2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
b'AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
2RUKB 3A8QA 3LJUX 3NSUA 4KHBB 4A6KA 2QKLA 4HHVA 3ULCA 2D11A 4HAXB 4YONA 2J0KA 2UVMA 1SQVK 3PP2A 4HB0B 3A8PA 3ODXA 1FHXA 3QIJA 5HE2A 4Z2NA 4CHMA 2DX1A 2RLOA 2ZPYA 1V5MA 3SO6A 3P7ZA 4CHJA 3M9QA 1SGHA 2ELAA 2VRWB 1J19A 5FI0A 1XR0B 4KHOA 4EMOA 2UZSA 4KAXB 3AU5A 1SQPK 2LKOA 2D2QA 4HATB 4IFDK 4K17A 4F7UP 3MPXA 2COCA 2RSGA 4PNKA 1U5GA 2DKPA 5C79A 3BINA 1X1FA 4Y94A 4MT7A 5C16A 1N3HA 4F7HA 1MIZB 4PQ0A 3VIAA 2W2XD 2HE7A 2CRFA 4KHAA 4HAVB 4TYZA 3DXDA 1OMWA 1TXDA 1U29A 2D9WA 3SYXA 1UEFA 4L6EA 1UPRA 2MKRA 3ZVRA 4EKUA 2Y8GA 4H8SA 2DYQA 1P6SA 1J0WA 4DXAB 3F0WA 1SQXK 1FAOA 1XODA 1MPHA 2UZRA 3QBVB 2K2JA 2M38A 3D8FA 2AL6A 2LG1A 1FGYA 1ISNA 3AU4A 3GYOA 4ZRKA 2EJ8A 1XCGA 2P0DA 2K2UA 3SV1A 1NU1K 2COAA 2YT0A 3LW5H 5KQ4A 1W1GA 2DHIA 4CYEA 1DDVA 1I7AA 2ROZB 4HDOA 3WYFB 5KQ1A 1U5EA 1BTNA 1P3RA 1Q67A 2LOZA 3T06A 5CLLB 1OQNA 4HB2B 2FYUK 1P5TA 1NI2A 5DHAB 2IYBA 1MK7B 4NSWA 2R0DA 1X11A 4A5KA 5C5BA 2J59M 3P6AA 1Y5OA 3ML4A 3ODWA 3ZDTA 2R09A 2RVBB 4YL8A 2CODA 1L0NK 1GC7A 2VSZA 2YT1A 1X1GA 2YF0A 2DA0A 1SQQK 4DX90 2COFA 4P7IA 2E2XA 1L0LK 2M14A 4HAYB 2Z0PA 1SHCA 2ADZA 3PVWA 2H7DA 5JP4A 1EF1A 5D3WA 5LONB 3O96A 2P8VA 5LOPB 1FHOA 2CY4A 2D9XA 2OTXA 5GOWB 2EMSA 1BTKA 3PVLA 1M7EA 1PMSA 2N23A 2N0YA 4DX8A 1H10A 4HDQA 5L81A 5CLQB 1U2BA 5D3VA 1NTKK 2GCJA 2YS3A 3X23A 1V61A 1WVHA 1TJ6A 4EJNA 1KI1B 2XQNM 2J0JA 4HAZB 1WG7A 1LB1A 2DHKA 2DFKA 1E5WA 4IAPA 1B55A 3D8DA 3G3ZA 1NTMK 4ZRIA 1V5UA 2L1CA 2OQBA 3TVVA 2PZ1A 3G9WA 1Y19B 5J3TA 2YVCA 2MDXA 1U27A 3GYPA 2CY5A 4GN1A 1NTYA 1LW3A 5D3YA 1UPQA 4GMVA 5HE1A 1U5FA 1UNQA 2MWNB 1NTZK 3DXEA 2KCJA 2P0HA 1ZVRA 5C5BB 2EMTA 3TCAA 5HE3A 2D10A 3KRXA 1FOEA 2HTHB 1DDWA 1XX0A 3FSSA 2D4QA 4WSFA 3KRWA 2O01H 5JHHA 2L2IA 2WSEH 2LOXA 3PEGA 3VOQA 1MAIA 1OY2A 5DH9B 3HW2B 3FEHA 2I5FA 2K00A 5DI9B 1V88A 1UNPA 3KSYA 2W2XC 1X05A 1ZC4B 1KZ7A 1BAKA 1V5PA 4XWXA 1DYNA 2AEHA 1WI1A 2X18A 5J3QA 1M7RA 5J3YA 1XKEA 2Z0OA 4HAWB 3KY9A 4TKNA 5EFXA 5JHGA 1WJ1A 3AJ4A 3A98B 1ZM0A 2DTCA 4D0NB 1EVHA 1PLSA 1BWNA 2G35A 3RCPA 2Y8FA 1AQCA 2YS1A 1EGXA 1RJ2A 1TQZA 1FHWA 2H7EA 3FM8C 4IFSA 2EC1A 2DLWA 2LKMA 1WGQA 2LULA 4C0AA 4BBKA 4K2PA 5D3XA 3V5WA 2CAYA 3SNHA 2D9YA 1XD4A 3KZ1A 2P0FA 2IFSA 4KVGB 2RGNB 2WSCH 4K81A 1GG3A 3U8ZA 1H4RA 3F5RA 1NU2A 2GJYA 2W2WA 3TO1A 2I1JA 1QQGA 2YSZA 1RRPB 4HB3B 3DXCA 2J0MA 2KUPA 2JP2A 1MKEA 1V89A 2QKMA 3UZTA 4MY6A 4A6FA 1FGZA 1WJMA 2DN6A 3WA0A 2WSFH 2LYDA 1SQBK 2GS0A 3HK0A 4WVFB 4GXBA 2DKQA 3D8EA 1W1DA 4HB4B 2NMBA 3U7DA 1EAZA 2GCLA 2DYNA 1MK9B 1Z87A 2I1KA 4A6HA 3CLQA 2I5CA 2Z0QA 2VKIA 2OARA 4GZUA 2D9ZA 1GC6A 2Y7BA 1I2HA 5FI1A 3N7CA 3M1IB 1MIXA 3CXBB 3BJIA 1NTVA 2KGXB 1PFJA 2DX5A 3ODOA 2DHJA 1ZC3B 4Z2MB 1WGUA 1W1HA 3QWMA 4B6HA 2RNRB 4NY0A 2Q13A 3PZDA 3ULBA 1DROA 1QC6A 4GMXB 1X86A 2BCJA 2V76A 2YRYA 3PSCA 5DHFB 1KZGA 2D9VA 1K5DB 1IRSA 3OANA 4WJ7A 3PVUA 2MFQA 4IOYX 2FJLA 1DBHA 3MDBC 4MK0A 1UNRA 5KCVA 2YS5A 3HQCA 4HAUB 3TFMA 4A6FB 5HE0A 1DDMA 5KLVK 3SUZA 3TW1A 5DIFB 2ROVA 4DBBA 1FB8A 5JLJB 2ELBA 4F7GA 3CIKA 1AWEA 3PG7A 1K5GB 5C6RA 2NZ8B 5D27A 3IVFA 4ZRJA 4K2OA 1U5DA 1ZSQA 4GPTB
chains in the Genus database with same CATH superfamily
1PFIA 3A8QA 3LJUX 1LT9A 1HUCA 4KHBB 4MN4C 1NHLA 1DEBA 2B87B 3HE5A 3RL0g 1Q82Q 2IBZE 2K37A 2L5GB 2UVMA 4HB0B 3A8PA 2CPBA 3CX5I 2IDBA 3L37A 2E76B 4C7NA 3OW2O 2AEJA 1VQKP 2DX1A 2RLOA 2KSEA 2WSEJ 3ABVC 3SO6A 3V4WA 3EFGA 3FWLA 1XR0B 3CCUP 1W2EA 2P58A 4HYTB 1IK9A 3H1JG 2D2QA 4K17A 3AE5C 3MPXA 5AVZB 1T8ZA 3CC4P 4PNKA 2CK3H 2DKPA 1X1FA 1MIZB 4PQ0A 3VMXA 2HE7A 1J2JB 1LWUB 3TSIA 4XE5B 1OVRA 1BSNA 2GA1A 2Z14A 1MKMA 1PP9E 1P6SA 3LIDA 1J0WA 1VF5D 1U7MA 4U3FG 1YJNP 1MPHA 3H6PA 3G6EP 2AL6A 1SQQE 1JO5A 2XU6A 4EDFA 1NU1K 2COAA 1J1DB 5KAIE 5APVA 1DDVA 1I7AA 2ROZB 4HDOA 4GIFA 3WYFB 5BU5A 2W6JH 3HD7D 3CC7P 2QE7H 2N1TA 4D6TG 1Q67A 3CWBJ 4PD4E 3IFMA 1LTGC 4EI2A 2FYUK 1NI2A 2IYBA 3GF3A 3BATA 4JQ0D 1X11A 1QLED 4ZMDA 1KC8Q 3P6AA 3CX5H 5B66E 3ODWA 3QH9A 2WMMA 1WRGA 3TK1A 4TLFA 3MD0A 2DW3A 1X1GA 2Z5HA 2YF0A 4HJGH 1OVVA 4Z1MH 2M14A 2Z0PA 3GHGA 4RJTA 3PVWA 4IFMA 1JMBA 3P8CD 2NPSD 3O8ZA 1EF1A 5D3WA 2HLOA 1FHOA 5BU8B 2D9XA 5GOWB 1KB9I 1OW8A 2M3BA 1T2KD 4QMAA 3WUTA 4HDQA 1HWTC 5D3VA 2V7QH 3X23A 5KKZC 1TJ6A 1M90Q 1ZP0C 4R4LA 3Q3DA 2V4HA 2XQNM 3AEEC 2YO2A 4AUWA 2J0JA 3II6A 1WG7A 1GL2A 3VN0A 1E5WA 1NTKJ 1FZCC 2QSIA 1ZV8A 2OQBA 3TVVA 3CD6P 1DIPA 5KLIB 3G9WA 5J3TA 2YVCA 1D7MA 3LIEA 2MDXA 4M3LA 4YXWH 2YKPA 3S9OA 1M1JC 2M8RA 1LJ2A 2P1JA 2NPSB 1U5FA 3M0DC 1NTZK 4IL6H 2P0HA 1RE4C 3L70E 1ZVRA 5C5BB 2KNCA 1VQOP 1SVFA 3TCAA 2KIGA 1FOEA 2D2CD 1KILD 1XX0A 2O1KA 5AVVB 1NAFA 3KRWA 3V2PA 1MAIA 1KFNA 3VMYA 5M4YB 4WBAA 2K00A 2H7HA 1UNPA 2QG4A 2YIUC 1JY3N 4IL6X 2W2XC 5C39A 2KIEA 5APUA 1KILE 4ASVA 2AEHA 3CX5D 3VYIA 3E7KA 4UB6H 2B88A 3A5TA 2A06D 1M7RA 2WPSA 3AE2C 3HTKB 1XKEA 1CI6A 3SWKA 1L4AC 3I56P 2OQQA 3CMEP 4TKNA 3SFEC 4I6MC 2M3EA 2FYUJ 3BASA 1KB9H 3D6ZA 1ZM0A 1EVHA 2DTCA 1PLSA 2G35A 2JWAA 3RCPA 2KUQA 1AQCA 4BRYA 3RK3E 1KILB 2G8YA 3CX5E 1DD3A 2H7EA 2BCCJ 3FM8C 4IFSA 3JC22 1AVYA 2UWJE 2EC1A 2DLWA 2KB7P 1LGHB 1K05A 1KQLA 1FDOA 2W8ZA 1YITP 3L71J 1M8OB 4ASWA 4L1RA 3V5WA 4HB1A 2P0FA 1JCDA 2WSCH 2O1JA 1IFNA 3TGUD 1EDKA 3RK3B 4I7ZC 3TO1A 2A06G 1EDIA 1QQGA 3DXCA 2KUPA 2IBZI 2QKMA 3Q5RA 4IFFA 4OSNA 1KQFB 2IPPA 1FGZA 1IC2A 2HPCB 2YKOA 2OTKE 3G9RA 2R2YA 3EFFK 2K1AA 2GS0A 3HK0A 2AXTE 2YXRB 4GXBA 3TGUE 1KYOI 5KLVD 3PRJA 1VL2A 1W1DA 2FYNC 1RF1C 4OGQC 2FFDA 3MTUE 1Z87A 3H1KJ 1JCCA 1NYHA 4HSIA 1GDTA 2Z4DA 2VKIA 4GZUA 2D9ZA 1GC6A 1NO4A 5CCHC 2Y0CA 2Q7CA 1JY2O 3NWFA 3TGUG 1WMKA 5KLVE 1GU4A 3HD7A 1JEKA 4IL6E 3KQGA 3L72D 1KZUB 1LT9C 2DHJA 1DD4A 1SQVD 3PHLA 3QWMA 2RNRB 2Q13A 3MUDA 2KLUA 4H13D 3ULBA 1DROA 4GMXB 1X86A 2BCJA 2YRYA 1SQBD 1KZGA 2KSJA 3L72E 1IRSA 1FZCA 1IFIA 1SQVE 1KB9D 2MFQA 4WY4D 2OYHB 2FXOA 3MDBC 4MK0A 4JBZA 4C7NB 4K3AA 4A6FB 3SUZA 3TW1A 2W83C 4UB6E 5DIFB 4PD4I 2ZYDA 2KOGA 2R44A 1RE4A 3CCQP 4QJ5B 1SQPE 2XNXA 3L75J 3IVFA 1KB9E 4GPTB 2K3RA 5M1BA 1N7SC 3RK2B 1SQXD 3IN6A 4DZOA 3NSUA 1T6AA 4TT3H 4A6KA 1KYOH 4HHVA 1YQ3C 1SQBG 4HAXB 1HH0A 1BE3E 1NTZE 5CJ0A 1LP1A 4Z2NA 3G4SP 4WY4B 2ZPYA 1SQXE 3Q5PA 1GW4A 3P7ZA 4CHJA 3FX0A 1OFCX 3M9QA 2Y9ZA 1SGHA 1J19A 2ZT9D 3OA7A 3BCCJ 1ZRTD 3NWAA 1L4AA 3GLMA 1K73Q 2UZSA 3H1HJ 4IFDK 2R5DA 3L4FA 1XTCC 2COCA 2PAJA 1MI1A 1UIIA 1R8EA 2PRRA 4LC1A 1S3JA 1ZYIA 5C16A 2YMYA 1YTZI 1FDIA 3L74D 3VIAA 2C0XA 4F7HA 3H1ID 1E79H 2CRFA 4TYZA 2HODB 1KQSO 2Q9IA 1OMWA 4H44C 1FZGA 5CJ4A 1PZQA 1L0LD 1MUUA 3B5ND 1UEFA 4L6EA 3HUSB 5AW3B 1UPRA 2Y8GA 4H8SA 3CCVP 4R4MA 4DXAB 3E1IA 3VP9A 2E74C 5TISH 1OVUA 3H1JJ 1L0NE 2OTJP 3KZIH 3D8FA 1P84I 3H1LD 2LG1A 1KD1Q 1GMJA 2XDJA 3KYQA 1ISNA 3AU4A 3FXDA 4PD4H 3VMZA 4DOJA 4ZRKA 2ZT9B 2M0BA 1XCGA 1RQUA 2EJ8A 1L0LE 3SV1A 3LW5H 1W1GA 1JY2P 4CYEA 1EZVI 5KQ1A 4PV1D 5E79H 2E75D 1Q7YQ 3CCMP 3R2PA 1U5EA 3L74G 5B66H 3H1IG 3T06A 2JDIH 5CHXA 4Y99B 3CXHI 1URQC 2H43A 2NRGA 1P5TA 5DHAB 1BCCD 3GF7A 1MK7B 1FZFA 1SLQA 4A5KA 4U3FJ 1T3JA 2HG5D 2R3CA 2IBZD 2WPVB 2JO1A 3CPWO 1RY3A 3ML4A 3ZDTA 1BGYD 1T77A 2RVBB 1J1EB 3FGAD 2CODA 4QJ4B 2R5BA 2YT1A 3V2QA 4H0LD 2QJYB 1NTME 1EDLA 2DA0A 3H1LG 1KYOD 2H8PD 4DX90 1X9VA 1BCCE 4Y28J 2E43A 3RL0B 3M9HA 5APSA 2ADZA 1SFCD 4D6TJ 2H7DA 5JP4A 1YTZT 1HJBA 3O96A 5KJ7D 2P8VA 1HTLC 5APXA 1BGYE 1HBWA 4DT0A 2OYIB 2OTXA 5GTHH 4PV1B 5KAFE 2E75B 1DX7A 2E76C 4OVNF 2O01J 3U12A 2QIWA 3B71A 1M7EA 2J58A 1KYOE 4DX8A 1NTKK 3PP5A 2RH0A 3TF5A 2P10A 3CI9A 1OW6A 1WVHA 2LR2A 1CZQA 2IBZG 3M06A 1KI1B 3F89A 1EQ7A 2BASA 4EOTA 1FDMA 1PP9D 1LB1A 1FU1A 4IAPA 3D8DA 1LTBC 3A0HH 1V5UA 2Q3EA 1P84H 4H0LB 1NWQA 3OHMB 1MFTA 4GN1A 1SQQD 3HE4B 1FE6A 4EYYQ 2M5AA 2JEEA 3AE4C 1SFCB 4RESB 1N7SA 2Q5UA 2K8EA 2MWNB 3DXEA 3NTNA 2AEMA 3L73D 1NKZB 3D6YA 3CXHH 1IFDA 2Z59A 1KFMA 1PIXA 4PD4D 2Q6QA 5HE3A 3K5BA 1S5LH 2POHA 2ZJSE 2QJKC 2D4QA 1USEA 3PEGA 3VOQA 5TISE 1PP9G 1H89A 1OY2A 5DH9B 3KZIE 4NPDA 3FEHA 1X0TA 3L73E 5AVRB 1JTHA 1S2EA 1L2PA 1KZ7A 1V5PA 1VQMP 1SQQG 1Q86Q 1QX8A 2A45I 1WI1A 4XFJA 1BDCA 2FXPA 3U1CA 5E79E 2Z0OA 4HAWB 1PGPA 1S5LX 1YJWP 2SPZA 4I2LC 2W6AA 3D70A 1WJ1A 1VF5C 2FFDC 1BWNA 1G1IA 3T97A 1H0TB 2Y8FA 4BXLA 4HH2A 1FHWA 3SSUA 1HF9A 3W67A 1ZXGA 1R5SA 2OTLP 5IRSA 2LXCB 1NH4A 3HD7C 2P67A 1M57D 2LULA 2IZ0A 2E5TA 3CCJP 2Z4EA 3AE3C 2YXQB 1RF0A 4OH8B 1X8YA 4JPZB 2CAYA 2IFSA 2RGNB 3PTZA 4K81A 1H4RA 2HR3A 2WT7A 3BVHA 2JP3A 2W2WA 1AQTA 2AXTH 3MUDC 5GTHE 2YSZA 1RRPB 4HB3B 5CCGD 1URQA 3GMAA 2O01N 1MKEA 3UIAA 1P84D 3L70D 1WJMA 2XV5A 4OWFA 5I2SA 3B5NA 3O6QA 3F5HA 2WSFH 3NMDA 1GD2E 2LYDA 1SQBK 5KKZB 1VQ5P 1OXZA 1ZN5A 3CWBE 2DKQA 3D8EA 1EZVD 2K9JB 1H8AA 2DYNA 1MK9B 1IO4A 1M7LA 4A6HA 3A0HE 3CXHD 4KHBA 1P84E 1HGZA 2B87A 2Y7BA 1Z56A 1T2KC 2KYVA 2QRXA 2WVRA 5AVSB 3M1IB 2A45H 1A02F 3BJIA 1M1JB 1EZVE 1LTJB 1PFJA 1SP4A 2QVAA 2KP8A 1ZC3B 3R4YA 1W1HA 3CXHE 1AVOA 3L70G 4XA4A 3CCSP 4NY0A 3I5CA 1S5LE 3H32B 3CCLP 1YBKA 1VQ7P 1S1CX 3RK3D 1KN7A 3AE8C 2KXPB 2Q3IA 2FBWC 1LWUA 3TGUJ 1N86A 2YKQA 4B86A 2FJLA 2YS5A 1QVFO 5B5EH 1N73B 5HE0A 4GOUA 1NTKE 2B89A 5KJ7A 2ROVA 4DBBA 5AW1B 2D2CC 3AECC 1KILC 5JLJB 1N8RQ 1LTSC 4KHXA 3CIKA 3V6IA 1KMIZ 1U5DA 2P2UA 2PGDA 2YMKA 3NXSA 2RN0A 1YI2P 1JY3O 2ITAA 4DIXA 4N6JA 3P32A 2QKLA 1NKNA 3ULCA 1FZEA 5AW6B 2D11A 2FJUB 4YONA 3PP2A 1NU1D 1FHXA 3QIJA 1MFZA 4CHMA 1G2CB 1IZNB 3GG2A 2KS1B 2VRWB 2Z13A 2XZRA 2RKLA 1IK7A 2FYUD 1FAVA 1LTIC 3JCUE 3AU5A 4I7ZB 2L91A 1NU1E 1VQ9P 3SFDC 2ZYAA 4Y94A 1SQBJ 1PGQA 4KHAA 4HAVB 4KJMA 1FC2C 4KT0J 3DXDA 3MHVA 2WZ7A 1FOSF 2FYUE 2FYNB 5APQA 1IFJA 1RF1B 1U29A 3U1AA 1JMMA 2D9WA 3SYXA 4EKUA 3TNUB 1ZLLA 3MZWB 2DYQA 2ZVOB 1OW7A 3GW6A 1MZ9A 2BCCE 3AEBC 2UZRA 2JR8A 2WQYC 3RK2D 2E5YA 2W27A 4N3YB 2K9YA 2M38A 3GYOA 1G1JA 3L71E 2K2UA 4YXDC 1R5LA 5KLVG 5APTA 1LT9B 3C8VA 3AE9C 1SQXJ 5AVWB 1NOHA 2Q1KA 1SQPD 3CC2P 3HE5B 3B8EB 4L76A 1BTNA 1RE3A 2OYHC 3MGNA 2H89C 3H1KD 2A45G 1NVOA 4HB2B 2NPSA 3ITKA 5C5BA 2J59M 4CSQA 1QL1A 3L72G 1BE3D 3KDPB 1SQVG 1NTZD 1AA0A 1PPJD 5B5EE 3AEFC 5LG4B 5KAFH 3TDKA 3H1KE 2N1TD 1SQQK 3WUVA 4L75A 2E2XA 2Y0DA 4H13C 1FOSE 1T3UA 2FY8A 3P8MC 5CBOA 3L74J 3H1IJ 1SQPG 1S72P 2BEQD 2CY4A 3Q2YA 2EMSA 3AE1C 1NGMB 1EC5A 1PPJE 3FXEA 3PVLA 1PMSA 4WY4C 1VQLP 2N23A 2N0YA 1H10A 5L81A 1U2BA 1VQNP 3HTKA 1DEEG 1VQ4P 1JY3P 4EJNA 2OYOA 4ZNCA 3H1LJ 1W5CE 4C7RA 2IYPA 1BE3G 1GU5A 2DFKA 1NTZG 1S9KE 3N7NA 1B55A 3B77A 1PGOA 1KILA 1SQXG 1L0ND 2RMZA 3I55P 3L75D 1Y19B 2N1TB 3GYPA 5D3YA 1UPQA 3EQ2A 4GMVA 2IFNA 2KZJA 3L36A 1N7LA 4OT1A 2RRFA 1K9MQ 2KIKA 4AYCA 2R32A 1GL2D 1ZMEC 3PH0A 1W2BO 3L75E 1AJYA 4H44B 3KRXA 2WTYA 2W6BA 3RL0D 1BGYJ 1FZBA 3W68A 2ZT9C 1PL5A 1RF0C 2O01H 3KPEA 1M1KQ 2HPCA 2WSEH 2ZFCA 3GHGB 3BCCD 2Y9YA 3CL3D 5DI9B 1L0NG 1X05A 1ZC4B 1NTMD 4XWXA 1GW3A 4NPEA 1L0LG 4UB8H 4JF7A 3B5NC 1MV8A 2N9BA 5J3YA 3BCCE 3KY9A 5I2MA 5EFXA 5JHGA 3USSA 1QL2A 2QJPC 2KK7A 3A98B 4D0NB 5AW2B 1GL2B 5BVZA 1RJ2A 2NZ2A 3V2NA 1QEXA 1PP9J 1TQZA 3NWDA 4QXAB 2O3JA 5DJTB 3A0BE 2QM8A 1PGJA 1SS1A 4PV1C 1SQQJ 2E75C 1WGQA 1Q90D 4C0AA 4BBKA 3VOPA 4K2PA 2KLVA 1NTMG 3SNHA 3EWKA 4GODA 2KNCB 1XD4A 1KV4A 1BCCG 3H1JE 3L73J 4W80A 1NU2A 1JNMA 2OYHA 1M56D 1V89A 1BGYG 4PJ0H 3LW5J 4U3FD 3UZTA 4MY6A 4A6FA 2FYZA 2GUSA 1KORA 3MP7B 4L74A 2P7JA 1YQ4C 2WSSH 4H0LC 1NJIQ 3SWFA 5DJUB 2MKVA 1LWUC 3A3YB 1VQ8P 3KXDA 4WVFB 1GK4A 4HB4B 3U7DA 1SFCC 3BRVB 1USDA 1PV3A 2IZ1A 2QEXP 2I1KA 1JUNA 1ZR2A 5KJ7C 2ZAEB 1X22A 2IFMA 4U3FE 4D6TD 2I5CA 1K04A 3CCEP 2Z0QA 1CI6B 1AQ5A 4GKGA 1FJPA 1I2HA 1RHZB 3L35A 1GZLA 3N7CA 3FVCA 3CXBB 3Q5SA 1NTVA 4BRYB 3ODOA 2C9LY 1J1DC 4WY4A 4Z2MB 5AVUB 1WGUA 5L8RJ 3NFQA 4D6TE 4DJGA 4B6HA 3E1RA 2J5UA 3AE7C 1Y8AA 1LNQA 4CPGA 2QJKB 2E42A 3PSCA 2Z5IA 5DHFB 1K5DB 2K49A 2HYNA 2R3SA 3V4QA 2HODA 3PVUA 2ZYGA 2IYOA 1UIXA 3L73G 5KCVA 2ZVNB 3HUSA 4HAUB 2FXMA 1DDMA 5KLVK 4UB8E 4W7ZA 1YYCA 2OGUA 4GT1A 3L70J 2ELBA 2Y0EA 1AWEA 3PG7A 1K5GB 2NZ8B 5D27A 4ZRJA 1VF5B 1ZSQA 2FFDB 1KQGB 2RUKB 3RBXA 3V2RA 3M91A 3NW8A 2LXBA 4I1LA 3CWBD 3A58A 4HKZH 2J0KA 1SQVK 3JCUH 3ODXA 5AW4B 5HE2A 4W7YA 3HD7B 3AE6C 2GM4A 4ZKPA 1V5MA 4C46A 2GUVA 2ELAA 3U59A 5FI0A 5KLIC 4KHOA 1IJDB 4EMOA 2AXCA 4KAXB 1RE3C 1SQPK 2YNYA 4L73A 2LKOA 3P8CE 1YIJP 1LTAC 2JKVA 4HATB 4A7PA 1OZHA 4F7UP 1VPCA 3A2AA 4PJ0E 2RSGA 2NPSC 3MIWA 1U5GA 3S4RA 5C79A 3BINA 1Y9BA 5AVTB 4MT7A 1N3HA 1FZCB 2W2XD 3B4SA 3QWOC 1N2DC 3PLNA 3OAKA 1OWAA 1TXDA 2OYIA 3CWBG 1LTJC 2MKRA 3ZVRA 1L4AD 1ZW0A 2JJLA 1FJKA 3F0WA 1GK6A 5CCGC 4O9BA 2FKWB 1SQXK 2GUMA 1A02J 1FAOA 1XODA 3QBVB 3SWYA 2K2JA 1FGYA 2QA4P 2P0DA 1NTKD 2KZIA 1RH5B 1EZVG 1OMIA 2YT0A 5KQ4A 3V5BA 2DHIA 2V7QJ 4D6WA 3D71A 3AEAC 4QJ3B 4GNKB 1RQVA 1P3RA 2LOZA 2ZXXA 5CLLB 3HE4A 2WITA 2YIUB 1OQNA 2AEFA 5CBNA 1LP1B 1NU1J 1SFCA 3RGUA 1N73C 2K88A 3DCXA 4NSWA 1Q81Q 1HJ0A 2WPQA 2R0DA 5AW7B 2WSFJ 3CMAP 1L4AB 3VTPC 1JM0A 1Y5OA 1U57A 2R09A 4YL8A 2CPSA 1L0NK 1GC7A 3ZDMA 2VSZA 5KLVJ 4BWNA 3TYYA 2COFA 4ZKUA 4P7IA 1L0LK 2D2CB 4HAYB 1NTKG 1SHCA 4OGQD 3WUUA 2A06E 1CW5A 4JYCA 3RK3C 5LONB 2C0WA 4WVZA 5LOPB 5H2FH 2KUBA 3BRTB 4K35A 1BTKA 1EDJA 5CCHD 5APWA 3C1LA 3L72J 5CLQB 2BEZF 2GCJA 2YS3A 1JY2N 2G3AA 1SQVJ 5AW0B 1V61A 4LGDE 4HAZB 4GOFA 3C9IA 1H0TA 2DHKA 5CMZA 2VRSA 3G3ZA 1BDDA 1NTMK 2BCCD 2W90A 4ZRIA 2L1CA 2PZ1A 3VMAA 1SQPJ 1U27A 2CY5A 3OJAB 2HFED 4LLHA 1NTYA 3L71D 1LW3A 4OGQB 1VQ6P 5HE1A 1UNQA 1FZAA 1NU1G 2KCJA 3HIEA 2NBVA 4EIJA 3S1KA 4U7JA 2EMTA 2I8DA 1AV1A 2D10A 2HTHB 1Y47A 1OX3A 1BE3J 1DDWA 1NTZJ 3FSSA 2FYUG 5EFWB 5AVYB 3WU2H 3FWNA 2IX7C 4WSFA 3G71P 5JHHA 2L2IA 2LOXA 1VDFA 2WSCJ 1FS0E 1N7SD 5GTIH 1LT1A 3HW2B 4GOEA 2I5FA 2BCCG 3H25A 1V88A 4YPCA 1BSHA 3KSYA 1HVVA 2K9JA 1BAKA 1DYNA 3L71G 3VP8A 4RKUJ 2X18A 1YJ9P 5AVQB 2XNDH 5J3QA 1U7JA 5APYA 2YT2A 1FBMA 3A0BH 3AJ4A 1S4XA 3RBZA 3Q1MA 1M1JA 1ZR4A 1LTJA 3RK2C 1GTWA 2YS1A 1EGXA 3M0DA 1H88A 4WB4A 3JSVC 1SQBE 5CCGA 3AEDC 1L0NJ 2LKMA 2M5AB 1XTGB 3H32A 2N9YB 1S9KD 1N7SB 5K5GB 1L0LJ 3AEGC 5D3XA 4H44D 3HSAA 3H1KG 4GDOA 4H13B 2D9YA 3KZ1A 4KVGB 3HRNA 1GG3A 3U8ZA 3PJSK 1Q2NA 1K8AQ 3F5RA 2GJYA 5H2FE 2I1JA 2J0MA 2E74D 1ZOYC 2JP2A 1AFOA 3IAOA 1N73A 4WWIA 1QVGO 2JWDA 2DN6A 1PPJG 3CCRP 5AW5B 4JYBA 3KHUA 3WA0A 2N1TC 1YHQP 1IFPA 1JTHB 1IFMA 5AW8B 2NMBA 1EAZA 2GCLA 3M9BA 2MJZA 3HUSC 2ZKMX 3IF4A 1NTMJ 3P7KA 3CLQA 4RO0A 4DCKA 1BCCJ 3WMM0 5KTBA 1URQD 2OARA 1ZRTE 2C9NY 2WPRA 5FI1A 1LTTC 1MIXA 2KGXB 3T97B 5AW9B 2DX5A 1KTMA 5AVXB 5TJHA 1G2CA 1WT6A 2PFXA 5KAIH 3GHGC 4N78D 2E74B 3IR9A 2KS1A 3L74E 4NPFX 3H1IE 2XKMA 1QGKB 3H1HD 1JB0J 3PZDA 4Y99C 3L75G 1DH3A 1JOCA 1CSBA 2YO3A 1QC6A 3WU2E 4YTPC 2V76A 1X79B 2D9VA 3OANA 4WJ7A 5GTIE 1VQPP 4N78E 2E76D 3N4XA 2WT7B 1HGVA 4IOYX 3H1HE 1J1EC 4AQRD 1DBHA 1URQB 1UNRA 3A7OA 3H1LE 2ZXEB 1RF1A 2KI7B 1GL2C 3HQCA 3TFMA 2QJYC 1TU3F 3TNUA 1EXIA 3RL0C 1FB8A 3H1JD 3B5NB 3O6QB 1NAYA 2PP6A 4IOIH 3M0AA 2WWWA 4F7GA 2QM7A 1OIPA 2B9BA 5C6RA 5CCHA 2QJPB 3BCCG 4K2OA 1EXJA 2OYIC 2H88C 3H1HG 2KR0A
chains in the Genus database with same CATH topology
3RK2B 2RUKB 1PFIA 1JY3O 3A8QA 4DZOA 3LJUX 3NSUA 1LT9A 4N6JA 1HUCA 3V2RA 4KHBB 3M91A 3P32A 4A6KA 2QKLA 4I1LA 1NKNA 4HHVA 1NHLA 3ULCA 1DEBA 1FZEA 3HE5A 5AW6B 2D11A 4HAXB 1HH0A 2L5GB 4YONA 2J0KA 2UVMA 1SQVK 3PP2A 4HB0B 3A8PA 2CPBA 3ODXA 5AW4B 3L37A 1FHXA 3QIJA 5HE2A 4W7YA 1MFZA 3HD7B 5CJ0A 4Z2NA 4C7NA 4CHMA 2DX1A 2GM4A 2RLOA 4ZKPA 4WY4B 1V5MA 2ZPYA 3SO6A 1G2CB 1GW4A 3P7ZA 4CHJA 3V4WA 3M9QA 3EFGA 2GUVA 4C46A 1SGHA 1J19A 2ELAA 2XZRA 3U59A 2VRWB 5FI0A 1XR0B 1W2EA 3OA7A 4HYTB 4KHOA 1L4AA 1IJDB 1FAVA 4EMOA 2UZSA 1IK9A 1LTIC 1RE3C 3AU5A 1SQPK 2YNYA 2LKOA 4KAXB 2D2QA 3P8CE 4IFDK 1LTAC 4HATB 4K17A 4F7UP 1VPCA 2R5DA 3A2AA 3L4FA 3MPXA 1XTCC 5AVZB 2COCA 2RSGA 1T8ZA 4PNKA 2NPSC 2PAJA 3MIWA 1U5GA 2DKPA 4LC1A 5C79A 3BINA 1X1FA 4Y94A 5AVTB 4MT7A 5C16A 1N3HA 2YMYA 1YTZI 1MIZB 4PQ0A 3VIAA 2C0XA 1FZCB 4F7HA 3VMXA 2W2XD 2HE7A 2CRFA 4KHAA 4HAVB 2HODB 1J2JB 4TYZA 1LWUB 1N2DC 3DXDA 2Q9IA 2WZ7A 3OAKA 3TSIA 1OMWA 1FOSF 1FZGA 5CJ4A 1OWAA 5APQA 1IFJA 1MUUA 3B5ND 1RF1B 2OYIA 3U1AA 1JMMA 1TXDA 1U29A 1UEFA 2D9WA 4L6EA 1LTJC 3HUSB 4XE5B 5AW3B 1UPRA 2MKRA 1L4AD 3TNUB 2Y8GA 3ZVRA 4EKUA 4H8SA 1ZLLA 2DYQA 2JJLA 1P6SA 3LIDA 1J0WA 1FJKA 4DXAB 3E1IA 3VP9A 3F0WA 1GK6A 5CCGC 4O9BA 2FKWB 1SQXK 1MZ9A 1A02J 1FAOA 1XODA 1MPHA 2UZRA 3RK2D 3QBVB 3SWYA 2W27A 2K2JA 4N3YB 2M38A 3D8FA 3H6PA 2AL6A 2LG1A 1FGYA 2XDJA 3KYQA 1ISNA 3AU4A 3GYOA 1G1JA 3VMZA 4DOJA 1JO5A 4ZRKA 2EJ8A 2XU6A 1XCGA 2K2UA 2P0DA 3SYXA 3SV1A 5APTA 1NU1K 2COAA 2YT0A 1LT9B 3LW5H 1J1DB 5AVWB 1NOHA 5KQ4A 3V5BA 1W1GA 5APVA 2DHIA 1JY2P 4CYEA 1DDVA 1I7AA 2ROZB 4HDOA 4GIFA 3WYFB 5KQ1A 5BU5A 3HE5B 3HD7D 3R2PA 2N1TA 1U5EA 3B8EB 1BTNA 1RE3A 1P3RA 1Q67A 2LOZA 3T06A 2OYHC 3MGNA 3HE4A 5CLLB 2WITA 5CHXA 4Y99B 1OQNA 1URQC 3IFMA 2H43A 1LTGC 2A45G 1SFCA 4HB2B 2FYUK 1N73C 1P5TA 1NI2A 5DHAB 2IYBA 1MK7B 4NSWA 2NPSA 2WPQA 1FZFA 3BATA 2R0DA 1SLQA 5AW7B 1X11A 4A5KA 1T3JA 2HG5D 2R3CA 5C5BA 2J59M 3P6AA 1QL1A 1L4AB 3VTPC 1Y5OA 1RY3A 3ML4A 3ODWA 3ZDTA 1WRGA 3KDPB 2R09A 2RVBB 4YL8A 1J1EB 2CPSA 2CODA 3TK1A 1L0NK 1GC7A 2R5BA 2VSZA 2YT1A 3V2QA 3MD0A 1X1GA 2Z5HA 2N1TD 3TYYA 2DA0A 1SQQK 2YF0A 2H8PD 4DX90 2COFA 4ZKUA 4P7IA 1X9VA 2E2XA 1L0LK 2E43A 3RL0B 3M9HA 5APSA 1FOSE 2M14A 1T3UA 3GHGA 1SHCA 3P8MC 2ADZA 2Z0PA 3PVWA 1SFCD 2H7DA 4IFMA 5JP4A 1CW5A 3P8CD 2NPSD 3O8ZA 1EF1A 1YTZT 4JYCA 1HJBA 3RK3C 5D3WA 3O96A 5KJ7D 5LONB 2C0WA 2P8VA 2HLOA 5LOPB 1FHOA 1HTLC 5APXA 5BU8B 2CY4A 1HBWA 2D9XA 2OYIB 2OTXA 3BRTB 5GOWB 2EMSA 1BTKA 1DX7A 5CCHD 1M7EA 1PMSA 2M3BA 4WY4C 3PVLA 5APWA 2N23A 1T2KD 2J58A 2N0YA 4DX8A 1H10A 4HDQA 1HWTC 5L81A 5CLQB 1U2BA 5D3VA 1NTKK 3PP5A 2GCJA 3HTKA 2YS3A 1JY2N 5AW0B 3X23A 3CI9A 1V61A 1WVHA 1TJ6A 1CZQA 1JY3P 4EJNA 3M06A 4LGDE 1KI1B 2XQNM 1EQ7A 2BASA 2YO2A 4EOTA 4AUWA 1FDMA 2J0JA 3II6A 4C7RA 4HAZB 1WG7A 1GL2A 1GU5A 3C9IA 1LB1A 1FU1A 3VN0A 2DHKA 2DFKA 1S9KE 1E5WA 4IAPA 3N7NA 1B55A 5CMZA 2VRSA 1LTBC 3G3ZA 3D8DA 1NTMK 1FZCC 4ZRIA 1V5UA 2L1CA 1KILA 1ZV8A 2OQBA 3TVVA 2PZ1A 3G9WA 1Y19B 5J3TA 2YVCA 3LIEA 2MDXA 1NWQA 2N1TB 1U27A 4M3LA 3GYPA 2CY5A 3OJAB 4GN1A 3HE4B 2HFED 4LLHA 2JEEA 2YKPA 1NTYA 1LW3A 5D3YA 1UPQA 3EQ2A 1M1JC 1SFCB 4RESB 1N7SA 2M8RA 2IFNA 4GMVA 5HE1A 2Q5UA 2P1JA 2NPSB 3L36A 1U5FA 1FZAA 1UNQA 1N7LA 3M0DC 2MWNB 1NTZK 3DXEA 2KCJA 3NTNA 2P0HA 1RE4C 1ZVRA 5C5BB 4EIJA 4AYCA 2R32A 1GL2D 1NKZB 2EMTA 1IFDA 1SVFA 3TCAA 1KFMA 5HE3A 2D10A 3KRXA 2WTYA 1FOEA 2HTHB 2W6BA 3RL0D 1FZBA 1KILD 1DDWA 2POHA 1XX0A 4HAYB 3FSSA 2O1KA 5AVYB 5AVVB 1NAFA 1RF0C 2IX7C 2D4QA 3V2PA 3KRWA 2O01H 4WSFA 3KPEA 5JHHA 2HPCA 2L2IA 2WSEH 2ZFCA 2LOXA 3PEGA 3GHGB 3VOQA 1VDFA 1MAIA 1H89A 1N7SD 1OY2A 5DH9B 1KFNA 3HW2B 3FEHA 3VMYA 4WBAA 2I5FA 3CL3D 5AVRB 2K00A 5DI9B 1JTHA 2H7HA 1V88A 1UNPA 3KSYA 1JY3N 1HVVA 1X05A 1ZC4B 2W2XC 1KZ7A 1BAKA 1V5PA 4XWXA 5APUA 1DYNA 2AEHA 1GW3A 2A45I 1WI1A 3VP8A 3VYIA 4JF7A 2X18A 5AVQB 3U1CA 5J3QA 3A5TA 3B5NC 1MV8A 1M7RA 2WPSA 2N9BA 5J3YA 3HTKB 1XKEA 1CI6A 5APYA 2Z0OA 4HAWB 1L4AC 3KY9A 4TKNA 5EFXA 5JHGA 1FBMA 4I2LC 1QL2A 2W6AA 4I6MC 1WJ1A 3AJ4A 3BASA 3A98B 1ZM0A 2DTCA 4D0NB 1EVHA 5AW2B 2FFDC 1PLSA 1BWNA 2G35A 1G1IA 1M1JA 1GL2B 3T97A 3RCPA 1ZR4A 1LTJA 3RK2C 2Y8FA 1AQCA 1GTWA 5BVZA 2YS1A 1RJ2A 1EGXA 4HH2A 3V2NA 3M0DA 1H88A 4WB4A 1FHWA 1TQZA 1KILB 5CCGA 2H7EA 3FM8C 4IFSA 2QM8A 2EC1A 2DLWA 2LKMA 2KB7P 1XTGB 3H32A 1LGHB 1NH4A 1KQLA 1N7SB 3HD7C 2P67A 1S9KD 1WGQA 2LULA 4C0AA 2Z4EA 4BBKA 3VOPA 1RF0A 4OH8B 2KLVA 1X8YA 4K2PA 5D3XA 3V5WA 2CAYA 3SNHA 2D9YA 1XD4A 3KZ1A 2P0FA 2IFSA 3HRNA 4KVGB 1JCDA 2WSCH 2RGNB 4K81A 2O1JA 1IFNA 1GG3A 3U8ZA 1H4RA 2WT7A 3F5RA 3BVHA 4W80A 3RK3B 1NU2A 2GJYA 2W2WA 1JNMA 3TO1A 2I1JA 1QQGA 2OYHA 1RRPB 2YSZA 2J0MA 3DXCA 4HB3B 2KUPA 5CCGD 1URQA 2JP2A 1MKEA 1V89A 2QKMA 3UIAA 1AFOA 1N73A 4IFFA 3UZTA 4MY6A 2IPPA 4A6FA 1FGZA 1IC2A 1WJMA 2HPCB 2YKOA 2XV5A 2DN6A 2FYZA 2GUSA 4JYBA 5AW5B 2P7JA 3B5NA 3SWFA 3WA0A 1LWUC 2WSFH 3A3YB 3NMDA 1GD2E 2LYDA 2N1TC 1SQBK 2GS0A 3HK0A 4WVFB 4GXBA 1OXZA 1ZN5A 1JTHB 1IFMA 2DKQA 3D8EA 1W1DA 1GK4A 5AW8B 4HB4B 2NMBA 3U7DA 1RF1C 1EAZA 1H8AA 2GCLA 1SFCC 2FFDA 3M9BA 2MJZA 2DYNA 3BRVB 3HUSC 3MTUE 1MK9B 1Z87A 1IO4A 1JCCA 1M7LA 2I1KA 3P7KA 4A6HA 1JUNA 5KJ7C 3CLQA 1ZR2A 3WMM0 2IFMA 1GDTA 2I5CA 5KTBA 2Z0QA 1URQD 2VKIA 2OARA 1CI6B 1AQ5A 4GKGA 4GZUA 1HGZA 1GC6A 2D9ZA 2Y7BA 1NO4A 1FJPA 1I2HA 5CCHC 2Q7CA 1Z56A 1T2KC 2C9NY 1JY2O 2KYVA 2WPRA 1GZLA 3L35A 5AVSB 3N7CA 5FI1A 1LTTC 2A45H 1MIXA 3M1IB 1A02F 3BJIA 3CXBB 1NTVA 2KGXB 1M1JB 1GU4A 5AW9B 1LTJB 3HD7A 1PFJA 2DX5A 1SP4A 3KQGA 2KP8A 5AVXB 3ODOA 1KZUB 1LT9C 1J1DC 2C9LY 2DHJA 1ZC3B 4WY4A 4Z2MB 1G2CA 1WT6A 5AVUB 3GHGC 1WGUA 4N78D 3IR9A 3NFQA 1W1HA 3QWMA 2XKMA 4B6HA 4XA4A 2RNRB 4NY0A 3I5CA 2Q13A 3PZDA 3H32B 4Y99C 3MUDA 1DH3A 3ULBA 1DROA 1JOCA 1CSBA 2YO3A 1QC6A 4GMXB 1X86A 2BCJA 2V76A 2E42A 2YRYA 3RK3D 1X79B 3PSCA 2Z5IA 5DHFB 1KZGA 2KSJA 1K5DB 2D9VA 1IRSA 3OANA 2Q3IA 1FZCA 4WJ7A 1IFIA 2HYNA 3V4QA 4N78E 2HODA 3N4XA 1LWUA 2WT7B 1HGVA 3PVUA 2MFQA 1N86A 2YKQA 4WY4D 4IOYX 1J1EC 2OYHB 4B86A 2FJLA 4AQRD 1DBHA 3MDBC 4MK0A 1URQB 1UNRA 5KCVA 3A7OA 1RF1A 2ZXEB 2YS5A 1GL2C 4C7NB 1N73B 3HQCA 3HUSA 4HAUB 3TFMA 2FXMA 3TNUA 4A6FB 5HE0A 1DDMA 5KLVK 3SUZA 3TW1A 5DIFB 4W7ZA 5KJ7A 2ROVA 4DBBA 1YYCA 2KOGA 5AW1B 3RL0C 1FB8A 1RE4A 1KILC 3B5NB 4GT1A 5JLJB 2PP6A 2ELBA 3M0AA 1LTSC 4KHXA 2WWWA 4F7GA 2QM7A 3CIKA 1AWEA 2XNXA 3PG7A 1K5GB 5C6RA 5CCHA 2NZ8B 3IVFA 5D27A 4ZRJA 4K2OA 1U5DA 2P2UA 1ZSQA 2OYIC 4GPTB 2FFDB 1N7SC 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUK B;  3A8Q A;  3LJU X;  3NSU A;  4KHB B;  4A6K A;  2QKL A;  4HHV A;  3ULC A;  2D11 A;  4HAX B;  4YON A;  2J0K A;  2UVM A;  1SQV K;  3PP2 A;  4HB0 B;  3A8P A;  3ODX A;  1FHX A;  3QIJ A;  5HE2 A;  4Z2N A;  4CHM A;  2DX1 A;  2RLO A;  2ZPY A;  1V5M A;  3SO6 A;  3P7Z A;  4CHJ A;  3M9Q A;  1SGH A;  2ELA A;  2VRW B;  1J19 A;  5FI0 A;  1XR0 B;  4KHO A;  4EMO A;  2UZS A;  4KAX B;  3AU5 A;  1SQP K;  2LKO A;  2D2Q A;  4HAT B;  4IFD K;  4K17 A;  4F7U P;  3MPX A;  2COC A;  2RSG A;  4PNK A;  1U5G A;  2DKP A;  5C79 A;  3BIN A;  1X1F A;  4Y94 A;  4MT7 A;  5C16 A;  1N3H A;  4F7H A;  1MIZ B;  4PQ0 A;  3VIA A;  2W2X D;  2HE7 A;  2CRF A;  4KHA A;  4HAV B;  4TYZ A;  3DXD A;  1OMW A;  1TXD A;  1U29 A;  2D9W A;  3SYX A;  1UEF A;  4L6E A;  1UPR A;  2MKR A;  3ZVR A;  4EKU A;  2Y8G A;  4H8S A;  2DYQ A;  1P6S A;  1J0W A;  4DXA B;  3F0W A;  1SQX K;  1FAO A;  1XOD A;  1MPH A;  2UZR A;  3QBV B;  2K2J A;  2M38 A;  3D8F A;  2AL6 A;  2LG1 A;  1FGY A;  1ISN A;  3AU4 A;  3GYO A;  4ZRK A;  2EJ8 A;  1XCG A;  2P0D A;  2K2U A;  3SV1 A;  1NU1 K;  2COA A;  2YT0 A;  3LW5 H;  5KQ4 A;  1W1G A;  2DHI A;  4CYE A;  1DDV A;  1I7A A;  2ROZ B;  4HDO A;  3WYF B;  5KQ1 A;  1U5E A;  1BTN A;  1P3R A;  1Q67 A;  2LOZ A;  3T06 A;  5CLL B;  1OQN A;  4HB2 B;  2FYU K;  1P5T A;  1NI2 A;  5DHA B;  2IYB A;  1MK7 B;  4NSW A;  2R0D A;  1X11 A;  4A5K A;  5C5B A;  2J59 M;  3P6A A;  1Y5O A;  3ML4 A;  3ODW A;  3ZDT A;  2R09 A;  2RVB B;  4YL8 A;  2COD A;  1L0N K;  1GC7 A;  2VSZ A;  2YT1 A;  1X1G A;  2YF0 A;  2DA0 A;  1SQQ K;  4DX9 0;  2COF A;  4P7I A;  2E2X A;  1L0L K;  2M14 A;  4HAY B;  2Z0P A;  1SHC A;  2ADZ A;  3PVW A;  2H7D A;  5JP4 A;  1EF1 A;  5D3W A;  5LON B;  3O96 A;  2P8V A;  5LOP B;  1FHO A;  2CY4 A;  2D9X A;  2OTX A;  5GOW B;  2EMS A;  1BTK A;  3PVL A;  1M7E A;  1PMS A;  2N23 A;  2N0Y A;  4DX8 A;  1H10 A;  4HDQ A;  5L81 A;  5CLQ B;  1U2B A;  5D3V A;  1NTK K;  2GCJ A;  2YS3 A;  3X23 A;  1V61 A;  1WVH A;  1TJ6 A;  4EJN A;  1KI1 B;  2XQN M;  2J0J A;  4HAZ B;  1WG7 A;  1LB1 A;  2DHK A;  2DFK A;  1E5W A;  4IAP A;  1B55 A;  3D8D A;  3G3Z A;  1NTM K;  4ZRI A;  1V5U A;  2L1C A;  2OQB A;  3TVV A;  2PZ1 A;  3G9W A;  1Y19 B;  5J3T A;  2YVC A;  2MDX A;  1U27 A;  3GYP A;  2CY5 A;  4GN1 A;  1NTY A;  1LW3 A;  5D3Y A;  1UPQ A;  4GMV A;  5HE1 A;  1U5F A;  1UNQ A;  2MWN B;  1NTZ K;  3DXE A;  2KCJ A;  2P0H A;  1ZVR A;  5C5B B;  2EMT A;  3TCA A;  5HE3 A;  2D10 A;  3KRX A;  1FOE A;  2HTH B;  1DDW A;  1XX0 A;  3FSS A;  2D4Q A;  4WSF A;  3KRW A;  2O01 H;  5JHH A;  2L2I A;  2WSE H;  2LOX A;  3PEG A;  3VOQ A;  1MAI A;  1OY2 A;  5DH9 B;  3HW2 B;  3FEH A;  2I5F A;  2K00 A;  5DI9 B;  1V88 A;  1UNP A;  3KSY A;  2W2X C;  1X05 A;  1ZC4 B;  1KZ7 A;  1BAK A;  1V5P A;  4XWX A;  1DYN A;  2AEH A;  1WI1 A;  2X18 A;  5J3Q A;  1M7R A;  5J3Y A;  1XKE A;  2Z0O A;  4HAW B;  3KY9 A;  4TKN A;  5EFX A;  5JHG A;  1WJ1 A;  3AJ4 A;  3A98 B;  1ZM0 A;  2DTC A;  4D0N B;  1EVH A;  1PLS A;  1BWN A;  2G35 A;  3RCP A;  2Y8F A;  1AQC A;  2YS1 A;  1EGX A;  1RJ2 A;  1TQZ A;  1FHW A;  2H7E A;  3FM8 C;  4IFS A;  2EC1 A;  2DLW A;  2LKM A;  1WGQ A;  2LUL A;  4C0A A;  4BBK A;  4K2P A;  5D3X A;  3V5W A;  2CAY A;  3SNH A;  2D9Y A;  1XD4 A;  3KZ1 A;  2P0F A;  2IFS A;  4KVG B;  2RGN B;  2WSC H;  4K81 A;  1GG3 A;  3U8Z A;  1H4R A;  3F5R A;  1NU2 A;  2GJY A;  2W2W A;  3TO1 A;  2I1J A;  1QQG A;  2YSZ A;  1RRP B;  4HB3 B;  3DXC A;  2J0M A;  2KUP A;  2JP2 A;  1MKE A;  1V89 A;  2QKM A;  3UZT A;  4MY6 A;  4A6F A;  1FGZ A;  1WJM A;  2DN6 A;  3WA0 A;  2WSF H;  2LYD A;  1SQB K;  2GS0 A;  3HK0 A;  4WVF B;  4GXB A;  2DKQ A;  3D8E A;  1W1D A;  4HB4 B;  2NMB A;  3U7D A;  1EAZ A;  2GCL A;  2DYN A;  1MK9 B;  1Z87 A;  2I1K A;  4A6H A;  3CLQ A;  2I5C A;  2Z0Q A;  2VKI A;  2OAR A;  4GZU A;  2D9Z A;  1GC6 A;  2Y7B A;  1I2H A;  5FI1 A;  3N7C A;  3M1I B;  1MIX A;  3CXB B;  3BJI A;  1NTV A;  2KGX B;  1PFJ A;  2DX5 A;  3ODO A;  2DHJ A;  1ZC3 B;  4Z2M B;  1WGU A;  1W1H A;  3QWM A;  4B6H A;  2RNR B;  4NY0 A;  2Q13 A;  3PZD A;  3ULB A;  1DRO A;  1QC6 A;  4GMX B;  1X86 A;  2BCJ A;  2V76 A;  2YRY A;  3PSC A;  5DHF B;  1KZG A;  2D9V A;  1K5D B;  1IRS A;  3OAN A;  4WJ7 A;  3PVU A;  2MFQ A;  4IOY X;  2FJL A;  1DBH A;  3MDB C;  4MK0 A;  1UNR A;  5KCV A;  2YS5 A;  3HQC A;  4HAU B;  3TFM A;  4A6F B;  5HE0 A;  1DDM A;  5KLV K;  3SUZ A;  3TW1 A;  5DIF B;  2ROV A;  4DBB A;  1FB8 A;  5JLJ B;  2ELB A;  4F7G A;  3CIK A;  1AWE A;  3PG7 A;  1K5G B;  5C6R A;  2NZ8 B;  5D27 A;  3IVF A;  4ZRJ A;  4K2O A;  1U5D A;  1ZSQ A;  4GPT B; 
#chains in the Genus database with same CATH topology
 1PFI A;  3A8Q A;  3LJU X;  1LT9 A;  1HUC A;  4KHB B;  4MN4 C;  1NHL A;  1DEB A;  2B87 B;  3HE5 A;  3RL0 g;  1Q82 Q;  2IBZ E;  2K37 A;  2L5G B;  2UVM A;  4HB0 B;  3A8P A;  2CPB A;  3CX5 I;  2IDB A;  3L37 A;  2E76 B;  4C7N A;  3OW2 O;  2AEJ A;  1VQK P;  2DX1 A;  2RLO A;  2KSE A;  2WSE J;  3ABV C;  3SO6 A;  3V4W A;  3EFG A;  3FWL A;  1XR0 B;  3CCU P;  1W2E A;  2P58 A;  4HYT B;  1IK9 A;  3H1J G;  2D2Q A;  4K17 A;  3AE5 C;  3MPX A;  5AVZ B;  1T8Z A;  3CC4 P;  4PNK A;  2CK3 H;  2DKP A;  1X1F A;  1MIZ B;  4PQ0 A;  3VMX A;  2HE7 A;  1J2J B;  1LWU B;  3TSI A;  4XE5 B;  1OVR A;  1BSN A;  2GA1 A;  2Z14 A;  1MKM A;  1PP9 E;  1P6S A;  3LID A;  1J0W A;  1VF5 D;  1U7M A;  4U3F G;  1YJN P;  1MPH A;  3H6P A;  3G6E P;  2AL6 A;  1SQQ E;  1JO5 A;  2XU6 A;  4EDF A;  1NU1 K;  2COA A;  1J1D B;  5KAI E;  5APV A;  1DDV A;  1I7A A;  2ROZ B;  4HDO A;  4GIF A;  3WYF B;  5BU5 A;  2W6J H;  3HD7 D;  3CC7 P;  2QE7 H;  2N1T A;  4D6T G;  1Q67 A;  3CWB J;  4PD4 E;  3IFM A;  1LTG C;  4EI2 A;  2FYU K;  1NI2 A;  2IYB A;  3GF3 A;  3BAT A;  4JQ0 D;  1X11 A;  1QLE D;  4ZMD A;  1KC8 Q;  3P6A A;  3CX5 H;  5B66 E;  3ODW A;  3QH9 A;  2WMM A;  1WRG A;  3TK1 A;  4TLF A;  3MD0 A;  2DW3 A;  1X1G A;  2Z5H A;  2YF0 A;  4HJG H;  1OVV A;  4Z1M H;  2M14 A;  2Z0P A;  3GHG A;  4RJT A;  3PVW A;  4IFM A;  1JMB A;  3P8C D;  2NPS D;  3O8Z A;  1EF1 A;  5D3W A;  2HLO A;  1FHO A;  5BU8 B;  2D9X A;  5GOW B;  1KB9 I;  1OW8 A;  2M3B A;  1T2K D;  4QMA A;  3WUT A;  4HDQ A;  1HWT C;  5D3V A;  2V7Q H;  3X23 A;  5KKZ C;  1TJ6 A;  1M90 Q;  1ZP0 C;  4R4L A;  3Q3D A;  2V4H A;  2XQN M;  3AEE C;  2YO2 A;  4AUW A;  2J0J A;  3II6 A;  1WG7 A;  1GL2 A;  3VN0 A;  1E5W A;  1NTK J;  1FZC C;  2QSI A;  1ZV8 A;  2OQB A;  3TVV A;  3CD6 P;  1DIP A;  5KLI B;  3G9W A;  5J3T A;  2YVC A;  1D7M A;  3LIE A;  2MDX A;  4M3L A;  4YXW H;  2YKP A;  3S9O A;  1M1J C;  2M8R A;  1LJ2 A;  2P1J A;  2NPS B;  1U5F A;  3M0D C;  1NTZ K;  4IL6 H;  2P0H A;  1RE4 C;  3L70 E;  1ZVR A;  5C5B B;  2KNC A;  1VQO P;  1SVF A;  3TCA A;  2KIG A;  1FOE A;  2D2C D;  1KIL D;  1XX0 A;  2O1K A;  5AVV B;  1NAF A;  3KRW A;  3V2P A;  1MAI A;  1KFN A;  3VMY A;  5M4Y B;  4WBA A;  2K00 A;  2H7H A;  1UNP A;  2QG4 A;  2YIU C;  1JY3 N;  4IL6 X;  2W2X C;  5C39 A;  2KIE A;  5APU A;  1KIL E;  4ASV A;  2AEH A;  3CX5 D;  3VYI A;  3E7K A;  4UB6 H;  2B88 A;  3A5T A;  2A06 D;  1M7R A;  2WPS A;  3AE2 C;  3HTK B;  1XKE A;  1CI6 A;  3SWK A;  1L4A C;  3I56 P;  2OQQ A;  3CME P;  4TKN A;  3SFE C;  4I6M C;  2M3E A;  2FYU J;  3BAS A;  1KB9 H;  3D6Z A;  1ZM0 A;  1EVH A;  2DTC A;  1PLS A;  2G35 A;  2JWA A;  3RCP A;  2KUQ A;  1AQC A;  4BRY A;  3RK3 E;  1KIL B;  2G8Y A;  3CX5 E;  1DD3 A;  2H7E A;  2BCC J;  3FM8 C;  4IFS A;  3JC2 2;  1AVY A;  2UWJ E;  2EC1 A;  2DLW A;  2KB7 P;  1LGH B;  1K05 A;  1KQL A;  1FDO A;  2W8Z A;  1YIT P;  3L71 J;  1M8O B;  4ASW A;  4L1R A;  3V5W A;  4HB1 A;  2P0F A;  1JCD A;  2WSC H;  2O1J A;  1IFN A;  3TGU D;  1EDK A;  3RK3 B;  4I7Z C;  3TO1 A;  2A06 G;  1EDI A;  1QQG A;  3DXC A;  2KUP A;  2IBZ I;  2QKM A;  3Q5R A;  4IFF A;  4OSN A;  1KQF B;  2IPP A;  1FGZ A;  1IC2 A;  2HPC B;  2YKO A;  2OTK E;  3G9R A;  2R2Y A;  3EFF K;  2K1A A;  2GS0 A;  3HK0 A;  2AXT E;  2YXR B;  4GXB A;  3TGU E;  1KYO I;  5KLV D;  3PRJ A;  1VL2 A;  1W1D A;  2FYN C;  1RF1 C;  4OGQ C;  2FFD A;  3MTU E;  1Z87 A;  3H1K J;  1JCC A;  1NYH A;  4HSI A;  1GDT A;  2Z4D A;  2VKI A;  4GZU A;  2D9Z A;  1GC6 A;  1NO4 A;  5CCH C;  2Y0C A;  2Q7C A;  1JY2 O;  3NWF A;  3TGU G;  1WMK A;  5KLV E;  1GU4 A;  3HD7 A;  1JEK A;  4IL6 E;  3KQG A;  3L72 D;  1KZU B;  1LT9 C;  2DHJ A;  1DD4 A;  1SQV D;  3PHL A;  3QWM A;  2RNR B;  2Q13 A;  3MUD A;  2KLU A;  4H13 D;  3ULB A;  1DRO A;  4GMX B;  1X86 A;  2BCJ A;  2YRY A;  1SQB D;  1KZG A;  2KSJ A;  3L72 E;  1IRS A;  1FZC A;  1IFI A;  1SQV E;  1KB9 D;  2MFQ A;  4WY4 D;  2OYH B;  2FXO A;  3MDB C;  4MK0 A;  4JBZ A;  4C7N B;  4K3A A;  4A6F B;  3SUZ A;  3TW1 A;  2W83 C;  4UB6 E;  5DIF B;  4PD4 I;  2ZYD A;  2KOG A;  2R44 A;  1RE4 A;  3CCQ P;  4QJ5 B;  1SQP E;  2XNX A;  3L75 J;  3IVF A;  1KB9 E;  4GPT B;  2K3R A;  5M1B A;  1N7S C;  3RK2 B;  1SQX D;  3IN6 A;  4DZO A;  3NSU A;  1T6A A;  4TT3 H;  4A6K A;  1KYO H;  4HHV A;  1YQ3 C;  1SQB G;  4HAX B;  1HH0 A;  1BE3 E;  1NTZ E;  5CJ0 A;  1LP1 A;  4Z2N A;  3G4S P;  4WY4 B;  2ZPY A;  1SQX E;  3Q5P A;  1GW4 A;  3P7Z A;  4CHJ A;  3FX0 A;  1OFC X;  3M9Q A;  2Y9Z A;  1SGH A;  1J19 A;  2ZT9 D;  3OA7 A;  3BCC J;  1ZRT D;  3NWA A;  1L4A A;  3GLM A;  1K73 Q;  2UZS A;  3H1H J;  4IFD K;  2R5D A;  3L4F A;  1XTC C;  2COC A;  2PAJ A;  1MI1 A;  1UII A;  1R8E A;  2PRR A;  4LC1 A;  1S3J A;  1ZYI A;  5C16 A;  2YMY A;  1YTZ I;  1FDI A;  3L74 D;  3VIA A;  2C0X A;  4F7H A;  3H1I D;  1E79 H;  2CRF A;  4TYZ A;  2HOD B;  1KQS O;  2Q9I A;  1OMW A;  4H44 C;  1FZG A;  5CJ4 A;  1PZQ A;  1L0L D;  1MUU A;  3B5N D;  1UEF A;  4L6E A;  3HUS B;  5AW3 B;  1UPR A;  2Y8G A;  4H8S A;  3CCV P;  4R4M A;  4DXA B;  3E1I A;  3VP9 A;  2E74 C;  5TIS H;  1OVU A;  3H1J J;  1L0N E;  2OTJ P;  3KZI H;  3D8F A;  1P84 I;  3H1L D;  2LG1 A;  1KD1 Q;  1GMJ A;  2XDJ A;  3KYQ A;  1ISN A;  3AU4 A;  3FXD A;  4PD4 H;  3VMZ A;  4DOJ A;  4ZRK A;  2ZT9 B;  2M0B A;  1XCG A;  1RQU A;  2EJ8 A;  1L0L E;  3SV1 A;  3LW5 H;  1W1G A;  1JY2 P;  4CYE A;  1EZV I;  5KQ1 A;  4PV1 D;  5E79 H;  2E75 D;  1Q7Y Q;  3CCM P;  3R2P A;  1U5E A;  3L74 G;  5B66 H;  3H1I G;  3T06 A;  2JDI H;  5CHX A;  4Y99 B;  3CXH I;  1URQ C;  2H43 A;  2NRG A;  1P5T A;  5DHA B;  1BCC D;  3GF7 A;  1MK7 B;  1FZF A;  1SLQ A;  4A5K A;  4U3F J;  1T3J A;  2HG5 D;  2R3C A;  2IBZ D;  2WPV B;  2JO1 A;  3CPW O;  1RY3 A;  3ML4 A;  3ZDT A;  1BGY D;  1T77 A;  2RVB B;  1J1E B;  3FGA D;  2COD A;  4QJ4 B;  2R5B A;  2YT1 A;  3V2Q A;  4H0L D;  2QJY B;  1NTM E;  1EDL A;  2DA0 A;  3H1L G;  1KYO D;  2H8P D;  4DX9 0;  1X9V A;  1BCC E;  4Y28 J;  2E43 A;  3RL0 B;  3M9H A;  5APS A;  2ADZ A;  1SFC D;  4D6T J;  2H7D A;  5JP4 A;  1YTZ T;  1HJB A;  3O96 A;  5KJ7 D;  2P8V A;  1HTL C;  5APX A;  1BGY E;  1HBW A;  4DT0 A;  2OYI B;  2OTX A;  5GTH H;  4PV1 B;  5KAF E;  2E75 B;  1DX7 A;  2E76 C;  4OVN F;  2O01 J;  3U12 A;  2QIW A;  3B71 A;  1M7E A;  2J58 A;  1KYO E;  4DX8 A;  1NTK K;  3PP5 A;  2RH0 A;  3TF5 A;  2P10 A;  3CI9 A;  1OW6 A;  1WVH A;  2LR2 A;  1CZQ A;  2IBZ G;  3M06 A;  1KI1 B;  3F89 A;  1EQ7 A;  2BAS A;  4EOT A;  1FDM A;  1PP9 D;  1LB1 A;  1FU1 A;  4IAP A;  3D8D A;  1LTB C;  3A0H H;  1V5U A;  2Q3E A;  1P84 H;  4H0L B;  1NWQ A;  3OHM B;  1MFT A;  4GN1 A;  1SQQ D;  3HE4 B;  1FE6 A;  4EYY Q;  2M5A A;  2JEE A;  3AE4 C;  1SFC B;  4RES B;  1N7S A;  2Q5U A;  2K8E A;  2MWN B;  3DXE A;  3NTN A;  2AEM A;  3L73 D;  1NKZ B;  3D6Y A;  3CXH H;  1IFD A;  2Z59 A;  1KFM A;  1PIX A;  4PD4 D;  2Q6Q A;  5HE3 A;  3K5B A;  1S5L H;  2POH A;  2ZJS E;  2QJK C;  2D4Q A;  1USE A;  3PEG A;  3VOQ A;  5TIS E;  1PP9 G;  1H89 A;  1OY2 A;  5DH9 B;  3KZI E;  4NPD A;  3FEH A;  1X0T A;  3L73 E;  5AVR B;  1JTH A;  1S2E A;  1L2P A;  1KZ7 A;  1V5P A;  1VQM P;  1SQQ G;  1Q86 Q;  1QX8 A;  2A45 I;  1WI1 A;  4XFJ A;  1BDC A;  2FXP A;  3U1C A;  5E79 E;  2Z0O A;  4HAW B;  1PGP A;  1S5L X;  1YJW P;  2SPZ A;  4I2L C;  2W6A A;  3D70 A;  1WJ1 A;  1VF5 C;  2FFD C;  1BWN A;  1G1I A;  3T97 A;  1H0T B;  2Y8F A;  4BXL A;  4HH2 A;  1FHW A;  3SSU A;  1HF9 A;  3W67 A;  1ZXG A;  1R5S A;  2OTL P;  5IRS A;  2LXC B;  1NH4 A;  3HD7 C;  2P67 A;  1M57 D;  2LUL A;  2IZ0 A;  2E5T A;  3CCJ P;  2Z4E A;  3AE3 C;  2YXQ B;  1RF0 A;  4OH8 B;  1X8Y A;  4JPZ B;  2CAY A;  2IFS A;  2RGN B;  3PTZ A;  4K81 A;  1H4R A;  2HR3 A;  2WT7 A;  3BVH A;  2JP3 A;  2W2W A;  1AQT A;  2AXT H;  3MUD C;  5GTH E;  2YSZ A;  1RRP B;  4HB3 B;  5CCG D;  1URQ A;  3GMA A;  2O01 N;  1MKE A;  3UIA A;  1P84 D;  3L70 D;  1WJM A;  2XV5 A;  4OWF A;  5I2S A;  3B5N A;  3O6Q A;  3F5H A;  2WSF H;  3NMD A;  1GD2 E;  2LYD A;  1SQB K;  5KKZ B;  1VQ5 P;  1OXZ A;  1ZN5 A;  3CWB E;  2DKQ A;  3D8E A;  1EZV D;  2K9J B;  1H8A A;  2DYN A;  1MK9 B;  1IO4 A;  1M7L A;  4A6H A;  3A0H E;  3CXH D;  4KHB A;  1P84 E;  1HGZ A;  2B87 A;  2Y7B A;  1Z56 A;  1T2K C;  2KYV A;  2QRX A;  2WVR A;  5AVS B;  3M1I B;  2A45 H;  1A02 F;  3BJI A;  1M1J B;  1EZV E;  1LTJ B;  1PFJ A;  1SP4 A;  2QVA A;  2KP8 A;  1ZC3 B;  3R4Y A;  1W1H A;  3CXH E;  1AVO A;  3L70 G;  4XA4 A;  3CCS P;  4NY0 A;  3I5C A;  1S5L E;  3H32 B;  3CCL P;  1YBK A;  1VQ7 P;  1S1C X;  3RK3 D;  1KN7 A;  3AE8 C;  2KXP B;  2Q3I A;  2FBW C;  1LWU A;  3TGU J;  1N86 A;  2YKQ A;  4B86 A;  2FJL A;  2YS5 A;  1QVF O;  5B5E H;  1N73 B;  5HE0 A;  4GOU A;  1NTK E;  2B89 A;  5KJ7 A;  2ROV A;  4DBB A;  5AW1 B;  2D2C C;  3AEC C;  1KIL C;  5JLJ B;  1N8R Q;  1LTS C;  4KHX A;  3CIK A;  3V6I A;  1KMI Z;  1U5D A;  2P2U A;  2PGD A;  2YMK A;  3NXS A;  2RN0 A;  1YI2 P;  1JY3 O;  2ITA A;  4DIX A;  4N6J A;  3P32 A;  2QKL A;  1NKN A;  3ULC A;  1FZE A;  5AW6 B;  2D11 A;  2FJU B;  4YON A;  3PP2 A;  1NU1 D;  1FHX A;  3QIJ A;  1MFZ A;  4CHM A;  1G2C B;  1IZN B;  3GG2 A;  2KS1 B;  2VRW B;  2Z13 A;  2XZR A;  2RKL A;  1IK7 A;  2FYU D;  1FAV A;  1LTI C;  3JCU E;  3AU5 A;  4I7Z B;  2L91 A;  1NU1 E;  1VQ9 P;  3SFD C;  2ZYA A;  4Y94 A;  1SQB J;  1PGQ A;  4KHA A;  4HAV B;  4KJM A;  1FC2 C;  4KT0 J;  3DXD A;  3MHV A;  2WZ7 A;  1FOS F;  2FYU E;  2FYN B;  5APQ A;  1IFJ A;  1RF1 B;  1U29 A;  3U1A A;  1JMM A;  2D9W A;  3SYX A;  4EKU A;  3TNU B;  1ZLL A;  3MZW B;  2DYQ A;  2ZVO B;  1OW7 A;  3GW6 A;  1MZ9 A;  2BCC E;  3AEB C;  2UZR A;  2JR8 A;  2WQY C;  3RK2 D;  2E5Y A;  2W27 A;  4N3Y B;  2K9Y A;  2M38 A;  3GYO A;  1G1J A;  3L71 E;  2K2U A;  4YXD C;  1R5L A;  5KLV G;  5APT A;  1LT9 B;  3C8V A;  3AE9 C;  1SQX J;  5AVW B;  1NOH A;  2Q1K A;  1SQP D;  3CC2 P;  3HE5 B;  3B8E B;  4L76 A;  1BTN A;  1RE3 A;  2OYH C;  3MGN A;  2H89 C;  3H1K D;  2A45 G;  1NVO A;  4HB2 B;  2NPS A;  3ITK A;  5C5B A;  2J59 M;  4CSQ A;  1QL1 A;  3L72 G;  1BE3 D;  3KDP B;  1SQV G;  1NTZ D;  1AA0 A;  1PPJ D;  5B5E E;  3AEF C;  5LG4 B;  5KAF H;  3TDK A;  3H1K E;  2N1T D;  1SQQ K;  3WUV A;  4L75 A;  2E2X A;  2Y0D A;  4H13 C;  1FOS E;  1T3U A;  2FY8 A;  3P8M C;  5CBO A;  3L74 J;  3H1I J;  1SQP G;  1S72 P;  2BEQ D;  2CY4 A;  3Q2Y A;  2EMS A;  3AE1 C;  1NGM B;  1EC5 A;  1PPJ E;  3FXE A;  3PVL A;  1PMS A;  4WY4 C;  1VQL P;  2N23 A;  2N0Y A;  1H10 A;  5L81 A;  1U2B A;  1VQN P;  3HTK A;  1DEE G;  1VQ4 P;  1JY3 P;  4EJN A;  2OYO A;  4ZNC A;  3H1L J;  1W5C E;  4C7R A;  2IYP A;  1BE3 G;  1GU5 A;  2DFK A;  1NTZ G;  1S9K E;  3N7N A;  1B55 A;  3B77 A;  1PGO A;  1KIL A;  1SQX G;  1L0N D;  2RMZ A;  3I55 P;  3L75 D;  1Y19 B;  2N1T B;  3GYP A;  5D3Y A;  1UPQ A;  3EQ2 A;  4GMV A;  2IFN A;  2KZJ A;  3L36 A;  1N7L A;  4OT1 A;  2RRF A;  1K9M Q;  2KIK A;  4AYC A;  2R32 A;  1GL2 D;  1ZME C;  3PH0 A;  1W2B O;  3L75 E;  1AJY A;  4H44 B;  3KRX A;  2WTY A;  2W6B A;  3RL0 D;  1BGY J;  1FZB A;  3W68 A;  2ZT9 C;  1PL5 A;  1RF0 C;  2O01 H;  3KPE A;  1M1K Q;  2HPC A;  2WSE H;  2ZFC A;  3GHG B;  3BCC D;  2Y9Y A;  3CL3 D;  5DI9 B;  1L0N G;  1X05 A;  1ZC4 B;  1NTM D;  4XWX A;  1GW3 A;  4NPE A;  1L0L G;  4UB8 H;  4JF7 A;  3B5N C;  1MV8 A;  2N9B A;  5J3Y A;  3BCC E;  3KY9 A;  5I2M A;  5EFX A;  5JHG A;  3USS A;  1QL2 A;  2QJP C;  2KK7 A;  3A98 B;  4D0N B;  5AW2 B;  1GL2 B;  5BVZ A;  1RJ2 A;  2NZ2 A;  3V2N A;  1QEX A;  1PP9 J;  1TQZ A;  3NWD A;  4QXA B;  2O3J A;  5DJT B;  3A0B E;  2QM8 A;  1PGJ A;  1SS1 A;  4PV1 C;  1SQQ J;  2E75 C;  1WGQ A;  1Q90 D;  4C0A A;  4BBK A;  3VOP A;  4K2P A;  2KLV A;  1NTM G;  3SNH A;  3EWK A;  4GOD A;  2KNC B;  1XD4 A;  1KV4 A;  1BCC G;  3H1J E;  3L73 J;  4W80 A;  1NU2 A;  1JNM A;  2OYH A;  1M56 D;  1V89 A;  1BGY G;  4PJ0 H;  3LW5 J;  4U3F D;  3UZT A;  4MY6 A;  4A6F A;  2FYZ A;  2GUS A;  1KOR A;  3MP7 B;  4L74 A;  2P7J A;  1YQ4 C;  2WSS H;  4H0L C;  1NJI Q;  3SWF A;  5DJU B;  2MKV A;  1LWU C;  3A3Y B;  1VQ8 P;  3KXD A;  4WVF B;  1GK4 A;  4HB4 B;  3U7D A;  1SFC C;  3BRV B;  1USD A;  1PV3 A;  2IZ1 A;  2QEX P;  2I1K A;  1JUN A;  1ZR2 A;  5KJ7 C;  2ZAE B;  1X22 A;  2IFM A;  4U3F E;  4D6T D;  2I5C A;  1K04 A;  3CCE P;  2Z0Q A;  1CI6 B;  1AQ5 A;  4GKG A;  1FJP A;  1I2H A;  1RHZ B;  3L35 A;  1GZL A;  3N7C A;  3FVC A;  3CXB B;  3Q5S A;  1NTV A;  4BRY B;  3ODO A;  2C9L Y;  1J1D C;  4WY4 A;  4Z2M B;  5AVU B;  1WGU A;  5L8R J;  3NFQ A;  4D6T E;  4DJG A;  4B6H A;  3E1R A;  2J5U A;  3AE7 C;  1Y8A A;  1LNQ A;  4CPG A;  2QJK B;  2E42 A;  3PSC A;  2Z5I A;  5DHF B;  1K5D B;  2K49 A;  2HYN A;  2R3S A;  3V4Q A;  2HOD A;  3PVU A;  2ZYG A;  2IYO A;  1UIX A;  3L73 G;  5KCV A;  2ZVN B;  3HUS A;  4HAU B;  2FXM A;  1DDM A;  5KLV K;  4UB8 E;  4W7Z A;  1YYC A;  2OGU A;  4GT1 A;  3L70 J;  2ELB A;  2Y0E A;  1AWE A;  3PG7 A;  1K5G B;  2NZ8 B;  5D27 A;  4ZRJ A;  1VF5 B;  1ZSQ A;  2FFD B;  1KQG B;  2RUK B;  3RBX A;  3V2R A;  3M91 A;  3NW8 A;  2LXB A;  4I1L A;  3CWB D;  3A58 A;  4HKZ H;  2J0K A;  1SQV K;  3JCU H;  3ODX A;  5AW4 B;  5HE2 A;  4W7Y A;  3HD7 B;  3AE6 C;  2GM4 A;  4ZKP A;  1V5M A;  4C46 A;  2GUV A;  2ELA A;  3U59 A;  5FI0 A;  5KLI C;  4KHO A;  1IJD B;  4EMO A;  2AXC A;  4KAX B;  1RE3 C;  1SQP K;  2YNY A;  4L73 A;  2LKO A;  3P8C E;  1YIJ P;  1LTA C;  2JKV A;  4HAT B;  4A7P A;  1OZH A;  4F7U P;  1VPC A;  3A2A A;  4PJ0 E;  2RSG A;  2NPS C;  3MIW A;  1U5G A;  3S4R A;  5C79 A;  3BIN A;  1Y9B A;  5AVT B;  4MT7 A;  1N3H A;  1FZC B;  2W2X D;  3B4S A;  3QWO C;  1N2D C;  3PLN A;  3OAK A;  1OWA A;  1TXD A;  2OYI A;  3CWB G;  1LTJ C;  2MKR A;  3ZVR A;  1L4A D;  1ZW0 A;  2JJL A;  1FJK A;  3F0W A;  1GK6 A;  5CCG C;  4O9B A;  2FKW B;  1SQX K;  2GUM A;  1A02 J;  1FAO A;  1XOD A;  3QBV B;  3SWY A;  2K2J A;  1FGY A;  2QA4 P;  2P0D A;  1NTK D;  2KZI A;  1RH5 B;  1EZV G;  1OMI A;  2YT0 A;  5KQ4 A;  3V5B A;  2DHI A;  2V7Q J;  4D6W A;  3D71 A;  3AEA C;  4QJ3 B;  4GNK B;  1RQV A;  1P3R A;  2LOZ A;  2ZXX A;  5CLL B;  3HE4 A;  2WIT A;  2YIU B;  1OQN A;  2AEF A;  5CBN A;  1LP1 B;  1NU1 J;  1SFC A;  3RGU A;  1N73 C;  2K88 A;  3DCX A;  4NSW A;  1Q81 Q;  1HJ0 A;  2WPQ A;  2R0D A;  5AW7 B;  2WSF J;  3CMA P;  1L4A B;  3VTP C;  1JM0 A;  1Y5O A;  1U57 A;  2R09 A;  4YL8 A;  2CPS A;  1L0N K;  1GC7 A;  3ZDM A;  2VSZ A;  5KLV J;  4BWN A;  3TYY A;  2COF A;  4ZKU A;  4P7I A;  1L0L K;  2D2C B;  4HAY B;  1NTK G;  1SHC A;  4OGQ D;  3WUU A;  2A06 E;  1CW5 A;  4JYC A;  3RK3 C;  5LON B;  2C0W A;  4WVZ A;  5LOP B;  5H2F H;  2KUB A;  3BRT B;  4K35 A;  1BTK A;  1EDJ A;  5CCH D;  5APW A;  3C1L A;  3L72 J;  5CLQ B;  2BEZ F;  2GCJ A;  2YS3 A;  1JY2 N;  2G3A A;  1SQV J;  5AW0 B;  1V61 A;  4LGD E;  4HAZ B;  4GOF A;  3C9I A;  1H0T A;  2DHK A;  5CMZ A;  2VRS A;  3G3Z A;  1BDD A;  1NTM K;  2BCC D;  2W90 A;  4ZRI A;  2L1C A;  2PZ1 A;  3VMA A;  1SQP J;  1U27 A;  2CY5 A;  3OJA B;  2HFE D;  4LLH A;  1NTY A;  3L71 D;  1LW3 A;  4OGQ B;  1VQ6 P;  5HE1 A;  1UNQ A;  1FZA A;  1NU1 G;  2KCJ A;  3HIE A;  2NBV A;  4EIJ A;  3S1K A;  4U7J A;  2EMT A;  2I8D A;  1AV1 A;  2D10 A;  2HTH B;  1Y47 A;  1OX3 A;  1BE3 J;  1DDW A;  1NTZ J;  3FSS A;  2FYU G;  5EFW B;  5AVY B;  3WU2 H;  3FWN A;  2IX7 C;  4WSF A;  3G71 P;  5JHH A;  2L2I A;  2LOX A;  1VDF A;  2WSC J;  1FS0 E;  1N7S D;  5GTI H;  1LT1 A;  3HW2 B;  4GOE A;  2I5F A;  2BCC G;  3H25 A;  1V88 A;  4YPC A;  1BSH A;  3KSY A;  1HVV A;  2K9J A;  1BAK A;  1DYN A;  3L71 G;  3VP8 A;  4RKU J;  2X18 A;  1YJ9 P;  5AVQ B;  2XND H;  5J3Q A;  1U7J A;  5APY A;  2YT2 A;  1FBM A;  3A0B H;  3AJ4 A;  1S4X A;  3RBZ A;  3Q1M A;  1M1J A;  1ZR4 A;  1LTJ A;  3RK2 C;  1GTW A;  2YS1 A;  1EGX A;  3M0D A;  1H88 A;  4WB4 A;  3JSV C;  1SQB E;  5CCG A;  3AED C;  1L0N J;  2LKM A;  2M5A B;  1XTG B;  3H32 A;  2N9Y B;  1S9K D;  1N7S B;  5K5G B;  1L0L J;  3AEG C;  5D3X A;  4H44 D;  3HSA A;  3H1K G;  4GDO A;  4H13 B;  2D9Y A;  3KZ1 A;  4KVG B;  3HRN A;  1GG3 A;  3U8Z A;  3PJS K;  1Q2N A;  1K8A Q;  3F5R A;  2GJY A;  5H2F E;  2I1J A;  2J0M A;  2E74 D;  1ZOY C;  2JP2 A;  1AFO A;  3IAO A;  1N73 A;  4WWI A;  1QVG O;  2JWD A;  2DN6 A;  1PPJ G;  3CCR P;  5AW5 B;  4JYB A;  3KHU A;  3WA0 A;  2N1T C;  1YHQ P;  1IFP A;  1JTH B;  1IFM A;  5AW8 B;  2NMB A;  1EAZ A;  2GCL A;  3M9B A;  2MJZ A;  3HUS C;  2ZKM X;  3IF4 A;  1NTM J;  3P7K A;  3CLQ A;  4RO0 A;  4DCK A;  1BCC J;  3WMM 0;  5KTB A;  1URQ D;  2OAR A;  1ZRT E;  2C9N Y;  2WPR A;  5FI1 A;  1LTT C;  1MIX A;  2KGX B;  3T97 B;  5AW9 B;  2DX5 A;  1KTM A;  5AVX B;  5TJH A;  1G2C A;  1WT6 A;  2PFX A;  5KAI H;  3GHG C;  4N78 D;  2E74 B;  3IR9 A;  2KS1 A;  3L74 E;  4NPF X;  3H1I E;  2XKM A;  1QGK B;  3H1H D;  1JB0 J;  3PZD A;  4Y99 C;  3L75 G;  1DH3 A;  1JOC A;  1CSB A;  2YO3 A;  1QC6 A;  3WU2 E;  4YTP C;  2V76 A;  1X79 B;  2D9V A;  3OAN A;  4WJ7 A;  5GTI E;  1VQP P;  4N78 E;  2E76 D;  3N4X A;  2WT7 B;  1HGV A;  4IOY X;  3H1H E;  1J1E C;  4AQR D;  1DBH A;  1URQ B;  1UNR A;  3A7O A;  3H1L E;  2ZXE B;  1RF1 A;  2KI7 B;  1GL2 C;  3HQC A;  3TFM A;  2QJY C;  1TU3 F;  3TNU A;  1EXI A;  3RL0 C;  1FB8 A;  3H1J D;  3B5N B;  3O6Q B;  1NAY A;  2PP6 A;  4IOI H;  3M0A A;  2WWW A;  4F7G A;  2QM7 A;  1OIP A;  2B9B A;  5C6R A;  5CCH A;  2QJP B;  3BCC G;  4K2O A;  1EXJ A;  2OYI C;  2H88 C;  3H1H G;  2KR0 A; 
#chains in the Genus database with same CATH homology
 3RK2 B;  2RUK B;  1PFI A;  1JY3 O;  3A8Q A;  4DZO A;  3LJU X;  3NSU A;  1LT9 A;  4N6J A;  1HUC A;  3V2R A;  4KHB B;  3M91 A;  3P32 A;  4A6K A;  2QKL A;  4I1L A;  1NKN A;  4HHV A;  1NHL A;  3ULC A;  1DEB A;  1FZE A;  3HE5 A;  5AW6 B;  2D11 A;  4HAX B;  1HH0 A;  2L5G B;  4YON A;  2J0K A;  2UVM A;  1SQV K;  3PP2 A;  4HB0 B;  3A8P A;  2CPB A;  3ODX A;  5AW4 B;  3L37 A;  1FHX A;  3QIJ A;  5HE2 A;  4W7Y A;  1MFZ A;  3HD7 B;  5CJ0 A;  4Z2N A;  4C7N A;  4CHM A;  2DX1 A;  2GM4 A;  2RLO A;  4ZKP A;  4WY4 B;  1V5M A;  2ZPY A;  3SO6 A;  1G2C B;  1GW4 A;  3P7Z A;  4CHJ A;  3V4W A;  3M9Q A;  3EFG A;  2GUV A;  4C46 A;  1SGH A;  1J19 A;  2ELA A;  2XZR A;  3U59 A;  2VRW B;  5FI0 A;  1XR0 B;  1W2E A;  3OA7 A;  4HYT B;  4KHO A;  1L4A A;  1IJD B;  1FAV A;  4EMO A;  2UZS A;  1IK9 A;  1LTI C;  1RE3 C;  3AU5 A;  1SQP K;  2YNY A;  2LKO A;  4KAX B;  2D2Q A;  3P8C E;  4IFD K;  1LTA C;  4HAT B;  4K17 A;  4F7U P;  1VPC A;  2R5D A;  3A2A A;  3L4F A;  3MPX A;  1XTC C;  5AVZ B;  2COC A;  2RSG A;  1T8Z A;  4PNK A;  2NPS C;  2PAJ A;  3MIW A;  1U5G A;  2DKP A;  4LC1 A;  5C79 A;  3BIN A;  1X1F A;  4Y94 A;  5AVT B;  4MT7 A;  5C16 A;  1N3H A;  2YMY A;  1YTZ I;  1MIZ B;  4PQ0 A;  3VIA A;  2C0X A;  1FZC B;  4F7H A;  3VMX A;  2W2X D;  2HE7 A;  2CRF A;  4KHA A;  4HAV B;  2HOD B;  1J2J B;  4TYZ A;  1LWU B;  1N2D C;  3DXD A;  2Q9I A;  2WZ7 A;  3OAK A;  3TSI A;  1OMW A;  1FOS F;  1FZG A;  5CJ4 A;  1OWA A;  5APQ A;  1IFJ A;  1MUU A;  3B5N D;  1RF1 B;  2OYI A;  3U1A A;  1JMM A;  1TXD A;  1U29 A;  1UEF A;  2D9W A;  4L6E A;  1LTJ C;  3HUS B;  4XE5 B;  5AW3 B;  1UPR A;  2MKR A;  1L4A D;  3TNU B;  2Y8G A;  3ZVR A;  4EKU A;  4H8S A;  1ZLL A;  2DYQ A;  2JJL A;  1P6S A;  3LID A;  1J0W A;  1FJK A;  4DXA B;  3E1I A;  3VP9 A;  3F0W A;  1GK6 A;  5CCG C;  4O9B A;  2FKW B;  1SQX K;  1MZ9 A;  1A02 J;  1FAO A;  1XOD A;  1MPH A;  2UZR A;  3RK2 D;  3QBV B;  3SWY A;  2W27 A;  2K2J A;  4N3Y B;  2M38 A;  3D8F A;  3H6P A;  2AL6 A;  2LG1 A;  1FGY A;  2XDJ A;  3KYQ A;  1ISN A;  3AU4 A;  3GYO A;  1G1J A;  3VMZ A;  4DOJ A;  1JO5 A;  4ZRK A;  2EJ8 A;  2XU6 A;  1XCG A;  2K2U A;  2P0D A;  3SYX A;  3SV1 A;  5APT A;  1NU1 K;  2COA A;  2YT0 A;  1LT9 B;  3LW5 H;  1J1D B;  5AVW B;  1NOH A;  5KQ4 A;  3V5B A;  1W1G A;  5APV A;  2DHI A;  1JY2 P;  4CYE A;  1DDV A;  1I7A A;  2ROZ B;  4HDO A;  4GIF A;  3WYF B;  5KQ1 A;  5BU5 A;  3HE5 B;  3HD7 D;  3R2P A;  2N1T A;  1U5E A;  3B8E B;  1BTN A;  1RE3 A;  1P3R A;  1Q67 A;  2LOZ A;  3T06 A;  2OYH C;  3MGN A;  3HE4 A;  5CLL B;  2WIT A;  5CHX A;  4Y99 B;  1OQN A;  1URQ C;  3IFM A;  2H43 A;  1LTG C;  2A45 G;  1SFC A;  4HB2 B;  2FYU K;  1N73 C;  1P5T A;  1NI2 A;  5DHA B;  2IYB A;  1MK7 B;  4NSW A;  2NPS A;  2WPQ A;  1FZF A;  3BAT A;  2R0D A;  1SLQ A;  5AW7 B;  1X11 A;  4A5K A;  1T3J A;  2HG5 D;  2R3C A;  5C5B A;  2J59 M;  3P6A A;  1QL1 A;  1L4A B;  3VTP C;  1Y5O A;  1RY3 A;  3ML4 A;  3ODW A;  3ZDT A;  1WRG A;  3KDP B;  2R09 A;  2RVB B;  4YL8 A;  1J1E B;  2CPS A;  2COD A;  3TK1 A;  1L0N K;  1GC7 A;  2R5B A;  2VSZ A;  2YT1 A;  3V2Q A;  3MD0 A;  1X1G A;  2Z5H A;  2N1T D;  3TYY A;  2DA0 A;  1SQQ K;  2YF0 A;  2H8P D;  4DX9 0;  2COF A;  4ZKU A;  4P7I A;  1X9V A;  2E2X A;  1L0L K;  2E43 A;  3RL0 B;  3M9H A;  5APS A;  1FOS E;  2M14 A;  1T3U A;  3GHG A;  1SHC A;  3P8M C;  2ADZ A;  2Z0P A;  3PVW A;  1SFC D;  2H7D A;  4IFM A;  5JP4 A;  1CW5 A;  3P8C D;  2NPS D;  3O8Z A;  1EF1 A;  1YTZ T;  4JYC A;  1HJB A;  3RK3 C;  5D3W A;  3O96 A;  5KJ7 D;  5LON B;  2C0W A;  2P8V A;  2HLO A;  5LOP B;  1FHO A;  1HTL C;  5APX A;  5BU8 B;  2CY4 A;  1HBW A;  2D9X A;  2OYI B;  2OTX A;  3BRT B;  5GOW B;  2EMS A;  1BTK A;  1DX7 A;  5CCH D;  1M7E A;  1PMS A;  2M3B A;  4WY4 C;  3PVL A;  5APW A;  2N23 A;  1T2K D;  2J58 A;  2N0Y A;  4DX8 A;  1H10 A;  4HDQ A;  1HWT C;  5L81 A;  5CLQ B;  1U2B A;  5D3V A;  1NTK K;  3PP5 A;  2GCJ A;  3HTK A;  2YS3 A;  1JY2 N;  5AW0 B;  3X23 A;  3CI9 A;  1V61 A;  1WVH A;  1TJ6 A;  1CZQ A;  1JY3 P;  4EJN A;  3M06 A;  4LGD E;  1KI1 B;  2XQN M;  1EQ7 A;  2BAS A;  2YO2 A;  4EOT A;  4AUW A;  1FDM A;  2J0J A;  3II6 A;  4C7R A;  4HAZ B;  1WG7 A;  1GL2 A;  1GU5 A;  3C9I A;  1LB1 A;  1FU1 A;  3VN0 A;  2DHK A;  2DFK A;  1S9K E;  1E5W A;  4IAP A;  3N7N A;  1B55 A;  5CMZ A;  2VRS A;  1LTB C;  3G3Z A;  3D8D A;  1NTM K;  1FZC C;  4ZRI A;  1V5U A;  2L1C A;  1KIL A;  1ZV8 A;  2OQB A;  3TVV A;  2PZ1 A;  3G9W A;  1Y19 B;  5J3T A;  2YVC A;  3LIE A;  2MDX A;  1NWQ A;  2N1T B;  1U27 A;  4M3L A;  3GYP A;  2CY5 A;  3OJA B;  4GN1 A;  3HE4 B;  2HFE D;  4LLH A;  2JEE A;  2YKP A;  1NTY A;  1LW3 A;  5D3Y A;  1UPQ A;  3EQ2 A;  1M1J C;  1SFC B;  4RES B;  1N7S A;  2M8R A;  2IFN A;  4GMV A;  5HE1 A;  2Q5U A;  2P1J A;  2NPS B;  3L36 A;  1U5F A;  1FZA A;  1UNQ A;  1N7L A;  3M0D C;  2MWN B;  1NTZ K;  3DXE A;  2KCJ A;  3NTN A;  2P0H A;  1RE4 C;  1ZVR A;  5C5B B;  4EIJ A;  4AYC A;  2R32 A;  1GL2 D;  1NKZ B;  2EMT A;  1IFD A;  1SVF A;  3TCA A;  1KFM A;  5HE3 A;  2D10 A;  3KRX A;  2WTY A;  1FOE A;  2HTH B;  2W6B A;  3RL0 D;  1FZB A;  1KIL D;  1DDW A;  2POH A;  1XX0 A;  4HAY B;  3FSS A;  2O1K A;  5AVY B;  5AVV B;  1NAF A;  1RF0 C;  2IX7 C;  2D4Q A;  3V2P A;  3KRW A;  2O01 H;  4WSF A;  3KPE A;  5JHH A;  2HPC A;  2L2I A;  2WSE H;  2ZFC A;  2LOX A;  3PEG A;  3GHG B;  3VOQ A;  1VDF A;  1MAI A;  1H89 A;  1N7S D;  1OY2 A;  5DH9 B;  1KFN A;  3HW2 B;  3FEH A;  3VMY A;  4WBA A;  2I5F A;  3CL3 D;  5AVR B;  2K00 A;  5DI9 B;  1JTH A;  2H7H A;  1V88 A;  1UNP A;  3KSY A;  1JY3 N;  1HVV A;  1X05 A;  1ZC4 B;  2W2X C;  1KZ7 A;  1BAK A;  1V5P A;  4XWX A;  5APU A;  1DYN A;  2AEH A;  1GW3 A;  2A45 I;  1WI1 A;  3VP8 A;  3VYI A;  4JF7 A;  2X18 A;  5AVQ B;  3U1C A;  5J3Q A;  3A5T A;  3B5N C;  1MV8 A;  1M7R A;  2WPS A;  2N9B A;  5J3Y A;  3HTK B;  1XKE A;  1CI6 A;  5APY A;  2Z0O A;  4HAW B;  1L4A C;  3KY9 A;  4TKN A;  5EFX A;  5JHG A;  1FBM A;  4I2L C;  1QL2 A;  2W6A A;  4I6M C;  1WJ1 A;  3AJ4 A;  3BAS A;  3A98 B;  1ZM0 A;  2DTC A;  4D0N B;  1EVH A;  5AW2 B;  2FFD C;  1PLS A;  1BWN A;  2G35 A;  1G1I A;  1M1J A;  1GL2 B;  3T97 A;  3RCP A;  1ZR4 A;  1LTJ A;  3RK2 C;  2Y8F A;  1AQC A;  1GTW A;  5BVZ A;  2YS1 A;  1RJ2 A;  1EGX A;  4HH2 A;  3V2N A;  3M0D A;  1H88 A;  4WB4 A;  1FHW A;  1TQZ A;  1KIL B;  5CCG A;  2H7E A;  3FM8 C;  4IFS A;  2QM8 A;  2EC1 A;  2DLW A;  2LKM A;  2KB7 P;  1XTG B;  3H32 A;  1LGH B;  1NH4 A;  1KQL A;  1N7S B;  3HD7 C;  2P67 A;  1S9K D;  1WGQ A;  2LUL A;  4C0A A;  2Z4E A;  4BBK A;  3VOP A;  1RF0 A;  4OH8 B;  2KLV A;  1X8Y A;  4K2P A;  5D3X A;  3V5W A;  2CAY A;  3SNH A;  2D9Y A;  1XD4 A;  3KZ1 A;  2P0F A;  2IFS A;  3HRN A;  4KVG B;  1JCD A;  2WSC H;  2RGN B;  4K81 A;  2O1J A;  1IFN A;  1GG3 A;  3U8Z A;  1H4R A;  2WT7 A;  3F5R A;  3BVH A;  4W80 A;  3RK3 B;  1NU2 A;  2GJY A;  2W2W A;  1JNM A;  3TO1 A;  2I1J A;  1QQG A;  2OYH A;  1RRP B;  2YSZ A;  2J0M A;  3DXC A;  4HB3 B;  2KUP A;  5CCG D;  1URQ A;  2JP2 A;  1MKE A;  1V89 A;  2QKM A;  3UIA A;  1AFO A;  1N73 A;  4IFF A;  3UZT A;  4MY6 A;  2IPP A;  4A6F A;  1FGZ A;  1IC2 A;  1WJM A;  2HPC B;  2YKO A;  2XV5 A;  2DN6 A;  2FYZ A;  2GUS A;  4JYB A;  5AW5 B;  2P7J A;  3B5N A;  3SWF A;  3WA0 A;  1LWU C;  2WSF H;  3A3Y B;  3NMD A;  1GD2 E;  2LYD A;  2N1T C;  1SQB K;  2GS0 A;  3HK0 A;  4WVF B;  4GXB A;  1OXZ A;  1ZN5 A;  1JTH B;  1IFM A;  2DKQ A;  3D8E A;  1W1D A;  1GK4 A;  5AW8 B;  4HB4 B;  2NMB A;  3U7D A;  1RF1 C;  1EAZ A;  1H8A A;  2GCL A;  1SFC C;  2FFD A;  3M9B A;  2MJZ A;  2DYN A;  3BRV B;  3HUS C;  3MTU E;  1MK9 B;  1Z87 A;  1IO4 A;  1JCC A;  1M7L A;  2I1K A;  3P7K A;  4A6H A;  1JUN A;  5KJ7 C;  3CLQ A;  1ZR2 A;  3WMM 0;  2IFM A;  1GDT A;  2I5C A;  5KTB A;  2Z0Q A;  1URQ D;  2VKI A;  2OAR A;  1CI6 B;  1AQ5 A;  4GKG A;  4GZU A;  1HGZ A;  1GC6 A;  2D9Z A;  2Y7B A;  1NO4 A;  1FJP A;  1I2H A;  5CCH C;  2Q7C A;  1Z56 A;  1T2K C;  2C9N Y;  1JY2 O;  2KYV A;  2WPR A;  1GZL A;  3L35 A;  5AVS B;  3N7C A;  5FI1 A;  1LTT C;  2A45 H;  1MIX A;  3M1I B;  1A02 F;  3BJI A;  3CXB B;  1NTV A;  2KGX B;  1M1J B;  1GU4 A;  5AW9 B;  1LTJ B;  3HD7 A;  1PFJ A;  2DX5 A;  1SP4 A;  3KQG A;  2KP8 A;  5AVX B;  3ODO A;  1KZU B;  1LT9 C;  1J1D C;  2C9L Y;  2DHJ A;  1ZC3 B;  4WY4 A;  4Z2M B;  1G2C A;  1WT6 A;  5AVU B;  3GHG C;  1WGU A;  4N78 D;  3IR9 A;  3NFQ A;  1W1H A;  3QWM A;  2XKM A;  4B6H A;  4XA4 A;  2RNR B;  4NY0 A;  3I5C A;  2Q13 A;  3PZD A;  3H32 B;  4Y99 C;  3MUD A;  1DH3 A;  3ULB A;  1DRO A;  1JOC A;  1CSB A;  2YO3 A;  1QC6 A;  4GMX B;  1X86 A;  2BCJ A;  2V76 A;  2E42 A;  2YRY A;  3RK3 D;  1X79 B;  3PSC A;  2Z5I A;  5DHF B;  1KZG A;  2KSJ A;  1K5D B;  2D9V A;  1IRS A;  3OAN A;  2Q3I A;  1FZC A;  4WJ7 A;  1IFI A;  2HYN A;  3V4Q A;  4N78 E;  2HOD A;  3N4X A;  1LWU A;  2WT7 B;  1HGV A;  3PVU A;  2MFQ A;  1N86 A;  2YKQ A;  4WY4 D;  4IOY X;  1J1E C;  2OYH B;  4B86 A;  2FJL A;  4AQR D;  1DBH A;  3MDB C;  4MK0 A;  1URQ B;  1UNR A;  5KCV A;  3A7O A;  1RF1 A;  2ZXE B;  2YS5 A;  1GL2 C;  4C7N B;  1N73 B;  3HQC A;  3HUS A;  4HAU B;  3TFM A;  2FXM A;  3TNU A;  4A6F B;  5HE0 A;  1DDM A;  5KLV K;  3SUZ A;  3TW1 A;  5DIF B;  4W7Z A;  5KJ7 A;  2ROV A;  4DBB A;  1YYC A;  2KOG A;  5AW1 B;  3RL0 C;  1FB8 A;  1RE4 A;  1KIL C;  3B5N B;  4GT1 A;  5JLJ B;  2PP6 A;  2ELB A;  3M0A A;  1LTS C;  4KHX A;  2WWW A;  4F7G A;  2QM7 A;  3CIK A;  1AWE A;  2XNX A;  3PG7 A;  1K5G B;  5C6R A;  5CCH A;  2NZ8 B;  3IVF A;  5D27 A;  4ZRJ A;  4K2O A;  1U5D A;  2P2U A;  1ZSQ A;  2OYI C;  4GPT B;  2FFD B;  1N7S C;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...