2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
2NZ8B 5LOPB 1X05A 2AEHA 1ZC3B 1UNPA 4TYZA 1TXDA 2HE7A 2X18A 2Y7BA 4GN1A 4Y94A 2LYDA 1XKEA 2Y8GA 2LKOA 3TO1A 1MK9B 2L2IA 2ADZA 3QBVB 1LB1A 4HAWB 4KAXB 2DLWA 2Z0QA 1ISNA 3N7CA 1V61A 1DDWA 2YS1A 2GCJA 1MK7B 2CY5A 2N23A 4CYEA 2WSEH 2XQNM 1K5GB 3T06A 1NTYA 1GC6A 4MK0A 2I5FA 1XD4A 2FJLA 1OY2A 2R09A 2HTHB 4Z2MB 2YS5A 5DHAB 4ZRIA 4A6KA 3OANA 3F5RA 5KQ4A 3PVWA 3U8ZA 2K2JA 1WGUA 3KZ1A 1FHOA 1NTZK 2IFSA 2D11A 5DHFB 4MT7A 4WVFB 2DHJA 1B55A 1BWNA 1AWEA 3HQCA 1FOEA 1NU2A 3ML4A 1ZVRA 5DI9B 4DXAB 1Y5OA 2ROZB 3ODXA 1UNRA 2DHKA 2K00A 1U5DA 3TCAA 4HDOA 5D27A 3PSCA 1ZC4B 3SYXA 1EGXA 3KSYA 3G9WA 1DYNA 2ZPYA 3TVVA 3GYPA 3UZTA 1MAIA 1EVHA 5CLQB 2NMBA 3TFMA 3FEHA 2LKMA 5CLLB 4F7UP 1WJ1A 2DN6A 1QC6A 3PZDA 5KLVK 2P8VA 2LOZA 2I1JA 1SGHA 2DYQA 4P7IA 1NTVA 1QQGA 1V88A 3F0WA 5D3YA 5JHGA 4L6EA 2R0DA 1W1HA 4IFSA 2ELAA 5JP4A 4ZRKA 2IYBA 4H8SA 4B6HA 2WSCH 3D8FA 1V89A 2WSFH 4HAXB 1I2HA 4GZUA 3P6AA 1UPQA 2VSZA 3AU4A 2RNRB 2MDXA 4IOYX 1BTKA 1UPRA 2MWNB 1U5FA 1MPHA 5FI1A 5C16A 1DROA 1KI1B 1WJMA 2V76A 3U7DA 4K17A 1XX0A 2QKLA 3HW2B 4ZRJA 1EF1A 1DDVA 1FHWA 2DTCA 3LW5H 3NSUA 4XWXA 2J59M 2P0HA 3CIKA 1SQXK 1Y19B 2Z0PA 3MPXA 3FM8C 3FSSA 2D9XA 1X11A 1WGQA 1MIXA 1SQVK 5JLJB 1U27A 2YT0A 2D9WA 5D3WA 5DH9B 1KZGA 1RJ2A 1GG3A 2YF0A 2D4QA 4KHOA 2RVBB 3GYOA 3TW1A 1N3HA 4K2PA 5HE1A 1EAZA 3A8QA 1GC7A 1FB8A 1MKEA 2EJ8A 4Z2NA 5D3VA 2YSZA 1KZ7A 2W2XC 1BAKA 2CY4A 1FGZA 3A8PA 2DA0A 1IRSA 2D9YA 4PNKA 5J3TA 3DXDA 4F7HA 2H7DA 3MDBC 3VOQA 2J0JA 2KUPA 1WG7A 3PVUA 4HAUB 1P3RA 1P5TA 1FAOA 2UZRA 1M7EA 3PG7A 3G3ZA 4GXBA 5HE3A 1NTMK 1PFJA 4CHMA 2YVCA 4C0AA 1UEFA 2UVMA 3PVLA 4YONA 2PZ1A 4HB3B 2CAYA 2YS3A 1W1DA 2K2UA 1SHCA 5KCVA 3A98B 2D9ZA 2COCA 1XR0B 3V5WA 4NSWA 1MIZB 2GS0A 1K5DB 5C79A 4GMXB 4K2OA 2LG1A 2J0MA 3BINA 1X1GA 4HB4B 2CODA 1ZSQA 2VKIA 2D10A 1AQCA 3DXCA 2QKMA 2DX5A 4HB2B 2L1CA 2DFKA 2H7EA 3ODWA 2RGNB 2W2WA 1TQZA 2MKRA 3BJIA 3VIAA 2GJYA 1J0WA 5EFXA 1RRPB 1LW3A 1H4RA 3ODOA 1W1GA 1V5UA 1XODA 3SUZA 1OMWA 3PP2A 3O96A 1UNQA 2Z0OA 4A5KA 1NTKK 2I5CA 2DKQA 2COFA 4YL8A 4CHJA 2LULA 2D2QA 2D9VA 1E5WA 5C5BB 4KHAA 3M9QA 4KHBB 2ROVA 3QIJA 2P0FA 3HK0A 5HE2A 1V5MA 5GOWB 4DBBA 2YT1A 4DX90 2COAA 1SQPK 1Q67A 3M1IB 5KQ1A 4D0NB 5HE0A 2GCLA 4HATB 2VRWB 3SV1A 3KY9A 4PQ0A 3KRWA 5DIFB 5L81A 1NU1K 1NI2A 4A6FB 2J0KA 4HB0B 3ZVRA 1L0NK 2EMTA 4HHVA 2UZSA 2OARA 4EJNA 2OQBA 5J3QA 2MFQA 2Y8FA 4GMVA 4HAVB 2AL6A 4HDQA 2I1KA 5J3YA 4WSFA 2DX1A 5D3XA 4EKUA 1FHXA 2DKPA 4BBKA 3ULCA 1XCGA 2YRYA 3D8EA 4GPTB 1DBHA 3ULBA 3PEGA 2RLOA 1M7RA 1BTNA 1P6SA 2FYUK 1U5EA 3ZDTA 1SQQK 2KCJA 2DHIA 1WVHA 2G35A 1U2BA 2M14A 4HAZB 3RCPA 1U29A 2N0YA 2BCJA 1L0LK 2RUKB 2DYNA 3X23A 1U5GA 4K81A 4TKNA 5C6RA 1OQNA 2O01H 1J19A 2E2XA 2EMSA 4A6HA 1X1FA 2OTXA 3SNHA 5C5BA 1DDMA 3AJ4A 2W2XD 3KRXA 4HAYB 1TJ6A 3SO6A 2ELBA 2EC1A 1FGYA 4IAPA 4NY0A 3DXEA 1ZM0A 3IVFA 1X86A 3AU5A 2P0DA 4F7GA 3WA0A 2Q13A 3QWMA 3WYFB 1H10A 1Z87A 2KGXB 1SQBK 2CRFA 1V5PA 3D8DA 1PMSA 2LOXA 3P7ZA 4MY6A 2JP2A 4A6FA 4EMOA 3LJUX 4KVGB 4WJ7A 5LONB 1PLSA 2M38A 5FI0A 3CXBB 3CLQA 5JHHA 1WI1A 4DX8A 4IFDK 1I7AA 2RSGA
chains in the Genus database with same CATH superfamily
2W6JH 3USSA 1S3JA 2NRGA 3HD7A 1JMBA 5CBNA 2R5DA 2AEHA 1GD2E 1UNPA 1NTZE 1TXDA 2O01J 3UIAA 1M1JC 4ZMDA 2B88A 2JR8A 1YYCA 2P10A 2QJYB 1GU5A 4DOJA 1GTWA 5KAFH 2L2IA 1LTJB 4HAWB 4KAXB 4PD4I 3AE4C 2E43A 2R3CA 1V61A 5APUA 1MK7B 3W68A 1K5GB 2K3RA 2KIEA 1ZRTE 1M56D 1XD4A 2E5YA 2ZKMX 2HTHB 2PP6A 5AVWB 2D2CB 3KXDA 2YS5A 4ZRIA 4A6KA 5KQ4A 5KLVJ 3KZ1A 2WPRA 4DCKA 4JBZA 4Y28J 1KORA 3WU2E 4H13C 1OZHA 1AWEA 1ZMEC 4D6WA 2QJYC 3NW8A 1VQ5P 5DI9B 4ASWA 2ROZB 3ODXA 1LTJC 1DEEG 1UNRA 5AVYB 5TISE 2O1JA 3SWYA 1ZW0A 1IC2A 1PPJD 3RGUA 3SYXA 1OX3A 1EGXA 2N9YB 4WY4D 2BCCJ 1DYNA 2ZPYA 5CLQB 3VP8A 2LKMA 2QG4A 5CLLB 1AVOA 4F7UP 1RF1B 5AVTB 2D2CC 2ZVOB 2P8VA 2LOZA 3G71P 1SQQD 2K9JB 3TYYA 2JO1A 4A7PA 2FYUG 1QQGA 1RH5B 2R0DA 1MFTA 1SQXJ 3IN6A 2KZJA 3L74D 4GOUA 2JEEA 2WSFH 4HAXB 1IFDA 1U57A 3QWOC 1NU1E 1J1EC 1GL2A 3Q5RA 1DX7A 1WT6A 4DZOA 2WITA 3PRJA 3U7DA 1XX0A 1Y9BA 2KOGA 1KB9E 5AW7B 1OW6A 1QVGO 1T2KD 1M1KQ 2AXCA 1VL2A 1HF9A 3RK3E 1Y19B 5KLIB 3SFEC 2E75B 3VMXA 3H1IG 2YO2A 3V2RA 1NTME 1SQVK 2D9WA 5DH9B 2WSCJ 3CI9A 3V2QA 2BCCG 4K2PA 1FZCA 5HE1A 1EAZA 1JTHB 1FB8A 5CCGD 2WQYC 5BU8B 2W2XC 1EXIA 3OA7A 2DA0A 1IRSA 3A7OA 2KUQA 4HYTB 2G3AA 4PNKA 4XE5B 2KSEA 1USDA 1ZN5A 2AXTE 1USEA 3VOQA 1NHLA 4D6TE 3L71G 1MKMA 3GLMA 1FJKA 2SPZA 5KLIC 2POHA 2E74D 3MP7B 4GXBA 5HE3A 4JPZB 2OGUA 2YVCA 4C0AA 2M5AA 3PVLA 4O9BA 2MJZA 3H1HE 2RRFA 2K2UA 1NKZB 1NTKJ 1GZLA 2YIUC 1KV4A 2COCA 3A58A 2K1AA 2WSEJ 3B5NA 1MIZB 4OGQB 2N9BA 2FYUD 1LGHB 2K37A 4ZKUA 4K2OA 2AEFA 2J0MA 2QSIA 3L73E 3HD7C 3AECC 2CODA 3WUUA 5KKZB 3L72E 4OWFA 5AVVB 3LIEA 4M3LA 4N78D 2QKMA 1SQPJ 2L1CA 3MIWA 2DFKA 2W2WA 2E76D 3RK3B 1NWQA 3VIAA 2QM7A 2IBZG 2GJYA 3NWDA 4ASVA 5EFXA 1LTTC 1HH0A 3A0BE 2YXRB 3NMDA 4HJGH 1AFOA 1H4RA 1W1GA 3ODOA 3P8CE 3MZWB 2O3JA 1L0NE 1OMWA 3PP2A 1NGMB 3VMZA 1GL2D 3O96A 1UNQA 5KLVD 2Z0OA 3AE2C 1URQA 1FZFA 2LULA 1MV8A 4OGQC 4K3AA 1S5LH 1JB0J 1LTAC 4KHAA 1OVRA 4JYBA 5CCHD 1BE3E 3HE5B 5AW1B 1VF5D 3TF5A 5CJ0A 2KK7A 4D0NB 2IFNA 2JP3A 3ABVC 1QVFO 3Q5PA 3KY9A 2OYIB 4PQ0A 3RK3C 3CXHE 2BCCD 2WSSH 2J0KA 1CI6A 4IOIH 3OW2O 3SFDC 2EMTA 1HTLC 2UZSA 2YKOA 2NPSA 2PFXA 3HSAA 1QL1A 2OARA 3PP5A 4DT0A 4EJNA 5KJ7A 1KB9I 1L0LE 2JWAA 4Y99B 3CC4P 3CX5D 2W8ZA 3D71A 4HAVB 3H1LE 5AVXB 4EDFA 2AL6A 2I1KA 3L71D 4WSFA 2DX1A 5D3XA 2CPSA 4AQRD 1EZVE 4IL6E 3VTPC 2LXCB 4BBKA 1EDIA 1BDCA 1IO4A 1MZ9A 3CX5H 5H2FE 2Z4DA 2KLVA 2OQQA 2RLOA 3IF4A 3MUDA 1N8RQ 2OYIC 3ZDTA 4PJ0E 3AEBC 3H1JE 5TJHA 3TSIA 1SQQK 1N7SB 2G35A 5APYA 2N0YA 1IK7A 1BCCG 3B8EB 3X23A 5AW0B 1U5GA 1VQMP 1A02J 3EWKA 4BWNA 1OQNA 4R4LA 3N7NA 2IBZD 1KILE 2WPSA 3HTKA 1FDMA 2A06E 2KNCA 1X1FA 1FOSF 4KHBA 1YITP 3KRXA 1Q86Q 5IRSA 3VOPA 1J1DB 1YTZI 4NY0A 2L91A 2W6BA 1ZM0A 3IVFA 4L75A 1N7SC 2P0DA 2V7QJ 3QWMA 2KGXB 4GODA 1V5PA 2LOXA 1SQVE 1URQD 2M0BA 3AEAC 1LT9A 3TGUJ 1WRGA 1PLSA 2M38A 5KAIE 1T3UA 5JHHA 3KPEA 3F5HA 1WI1A 4WB4A 3CWBJ 2RSGA 2NZ8B 5LOPB 1RE4A 1W2BO 2KIGA 2IYOA 1SFCB 1NTZJ 2GA1A 4TYZA 2HE7A 2X18A 3CX5I 4AUWA 5B5EH 3P32A 2YXQB 2A45G 2LYDA 1J1DC 2KB7P 1XKEA 4PV1C 2Y8GA 5APVA 2M3EA 1IK9A 3TO1A 2QJKB 2ADZA 1LB1A 1BDDA 1KTMA 3N7CA 4H0LB 1ISNA 3H1KG 2Q5UA 1SQBG 1S2EA 2GCJA 3B5NC 5KJ7D 3RL0D 3U1CA 1KYOD 2WSEH 3T06A 1YJWP 1NTYA 4MK0A 3I55P 4I6MC 2I5FA 3BCCG 1NJIQ 1OY2A 2R09A 4CPGA 4Z2MB 2H89C 5DHAB 5GTIE 3AEFC 2BEZF 3PVWA 5M1BA 2K2JA 1KILB 5APQA 1JO5A 4GNKB 1OIPA 2WTYA 1FZAA 1P84D 1RF0A 2DHJA 3HRNA 1BCCD 3RBXA 4QJ3B 4WBAA 3FGAD 2NBVA 4N3YB 2QJKC 3CCJP 1YQ3C 2QJPB 1KN7A 4H0LC 2K00A 1P84H 4UB6H 3EFFK 4HDOA 4WY4A 1L4AB 5KAFE 4HSIA 3TGUG 1JNMA 3KSYA 3G9WA 3HE4A 1LWUA 3TVVA 4C7NB 1MAIA 1FU1A 1UIXA 1WJ1A 3PTZA 3PZDA 5KLVK 1YJNP 1M1JB 1SGHA 2FYNC 3VMAA 1KILC 2DYQA 2Q7CA 4P7IA 3CCMP 1NTVA 5D3YA 1V88A 5JHGA 1JY2O 2AEMA 5AW6B 3T97A 4IFSA 1AQTA 3TNUB 2Y9ZA 5JP4A 2NPSC 2IYBA 4B6HA 3D6YA 3P6AA 2Y0DA 2QJPC 1N73B 3E1IA 1IJDB 2MWNB 1L4AC 1U5FA 3GHGB 1DEBA 1LP1B 2B87A 3M0DA 3D6ZA 1PL5A 3M9HA 1ZXGA 1H8AA 2O1KA 4H13B 1EF1A 2DTCA 3KHUA 2YMKA 3VP9A 1LNQA 3HUSA 3LW5H 3NSUA 3H1KD 1SQBD 1PPJE 3CIKA 4NPDA 1SQXK 2Z0PA 1GW4A 3MPXA 5DJUB 3P8MC 2KLUA 1NTMJ 2WPVB 5JLJB 1U27A 2YT0A 3BCCD 2H8PD 3L75G 3NTNA 2RH0A 1RJ2A 1N73C 4UB8H 2QM8A 2YF0A 1P84I 4KHOA 3GYOA 1JY3O 2HPCB 5CCGA 5AW5B 3V2NA 3G4SP 1LT1A 3GHGC 3L70G 2P2UA 5I2MA 2IYPA 2EJ8A 1X9VA 4W80A 1J2JB 2YSZA 1ZLLA 1BAKA 1FGZA 3MTUE 1RE3A 3L74E 2QVAA 4WWIA 3G6EP 3O6QB 2H7DA 2FKWB 2KI7B 3JCUH 4D6TJ 1EDJA 2E42A 5AVUB 2WT7A 4HAUB 1P3RA 5AW2B 1M7EA 3PG7A 3TGUD 5BVZA 3G3ZA 2V4HA 1J1EB 1T77A 1Q2NA 1AA0A 3EQ2A 1UEFA 2UVMA 5APXA 2YS3A 3H1HJ 1S1CX 3BRVB 1SHCA 1AVYA 2KUBA 3U12A 3E1RA 4NSWA 2GS0A 3H32B 4GMXB 1KZUB 4I1LA 3OJAB 3L73J 1X1GA 4HB4B 3L72J 2VKIA 1HGZA 2Z5IA 2OYHA 1OVVA 2WPQA 2FFDB 2C0XA 1BGYE 1TQZA 4L1RA 2Q1KA 1NTMG 3A0HH 1J0WA 3KDPB 3M9BA 4L74A 1L0NJ 3CPWO 1S5LX 1KQFB 2K88A 4A5KA 1NTKK 2I5CA 1VQNP 1X22A 1LTBC 4HH2A 4CHJA 5M4YB 1JMMA 2ZT9D 2D2QA 1E5WA 5CCHA 5KLVG 1AQ5A 5C5BB 1HJBA 2Z4EA 3KZIH 3WMM0 3AE7C 1NAYA 1FC2C 2FY8A 1BE3J 1JM0A 1IFNA 2ZYAA 5AW8B 4DBBA 2M3BA 2YT1A 3SWFA 3M1IB 1SQPK 5KQ1A 2FFDC 3L75D 2VRWB 5B66H 4EYYQ 5L81A 1QX8A 3AE6C 3Q1MA 4A6FB 1PIXA 2PRRA 2FYUE 1SVFA 3ZVRA 3L70D 4WY4C 2P1JA 1A02F 3F89A 3H1HG 2YIUB 1E79H 2Z5HA 3FXEA 5J3QA 1G2CB 1L0LJ 2JKVA 4N78E 5AVZB 3HD7B 3S1KA 3C1LA 4U3FE 3H1LJ 3L73G 2R2YA 3GMAA 3L72G 4RO0A 2KZIA 2IPPA 3ULCA 1S5LE 1SQXG 2HODA 5CMZA 3ULBA 5E79H 3IAOA 2VRSA 1BTNA 4B86A 1Q7YQ 3L4FA 3VYIA 4IFFA 1U5EA 4LLHA 3H1JJ 1L0NG 3VMYA 2ZXXA 2DHIA 1WVHA 1U2BA 1LJ2A 1T6AA 2M14A 4HAZB 1U29A 2ZFCA 3H1IE 3M0DC 4XA4A 2ZAEB 2YO3A 2FBWC 1PP9E 4GKGA 2YMYA 1T2KC 4K81A 1BE3G 2B9BA 2O01H 2M8RA 1VQPP 1U7MA 1NTMD 4WVZA 3HUSC 2E74B 4KT0J 2ZVNB 3CMAP 4A6HA 4Z1MH 2RN0A 3D70A 3AJ4A 1NOHA 1MUUA 4HAYB 2E5TA 3SO6A 2ELBA 2EC1A 4IL6X 3DXEA 3CX5E 3W67A 1R8EA 1FDIA 3KYQA 1PGQA 2HLOA 3L71E 5CCGC 1XTGB 1L0LG 4HB1A 1H10A 1Z87A 4BXLA 1SQBK 1SQVJ 1R5SA 3RK2D 2RMZA 4WJ7A 5LONB 1RE3C 1YQ4C 1HJ0A 2KS1A 1EZVG 2HG5D 4I7ZB 1X05A 1LTSC 2XDJA 2E74C 3R4YA 1FDOA 1ZC3B 3H1HD 4YXWH 3MHVA 2Y7BA 1GL2B 2ZYDA 1CW5A 1L2PA 1NTKG 3QBVB 3L73D 1DDWA 3L72D 2N23A 4CYEA 2XQNM 1SQXD 1PGJA 2Y0CA 1QL2A 5L8RJ 1SQPG 4I7ZC 3M0AA 4GOEA 1ZOYC 2A06G 2HFED 3O8ZA 2E76C 3OANA 3F5RA 2ITAA 2O01N 3U8ZA 3P8CD 1FHOA 1NTZK 1L0ND 3CC7P 2D11A 1JEKA 1H0TA 5DHFB 2N1TA 1K9MQ 4WVFB 1GL2C 1OXZA 3Q3DA 1B55A 3ITKA 2K49A 1PZQA 2C9NY 1FZCB 3A2AA 1NU2A 3ML4A 3GF3A 3IFMA 1HUCA 3A5TA 4DXAB 5B5EE 3V6IA 1Y5OA 1VDFA 2DHKA 1BE3D 1XTCC 4QMAA 5CCHC 2QE7H 1M8OB 1ZC4B 1SLQA 2C9LY 1VF5C 1EVHA 2NMBA 5CBOA 3TFMA 4C46A 3CCUP 5LG4B 3L37A 2I1JA 1IFMA 1NYHA 2P7JA 1JCCA 2M5AB 4PV1B 2H88C 3F0WA 1L0LD 1D7MA 3CCLP 1W1HA 3H6PA 3PLNA 1EC5A 3IR9A 1FZCC 1OVUA 4H8SA 3H1LD 2WSCH 3B5NB 1VQ9P 1DD3A 2XU6A 4GZUA 1KFNA 1BSHA 1UPQA 3AU4A 1EZVD 1YTZT 2RNRB 1KFMA 3V2PA 1SFCD 2KYVA 1MPHA 2KR0A 5FI1A 2XKMA 5C16A 5AW3B 1P84E 1ZP0C 4UB6E 1LTJA 2V76A 1BCCE 4LGDE 2OYOA 2QKLA 1H89A 3HW2B 4H44D 1NTKD 3WUTA 5AVRB 1WMKA 3EFGA 2XNXA 4XWXA 2J59M 2CPBA 1URQB 1X11A 3JSVC 1WGQA 2R3SA 1Q90D 2CK3H 1OW8A 5D3WA 1GU4A 1SQPD 1GG3A 1Q82Q 3NWFA 2A06D 2RVBB 2WSFJ 1PFIA 5APWA 4RKUJ 3A8QA 3JC22 1GC7A 4Z2NA 5D3VA 3AE5C 1KZ7A 1KYOH 3E7KA 2CY4A 2FYNB 3A8PA 3L74J 3FXDA 2D9YA 3AE8C 3L35A 5J3TA 1CI6B 2PAJA 5GTHH 3MDBC 2WZ7A 2N1TD 2NPSB 1S9KD 2IBZI 1RF1A 4PD4D 2UZRA 3RL0B 1NTMK 1KQGB 2YNYA 1AJYA 1URQC 2K9JA 1PFJA 4CHMA 2BEQD 1CSBA 2UWJE 1IFIA 1YHQP 1FZBA 4YONA 2PZ1A 4HB3B 2CAYA 1VQOP 1W1DA 4PD4H 3A3YB 5KCVA 2D9ZA 2FXMA 3CWBG 1XR0B 1UIIA 3V5WA 1Y47A 3H1KE 4L76A 4UB8E 1SQBE 1NTZG 1PV3A 4EIJA 1ZSQA 1AQCA 1EDKA 4U7JA 3CCRP 3DXCA 2GUMA 3BCCE 2JJLA 1R5LA 1BGYJ 2RGNB 1KC8Q 5KJ7C 3MD0A 1M7LA 1JCDA 3RL0C 1NU1J 3SSUA 3JCUE 1RRPB 1LW3A 1FAVA 1V5UA 4H13D 3N4XA 4N6JA 1NVOA 4NPFX 1DH3A 1YJ9P 1MFZA 4YL8A 3HTKB 4GDOA 4RESB 3BRTB 2FXPA 2D9VA 3M91A 1EQ7A 2KNCB 3WUVA 2W90A 1SP4A 4KHBB 3AEDC 4YPCA 2ROVA 3MUDC 2P0FA 1KYOI 1VQ6P 3CD6P 2FJUB 1V5MA 5GOWB 2GUVA 4L73A 2LR2A 3NWAA 2LXBA 3U1AA 1JTHA 1Q67A 5AW9B 5HE0A 2A45H 5CJ4A 4HATB 2D2CD 2P58A 3KRWA 2KXPB 5DIFB 1NI2A 2FYUJ 1LT9B 4HB0B 1DD4A 1SQQE 1L0NK 2QRXA 3GW6A 3CC2P 4HHVA 4R4MA 3A0HE 3R2PA 2DW3A 2OQBA 2Y8FA 1X79B 3SWKA 1JOCA 1FJPA 4U3FJ 1GDTA 1NKNA 3AE9C 4OVNF 1YIJP 2IX7C 1XCGA 2WWWA 1BGYG 2Z13A 3KZIE 1DBHA 4GPTB 3PEGA 1AV1A 2Q6QA 2YKPA 2WVRA 2V7QH 1NU1G 2XZRA 1P6SA 1BSNA 3CWBD 2GM4A 1LT9C 4GT1A 3PJSK 5B66E 1NTZD 1RY3A 1OMIA 3H1IJ 2BCJA 1L0LK 3BASA 2RUKB 1PP9J 3MGNA 1ZR2A 1RE4C 4ZKPA 3L75E 4JYCA 1X0TA 4TKNA 2ZXEB 5BU5A 2JDIH 4CSQA 2YKQA 1J19A 3L70E 4BRYA 2E2XA 2ZYGA 1KMIZ 2W2XD 1ZRTD 2A45I 1IFJA 4WY4B 4IAPA 3HE5A 4OH8B 1X86A 2R32A 3HE4B 1LWUB 3AU5A 5E79E 4F7GA 3L71J 4QJ4B 4GIFA 3WYFB 1N86A 2OYIA 2CRFA 1LTIC 1PMSA 4TT3H 3P7ZA 2E75D 2JP2A 3AE1C 4U3FG 2KIKA 4XFJA 4ZNCA 3CCVP 4TLFA 5FI0A 1RF0C 1Z56A 3WU2H 1RQUA 3V4QA 4D6TG 4IFDK 3T97B 5DJTB 1I7AA 2QA4P 5EFWB 1NAFA 1S72P 1KQSO 1RF1C 4OSNA 2HYNA 2OTLP 4JF7A 3HD7D 4GN1A 3FWLA 4Y94A 5TISH 2PGDA 1X8YA 2LKOA 1K04A 3B4SA 2B87B 1MK9B 2ZT9B 1LWUC 2KP8A 2DLWA 2Z0QA 3PHLA 1M57D 2YS1A 1FBMA 1PP9G 1FOSE 2R5BA 1JY2N 2CY5A 1GK6A 1N7SA 3BVHA 1GC6A 1BGYD 3HUSB 2FJLA 2JWDA 3U59A 1W5CE 1NU1D 2AEJA 1NO4A 5KLVE 2Z59A 1WGUA 2BASA 2IFSA 3NFQA 4OGQD 1MI1A 4MT7A 3C8VA 3CCEP 1RQVA 4LC1A 1BWNA 3HQCA 1FOEA 1KB9D 1ZVRA 3K5BA 2ZT9C 1JY2P 2E75C 1HWTC 3L36A 1U5DA 1OFCX 2IZ0A 3TCAA 1G1IA 3I56P 3RK3D 5D27A 3PSCA 2WMMA 2ZJSE 1PGPA 1KB9H 2BCCE 4QXAB 3GYPA 3UZTA 3FEHA 2DN6A 2WT7B 2W83C 4EI2A 1QC6A 2G8YA 4JQ0D 2Q3EA 2XV5A 3NXSA 1JY3N 3II6A 5APTA 4QJ5B 4OT1A 4L6EA 1SQXE 2ELAA 1W2EA 4ZRKA 4U3FD 1KD1Q 3D8FA 1V89A 1SFCA 2P67A 1I2HA 2VSZA 1VQ8P 1FZEA 2MDXA 4IOYX 3OAKA 3H1LG 1BTKA 4D6TD 1UPRA 1VPCA 1JUNA 1DROA 2OYHB 3AE3C 1KI1B 1RHZB 2E76B 1K8AQ 1WJMA 1GW3A 4BRYB 2AXTH 1BCCJ 3FVCA 4K17A 1JY3P 1IFPA 2NZ2A 3GG2A 2R44A 4ZRJA 4DIXA 1QGKB 1DDVA 1FHWA 1ZR4A 3H1JG 5KKZC 3H1ID 2P0HA 1PP9D 1VQ7P 1OWAA 1LTGC 3FM8C 1GMJA 3FSSA 2D9XA 2Y0EA 3RK2B 3Q5SA 2IBZE 1KQLA 3CL3D 1KILA 1MIXA 1QLED 1KZGA 1VF5B 2D4QA 3TW1A 1N3HA 3M06A 1N7SD 5I2SA 2OYHC 3AEGC 1MKEA 4NPEA 1HVVA 1L4AA 1K73Q 2H43A 3DXDA 3FX0A 4F7HA 1ZV8A 1VQ4P 4C7NA 2IFMA 1EDLA 2J0JA 3A0BH 3H25A 2KUPA 1WG7A 2L5GB 3PVUA 2W27A 1P5TA 5CHXA 2Q3IA 1FAOA 1M1JA 3RK2C 3LW5J 1SQVG 1QEXA 1EXJA 3TDKA 2K9YA 1HGVA 1YI2P 3TNUA 4PV1D 1NTKE 3A98B 3CXHD 2XNDH 2HODB 3H1KJ 1SQBJ 1K5DB 2QEXP 5C79A 2MKVA 1N73A 2LG1A 4Y99C 3B5ND 5KTBA 3BINA 2D10A 3BCCJ 3GHGA 3GF7A 1LP1A 3CXHH 2OTJP 1KYOE 2DX5A 4HB2B 1SQPE 3RL0g 3HIEA 5APSA 1SS1A 2H7EA 3ODWA 1GK4A 2Q9IA 1N2DC 2J58A 2MKRA 3BJIA 1T3JA 5AW4B 5GTHE 3G9RA 1HBWA 1G1JA 3I5CA 1NH4A 1XODA 3SUZA 1OW7A 3B71A 2DKQA 1VQKP 2COFA 4I2LC 4IL6H 2I8DA 1S9KE 3H1JD 4H0LD 4PD4E 3OHMB 4K35A 3AEEC 3M9QA 5H2FH 3QIJA 3PH0A 3HK0A 5HE2A 2HPCA 4RJTA 4DX90 2W6AA 2COAA 1CZQA 1S4XA 2GCLA 4PJ0H 1U7JA 1TU3F 2IZ1A 4MN4C 3SV1A 1NU1K 1FE6A 1T8ZA 1KILD 1SQQJ 3O6QA 2FXOA 2KS1B 3QH9A 3CCSP 1PGOA 2MFQA 2NPSD 4GOFA 2H7HA 3KQGA 1ZYIA 4H44B 4GMVA 3LIDA 2GUSA 1N7LA 4HDQA 5J3YA 1L4AD 3FWNA 1FHXA 4EKUA 2DKPA 3DCXA 1IZNB 2K8EA 4C7RA 1SQVD 2YRYA 1DIPA 3D8EA 3CXHI 3H32A 2KSJA 4EOTA 5K5GB 3VN0A 1SFCC 1YBKA 5C39A 1M7RA 2FYUK 3BATA 2OTKE 2HR3A 3TK1A 2Y9YA 2KCJA 4IFMA 2FFDA 4KJMA 2B89A 4W7YA 4YTPC 3RCPA 4YXDC 3S4RA 4AYCA 5KAIH 2Z14A 2DYNA 4H44C 3L75J 5AVSB 1EZVI 1H0TB 5C6RA 2N1TB 3P7KA 4KHXA 1PPJG 3L70J 3S9OA 2EMSA 5AVQB 3CCQP 4W7ZA 2OTXA 1H88A 3SNHA 5C5BA 1DDMA 2QIWA 3ZDMA 2J5UA 1VQLP 1TJ6A 4DJGA 3C9IA 1FGYA 1SQQG 3B77A 2FYZA 3Q2YA 3WA0A 2Q13A 1M90Q 1K05A 3D8DA 4MY6A 2C0WA 4A6FA 2YT2A 4EMOA 3L74G 1Y8AA 2IDBA 2RKLA 3RBZA 5GTIH 1Q81Q 3LJUX 4KVGB 3TGUE 3CMEP 3CXBB 3CLQA 2N1TC 4HKZH 1FS0E 4DX8A 1FZGA 1G2CA 3CWBE 3V4WA 3V5BA
chains in the Genus database with same CATH topology
2NZ8B 5LOPB 1X05A 1LTSC 1RE4A 2XDJA 2AEHA 3HD7A 1NAFA 2R5DA 1RF1C 1ZC3B 1GD2E 1SFCB 1UNPA 2HYNA 4TYZA 1TXDA 4JF7A 2HE7A 2X18A 3UIAA 1M1JC 3HD7D 4AUWA 2Y7BA 1GL2B 4GN1A 3P32A 2A45G 4Y94A 2LYDA 1YYCA 1X8YA 1J1DC 2KB7P 1GU5A 1CW5A 1XKEA 5APVA 2LKOA 2Y8GA 4DOJA 1IK9A 1GTWA 3TO1A 1MK9B 2L2IA 2ADZA 3QBVB 1LB1A 1LWUC 1LTJB 2KP8A 4HAWB 4KAXB 2DLWA 2Z0QA 1ISNA 2E43A 2R3CA 1V61A 3N7CA 1DDWA 2Q5UA 2YS1A 1FBMA 1FOSE 5APUA 2R5BA 2GCJA 3B5NC 1JY2N 5KJ7D 1MK7B 3RL0D 2CY5A 2N23A 3U1CA 4CYEA 2WSEH 2XQNM 1K5GB 3T06A 1GK6A 1N7SA 3BVHA 1NTYA 1GC6A 4MK0A 4I6MC 2I5FA 1QL2A 3HUSB 1XD4A 2FJLA 1OY2A 2R09A 2HTHB 2PP6A 5AVWB 3M0AA 3U59A 4Z2MB 2YS5A 5DHAB 4ZRIA 2HFED 3O8ZA 4A6KA 3OANA 3F5RA 1NO4A 5KQ4A 3PVWA 3U8ZA 3P8CD 2K2JA 1WGUA 3KZ1A 1FHOA 1NTZK 2BASA 2WPRA 2IFSA 3NFQA 1KILB 5APQA 2D11A 1JO5A 5DHFB 4MT7A 2N1TA 1FZAA 2WTYA 1RF0A 4WVFB 1GL2C 1OXZA 3HRNA 2DHJA 1B55A 4LC1A 1BWNA 1AWEA 3HQCA 4WBAA 2C9NY 1FZCB 3A2AA 1FOEA 1NU2A 3ML4A 1ZVRA 3IFMA 1HUCA 3A5TA 4N3YB 5DI9B 4DXAB 1JY2P 1Y5OA 2ROZB 3ODXA 1LTJC 1UNRA 1VDFA 5AVYB 1HWTC 2DHKA 2K00A 2O1JA 3L36A 1U5DA 1XTCC 3SWYA 3TCAA 1G1IA 4WY4A 4HDOA 1L4AB 3RK3D 5CCHC 5D27A 1IC2A 3PSCA 1ZC4B 3SYXA 1EGXA 1JNMA 3KSYA 4WY4D 1DYNA 3G9WA 1SLQA 2ZPYA 3HE4A 1LWUA 2C9LY 4C7NB 3GYPA 3TVVA 3UZTA 1MAIA 1EVHA 5CLQB 2NMBA 1FU1A 3VP8A 3FEHA 3TFMA 2LKMA 4C46A 5CLLB 4F7UP 1WJ1A 2DN6A 1RF1B 2WT7B 5AVTB 1QC6A 3PZDA 5KLVK 3L37A 2P8VA 2LOZA 2I1JA 2XV5A 1M1JB 1IFMA 3NXSA 1SGHA 1JY3N 3TYYA 3II6A 2P7JA 5APTA 1KILC 1JCCA 2DYQA 2Q7CA 4P7IA 1NTVA 1QQGA 1V88A 3F0WA 1JY2O 5D3YA 5JHGA 4L6EA 5AW6B 2R0DA 1W1HA 3H6PA 3T97A 4IFSA 3IR9A 3TNUB 2ELAA 5JP4A 1W2EA 2NPSC 1FZCC 2IYBA 4ZRKA 4H8SA 4B6HA 2WSCH 3D8FA 3B5NB 1SFCA 2P67A 1V89A 2JEEA 2WSFH 4HAXB 1I2HA 2XU6A 1IFDA 4GZUA 3P6AA 1KFNA 1UPQA 2VSZA 3AU4A 1YTZT 2RNRB 1J1EC 1FZEA 1KFMA 3OAKA 3V2PA 1N73B 1GL2A 1SFCD 2KYVA 3E1IA 1BTKA 1IJDB 1UPRA 2MWNB 1DX7A 1L4AC 1VPCA 1JUNA 1U5FA 1MPHA 5FI1A 2XKMA 1WT6A 3GHGB 5C16A 1DEBA 1DROA 4DZOA 2OYHB 5AW3B 1KI1B 2WITA 3M0DA 1LTJA 1WJMA 1GW3A 2V76A 3U7DA 3M9HA 4LGDE 4K17A 1XX0A 1JY3P 2KOGA 5AW7B 2QKLA 1H89A 3HW2B 1H8AA 1T2KD 2O1KA 4ZRJA 1EF1A 1DDVA 1FHWA 1ZR4A 2DTCA 5AVRB 3VP9A 3EFGA 3HUSA 3LW5H 2XNXA 3NSUA 4XWXA 2J59M 2P0HA 3CIKA 1OWAA 1SQXK 1Y19B 1GW4A 1LTGC 2Z0PA 3MPXA 2CPBA 3FM8C 3P8MC 3FSSA 3VMXA 2D9XA 1URQB 2YO2A 3RK2B 1X11A 3V2RA 1KQLA 3CL3D 1WGQA 1KILA 1MIXA 1SQVK 5JLJB 1U27A 2YT0A 2D9WA 5D3WA 5DH9B 2H8PD 3NTNA 1KZGA 1RJ2A 1GU4A 1N73C 2QM8A 1GG3A 2YF0A 2D4QA 4KHOA 2RVBB 3GYOA 3V2QA 1JY3O 3CI9A 2HPCB 1N3HA 3TW1A 5CCGA 4K2PA 1FZCA 1PFIA 5AW5B 3V2NA 1EAZA 5HE1A 5APWA 3M06A 1N7SD 3GHGC 1JTHB 2OYHC 3A8QA 2P2UA 1GC7A 1FB8A 1MKEA 5CCGD 2EJ8A 4Z2NA 1X9VA 5D3VA 4W80A 1J2JB 2YSZA 1ZLLA 5BU8B 1KZ7A 2W2XC 2CY4A 1HVVA 3OA7A 1FGZA 1BAKA 3A8PA 2DA0A 1L4AA 1RE3A 3MTUE 1IRSA 3A7OA 4HYTB 2D9YA 2H43A 3L35A 4PNKA 5J3TA 4XE5B 3DXDA 4F7HA 1ZN5A 1ZV8A 1CI6B 4C7NA 2IFMA 2PAJA 2H7DA 2FKWB 3MDBC 3VOQA 2WZ7A 1NHLA 2J0JA 2N1TD 2NPSB 2KUPA 1S9KD 2E42A 2L5GB 5AVUB 1WG7A 1RF1A 3PVUA 2W27A 2WT7A 1FJKA 5CHXA 1P3RA 1P5TA 2Q3IA 4HAUB 1FAOA 5AW2B 1M7EA 2UZRA 3RL0B 3PG7A 2POHA 5BVZA 3G3ZA 1M1JA 4GXBA 1J1EB 1NTMK 2YNYA 5HE3A 1URQC 3RK2C 1PFJA 4CHMA 2YVCA 1CSBA 4C0AA 1IFIA 3EQ2A 1UEFA 2UVMA 1FZBA 3PVLA 4YONA 2PZ1A 4O9BA 4HB3B 2CAYA 5APXA 2YS3A 2MJZA 1W1DA 2K2UA 1NKZB 1HGVA 3BRVB 3TNUA 3A3YB 1SHCA 5KCVA 1GZLA 3A98B 2D9ZA 2FXMA 2MDXA 2COCA 1XR0B 3V5WA 4NSWA 3B5NA 1MIZB 2HODB 2GS0A 2N9BA 1K5DB 1LGHB 3H32B 4ZKUA 4GMXB 5C79A 1KZUB 4I1LA 4K2OA 3OJAB 1N73A 2LG1A 2J0MA 4Y99C 3B5ND 3HD7C 5KTBA 1X1GA 3BINA 4HB4B 2CODA 4EIJA 1ZSQA 2VKIA 1HGZA 2Z5IA 2D10A 5AVVB 3LIEA 1AQCA 3DXCA 3GHGA 2OYHA 4M3LA 4N78D 2QKMA 2JJLA 2DX5A 2WPQA 4HB2B 2FFDB 2L1CA 2C0XA 5APSA 3MIWA 2DFKA 2H7EA 3ODWA 2RGNB 1GK4A 2Q9IA 1N2DC 2J58A 2W2WA 1TQZA 2MKRA 3RK3B 1NWQA 3BJIA 3VIAA 5KJ7C 2QM7A 3MD0A 1T3JA 5AW4B 2GJYA 1M7LA 1JCDA 3RL0C 1J0WA 1LTTC 5EFXA 3KDPB 1HH0A 3M9BA 1LW3A 1RRPB 1HBWA 1H4RA 1AFOA 3NMDA 1W1GA 3ODOA 1FAVA 1G1JA 3I5CA 1NH4A 3P8CE 1V5UA 1XODA 3SUZA 1OMWA 3PP2A 3N4XA 3VMZA 1GL2D 4N6JA 3O96A 1UNQA 2Z0OA 4A5KA 1NTKK 2I5CA 2DKQA 1DH3A 2COFA 1MFZA 4YL8A 1LTBC 4HH2A 4CHJA 3HTKB 1URQA 4RESB 3BRTB 1JMMA 4I2LC 1FZFA 2LULA 2D2QA 2D9VA 1E5WA 5CCHA 1MV8A 1EQ7A 3M91A 1S9KE 1AQ5A 5C5BB 1HJBA 1LTAC 1SP4A 4KHAA 3M9QA 2Z4EA 4JYBA 4KHBB 2ROVA 3WMM0 5CCHD 3QIJA 2P0FA 3HK0A 5HE2A 1V5MA 5GOWB 2HPCA 2GUVA 1IFNA 5AW8B 4DBBA 2M3BA 3HE5B 3U1AA 5AW1B 2YT1A 2W6AA 4DX90 3SWFA 5CJ0A 1JTHA 1SQPK 1CZQA 1Q67A 2COAA 5AW9B 3M1IB 2IFNA 5HE0A 2GCLA 4D0NB 5KQ1A 2A45H 2FFDC 5CJ4A 4HATB 2VRWB 3SV1A 3KY9A 2OYIB 4PQ0A 3KRWA 5DIFB 3RK3C 5L81A 1NU1K 1NI2A 4A6FB 1LT9B 1T8ZA 1SVFA 2J0KA 4HB0B 3ZVRA 1KILD 1CI6A 2P1JA 4WY4C 1L0NK 2EMTA 1HTLC 1A02F 4HHVA 2UZSA 2YKOA 2NPSA 3R2PA 2Z5HA 1QL1A 2OARA 3PP5A 1G2CB 2OQBA 5KJ7A 4EJNA 5J3QA 2MFQA 2NPSD 4N78E 2H7HA 2Y8FA 1X79B 5AVZB 3KQGA 4Y99B 3HD7B 4GMVA 1JOCA 3LIDA 1FJPA 1GDTA 4HAVB 5AVXB 2AL6A 2GUSA 1NKNA 1N7LA 4HDQA 2I1KA 5J3YA 4WSFA 2DX1A 1L4AD 5D3XA 4IOYX 4EKUA 1FHXA 2CPSA 4AQRD 3VTPC 2DKPA 4BBKA 2IPPA 4C7RA 2IX7C 3ULCA 1XCGA 2YRYA 1IO4A 1MZ9A 2HODA 2WWWA 5CMZA 3D8EA 3H32A 2KLVA 1DBHA 4GPTB 2KSJA 3PEGA 3ULBA 4EOTA 2YKPA 2RLOA 2VRSA 3MUDA 3VN0A 1SFCC 2OYIC 2XZRA 1BTNA 1M7RA 4B86A 1P6SA 3L4FA 2FYUK 4IFFA 3BATA 3VYIA 1U5EA 3ZDTA 4LLHA 2GM4A 3TK1A 1LT9C 1SQQK 4GT1A 3TSIA 2KCJA 1N7SB 3VMYA 4IFMA 2FFDA 2DHIA 1WVHA 2G35A 1U2BA 4W7YA 2M14A 1RY3A 5APYA 4HAZB 3RCPA 1U29A 2ZFCA 2N0YA 2BCJA 1L0LK 4AYCA 3BASA 3M0DC 4XA4A 2YO3A 3B8EB 2RUKB 3MGNA 2DYNA 4GKGA 5AW0B 1ZR2A 2YMYA 3X23A 1RE4C 1T2KC 1U5GA 4ZKPA 4K81A 4JYCA 5AVSB 4TKNA 2ZXEB 5BU5A 1A02J 5C6RA 2N1TB 3P7KA 1OQNA 2YKQA 2O01H 2M8RA 1J19A 4KHXA 3N7NA 2WPSA 3HUSC 3HTKA 1FDMA 2E2XA 2EMSA 5AVQB 4A6HA 4W7ZA 1X1FA 2OTXA 1H88A 3SNHA 5C5BA 1DDMA 3AJ4A 2W2XD 1FOSF 2A45I 1NOHA 1MUUA 3KRXA 4HAYB 1IFJA 4WY4B 1TJ6A 3SO6A 2ELBA 2EC1A 3VOPA 3C9IA 1FGYA 1J1DB 4IAPA 1YTZI 4NY0A 3DXEA 2W6BA 1ZM0A 3IVFA 3HE5A 4OH8B 2FYZA 1X86A 2R32A 3HE4B 1LWUB 3KYQA 1N7SC 2P0DA 3AU5A 2HLOA 3WA0A 4F7GA 2Q13A 5CCGC 1XTGB 4GIFA 3QWMA 3WYFB 1H10A 1Z87A 2KGXB 1N86A 1SQBK 2OYIA 1V5PA 1LTIC 2CRFA 3D8DA 1PMSA 2LOXA 3P7ZA 4MY6A 2C0WA 2JP2A 1URQD 3RK2D 4A6FA 4EMOA 1LT9A 3LJUX 4KVGB 4WJ7A 5LONB 1RE3C 1WRGA 1PLSA 2M38A 5FI0A 3CXBB 2HG5D 3CLQA 1T3UA 2N1TC 5JHHA 3KPEA 1RF0C 1WI1A 1Z56A 4WB4A 3V4QA 4DX8A 1FZGA 4IFDK 1G2CA 3V4WA 3V5BA 1I7AA 2RSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ8 B;  5LOP B;  1X05 A;  2AEH A;  1ZC3 B;  1UNP A;  4TYZ A;  1TXD A;  2HE7 A;  2X18 A;  2Y7B A;  4GN1 A;  4Y94 A;  2LYD A;  1XKE A;  2Y8G A;  2LKO A;  3TO1 A;  1MK9 B;  2L2I A;  2ADZ A;  3QBV B;  1LB1 A;  4HAW B;  4KAX B;  2DLW A;  2Z0Q A;  1ISN A;  3N7C A;  1V61 A;  1DDW A;  2YS1 A;  2GCJ A;  1MK7 B;  2CY5 A;  2N23 A;  4CYE A;  2WSE H;  2XQN M;  1K5G B;  3T06 A;  1NTY A;  1GC6 A;  4MK0 A;  2I5F A;  1XD4 A;  2FJL A;  1OY2 A;  2R09 A;  2HTH B;  4Z2M B;  2YS5 A;  5DHA B;  4ZRI A;  4A6K A;  3OAN A;  3F5R A;  5KQ4 A;  3PVW A;  3U8Z A;  2K2J A;  1WGU A;  3KZ1 A;  1FHO A;  1NTZ K;  2IFS A;  2D11 A;  5DHF B;  4MT7 A;  4WVF B;  2DHJ A;  1B55 A;  1BWN A;  1AWE A;  3HQC A;  1FOE A;  1NU2 A;  3ML4 A;  1ZVR A;  5DI9 B;  4DXA B;  1Y5O A;  2ROZ B;  3ODX A;  1UNR A;  2DHK A;  2K00 A;  1U5D A;  3TCA A;  4HDO A;  5D27 A;  3PSC A;  1ZC4 B;  3SYX A;  1EGX A;  3KSY A;  3G9W A;  1DYN A;  2ZPY A;  3TVV A;  3GYP A;  3UZT A;  1MAI A;  1EVH A;  5CLQ B;  2NMB A;  3TFM A;  3FEH A;  2LKM A;  5CLL B;  4F7U P;  1WJ1 A;  2DN6 A;  1QC6 A;  3PZD A;  5KLV K;  2P8V A;  2LOZ A;  2I1J A;  1SGH A;  2DYQ A;  4P7I A;  1NTV A;  1QQG A;  1V88 A;  3F0W A;  5D3Y A;  5JHG A;  4L6E A;  2R0D A;  1W1H A;  4IFS A;  2ELA A;  5JP4 A;  4ZRK A;  2IYB A;  4H8S A;  4B6H A;  2WSC H;  3D8F A;  1V89 A;  2WSF H;  4HAX B;  1I2H A;  4GZU A;  3P6A A;  1UPQ A;  2VSZ A;  3AU4 A;  2RNR B;  2MDX A;  4IOY X;  1BTK A;  1UPR A;  2MWN B;  1U5F A;  1MPH A;  5FI1 A;  5C16 A;  1DRO A;  1KI1 B;  1WJM A;  2V76 A;  3U7D A;  4K17 A;  1XX0 A;  2QKL A;  3HW2 B;  4ZRJ A;  1EF1 A;  1DDV A;  1FHW A;  2DTC A;  3LW5 H;  3NSU A;  4XWX A;  2J59 M;  2P0H A;  3CIK A;  1SQX K;  1Y19 B;  2Z0P A;  3MPX A;  3FM8 C;  3FSS A;  2D9X A;  1X11 A;  1WGQ A;  1MIX A;  1SQV K;  5JLJ B;  1U27 A;  2YT0 A;  2D9W A;  5D3W A;  5DH9 B;  1KZG A;  1RJ2 A;  1GG3 A;  2YF0 A;  2D4Q A;  4KHO A;  2RVB B;  3GYO A;  3TW1 A;  1N3H A;  4K2P A;  5HE1 A;  1EAZ A;  3A8Q A;  1GC7 A;  1FB8 A;  1MKE A;  2EJ8 A;  4Z2N A;  5D3V A;  2YSZ A;  1KZ7 A;  2W2X C;  1BAK A;  2CY4 A;  1FGZ A;  3A8P A;  2DA0 A;  1IRS A;  2D9Y A;  4PNK A;  5J3T A;  3DXD A;  4F7H A;  2H7D A;  3MDB C;  3VOQ A;  2J0J A;  2KUP A;  1WG7 A;  3PVU A;  4HAU B;  1P3R A;  1P5T A;  1FAO A;  2UZR A;  1M7E A;  3PG7 A;  3G3Z A;  4GXB A;  5HE3 A;  1NTM K;  1PFJ A;  4CHM A;  2YVC A;  4C0A A;  1UEF A;  2UVM A;  3PVL A;  4YON A;  2PZ1 A;  4HB3 B;  2CAY A;  2YS3 A;  1W1D A;  2K2U A;  1SHC A;  5KCV A;  3A98 B;  2D9Z A;  2COC A;  1XR0 B;  3V5W A;  4NSW A;  1MIZ B;  2GS0 A;  1K5D B;  5C79 A;  4GMX B;  4K2O A;  2LG1 A;  2J0M A;  3BIN A;  1X1G A;  4HB4 B;  2COD A;  1ZSQ A;  2VKI A;  2D10 A;  1AQC A;  3DXC A;  2QKM A;  2DX5 A;  4HB2 B;  2L1C A;  2DFK A;  2H7E A;  3ODW A;  2RGN B;  2W2W A;  1TQZ A;  2MKR A;  3BJI A;  3VIA A;  2GJY A;  1J0W A;  5EFX A;  1RRP B;  1LW3 A;  1H4R A;  3ODO A;  1W1G A;  1V5U A;  1XOD A;  3SUZ A;  1OMW A;  3PP2 A;  3O96 A;  1UNQ A;  2Z0O A;  4A5K A;  1NTK K;  2I5C A;  2DKQ A;  2COF A;  4YL8 A;  4CHJ A;  2LUL A;  2D2Q A;  2D9V A;  1E5W A;  5C5B B;  4KHA A;  3M9Q A;  4KHB B;  2ROV A;  3QIJ A;  2P0F A;  3HK0 A;  5HE2 A;  1V5M A;  5GOW B;  4DBB A;  2YT1 A;  4DX9 0;  2COA A;  1SQP K;  1Q67 A;  3M1I B;  5KQ1 A;  4D0N B;  5HE0 A;  2GCL A;  4HAT B;  2VRW B;  3SV1 A;  3KY9 A;  4PQ0 A;  3KRW A;  5DIF B;  5L81 A;  1NU1 K;  1NI2 A;  4A6F B;  2J0K A;  4HB0 B;  3ZVR A;  1L0N K;  2EMT A;  4HHV A;  2UZS A;  2OAR A;  4EJN A;  2OQB A;  5J3Q A;  2MFQ A;  2Y8F A;  4GMV A;  4HAV B;  2AL6 A;  4HDQ A;  2I1K A;  5J3Y A;  4WSF A;  2DX1 A;  5D3X A;  4EKU A;  1FHX A;  2DKP A;  4BBK A;  3ULC A;  1XCG A;  2YRY A;  3D8E A;  4GPT B;  1DBH A;  3ULB A;  3PEG A;  2RLO A;  1M7R A;  1BTN A;  1P6S A;  2FYU K;  1U5E A;  3ZDT A;  1SQQ K;  2KCJ A;  2DHI A;  1WVH A;  2G35 A;  1U2B A;  2M14 A;  4HAZ B;  3RCP A;  1U29 A;  2N0Y A;  2BCJ A;  1L0L K;  2RUK B;  2DYN A;  3X23 A;  1U5G A;  4K81 A;  4TKN A;  5C6R A;  1OQN A;  2O01 H;  1J19 A;  2E2X A;  2EMS A;  4A6H A;  1X1F A;  2OTX A;  3SNH A;  5C5B A;  1DDM A;  3AJ4 A;  2W2X D;  3KRX A;  4HAY B;  1TJ6 A;  3SO6 A;  2ELB A;  2EC1 A;  1FGY A;  4IAP A;  4NY0 A;  3DXE A;  1ZM0 A;  3IVF A;  1X86 A;  3AU5 A;  2P0D A;  4F7G A;  3WA0 A;  2Q13 A;  3QWM A;  3WYF B;  1H10 A;  1Z87 A;  2KGX B;  1SQB K;  2CRF A;  1V5P A;  3D8D A;  1PMS A;  2LOX A;  3P7Z A;  4MY6 A;  2JP2 A;  4A6F A;  4EMO A;  3LJU X;  4KVG B;  4WJ7 A;  5LON B;  1PLS A;  2M38 A;  5FI0 A;  3CXB B;  3CLQ A;  5JHH A;  1WI1 A;  4DX8 A;  4IFD K;  1I7A A;  2RSG A; 
#chains in the Genus database with same CATH topology
 2W6J H;  3USS A;  1S3J A;  2NRG A;  3HD7 A;  1JMB A;  5CBN A;  2R5D A;  2AEH A;  1GD2 E;  1UNP A;  1NTZ E;  1TXD A;  2O01 J;  3UIA A;  1M1J C;  4ZMD A;  2B88 A;  2JR8 A;  1YYC A;  2P10 A;  2QJY B;  1GU5 A;  4DOJ A;  1GTW A;  5KAF H;  2L2I A;  1LTJ B;  4HAW B;  4KAX B;  4PD4 I;  3AE4 C;  2E43 A;  2R3C A;  1V61 A;  5APU A;  1MK7 B;  3W68 A;  1K5G B;  2K3R A;  2KIE A;  1ZRT E;  1M56 D;  1XD4 A;  2E5Y A;  2ZKM X;  2HTH B;  2PP6 A;  5AVW B;  2D2C B;  3KXD A;  2YS5 A;  4ZRI A;  4A6K A;  5KQ4 A;  5KLV J;  3KZ1 A;  2WPR A;  4DCK A;  4JBZ A;  4Y28 J;  1KOR A;  3WU2 E;  4H13 C;  1OZH A;  1AWE A;  1ZME C;  4D6W A;  2QJY C;  3NW8 A;  1VQ5 P;  5DI9 B;  4ASW A;  2ROZ B;  3ODX A;  1LTJ C;  1DEE G;  1UNR A;  5AVY B;  5TIS E;  2O1J A;  3SWY A;  1ZW0 A;  1IC2 A;  1PPJ D;  3RGU A;  3SYX A;  1OX3 A;  1EGX A;  2N9Y B;  4WY4 D;  2BCC J;  1DYN A;  2ZPY A;  5CLQ B;  3VP8 A;  2LKM A;  2QG4 A;  5CLL B;  1AVO A;  4F7U P;  1RF1 B;  5AVT B;  2D2C C;  2ZVO B;  2P8V A;  2LOZ A;  3G71 P;  1SQQ D;  2K9J B;  3TYY A;  2JO1 A;  4A7P A;  2FYU G;  1QQG A;  1RH5 B;  2R0D A;  1MFT A;  1SQX J;  3IN6 A;  2KZJ A;  3L74 D;  4GOU A;  2JEE A;  2WSF H;  4HAX B;  1IFD A;  1U57 A;  3QWO C;  1NU1 E;  1J1E C;  1GL2 A;  3Q5R A;  1DX7 A;  1WT6 A;  4DZO A;  2WIT A;  3PRJ A;  3U7D A;  1XX0 A;  1Y9B A;  2KOG A;  1KB9 E;  5AW7 B;  1OW6 A;  1QVG O;  1T2K D;  1M1K Q;  2AXC A;  1VL2 A;  1HF9 A;  3RK3 E;  1Y19 B;  5KLI B;  3SFE C;  2E75 B;  3VMX A;  3H1I G;  2YO2 A;  3V2R A;  1NTM E;  1SQV K;  2D9W A;  5DH9 B;  2WSC J;  3CI9 A;  3V2Q A;  2BCC G;  4K2P A;  1FZC A;  5HE1 A;  1EAZ A;  1JTH B;  1FB8 A;  5CCG D;  2WQY C;  5BU8 B;  2W2X C;  1EXI A;  3OA7 A;  2DA0 A;  1IRS A;  3A7O A;  2KUQ A;  4HYT B;  2G3A A;  4PNK A;  4XE5 B;  2KSE A;  1USD A;  1ZN5 A;  2AXT E;  1USE A;  3VOQ A;  1NHL A;  4D6T E;  3L71 G;  1MKM A;  3GLM A;  1FJK A;  2SPZ A;  5KLI C;  2POH A;  2E74 D;  3MP7 B;  4GXB A;  5HE3 A;  4JPZ B;  2OGU A;  2YVC A;  4C0A A;  2M5A A;  3PVL A;  4O9B A;  2MJZ A;  3H1H E;  2RRF A;  2K2U A;  1NKZ B;  1NTK J;  1GZL A;  2YIU C;  1KV4 A;  2COC A;  3A58 A;  2K1A A;  2WSE J;  3B5N A;  1MIZ B;  4OGQ B;  2N9B A;  2FYU D;  1LGH B;  2K37 A;  4ZKU A;  4K2O A;  2AEF A;  2J0M A;  2QSI A;  3L73 E;  3HD7 C;  3AEC C;  2COD A;  3WUU A;  5KKZ B;  3L72 E;  4OWF A;  5AVV B;  3LIE A;  4M3L A;  4N78 D;  2QKM A;  1SQP J;  2L1C A;  3MIW A;  2DFK A;  2W2W A;  2E76 D;  3RK3 B;  1NWQ A;  3VIA A;  2QM7 A;  2IBZ G;  2GJY A;  3NWD A;  4ASV A;  5EFX A;  1LTT C;  1HH0 A;  3A0B E;  2YXR B;  3NMD A;  4HJG H;  1AFO A;  1H4R A;  1W1G A;  3ODO A;  3P8C E;  3MZW B;  2O3J A;  1L0N E;  1OMW A;  3PP2 A;  1NGM B;  3VMZ A;  1GL2 D;  3O96 A;  1UNQ A;  5KLV D;  2Z0O A;  3AE2 C;  1URQ A;  1FZF A;  2LUL A;  1MV8 A;  4OGQ C;  4K3A A;  1S5L H;  1JB0 J;  1LTA C;  4KHA A;  1OVR A;  4JYB A;  5CCH D;  1BE3 E;  3HE5 B;  5AW1 B;  1VF5 D;  3TF5 A;  5CJ0 A;  2KK7 A;  4D0N B;  2IFN A;  2JP3 A;  3ABV C;  1QVF O;  3Q5P A;  3KY9 A;  2OYI B;  4PQ0 A;  3RK3 C;  3CXH E;  2BCC D;  2WSS H;  2J0K A;  1CI6 A;  4IOI H;  3OW2 O;  3SFD C;  2EMT A;  1HTL C;  2UZS A;  2YKO A;  2NPS A;  2PFX A;  3HSA A;  1QL1 A;  2OAR A;  3PP5 A;  4DT0 A;  4EJN A;  5KJ7 A;  1KB9 I;  1L0L E;  2JWA A;  4Y99 B;  3CC4 P;  3CX5 D;  2W8Z A;  3D71 A;  4HAV B;  3H1L E;  5AVX B;  4EDF A;  2AL6 A;  2I1K A;  3L71 D;  4WSF A;  2DX1 A;  5D3X A;  2CPS A;  4AQR D;  1EZV E;  4IL6 E;  3VTP C;  2LXC B;  4BBK A;  1EDI A;  1BDC A;  1IO4 A;  1MZ9 A;  3CX5 H;  5H2F E;  2Z4D A;  2KLV A;  2OQQ A;  2RLO A;  3IF4 A;  3MUD A;  1N8R Q;  2OYI C;  3ZDT A;  4PJ0 E;  3AEB C;  3H1J E;  5TJH A;  3TSI A;  1SQQ K;  1N7S B;  2G35 A;  5APY A;  2N0Y A;  1IK7 A;  1BCC G;  3B8E B;  3X23 A;  5AW0 B;  1U5G A;  1VQM P;  1A02 J;  3EWK A;  4BWN A;  1OQN A;  4R4L A;  3N7N A;  2IBZ D;  1KIL E;  2WPS A;  3HTK A;  1FDM A;  2A06 E;  2KNC A;  1X1F A;  1FOS F;  4KHB A;  1YIT P;  3KRX A;  1Q86 Q;  5IRS A;  3VOP A;  1J1D B;  1YTZ I;  4NY0 A;  2L91 A;  2W6B A;  1ZM0 A;  3IVF A;  4L75 A;  1N7S C;  2P0D A;  2V7Q J;  3QWM A;  2KGX B;  4GOD A;  1V5P A;  2LOX A;  1SQV E;  1URQ D;  2M0B A;  3AEA C;  1LT9 A;  3TGU J;  1WRG A;  1PLS A;  2M38 A;  5KAI E;  1T3U A;  5JHH A;  3KPE A;  3F5H A;  1WI1 A;  4WB4 A;  3CWB J;  2RSG A;  2NZ8 B;  5LOP B;  1RE4 A;  1W2B O;  2KIG A;  2IYO A;  1SFC B;  1NTZ J;  2GA1 A;  4TYZ A;  2HE7 A;  2X18 A;  3CX5 I;  4AUW A;  5B5E H;  3P32 A;  2YXQ B;  2A45 G;  2LYD A;  1J1D C;  2KB7 P;  1XKE A;  4PV1 C;  2Y8G A;  5APV A;  2M3E A;  1IK9 A;  3TO1 A;  2QJK B;  2ADZ A;  1LB1 A;  1BDD A;  1KTM A;  3N7C A;  4H0L B;  1ISN A;  3H1K G;  2Q5U A;  1SQB G;  1S2E A;  2GCJ A;  3B5N C;  5KJ7 D;  3RL0 D;  3U1C A;  1KYO D;  2WSE H;  3T06 A;  1YJW P;  1NTY A;  4MK0 A;  3I55 P;  4I6M C;  2I5F A;  3BCC G;  1NJI Q;  1OY2 A;  2R09 A;  4CPG A;  4Z2M B;  2H89 C;  5DHA B;  5GTI E;  3AEF C;  2BEZ F;  3PVW A;  5M1B A;  2K2J A;  1KIL B;  5APQ A;  1JO5 A;  4GNK B;  1OIP A;  2WTY A;  1FZA A;  1P84 D;  1RF0 A;  2DHJ A;  3HRN A;  1BCC D;  3RBX A;  4QJ3 B;  4WBA A;  3FGA D;  2NBV A;  4N3Y B;  2QJK C;  3CCJ P;  1YQ3 C;  2QJP B;  1KN7 A;  4H0L C;  2K00 A;  1P84 H;  4UB6 H;  3EFF K;  4HDO A;  4WY4 A;  1L4A B;  5KAF E;  4HSI A;  3TGU G;  1JNM A;  3KSY A;  3G9W A;  3HE4 A;  1LWU A;  3TVV A;  4C7N B;  1MAI A;  1FU1 A;  1UIX A;  1WJ1 A;  3PTZ A;  3PZD A;  5KLV K;  1YJN P;  1M1J B;  1SGH A;  2FYN C;  3VMA A;  1KIL C;  2DYQ A;  2Q7C A;  4P7I A;  3CCM P;  1NTV A;  5D3Y A;  1V88 A;  5JHG A;  1JY2 O;  2AEM A;  5AW6 B;  3T97 A;  4IFS A;  1AQT A;  3TNU B;  2Y9Z A;  5JP4 A;  2NPS C;  2IYB A;  4B6H A;  3D6Y A;  3P6A A;  2Y0D A;  2QJP C;  1N73 B;  3E1I A;  1IJD B;  2MWN B;  1L4A C;  1U5F A;  3GHG B;  1DEB A;  1LP1 B;  2B87 A;  3M0D A;  3D6Z A;  1PL5 A;  3M9H A;  1ZXG A;  1H8A A;  2O1K A;  4H13 B;  1EF1 A;  2DTC A;  3KHU A;  2YMK A;  3VP9 A;  1LNQ A;  3HUS A;  3LW5 H;  3NSU A;  3H1K D;  1SQB D;  1PPJ E;  3CIK A;  4NPD A;  1SQX K;  2Z0P A;  1GW4 A;  3MPX A;  5DJU B;  3P8M C;  2KLU A;  1NTM J;  2WPV B;  5JLJ B;  1U27 A;  2YT0 A;  3BCC D;  2H8P D;  3L75 G;  3NTN A;  2RH0 A;  1RJ2 A;  1N73 C;  4UB8 H;  2QM8 A;  2YF0 A;  1P84 I;  4KHO A;  3GYO A;  1JY3 O;  2HPC B;  5CCG A;  5AW5 B;  3V2N A;  3G4S P;  1LT1 A;  3GHG C;  3L70 G;  2P2U A;  5I2M A;  2IYP A;  2EJ8 A;  1X9V A;  4W80 A;  1J2J B;  2YSZ A;  1ZLL A;  1BAK A;  1FGZ A;  3MTU E;  1RE3 A;  3L74 E;  2QVA A;  4WWI A;  3G6E P;  3O6Q B;  2H7D A;  2FKW B;  2KI7 B;  3JCU H;  4D6T J;  1EDJ A;  2E42 A;  5AVU B;  2WT7 A;  4HAU B;  1P3R A;  5AW2 B;  1M7E A;  3PG7 A;  3TGU D;  5BVZ A;  3G3Z A;  2V4H A;  1J1E B;  1T77 A;  1Q2N A;  1AA0 A;  3EQ2 A;  1UEF A;  2UVM A;  5APX A;  2YS3 A;  3H1H J;  1S1C X;  3BRV B;  1SHC A;  1AVY A;  2KUB A;  3U12 A;  3E1R A;  4NSW A;  2GS0 A;  3H32 B;  4GMX B;  1KZU B;  4I1L A;  3OJA B;  3L73 J;  1X1G A;  4HB4 B;  3L72 J;  2VKI A;  1HGZ A;  2Z5I A;  2OYH A;  1OVV A;  2WPQ A;  2FFD B;  2C0X A;  1BGY E;  1TQZ A;  4L1R A;  2Q1K A;  1NTM G;  3A0H H;  1J0W A;  3KDP B;  3M9B A;  4L74 A;  1L0N J;  3CPW O;  1S5L X;  1KQF B;  2K88 A;  4A5K A;  1NTK K;  2I5C A;  1VQN P;  1X22 A;  1LTB C;  4HH2 A;  4CHJ A;  5M4Y B;  1JMM A;  2ZT9 D;  2D2Q A;  1E5W A;  5CCH A;  5KLV G;  1AQ5 A;  5C5B B;  1HJB A;  2Z4E A;  3KZI H;  3WMM 0;  3AE7 C;  1NAY A;  1FC2 C;  2FY8 A;  1BE3 J;  1JM0 A;  1IFN A;  2ZYA A;  5AW8 B;  4DBB A;  2M3B A;  2YT1 A;  3SWF A;  3M1I B;  1SQP K;  5KQ1 A;  2FFD C;  3L75 D;  2VRW B;  5B66 H;  4EYY Q;  5L81 A;  1QX8 A;  3AE6 C;  3Q1M A;  4A6F B;  1PIX A;  2PRR A;  2FYU E;  1SVF A;  3ZVR A;  3L70 D;  4WY4 C;  2P1J A;  1A02 F;  3F89 A;  3H1H G;  2YIU B;  1E79 H;  2Z5H A;  3FXE A;  5J3Q A;  1G2C B;  1L0L J;  2JKV A;  4N78 E;  5AVZ B;  3HD7 B;  3S1K A;  3C1L A;  4U3F E;  3H1L J;  3L73 G;  2R2Y A;  3GMA A;  3L72 G;  4RO0 A;  2KZI A;  2IPP A;  3ULC A;  1S5L E;  1SQX G;  2HOD A;  5CMZ A;  3ULB A;  5E79 H;  3IAO A;  2VRS A;  1BTN A;  4B86 A;  1Q7Y Q;  3L4F A;  3VYI A;  4IFF A;  1U5E A;  4LLH A;  3H1J J;  1L0N G;  3VMY A;  2ZXX A;  2DHI A;  1WVH A;  1U2B A;  1LJ2 A;  1T6A A;  2M14 A;  4HAZ B;  1U29 A;  2ZFC A;  3H1I E;  3M0D C;  4XA4 A;  2ZAE B;  2YO3 A;  2FBW C;  1PP9 E;  4GKG A;  2YMY A;  1T2K C;  4K81 A;  1BE3 G;  2B9B A;  2O01 H;  2M8R A;  1VQP P;  1U7M A;  1NTM D;  4WVZ A;  3HUS C;  2E74 B;  4KT0 J;  2ZVN B;  3CMA P;  4A6H A;  4Z1M H;  2RN0 A;  3D70 A;  3AJ4 A;  1NOH A;  1MUU A;  4HAY B;  2E5T A;  3SO6 A;  2ELB A;  2EC1 A;  4IL6 X;  3DXE A;  3CX5 E;  3W67 A;  1R8E A;  1FDI A;  3KYQ A;  1PGQ A;  2HLO A;  3L71 E;  5CCG C;  1XTG B;  1L0L G;  4HB1 A;  1H10 A;  1Z87 A;  4BXL A;  1SQB K;  1SQV J;  1R5S A;  3RK2 D;  2RMZ A;  4WJ7 A;  5LON B;  1RE3 C;  1YQ4 C;  1HJ0 A;  2KS1 A;  1EZV G;  2HG5 D;  4I7Z B;  1X05 A;  1LTS C;  2XDJ A;  2E74 C;  3R4Y A;  1FDO A;  1ZC3 B;  3H1H D;  4YXW H;  3MHV A;  2Y7B A;  1GL2 B;  2ZYD A;  1CW5 A;  1L2P A;  1NTK G;  3QBV B;  3L73 D;  1DDW A;  3L72 D;  2N23 A;  4CYE A;  2XQN M;  1SQX D;  1PGJ A;  2Y0C A;  1QL2 A;  5L8R J;  1SQP G;  4I7Z C;  3M0A A;  4GOE A;  1ZOY C;  2A06 G;  2HFE D;  3O8Z A;  2E76 C;  3OAN A;  3F5R A;  2ITA A;  2O01 N;  3U8Z A;  3P8C D;  1FHO A;  1NTZ K;  1L0N D;  3CC7 P;  2D11 A;  1JEK A;  1H0T A;  5DHF B;  2N1T A;  1K9M Q;  4WVF B;  1GL2 C;  1OXZ A;  3Q3D A;  1B55 A;  3ITK A;  2K49 A;  1PZQ A;  2C9N Y;  1FZC B;  3A2A A;  1NU2 A;  3ML4 A;  3GF3 A;  3IFM A;  1HUC A;  3A5T A;  4DXA B;  5B5E E;  3V6I A;  1Y5O A;  1VDF A;  2DHK A;  1BE3 D;  1XTC C;  4QMA A;  5CCH C;  2QE7 H;  1M8O B;  1ZC4 B;  1SLQ A;  2C9L Y;  1VF5 C;  1EVH A;  2NMB A;  5CBO A;  3TFM A;  4C46 A;  3CCU P;  5LG4 B;  3L37 A;  2I1J A;  1IFM A;  1NYH A;  2P7J A;  1JCC A;  2M5A B;  4PV1 B;  2H88 C;  3F0W A;  1L0L D;  1D7M A;  3CCL P;  1W1H A;  3H6P A;  3PLN A;  1EC5 A;  3IR9 A;  1FZC C;  1OVU A;  4H8S A;  3H1L D;  2WSC H;  3B5N B;  1VQ9 P;  1DD3 A;  2XU6 A;  4GZU A;  1KFN A;  1BSH A;  1UPQ A;  3AU4 A;  1EZV D;  1YTZ T;  2RNR B;  1KFM A;  3V2P A;  1SFC D;  2KYV A;  1MPH A;  2KR0 A;  5FI1 A;  2XKM A;  5C16 A;  5AW3 B;  1P84 E;  1ZP0 C;  4UB6 E;  1LTJ A;  2V76 A;  1BCC E;  4LGD E;  2OYO A;  2QKL A;  1H89 A;  3HW2 B;  4H44 D;  1NTK D;  3WUT A;  5AVR B;  1WMK A;  3EFG A;  2XNX A;  4XWX A;  2J59 M;  2CPB A;  1URQ B;  1X11 A;  3JSV C;  1WGQ A;  2R3S A;  1Q90 D;  2CK3 H;  1OW8 A;  5D3W A;  1GU4 A;  1SQP D;  1GG3 A;  1Q82 Q;  3NWF A;  2A06 D;  2RVB B;  2WSF J;  1PFI A;  5APW A;  4RKU J;  3A8Q A;  3JC2 2;  1GC7 A;  4Z2N A;  5D3V A;  3AE5 C;  1KZ7 A;  1KYO H;  3E7K A;  2CY4 A;  2FYN B;  3A8P A;  3L74 J;  3FXD A;  2D9Y A;  3AE8 C;  3L35 A;  5J3T A;  1CI6 B;  2PAJ A;  5GTH H;  3MDB C;  2WZ7 A;  2N1T D;  2NPS B;  1S9K D;  2IBZ I;  1RF1 A;  4PD4 D;  2UZR A;  3RL0 B;  1NTM K;  1KQG B;  2YNY A;  1AJY A;  1URQ C;  2K9J A;  1PFJ A;  4CHM A;  2BEQ D;  1CSB A;  2UWJ E;  1IFI A;  1YHQ P;  1FZB A;  4YON A;  2PZ1 A;  4HB3 B;  2CAY A;  1VQO P;  1W1D A;  4PD4 H;  3A3Y B;  5KCV A;  2D9Z A;  2FXM A;  3CWB G;  1XR0 B;  1UII A;  3V5W A;  1Y47 A;  3H1K E;  4L76 A;  4UB8 E;  1SQB E;  1NTZ G;  1PV3 A;  4EIJ A;  1ZSQ A;  1AQC A;  1EDK A;  4U7J A;  3CCR P;  3DXC A;  2GUM A;  3BCC E;  2JJL A;  1R5L A;  1BGY J;  2RGN B;  1KC8 Q;  5KJ7 C;  3MD0 A;  1M7L A;  1JCD A;  3RL0 C;  1NU1 J;  3SSU A;  3JCU E;  1RRP B;  1LW3 A;  1FAV A;  1V5U A;  4H13 D;  3N4X A;  4N6J A;  1NVO A;  4NPF X;  1DH3 A;  1YJ9 P;  1MFZ A;  4YL8 A;  3HTK B;  4GDO A;  4RES B;  3BRT B;  2FXP A;  2D9V A;  3M91 A;  1EQ7 A;  2KNC B;  3WUV A;  2W90 A;  1SP4 A;  4KHB B;  3AED C;  4YPC A;  2ROV A;  3MUD C;  2P0F A;  1KYO I;  1VQ6 P;  3CD6 P;  2FJU B;  1V5M A;  5GOW B;  2GUV A;  4L73 A;  2LR2 A;  3NWA A;  2LXB A;  3U1A A;  1JTH A;  1Q67 A;  5AW9 B;  5HE0 A;  2A45 H;  5CJ4 A;  4HAT B;  2D2C D;  2P58 A;  3KRW A;  2KXP B;  5DIF B;  1NI2 A;  2FYU J;  1LT9 B;  4HB0 B;  1DD4 A;  1SQQ E;  1L0N K;  2QRX A;  3GW6 A;  3CC2 P;  4HHV A;  4R4M A;  3A0H E;  3R2P A;  2DW3 A;  2OQB A;  2Y8F A;  1X79 B;  3SWK A;  1JOC A;  1FJP A;  4U3F J;  1GDT A;  1NKN A;  3AE9 C;  4OVN F;  1YIJ P;  2IX7 C;  1XCG A;  2WWW A;  1BGY G;  2Z13 A;  3KZI E;  1DBH A;  4GPT B;  3PEG A;  1AV1 A;  2Q6Q A;  2YKP A;  2WVR A;  2V7Q H;  1NU1 G;  2XZR A;  1P6S A;  1BSN A;  3CWB D;  2GM4 A;  1LT9 C;  4GT1 A;  3PJS K;  5B66 E;  1NTZ D;  1RY3 A;  1OMI A;  3H1I J;  2BCJ A;  1L0L K;  3BAS A;  2RUK B;  1PP9 J;  3MGN A;  1ZR2 A;  1RE4 C;  4ZKP A;  3L75 E;  4JYC A;  1X0T A;  4TKN A;  2ZXE B;  5BU5 A;  2JDI H;  4CSQ A;  2YKQ A;  1J19 A;  3L70 E;  4BRY A;  2E2X A;  2ZYG A;  1KMI Z;  2W2X D;  1ZRT D;  2A45 I;  1IFJ A;  4WY4 B;  4IAP A;  3HE5 A;  4OH8 B;  1X86 A;  2R32 A;  3HE4 B;  1LWU B;  3AU5 A;  5E79 E;  4F7G A;  3L71 J;  4QJ4 B;  4GIF A;  3WYF B;  1N86 A;  2OYI A;  2CRF A;  1LTI C;  1PMS A;  4TT3 H;  3P7Z A;  2E75 D;  2JP2 A;  3AE1 C;  4U3F G;  2KIK A;  4XFJ A;  4ZNC A;  3CCV P;  4TLF A;  5FI0 A;  1RF0 C;  1Z56 A;  3WU2 H;  1RQU A;  3V4Q A;  4D6T G;  4IFD K;  3T97 B;  5DJT B;  1I7A A;  2QA4 P;  5EFW B;  1NAF A;  1S72 P;  1KQS O;  1RF1 C;  4OSN A;  2HYN A;  2OTL P;  4JF7 A;  3HD7 D;  4GN1 A;  3FWL A;  4Y94 A;  5TIS H;  2PGD A;  1X8Y A;  2LKO A;  1K04 A;  3B4S A;  2B87 B;  1MK9 B;  2ZT9 B;  1LWU C;  2KP8 A;  2DLW A;  2Z0Q A;  3PHL A;  1M57 D;  2YS1 A;  1FBM A;  1PP9 G;  1FOS E;  2R5B A;  1JY2 N;  2CY5 A;  1GK6 A;  1N7S A;  3BVH A;  1GC6 A;  1BGY D;  3HUS B;  2FJL A;  2JWD A;  3U59 A;  1W5C E;  1NU1 D;  2AEJ A;  1NO4 A;  5KLV E;  2Z59 A;  1WGU A;  2BAS A;  2IFS A;  3NFQ A;  4OGQ D;  1MI1 A;  4MT7 A;  3C8V A;  3CCE P;  1RQV A;  4LC1 A;  1BWN A;  3HQC A;  1FOE A;  1KB9 D;  1ZVR A;  3K5B A;  2ZT9 C;  1JY2 P;  2E75 C;  1HWT C;  3L36 A;  1U5D A;  1OFC X;  2IZ0 A;  3TCA A;  1G1I A;  3I56 P;  3RK3 D;  5D27 A;  3PSC A;  2WMM A;  2ZJS E;  1PGP A;  1KB9 H;  2BCC E;  4QXA B;  3GYP A;  3UZT A;  3FEH A;  2DN6 A;  2WT7 B;  2W83 C;  4EI2 A;  1QC6 A;  2G8Y A;  4JQ0 D;  2Q3E A;  2XV5 A;  3NXS A;  1JY3 N;  3II6 A;  5APT A;  4QJ5 B;  4OT1 A;  4L6E A;  1SQX E;  2ELA A;  1W2E A;  4ZRK A;  4U3F D;  1KD1 Q;  3D8F A;  1V89 A;  1SFC A;  2P67 A;  1I2H A;  2VSZ A;  1VQ8 P;  1FZE A;  2MDX A;  4IOY X;  3OAK A;  3H1L G;  1BTK A;  4D6T D;  1UPR A;  1VPC A;  1JUN A;  1DRO A;  2OYH B;  3AE3 C;  1KI1 B;  1RHZ B;  2E76 B;  1K8A Q;  1WJM A;  1GW3 A;  4BRY B;  2AXT H;  1BCC J;  3FVC A;  4K17 A;  1JY3 P;  1IFP A;  2NZ2 A;  3GG2 A;  2R44 A;  4ZRJ A;  4DIX A;  1QGK B;  1DDV A;  1FHW A;  1ZR4 A;  3H1J G;  5KKZ C;  3H1I D;  2P0H A;  1PP9 D;  1VQ7 P;  1OWA A;  1LTG C;  3FM8 C;  1GMJ A;  3FSS A;  2D9X A;  2Y0E A;  3RK2 B;  3Q5S A;  2IBZ E;  1KQL A;  3CL3 D;  1KIL A;  1MIX A;  1QLE D;  1KZG A;  1VF5 B;  2D4Q A;  3TW1 A;  1N3H A;  3M06 A;  1N7S D;  5I2S A;  2OYH C;  3AEG C;  1MKE A;  4NPE A;  1HVV A;  1L4A A;  1K73 Q;  2H43 A;  3DXD A;  3FX0 A;  4F7H A;  1ZV8 A;  1VQ4 P;  4C7N A;  2IFM A;  1EDL A;  2J0J A;  3A0B H;  3H25 A;  2KUP A;  1WG7 A;  2L5G B;  3PVU A;  2W27 A;  1P5T A;  5CHX A;  2Q3I A;  1FAO A;  1M1J A;  3RK2 C;  3LW5 J;  1SQV G;  1QEX A;  1EXJ A;  3TDK A;  2K9Y A;  1HGV A;  1YI2 P;  3TNU A;  4PV1 D;  1NTK E;  3A98 B;  3CXH D;  2XND H;  2HOD B;  3H1K J;  1SQB J;  1K5D B;  2QEX P;  5C79 A;  2MKV A;  1N73 A;  2LG1 A;  4Y99 C;  3B5N D;  5KTB A;  3BIN A;  2D10 A;  3BCC J;  3GHG A;  3GF7 A;  1LP1 A;  3CXH H;  2OTJ P;  1KYO E;  2DX5 A;  4HB2 B;  1SQP E;  3RL0 g;  3HIE A;  5APS A;  1SS1 A;  2H7E A;  3ODW A;  1GK4 A;  2Q9I A;  1N2D C;  2J58 A;  2MKR A;  3BJI A;  1T3J A;  5AW4 B;  5GTH E;  3G9R A;  1HBW A;  1G1J A;  3I5C A;  1NH4 A;  1XOD A;  3SUZ A;  1OW7 A;  3B71 A;  2DKQ A;  1VQK P;  2COF A;  4I2L C;  4IL6 H;  2I8D A;  1S9K E;  3H1J D;  4H0L D;  4PD4 E;  3OHM B;  4K35 A;  3AEE C;  3M9Q A;  5H2F H;  3QIJ A;  3PH0 A;  3HK0 A;  5HE2 A;  2HPC A;  4RJT A;  4DX9 0;  2W6A A;  2COA A;  1CZQ A;  1S4X A;  2GCL A;  4PJ0 H;  1U7J A;  1TU3 F;  2IZ1 A;  4MN4 C;  3SV1 A;  1NU1 K;  1FE6 A;  1T8Z A;  1KIL D;  1SQQ J;  3O6Q A;  2FXO A;  2KS1 B;  3QH9 A;  3CCS P;  1PGO A;  2MFQ A;  2NPS D;  4GOF A;  2H7H A;  3KQG A;  1ZYI A;  4H44 B;  4GMV A;  3LID A;  2GUS A;  1N7L A;  4HDQ A;  5J3Y A;  1L4A D;  3FWN A;  1FHX A;  4EKU A;  2DKP A;  3DCX A;  1IZN B;  2K8E A;  4C7R A;  1SQV D;  2YRY A;  1DIP A;  3D8E A;  3CXH I;  3H32 A;  2KSJ A;  4EOT A;  5K5G B;  3VN0 A;  1SFC C;  1YBK A;  5C39 A;  1M7R A;  2FYU K;  3BAT A;  2OTK E;  2HR3 A;  3TK1 A;  2Y9Y A;  2KCJ A;  4IFM A;  2FFD A;  4KJM A;  2B89 A;  4W7Y A;  4YTP C;  3RCP A;  4YXD C;  3S4R A;  4AYC A;  5KAI H;  2Z14 A;  2DYN A;  4H44 C;  3L75 J;  5AVS B;  1EZV I;  1H0T B;  5C6R A;  2N1T B;  3P7K A;  4KHX A;  1PPJ G;  3L70 J;  3S9O A;  2EMS A;  5AVQ B;  3CCQ P;  4W7Z A;  2OTX A;  1H88 A;  3SNH A;  5C5B A;  1DDM A;  2QIW A;  3ZDM A;  2J5U A;  1VQL P;  1TJ6 A;  4DJG A;  3C9I A;  1FGY A;  1SQQ G;  3B77 A;  2FYZ A;  3Q2Y A;  3WA0 A;  2Q13 A;  1M90 Q;  1K05 A;  3D8D A;  4MY6 A;  2C0W A;  4A6F A;  2YT2 A;  4EMO A;  3L74 G;  1Y8A A;  2IDB A;  2RKL A;  3RBZ A;  5GTI H;  1Q81 Q;  3LJU X;  4KVG B;  3TGU E;  3CME P;  3CXB B;  3CLQ A;  2N1T C;  4HKZ H;  1FS0 E;  4DX8 A;  1FZG A;  1G2C A;  3CWB E;  3V4W A;  3V5B A; 
#chains in the Genus database with same CATH homology
 2NZ8 B;  5LOP B;  1X05 A;  1LTS C;  1RE4 A;  2XDJ A;  2AEH A;  3HD7 A;  1NAF A;  2R5D A;  1RF1 C;  1ZC3 B;  1GD2 E;  1SFC B;  1UNP A;  2HYN A;  4TYZ A;  1TXD A;  4JF7 A;  2HE7 A;  2X18 A;  3UIA A;  1M1J C;  3HD7 D;  4AUW A;  2Y7B A;  1GL2 B;  4GN1 A;  3P32 A;  2A45 G;  4Y94 A;  2LYD A;  1YYC A;  1X8Y A;  1J1D C;  2KB7 P;  1GU5 A;  1CW5 A;  1XKE A;  5APV A;  2LKO A;  2Y8G A;  4DOJ A;  1IK9 A;  1GTW A;  3TO1 A;  1MK9 B;  2L2I A;  2ADZ A;  3QBV B;  1LB1 A;  1LWU C;  1LTJ B;  2KP8 A;  4HAW B;  4KAX B;  2DLW A;  2Z0Q A;  1ISN A;  2E43 A;  2R3C A;  1V61 A;  3N7C A;  1DDW A;  2Q5U A;  2YS1 A;  1FBM A;  1FOS E;  5APU A;  2R5B A;  2GCJ A;  3B5N C;  1JY2 N;  5KJ7 D;  1MK7 B;  3RL0 D;  2CY5 A;  2N23 A;  3U1C A;  4CYE A;  2WSE H;  2XQN M;  1K5G B;  3T06 A;  1GK6 A;  1N7S A;  3BVH A;  1NTY A;  1GC6 A;  4MK0 A;  4I6M C;  2I5F A;  1QL2 A;  3HUS B;  1XD4 A;  2FJL A;  1OY2 A;  2R09 A;  2HTH B;  2PP6 A;  5AVW B;  3M0A A;  3U59 A;  4Z2M B;  2YS5 A;  5DHA B;  4ZRI A;  2HFE D;  3O8Z A;  4A6K A;  3OAN A;  3F5R A;  1NO4 A;  5KQ4 A;  3PVW A;  3U8Z A;  3P8C D;  2K2J A;  1WGU A;  3KZ1 A;  1FHO A;  1NTZ K;  2BAS A;  2WPR A;  2IFS A;  3NFQ A;  1KIL B;  5APQ A;  2D11 A;  1JO5 A;  5DHF B;  4MT7 A;  2N1T A;  1FZA A;  2WTY A;  1RF0 A;  4WVF B;  1GL2 C;  1OXZ A;  3HRN A;  2DHJ A;  1B55 A;  4LC1 A;  1BWN A;  1AWE A;  3HQC A;  4WBA A;  2C9N Y;  1FZC B;  3A2A A;  1FOE A;  1NU2 A;  3ML4 A;  1ZVR A;  3IFM A;  1HUC A;  3A5T A;  4N3Y B;  5DI9 B;  4DXA B;  1JY2 P;  1Y5O A;  2ROZ B;  3ODX A;  1LTJ C;  1UNR A;  1VDF A;  5AVY B;  1HWT C;  2DHK A;  2K00 A;  2O1J A;  3L36 A;  1U5D A;  1XTC C;  3SWY A;  3TCA A;  1G1I A;  4WY4 A;  4HDO A;  1L4A B;  3RK3 D;  5CCH C;  5D27 A;  1IC2 A;  3PSC A;  1ZC4 B;  3SYX A;  1EGX A;  1JNM A;  3KSY A;  4WY4 D;  1DYN A;  3G9W A;  1SLQ A;  2ZPY A;  3HE4 A;  1LWU A;  2C9L Y;  4C7N B;  3GYP A;  3TVV A;  3UZT A;  1MAI A;  1EVH A;  5CLQ B;  2NMB A;  1FU1 A;  3VP8 A;  3FEH A;  3TFM A;  2LKM A;  4C46 A;  5CLL B;  4F7U P;  1WJ1 A;  2DN6 A;  1RF1 B;  2WT7 B;  5AVT B;  1QC6 A;  3PZD A;  5KLV K;  3L37 A;  2P8V A;  2LOZ A;  2I1J A;  2XV5 A;  1M1J B;  1IFM A;  3NXS A;  1SGH A;  1JY3 N;  3TYY A;  3II6 A;  2P7J A;  5APT A;  1KIL C;  1JCC A;  2DYQ A;  2Q7C A;  4P7I A;  1NTV A;  1QQG A;  1V88 A;  3F0W A;  1JY2 O;  5D3Y A;  5JHG A;  4L6E A;  5AW6 B;  2R0D A;  1W1H A;  3H6P A;  3T97 A;  4IFS A;  3IR9 A;  3TNU B;  2ELA A;  5JP4 A;  1W2E A;  2NPS C;  1FZC C;  2IYB A;  4ZRK A;  4H8S A;  4B6H A;  2WSC H;  3D8F A;  3B5N B;  1SFC A;  2P67 A;  1V89 A;  2JEE A;  2WSF H;  4HAX B;  1I2H A;  2XU6 A;  1IFD A;  4GZU A;  3P6A A;  1KFN A;  1UPQ A;  2VSZ A;  3AU4 A;  1YTZ T;  2RNR B;  1J1E C;  1FZE A;  1KFM A;  3OAK A;  3V2P A;  1N73 B;  1GL2 A;  1SFC D;  2KYV A;  3E1I A;  1BTK A;  1IJD B;  1UPR A;  2MWN B;  1DX7 A;  1L4A C;  1VPC A;  1JUN A;  1U5F A;  1MPH A;  5FI1 A;  2XKM A;  1WT6 A;  3GHG B;  5C16 A;  1DEB A;  1DRO A;  4DZO A;  2OYH B;  5AW3 B;  1KI1 B;  2WIT A;  3M0D A;  1LTJ A;  1WJM A;  1GW3 A;  2V76 A;  3U7D A;  3M9H A;  4LGD E;  4K17 A;  1XX0 A;  1JY3 P;  2KOG A;  5AW7 B;  2QKL A;  1H89 A;  3HW2 B;  1H8A A;  1T2K D;  2O1K A;  4ZRJ A;  1EF1 A;  1DDV A;  1FHW A;  1ZR4 A;  2DTC A;  5AVR B;  3VP9 A;  3EFG A;  3HUS A;  3LW5 H;  2XNX A;  3NSU A;  4XWX A;  2J59 M;  2P0H A;  3CIK A;  1OWA A;  1SQX K;  1Y19 B;  1GW4 A;  1LTG C;  2Z0P A;  3MPX A;  2CPB A;  3FM8 C;  3P8M C;  3FSS A;  3VMX A;  2D9X A;  1URQ B;  2YO2 A;  3RK2 B;  1X11 A;  3V2R A;  1KQL A;  3CL3 D;  1WGQ A;  1KIL A;  1MIX A;  1SQV K;  5JLJ B;  1U27 A;  2YT0 A;  2D9W A;  5D3W A;  5DH9 B;  2H8P D;  3NTN A;  1KZG A;  1RJ2 A;  1GU4 A;  1N73 C;  2QM8 A;  1GG3 A;  2YF0 A;  2D4Q A;  4KHO A;  2RVB B;  3GYO A;  3V2Q A;  1JY3 O;  3CI9 A;  2HPC B;  1N3H A;  3TW1 A;  5CCG A;  4K2P A;  1FZC A;  1PFI A;  5AW5 B;  3V2N A;  1EAZ A;  5HE1 A;  5APW A;  3M06 A;  1N7S D;  3GHG C;  1JTH B;  2OYH C;  3A8Q A;  2P2U A;  1GC7 A;  1FB8 A;  1MKE A;  5CCG D;  2EJ8 A;  4Z2N A;  1X9V A;  5D3V A;  4W80 A;  1J2J B;  2YSZ A;  1ZLL A;  5BU8 B;  1KZ7 A;  2W2X C;  2CY4 A;  1HVV A;  3OA7 A;  1FGZ A;  1BAK A;  3A8P A;  2DA0 A;  1L4A A;  1RE3 A;  3MTU E;  1IRS A;  3A7O A;  4HYT B;  2D9Y A;  2H43 A;  3L35 A;  4PNK A;  5J3T A;  4XE5 B;  3DXD A;  4F7H A;  1ZN5 A;  1ZV8 A;  1CI6 B;  4C7N A;  2IFM A;  2PAJ A;  2H7D A;  2FKW B;  3MDB C;  3VOQ A;  2WZ7 A;  1NHL A;  2J0J A;  2N1T D;  2NPS B;  2KUP A;  1S9K D;  2E42 A;  2L5G B;  5AVU B;  1WG7 A;  1RF1 A;  3PVU A;  2W27 A;  2WT7 A;  1FJK A;  5CHX A;  1P3R A;  1P5T A;  2Q3I A;  4HAU B;  1FAO A;  5AW2 B;  1M7E A;  2UZR A;  3RL0 B;  3PG7 A;  2POH A;  5BVZ A;  3G3Z A;  1M1J A;  4GXB A;  1J1E B;  1NTM K;  2YNY A;  5HE3 A;  1URQ C;  3RK2 C;  1PFJ A;  4CHM A;  2YVC A;  1CSB A;  4C0A A;  1IFI A;  3EQ2 A;  1UEF A;  2UVM A;  1FZB A;  3PVL A;  4YON A;  2PZ1 A;  4O9B A;  4HB3 B;  2CAY A;  5APX A;  2YS3 A;  2MJZ A;  1W1D A;  2K2U A;  1NKZ B;  1HGV A;  3BRV B;  3TNU A;  3A3Y B;  1SHC A;  5KCV A;  1GZL A;  3A98 B;  2D9Z A;  2FXM A;  2MDX A;  2COC A;  1XR0 B;  3V5W A;  4NSW A;  3B5N A;  1MIZ B;  2HOD B;  2GS0 A;  2N9B A;  1K5D B;  1LGH B;  3H32 B;  4ZKU A;  4GMX B;  5C79 A;  1KZU B;  4I1L A;  4K2O A;  3OJA B;  1N73 A;  2LG1 A;  2J0M A;  4Y99 C;  3B5N D;  3HD7 C;  5KTB A;  1X1G A;  3BIN A;  4HB4 B;  2COD A;  4EIJ A;  1ZSQ A;  2VKI A;  1HGZ A;  2Z5I A;  2D10 A;  5AVV B;  3LIE A;  1AQC A;  3DXC A;  3GHG A;  2OYH A;  4M3L A;  4N78 D;  2QKM A;  2JJL A;  2DX5 A;  2WPQ A;  4HB2 B;  2FFD B;  2L1C A;  2C0X A;  5APS A;  3MIW A;  2DFK A;  2H7E A;  3ODW A;  2RGN B;  1GK4 A;  2Q9I A;  1N2D C;  2J58 A;  2W2W A;  1TQZ A;  2MKR A;  3RK3 B;  1NWQ A;  3BJI A;  3VIA A;  5KJ7 C;  2QM7 A;  3MD0 A;  1T3J A;  5AW4 B;  2GJY A;  1M7L A;  1JCD A;  3RL0 C;  1J0W A;  1LTT C;  5EFX A;  3KDP B;  1HH0 A;  3M9B A;  1LW3 A;  1RRP B;  1HBW A;  1H4R A;  1AFO A;  3NMD A;  1W1G A;  3ODO A;  1FAV A;  1G1J A;  3I5C A;  1NH4 A;  3P8C E;  1V5U A;  1XOD A;  3SUZ A;  1OMW A;  3PP2 A;  3N4X A;  3VMZ A;  1GL2 D;  4N6J A;  3O96 A;  1UNQ A;  2Z0O A;  4A5K A;  1NTK K;  2I5C A;  2DKQ A;  1DH3 A;  2COF A;  1MFZ A;  4YL8 A;  1LTB C;  4HH2 A;  4CHJ A;  3HTK B;  1URQ A;  4RES B;  3BRT B;  1JMM A;  4I2L C;  1FZF A;  2LUL A;  2D2Q A;  2D9V A;  1E5W A;  5CCH A;  1MV8 A;  1EQ7 A;  3M91 A;  1S9K E;  1AQ5 A;  5C5B B;  1HJB A;  1LTA C;  1SP4 A;  4KHA A;  3M9Q A;  2Z4E A;  4JYB A;  4KHB B;  2ROV A;  3WMM 0;  5CCH D;  3QIJ A;  2P0F A;  3HK0 A;  5HE2 A;  1V5M A;  5GOW B;  2HPC A;  2GUV A;  1IFN A;  5AW8 B;  4DBB A;  2M3B A;  3HE5 B;  3U1A A;  5AW1 B;  2YT1 A;  2W6A A;  4DX9 0;  3SWF A;  5CJ0 A;  1JTH A;  1SQP K;  1CZQ A;  1Q67 A;  2COA A;  5AW9 B;  3M1I B;  2IFN A;  5HE0 A;  2GCL A;  4D0N B;  5KQ1 A;  2A45 H;  2FFD C;  5CJ4 A;  4HAT B;  2VRW B;  3SV1 A;  3KY9 A;  2OYI B;  4PQ0 A;  3KRW A;  5DIF B;  3RK3 C;  5L81 A;  1NU1 K;  1NI2 A;  4A6F B;  1LT9 B;  1T8Z A;  1SVF A;  2J0K A;  4HB0 B;  3ZVR A;  1KIL D;  1CI6 A;  2P1J A;  4WY4 C;  1L0N K;  2EMT A;  1HTL C;  1A02 F;  4HHV A;  2UZS A;  2YKO A;  2NPS A;  3R2P A;  2Z5H A;  1QL1 A;  2OAR A;  3PP5 A;  1G2C B;  2OQB A;  5KJ7 A;  4EJN A;  5J3Q A;  2MFQ A;  2NPS D;  4N78 E;  2H7H A;  2Y8F A;  1X79 B;  5AVZ B;  3KQG A;  4Y99 B;  3HD7 B;  4GMV A;  1JOC A;  3LID A;  1FJP A;  1GDT A;  4HAV B;  5AVX B;  2AL6 A;  2GUS A;  1NKN A;  1N7L A;  4HDQ A;  2I1K A;  5J3Y A;  4WSF A;  2DX1 A;  1L4A D;  5D3X A;  4IOY X;  4EKU A;  1FHX A;  2CPS A;  4AQR D;  3VTP C;  2DKP A;  4BBK A;  2IPP A;  4C7R A;  2IX7 C;  3ULC A;  1XCG A;  2YRY A;  1IO4 A;  1MZ9 A;  2HOD A;  2WWW A;  5CMZ A;  3D8E A;  3H32 A;  2KLV A;  1DBH A;  4GPT B;  2KSJ A;  3PEG A;  3ULB A;  4EOT A;  2YKP A;  2RLO A;  2VRS A;  3MUD A;  3VN0 A;  1SFC C;  2OYI C;  2XZR A;  1BTN A;  1M7R A;  4B86 A;  1P6S A;  3L4F A;  2FYU K;  4IFF A;  3BAT A;  3VYI A;  1U5E A;  3ZDT A;  4LLH A;  2GM4 A;  3TK1 A;  1LT9 C;  1SQQ K;  4GT1 A;  3TSI A;  2KCJ A;  1N7S B;  3VMY A;  4IFM A;  2FFD A;  2DHI A;  1WVH A;  2G35 A;  1U2B A;  4W7Y A;  2M14 A;  1RY3 A;  5APY A;  4HAZ B;  3RCP A;  1U29 A;  2ZFC A;  2N0Y A;  2BCJ A;  1L0L K;  4AYC A;  3BAS A;  3M0D C;  4XA4 A;  2YO3 A;  3B8E B;  2RUK B;  3MGN A;  2DYN A;  4GKG A;  5AW0 B;  1ZR2 A;  2YMY A;  3X23 A;  1RE4 C;  1T2K C;  1U5G A;  4ZKP A;  4K81 A;  4JYC A;  5AVS B;  4TKN A;  2ZXE B;  5BU5 A;  1A02 J;  5C6R A;  2N1T B;  3P7K A;  1OQN A;  2YKQ A;  2O01 H;  2M8R A;  1J19 A;  4KHX A;  3N7N A;  2WPS A;  3HUS C;  3HTK A;  1FDM A;  2E2X A;  2EMS A;  5AVQ B;  4A6H A;  4W7Z A;  1X1F A;  2OTX A;  1H88 A;  3SNH A;  5C5B A;  1DDM A;  3AJ4 A;  2W2X D;  1FOS F;  2A45 I;  1NOH A;  1MUU A;  3KRX A;  4HAY B;  1IFJ A;  4WY4 B;  1TJ6 A;  3SO6 A;  2ELB A;  2EC1 A;  3VOP A;  3C9I A;  1FGY A;  1J1D B;  4IAP A;  1YTZ I;  4NY0 A;  3DXE A;  2W6B A;  1ZM0 A;  3IVF A;  3HE5 A;  4OH8 B;  2FYZ A;  1X86 A;  2R32 A;  3HE4 B;  1LWU B;  3KYQ A;  1N7S C;  2P0D A;  3AU5 A;  2HLO A;  3WA0 A;  4F7G A;  2Q13 A;  5CCG C;  1XTG B;  4GIF A;  3QWM A;  3WYF B;  1H10 A;  1Z87 A;  2KGX B;  1N86 A;  1SQB K;  2OYI A;  1V5P A;  1LTI C;  2CRF A;  3D8D A;  1PMS A;  2LOX A;  3P7Z A;  4MY6 A;  2C0W A;  2JP2 A;  1URQ D;  3RK2 D;  4A6F A;  4EMO A;  1LT9 A;  3LJU X;  4KVG B;  4WJ7 A;  5LON B;  1RE3 C;  1WRG A;  1PLS A;  2M38 A;  5FI0 A;  3CXB B;  2HG5 D;  3CLQ A;  1T3U A;  2N1T C;  5JHH A;  3KPE A;  1RF0 C;  1WI1 A;  1Z56 A;  4WB4 A;  3V4Q A;  4DX8 A;  1FZG A;  4IFD K;  1G2C A;  3V4W A;  3V5B A;  1I7A A;  2RSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...