;  1LTG C;  2Z5H A;  5KJ7 C;  2OYI C;  2OQB A;  3PVW A;  3H32 A;  1FZC C;  2RGN B;  1N7S B;  5CCH C;  4DZO A;  4GPT B;  4MY6 A;  2M38 A;  1FU1 A;  5D3X A;  5APW A;  1DRO A;  1N86 A;  2CY5 A;  2D10 A;  3UIA A;  1Y5O A;  5HE2 A;  4WY4 C;  2P8V A;  3HD7 D;  4HB2 B;  1W2E A;  1JY2 N;  5AVT B;  1JY2 O;  1J1E C;  2I1J A;  3P8C D;  1AQ5 A;  4Y99 B;  1NKN A;  1K5D B;  1LTJ A;  4HAZ B;  1VPC A;  2M3B A;  2WPQ A;  3O96 A;  2X18 A;  4DX9 0;  1XCG A;  5AVU B;  2YF0 A;  4A6K A;  4I1L A;  5CJ0 A;  4AQR D;  2C9L Y;  4LLH A;  1KIL A;  4MK0 A;  2RLO A;  1KZU B;  1FZE A;  1MUU A;  3KDP B;  1UEF A;  4ZKP A;  1L0N K;  2FKW B;  3T06 A;  3V5W A;  2P1J A;  1I2H A;  2KP8 A;  3NMD A;  3SNH A;  1L4A B;  3G3Z A;  1CI6 A;  1JY3 N;  2Z0P A;  3P7Z A;  1N7S A;  1S9K D;  1BWN A;  2GS0 A;  1SQV K;  4ZRK A;  4N3Y B;  2UZR A;  3RCP A;  2P2U A;  2R0D A;  2KYV A;  2COC A;  4IFM A;  1U5G A;  2EMT A;  2HLO A;  2JP2 A;  1HBW A;  1ZC3 B;  3OAN A;  3HRN A;  3AU4 A;  1URQ C;  3D8E A;  3U1C A;  3VMX A;  1UNR A;  1N7L A;  2J0J A;  1RE3 A;  1KIL D;  1Z87 A;  5AW1 B;  4HDO A;  2J58 A;  3F5R A;  2XNX A;  5CLL B;  4Y99 C;  1IFI A;  3A2A A;  1GC6 A;  3N7C A;  2HYN A;  2NPS B;  1P5T A;  1SHC A;  5DH9 B;  4CHM A;  1L4A A;  1HTL C;  3VN0 A;  1MK7 B;  1N7S D;  3A5T A;  1FHX A;  2C9N Y;  2ZFC A;  2L5G B;  3PZD A;  1P3R A;  1EQ7 A;  2FXM A;  2G35 A;  2H7E A;  2FFD B;  2HPC A;  1H4R A;  2K00 A;  5DIF B;  1LW3 A;  2XQN M;  3U8Z A;  1EVH A;  1NTV A;  2YKP A;  4OH8 B;  3HE5 B;  1Y19 B;  2Z0Q A;  2WSE H;  2MFQ A;  1YTZ I;  1IFN A;  4K2P A;  1JTH B;  1XTC C;  1KZG A;  4O9B A;  4HYT B;  1KQL A;  4YON A;  3TCA A;  2COA A;  3HUS C;  1FB8 A;  5APY A;  2CRF A;  1GL2 A;  2DA0 A;  1L4A D;  3GHG A;  2YO3 A;  4C7N A;  1WVH A;  3RK2 C;  3M91 A;  3VMY A;  2P0H A;  3PP5 A;  2M14 A;  2YS3 A;  3NXS A;  5JHG A;  4Y94 A;  5J3Q A;  1ISN A;  1MPH A;  2FJL A;  1ZC4 B;  2UZS A;  3SV1 A;  1NO4 A;  4W7Y A;  3HE4 B;  2FFD A;  5BU5 A;  3D8F A;  2GJY A;  5KLV K;  4GIF A;  3WYF B;  2FYU K;  2P7J A;  3BRV B;  2BCJ A;  5KQ4 A;  1LT9 A;  1GK4 A;  2DFK A;  4W80 A;  4GZU A;  3M0A A;  3MD0 A;  4CYE A;  2W2W A;  1BTN A;  1JTH A;  1LTT C;  2OYI B;  4HH2 A;  1FZB A;  5CMZ A;  2NZ8 B;  3GYP A;  3M9Q A;  1WJ1 A;  2YKO A;  4C46 A;  5D3W A;  4DX8 A;  1M7E A;  2NPS D;  1ZVR A;  1TXD A;  3RL0 D;  1GD2 E;  1MIZ B;  2MWN B;  1V5P A;  2XDJ A;  1H88 A;  1V5U A;  4WY4 B;  3RK3 C;  3B5N A;  2R09 A;  1GC7 A;  5FI0 A;  4DXA B;  3CLQ A;  1NU2 A;  1N73 B;  3LW5 H;  1XTG B;  4A6F A;  3PVU A;  3VIA A;  2CPS A;  3VTP C;  2EMS A;  2LOZ A;  2LUL A;  2Y7B A;  3CXB B;  4KAX B;  1NKZ B;  2YVC A;  5AVS B;  1RE4 A;  3SUZ A;  1JOC A;  2N9B A;  4K2O A;  1MAI A;  3BIN A;  1LTS C;  3M1I B;  1NTY A;  5DHA B;  5KJ7 A;  1B55 A;  2OYI A;  3DXE A;  1IK9 A;  1SFC C;  3TFM A;  3A8Q A;  1FZC A;  2A45 G;  3KYQ A;  4WBA A;  4TYZ A;  2ROV A;  5CCH A;  2DTC A;  5BVZ A;  1T2K C;  1J19 A;  4LC1 A;  1X1F A;  1XKE A;  1CSB A;  4HB0 B;  1ZSQ A;  1QL2 A;  3KPE A;  4I2L C;  4HAW B;  1H10 A;  2DX1 A;  4JYB A;  2H7D A;  3B5N D;  5APQ A;  1FOE A;  1OXZ A;  1UNP A;  3NTN A;  5DI9 B;  1AFO A;  5J3T A;  1FBM A;  2UVM A;  3FM8 C;  5L81 A;  1JY3 P;  1SQB K;  3MUD A;  3C9I A;  1RF1 C;  1URQ B;  1KFN A;  3KRW A;  2MDX A;  2R5B A;  3IR9 A;  3SO6 A;  1N73 C;  1L0L K;  3OJA B;  2YSZ A;  1A02 F;  1N2D C;  5AW8 B;  5KJ7 D;  5CHX A;  4C0A A;  5AW9 B;  1XD4 A;  5EFX A;  2HFE D;  5GOW B;  3BAS A;  1FOS E;  3ULB A;  1X9V A;  2O1J A;  4WJ7 A;  1NWQ A;  1HJB A;  3QIJ A;  2XKM A;  1FAO A;  2KCJ A;  5CCH D;  3HK0 A;  3HW2 B;  4KHA A;  1U5F A;  2I5F A;  2GCL A;  2JEE A;  2LKM A;  4N78 E;  2VRS A;  1IRS A;  1NI2 A;  4WB4 A;  3MPX A;  3ODO A;  4WY4 D;  1BTK A;  2H7H A;  4HB4 B;  2NMB A;  5C6R A;  1M7L A;  5APS A;  4ZRJ A;  5C79 A;  1T8Z A;  4HHV A;  1SP4 A;  1URQ A;  2WPR A;  4JF7 A;  2D2Q A;  3NFQ A;  1GG3 A;  1ZLL A;  3BAT A;  1SGH A;  1J1D B;  3VOQ A;  2J59 M;  2N0Y A;  1NH4 A;  5AW0 B;  5AW5 B;  2D9W A;  1MFZ A;  1TQZ A;  2IFN A;  3HUS B;  1QC6 A;  1NTK K;  1UPQ A;  2YKQ A;  2YT0 A;  2MJZ A;  1LTJ C;  5AW7 B;  4BBK A;  3G9W A;  2RSG A;  3RK2 B;  3L4F A;  3H6P A;  4HAY B;  2Z4E A;  1NTM K;  3L35 A;  5AVZ B;  3LID A;  2DYN A;  2EC1 A;  2ELB A;  2RVB B;  4GN1 A;  2BAS A;  4GKG A;  4P7I A;  3M0D C;  2LKO A;  1WRG A;  1GDT A;  2YT1 A;  1W1D A;  1Z56 A;  3AU5 A;  1HUC A;  1DEB A;  1URQ D;  2YNY A;  5HE3 A;  1LTA C;  3WA0 A;  4EMO A;  2E42 A;  1M7R A;  1NTZ K;  1QL1 A;  2J0K A;  2K2U A;  4EJN A;  1V89 A;  5KQ1 A;  2J0M A;  2WWW A;  2WIT A;  1NAF A;  3VOP A;  1FZA A;  5KTB A;  1SQQ K;  2Q7C A;  1YTZ T;  1P6S A;  3ULC A;  5CCG C;  1J1D C;  4HAV B;  5D3Y A;  5HE0 A;  2Y8F A;  3UZT A;  1RE3 C;  1GW3 A;  2Q3I A;  1V61 A;  2W6A A;  5D27 A;  3RK3 B;  2ROZ B;  1IO4 A;  3P8C E;  5BU8 B;  3PG7 A;  2NPS A;  3EQ2 A;  1RJ2 A;  1N3H A;  2DX5 A;  1J2J B;  4K17 A;  1FDM A;  2IX7 C;  2N1T C;  4RES B;  3CI9 A;  2M8R A;  3M06 A;  1X79 B;  5AVQ B;  3IVF A;  4YL8 A;  2DYQ A;  3A98 B;  3ZDT A;  4DBB A;  1DDM A;  2VRW B;  1M1J B;  1G2C B;  1SFC B;  2E43 A;  3HE5 A;  3LIE A;  1S9K E;  1U5D A;  3TO1 A;  1EGX A;  1DDV A;  3TW1 A;  2Z0O A;  2OAR A;  1DH3 A;  5AVR B;  4MT7 A;  3RK2 D;  1FJP A;  1FOS F;  3FSS A;  1X05 A;  4JYC A;  2PAJ A;  2YO2 A;  4C7R A;  3ML4 A;  2KB7 P;  3TYY A;  4EKU A;  2DLW A;  4IOY X;  1ZR2 A;  3VP8 A;  2MKR A;  1GL2 C;  1RF1 B;  1FJK A;  3II6 A;  5APU A;  2EJ8 A;  1DX7 A;  2A45 H;  1PFJ A;  2AL6 A;  3TNU B;  5APX A;  2ELA A;  5AW3 B;  4L6E A;  3P8M C;  2CAY A;  3HE4 A;  4IAP A;  3HD7 B;  2V76 A;  1MV8 A;  1FGZ A;  1ZN5 A;  1Q67 A;  1T3U A;  3OA7 A;  3KY9 A;  1PLS A;  3SWY A;  2N23 A;  1G2C A;  1SFC A;  3NSU A;  2ADZ A;  1HH0 A;  1JY2 P;  3TVV A;  3KRX A;  2OTX A;  1WGU A;  3N7N A;  2IFS A;  2GUV A;  1M1J C;  1EF1 A;  5D3V A;  1VDF A;  2D4Q A;  3RK3 D;  2W2X C;  1IC2 A;  1IFM A;  2H43 A;  1KI1 B;  3FEH A;  3R2P A;  3U1A A;  1JCD A;  2IPP A;  1CZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...