2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
3SO6A 2CY4A 1P6SA 2GCLA 1U5DA 4K17A 2UZRA 1ZVRA 2MWNB 2HE7A 3CLQA 2D10A 1M7EA 5DH9B 4F7HA 5KLVK 1SQBK 1FHXA 3D8FA 2AEHA 4A6FA 4GMVA 4K81A 5HE2A 3X23A 2D9XA 3ULBA 1Y5OA 1ZSQA 3WA0A 5C6RA 5C79A 5HE0A 3P7ZA 2ZPYA 1FOEA 1X11A 2YT1A 3GYPA 1V89A 1EAZA 4Y94A 1U2BA 1WVHA 2RVBB 5GOWB 1NTKK 1FGZA 2RUKB 4XWXA 2D9ZA 3AJ4A 4ZRKA 1XX0A 4F7GA 2CODA 5J3QA 4K2OA 1WGQA 5J3YA 2VRWB 1MK9B 4DXAB 1OMWA 3ZVRA 1BWNA 2DX1A 1AQCA 1XD4A 4GN1A 4IFSA 2RLOA 3MDBC 2GJYA 2O01H 3SNHA 3LW5H 3V5WA 2DLWA 3ODWA 3RCPA 2YRYA 4TYZA 3TFMA 3DXEA 3VIAA 1DDWA 4HAVB 2D11A 2I5FA 1M7RA 4GZUA 2I5CA 2R09A 1W1GA 2K2JA 1Z87A 2EC1A 4EKUA 4P7IA 2D9WA 3PG7A 1LB1A 1X86A 1L0NK 2HTHB 3CXBB 1TQZA 4HHVA 5D3XA 1GC6A 2KCJA 4DX8A 4ZRJA 3SUZA 1U5FA 1FGYA 5C5BA 1NTMK 1SHCA 1Q67A 2DA0A 2CRFA 3HW2B 4PNKA 2K00A 2YS3A 1DROA 1BAKA 4PQ0A 5CLLB 2EMSA 2RGNB 2LG1A 4HAWB 2I1JA 2W2WA 3G9WA 2YS1A 3BINA 1BTKA 3KZ1A 1UNQA 3A98B 5CLQB 2J59M 4KHBB 3LJUX 3FM8C 4HB2B 1V5UA 2K2UA 5L81A 1Y19B 2H7DA 1B55A 1MK7B 3F0WA 1V5MA 2QKLA 3NSUA 1V88A 5FI1A 4A6KA 2KUPA 4DX90 3ZDTA 5JHHA 2RSGA 3UZTA 2OTXA 3N7CA 1KI1B 4GMXB 2E2XA 3OANA 2I1KA 3TO1A 2J0KA 5FI0A 5LOPB 4HDQA 1U29A 5D3VA 1DBHA 5D3YA 2DTCA 1UEFA 2JP2A 2ROZB 4K2PA 4B6HA 2W2XD 2PZ1A 3DXCA 1AWEA 1FB8A 2LKOA 3DXDA 1IRSA 1PMSA 1WJ1A 2M38A 2G35A 3QWMA 2V76A 2IFSA 1EVHA 1K5DB 1MIXA 2ELBA 4HAUB 2FJLA 3U8ZA 3U7DA 1OY2A 1RRPB 1SQVK 4A5KA 2XQNM 5DIFB 4ZRIA 2DKPA 4DBBA 3ODXA 4WJ7A 3M9QA 1E5WA 1SQPK 4BBKA 4CYEA 2WSEH 3VOQA 4GXBA 1PLSA 2D2QA 3QBVB 1P3RA 1WJMA 4IAPA 1NTVA 4EMOA 2UVMA 1J19A 3ULCA 1GC7A 1ZM0A 4HB4B 4CHMA 5D3WA 1U5EA 4KHOA 5KCVA 2COCA 1DDMA 3PZDA 1DYNA 1H10A 1BTNA 2D9YA 1KZ7A 2MFQA 2DKQA 2LOZA 3QIJA 1TXDA 1XR0B 2N0YA 4D0NB 4HAYB 2DX5A 1MAIA 3WYFB 4MT7A 2QKMA 1XODA 2NZ8B 3TCAA 4EJNA 1KZGA 1U27A 2W2XC 2J0JA 1NTYA 2VSZA 2YSZA 2Z0QA 5C16A 1SGHA 4A6HA 3KRWA 4KVGB 3PVWA 1XKEA 3O96A 2CAYA 3P6AA 2MDXA 3MPXA 1LW3A 1FHWA 4HDOA 2DHKA 3CIKA 4NY0A 5DHFB 3GYOA 2UZSA 2EMTA 1NU1K 3KY9A 4KHAA 2DFKA 4KAXB 4Z2MB 2DN6A 1L0LK 1V61A 4YL8A 5J3TA 4L6EA 3HK0A 3AU4A 1UNPA 2H7EA 1NI2A 1TJ6A 1N3HA 2DHIA 2YS5A 3F5RA 1QQGA 2ADZA 4Z2NA 4HB0B 2L2IA 2OARA 1UNRA 3SYXA 5C5BB 3TVVA 1I7AA 1WGUA 2M14A 3ML4A 2GCJA 2IYBA 2Y8FA 1SQXK 4CHJA 2P8VA 2LYDA 5LONB 4WSFA 2OQBA 2DHJA 2J0MA 4HATB 3KRXA 3AU5A 1NU2A 2NMBA 5D27A 2CY5A 2FYUK 4IFDK 1X1FA 2D9VA 1GG3A 1W1DA 3PSCA 4H8SA 1MKEA 2Z0PA 3BJIA 2LULA 5JP4A 1K5GB 3T06A 5JHGA 1MIZB 1X1GA 1MPHA 2LKMA 2P0DA 1H4RA 2D4QA 1UPRA 2GS0A 2X18A 1I2HA 5JLJB 5DI9B 2N23A 2DYNA 2COFA 1OQNA 4HB3B 2ROVA 4GPTB 3M1IB 2Y7BA 1FAOA 1UPQA 2Z0OA 1V5PA 2ELAA 3PVUA 4F7UP 1W1HA 3HQCA 4HAXB 1PFJA 1P5TA 2YT0A 3PP2A 1EGXA 2AL6A 1WG7A 2YVCA 1J0WA 2DYQA 2EJ8A 1WI1A 4C0AA 1ZC3B 4YONA 3TW1A 2R0DA 3FSSA 5KQ4A 3PVLA 4A6FB 3IVFA 5EFXA 2WSCH 1DDVA 2WSFH 5HE1A 3KSYA 4HAZB 2L1CA 1RJ2A 1ZC4B 2KGXB 1ISNA 4IOYX 1U5GA 3D8DA 2COAA 2BCJA 4MY6A 2Q13A 4MK0A 3FEHA 5HE3A 3SV1A 1XCGA 2P0HA 3A8PA 1NTZK 2MKRA 5KQ1A 2Y8GA 1QC6A 2P0FA 2LOXA 2VKIA 1SQQK 1X05A 2RNRB 4NSWA 2YF0A 3D8EA 4TKNA 3G3ZA 1FHOA 3PEGA 5DHAB 3A8QA 4WVFB 1EF1A 3ODOA
chains in the Genus database with same CATH superfamily
1YYCA 5CCHD 2V7QJ 1ZMEC 2UZRA 1ZVRA 2MWNB 1T2KD 2IYOA 5AW9B 1N73B 5KLVK 1K9MQ 1DD3A 2OTJP 4K81A 1ZSQA 3V5BA 1EZVG 3H1KD 5C79A 4LC1A 1BDDA 1W2BO 4BWNA 4I6MC 2JDIH 3SWFA 2L5GB 4PV1C 1RQUA 2YT1A 3L73J 3MP7B 2Z14A 1EAZA 4OGQD 2Q5UA 1U2BA 2NPSD 1KILC 5GOWB 3VMXA 1BE3J 1FGZA 1P84I 4ZRKA 4H13B 1FZCB 3O6QB 2CODA 3C9IA 4K2OA 1QL2A 4U7JA 1L4AC 2VRWB 2XV5A 3M0DC 4GIFA 1VF5C 5BU8B 2R3SA 1RH5B 3A2AA 2DX1A 1XD4A 1XTCC 1NKNA 1R5SA 2O1KA 5CMZA 2RLOA 1JUNA 1J1DB 2O01H 3LW5H 3V5WA 2DLWA 5GTHE 4W7YA 1JCCA 1GU4A 1PP9D 1DDWA 5BVZA 1BDCA 4HAVB 3KYQA 2WSSH 2HLOA 2R09A 4WBAA 2Z5IA 3L70E 4EKUA 1RF1C 2KK7A 3U59A 2KR0A 3AE1C 4C7RA 1NTKD 2Y0EA 5D3XA 4H44C 3AE7C 4ZRJA 4N6JA 5C5BA 2QG4A 1SHCA 1Q67A 2DA0A 2CRFA 2NPSC 2E76B 1HTLC 4H44D 3L71G 1DROA 4PQ0A 3UIAA 5AVVB 5CLLB 3SSUA 2RGNB 2PRRA 1GL2B 2BCCD 2P1JA 3GHGB 1JY3P 1NU1J 1CI6A 1PGOA 3TSIA 5L81A 2K2UA 3D71A 1PIXA 2WSFJ 2P7JA 3L75J 1FU1A 1V5MA 3WU2E 4DX90 2RSGA 1SQQJ 1IFJA 2OTXA 4HJGH 3TYYA 2H7HA 3PJSK 4GMXB 1UIIA 5TISH 3NWFA 2CPBA 3RL0D 1S3JA 3D70A 2YO3A 4GNKB 4HDQA 1DBHA 3RK2C 2DTCA 2FXOA 4RESB 1EZVE 2ROZB 3OHMB 3OJAB 2ZKMX 2LKOA 3PLNA 4JQ0D 3L72E 2HYNA 1N2DC 5KJ7C 2M38A 5AVQB 2Z4DA 2WZ7A 3HE4B 1KC8Q 3H6PA 2OGUA 2AXCA 3GLMA 3KPEA 5DIFB 4ZRIA 4DBBA 1H0TB 3VP8A 1LNQA 2A45G 4KHXA 3NMDA 1Q90D 2AEJA 4CYEA 5AW0B 1NTZD 3F89A 1PLSA 2K3RA 1FBMA 1ZR4A 1LTTC 4ZKUA 1CW5A 1RF1B 4ZKPA 1WJMA 2BEZF 2Y0CA 1J19A 3WU2H 1URQD 4KHOA 1NTMJ 3AE5C 1J2JB 1N7SA 2XZRA 1H10A 3CCSP 2FY8A 1ZW0A 1K05A 2Y9YA 5C39A 1OVUA 1XR0B 1KYOH 5CCGD 2MKVA 3KDPB 1KD1Q 1GL2C 4MT7A 2IX7C 4YXWH 1KTMA 1Z56A 1KZGA 2W2XC 2VSZA 3P7KA 1L0NJ 1P84H 2IDBA 2ZT9B 1FJKA 2JO1A 1GW3A 3P6AA 2IBZE 1VQPP 1IK9A 1EZVD 4PD4E 3B4SA 2FYUD 5KJ7D 2Q7CA 3H25A 3CMEP 4KHBA 4XFJA 4KHAA 1WT6A 1YJWP 1JOCA 2N1TB 4K3AA 2RN0A 4YL8A 2QIWA 2OTLP 4CSQA 1Y9BA 2YS5A 4AUWA 4UB8H 3CCEP 1AVYA 3MGNA 1UNRA 5C5BB 1LT9A 5CCGA 1WGUA 2M14A 5AVYB 1SQVJ 2YKPA 1RE4A 2HG5D 4CHJA 1GDTA 3TNUA 2IZ1A 4WSFA 2J0MA 2E74C 1KFNA 3LIDA 3AEGC 1NJIQ 4HATB 1ZRTD 1J1EB 3KRXA 1DX7A 4DCKA 5BU5A 1G2CA 2NMBA 5D27A 4ZNCA 5KAIE 1URQC 2FYUK 4L76A 3HE4A 1GK6A 2QA4P 1MKEA 2FYZA 2YNYA 1NU1E 1NTKG 1BE3G 1X1GA 2LKMA 2WT7B 4EOTA 4OT1A 1H4RA 1ZR2A 1EDLA 5KAIH 2D4QA 3HE5A 2X18A 2XDJA 5B5EE 1PV3A 4GOFA 5JLJB 3I55P 5DI9B 3MTUE 2DYNA 1HF9A 2ROVA 3C8VA 1FAOA 2BCCG 2KI7B 2Z0OA 1V5PA 2QJPC 3USSA 3PVUA 4F7UP 4HAXB 1P5TA 1Q86Q 5KLIB 4H13C 3PP2A 1BCCJ 1FZCC 1ZN5A 2PFXA 3CCMP 3L71J 4RJTA 2DYQA 3PTZA 1ZC3B 4YONA 1N8RQ 1VQKP 2R0DA 5KQ4A 2M0BA 5CCHA 3JCUH 3CC4P 4YXDC 5EFXA 1KILE 3CCLP 2IBZG 3H32A 4DOJA 1ISNA 1D7MA 5APYA 1KB9E 2COAA 3Q5RA 2JKVA 4MY6A 1DIPA 3SV1A 2P0HA 1HJBA 4L1RA 2IZ0A 4IFFA 1NTZK 2RKLA 1BE3D 2NPSA 1BE3E 4W80A 1AQTA 1LTAC 1GU5A 2W27A 3D8EA 1FHOA 3RGUA 2W6JH 3B5NC 2JJLA 3CCRP 1MUUA 3SO6A 2IPPA 2BCCE 2GCLA 5CCHC 2KNCB 5AVZB 2ZXEB 2HE7A 4H0LC 4C7NB 1M7EA 3D8FA 1X9VA 3IFMA 2AEHA 3CX5I 1S5LX 3RL0B 2A06G 2YMYA 5HE2A 1X79B 1G2CB 4ZMDA 2R3CA 3X23A 1AQ5A 5C6RA 3P7ZA 3WUUA 2ZPYA 5KLVD 1LT9C 2WPSA 3EFGA 3OA7A 3L74G 1LTSC 1X8YA 3CCUP 3GYPA 1QVGO 3CX5E 4Y94A 2KIGA 1AVOA 2K9YA 2K49A 3AE9C 1OMIA 5CHXA 2XU6A 2Y0DA 2C9NY 3AJ4A 3VOPA 4YPCA 5L8RJ 3TGUD 3O8ZA 2ZYGA 4MN4C 3CXHE 3B8EB 1SQBJ 1LTBC 1WGQA 3HIEA 1MZ9A 2V7QH 4XA4A 1L2PA 3LIEA 1OMWA 1JY2P 1VDFA 2GA1A 4GN1A 4IFSA 4OVNF 4I2LC 3L75D 1N7SD 3PP5A 3RK3B 2FFDC 2W6BA 3RCPA 4HKZH 1PGQA 1KYOE 3TFMA 3H1JJ 3GF7A 3V2PA 3RBZA 1M7RA 1AV1A 1KORA 1H89A 3GG2A 2HODA 2K2JA 2A45H 3QWOC 4PD4H 2PGDA 3PG7A 3N7NA 1KN7A 2ZYAA 2J58A 4HHVA 1GC6A 2KCJA 2WSCJ 2QJYB 3SUZA 3AE3C 1HGZA 1N7SC 4L74A 3L74E 2K00A 1BAKA 2JWAA 3JC22 2LG1A 1LGHB 3DCXA 2YS1A 4JBZA 1YBKA 3VN0A 1M1JC 2WITA 2OYIC 1BTKA 3KZ1A 1CI6B 1YQ3C 3A98B 1JY3O 4KHBB 1M56D 3A0HE 3HUSC 1EC5A 1ZYIA 2H7DA 1XTGB 3LW5J 3CL3D 3F0WA 1HGVA 1SS1A 4PD4D 3G6EP 1HVVA 1V88A 3H1KE 2KP8A 4WY4C 3ZDTA 5JHHA 2YKQA 4L75A 1JMMA 2BASA 1FOSE 3OANA 1SQPJ 1WMKA 1KQSO 2FXPA 3IR9A 3S1KA 1BCCE 1UEFA 1OWAA 4OGQB 1USEA 2JP2A 4K2PA 4B6HA 3BCCJ 1FB8A 2QSIA 2W83C 2P10A 1WJ1A 5H2FH 5I2MA 1L4AB 3GHGA 1EVHA 1VF5B 1JTHB 4IL6H 2ELBA 4HAUB 2G3AA 1PP9J 2FJLA 3U7DA 1Q2NA 1SQVK 4A5KA 4HSIA 1Y8AA 1BGYG 2DKPA 1RF1A 2CK3H 4DT0A 3M9QA 3O6QA 3RK3C 1FZAA 1YITP 1LTGC 1MV8A 2YXQB 5AVWB 2WSEH 2YIUB 3VOQA 4GXBA 1EXJA 4JYBA 4DZOA 1GK4A 3VTPC 4D6TD 4HB1A 4EMOA 3ULCA 1GC7A 4HB4B 1X22A 4Y28J 5KJ7A 5D3WA 5AW3B 4NPEA 1YI2P 2JWDA 3PZDA 3Q5SA 1JCDA 3G71P 1BTNA 4AQRD 2KXPB 1HH0A 2MFQA 3H1LJ 5AW7B 1YTZT 2DKQA 2KB7P 4H0LD 5GTHH 1YHQP 1PGPA 2NZ8B 3A0BE 3TCAA 3R4YA 2OYIB 4EJNA 1JMBA 2LXBA 2YSZA 1T6AA 1LWUA 1NAYA 1RY3A 3V2QA 5CBNA 2RH0A 3CWBJ 3O96A 1L0LG 2OYOA 3L73G 3Q5PA 1FHWA 3E1RA 3CCJP 3FGAD 1FC2C 4HDOA 2Q9IA 3PHLA 1DEBA 5M1BA 3CIKA 1VQOP 1BGYE 2C0XA 2H89C 5AW2B 4QJ5B 1PPJD 3GYOA 2HFED 2EMTA 3P8CD 3MUDA 2RRFA 1ZXGA 3KHUA 1RHZB 4ASWA 1E79H 1EXIA 2AEFA 3KY9A 3TK1A 3CX5H 1L0LK 3VMZA 3JCUE 1KQGB 1FS0E 5J3TA 4L6EA 4D6TG 3HK0A 2JEEA 1YJNP 4U3FG 1NI2A 1TJ6A 3F5RA 2DHIA 1RF0C 2UWJE 4HB0B 3TVVA 4KJMA 5DJUB 1FZBA 1NTME 3E7KA 1SQXK 3H1LG 1MFZA 1NHLA 4PV1D 3H1IJ 1KZUB 3AU5A 1NU2A 1SQXD 4H0LB 3CX5D 3NWAA 1FAVA 4C46A 1VPCA 3PSCA 2Z0PA 2ZVOB 2QRXA 3QH9A 2KYVA 3L73E 5E79H 1IFIA 3HTKA 3II6A 2FXMA 1K5GB 2N9BA 3ITKA 3SFEC 3TGUG 2KLVA 2GS0A 1SQVG 2K8EA 1U7MA 1OIPA 3MUDC 3TNUB 2FYUE 3HD7B 1KILB 1ZLLA 1R8EA 4GPTB 3H1KJ 1PP9G 2Y7BA 3WUVA 1P84D 2KSEA 5AW8B 2ZYDA 2ELAA 2E75C 2R5BA 3H1HG 4U3FE 5APXA 1JY3N 2Q3EA 1OXZA 2YVCA 1J0WA 2EJ8A 4PJ0H 1WI1A 4C0AA 5GTIH 4OSNA 3TW1A 2R44A 1M7LA 3PVLA 2Q1KA 3IVFA 3BRVB 3L70G 4UB6H 2WSCH 1DDVA 3KXDA 3L75E 4XE5B 2FFDB 4HAZB 2GUMA 2N9YB 1NGMB 2L1CA 4IOIH 5KTBA 1Y47A 1S9KD 1SQXG 1U5GA 1ZOYC 2D2CD 1RE3C 3Q2YA 3FEHA 3G9RA 3H1JE 1XCGA 3CXHD 3OAKA 2MKRA 3M0DA 2QJYC 3AE2C 5KQ1A 2ZFCA 5AVSB 1URQA 1QC6A 4O9BA 2M5AB 2VKIA 1X05A 2RNRB 4NSWA 1RE4C 2YF0A 2RMZA 4WVFB 1EF1A 2C0WA 2ZAEB 1SVFA 3ODOA 3BCCG 1IFPA 2CY4A 1M1JB 1U5DA 3G4SP 1T2KC 3CLQA 1HBWA 1GL2D 2D10A 1JTHA 3GMAA 3AE4C 4F7HA 2K37A 1VQMP 2WVRA 2PAJA 1U57A 3KZIE 2I8DA 4A6FA 4GMVA 1PZQA 3L72D 1IJDB 4BXLA 1Y5OA 3ULBA 1NU1D 4WY4B 3WA0A 1FOSF 5HE0A 1H8AA 1K8AQ 1FOEA 3MZWB 2NZ2A 2JP3A 3RBXA 3L70D 1X11A 1SFCD 1V89A 1KFMA 1MFTA 3A5TA 3HD7C 1WVHA 1CZQA 4JYCA 1ZP0C 1NTKK 1PFIA 5KLVG 4XWXA 5AVTB 4LGDE 4IL6E 4DIXA 4BRYA 3H32B 2KZIA 1OFCX 1L0LD 2FYUG 4UB8E 1NTMG 3FWNA 1MK9B 2PP6A 1LTJB 2WT7A 1T77A 1L0NG 1AQCA 2FBWC 1U7JA 4DJGA 3MDBC 2GJYA 1YTZI 3CWBG 3B5ND 3CC2P 4NPDA 2YRYA 2P2UA 4TYZA 1ZRTE 2NRGA 5KKZB 2YIUC 2D11A 4GKGA 2I5CA 4BRYB 1PPJE 1Z87A 2EC1A 3BVHA 4P7IA 1M90Q 3L75G 4TT3H 1L0NK 4U3FD 1TQZA 1NTZJ 1U5FA 1SQXE 1NTMK 1VQ6P 1P84E 3NFQA 2QM7A 5KAFE 4HAWB 1CSBA 2W2WA 3G9WA 4QJ3B 3M06A 2J5UA 2WPRA 3BINA 5TISE 5APVA 2J59M 5KLVJ 2WPQA 1KQFB 3FM8C 5M4YB 2ZT9C 1Y19B 1QVFO 4CPGA 1M1JA 3AEAC 3NWDA 3FWLA 1GTWA 1T3JA 3F5HA 3UZTA 3N7CA 1KI1B 1LT9B 4GT1A 3P32A 2E2XA 1LJ2A 2M5AA 2R5DA 2E43A 5AW4B 5LG4B 2MJZA 3Q3DA 1SFCA 5D3YA 1NTKJ 2SPZA 3BATA 4Z1MH 2JR8A 1SP4A 2W2XD 3H1JG 2PZ1A 3DXCA 1AWEA 1SQBE 2W8ZA 3DXDA 3VMAA 3H1LD 3FXDA 1N73A 2G35A 1K5DB 3SFDC 4D6WA 1OY2A 1VQ5P 3U1CA 1JO5A 3A0HH 1BCCG 5K5GB 1J1DC 1HUCA 3AEDC 2ZJSE 1QX8A 4R4LA 2E74D 4GOEA 1VQLP 2E74B 2Q6QA 2OYHC 4BBKA 1N86A 3BASA 3S4RA 2LXCB 3QBVB 3ABVC 2E42A 5AVXB 4IAPA 3EQ2A 4I7ZB 2UVMA 4HH2A 1H0TA 1ZM0A 4CHMA 1U5EA 5AVRB 2BCCJ 1DYNA 2FYNB 1N7SB 3RK3D 4QMAA 1KZ7A 1Q7YQ 2QEXP 1NOHA 2L91A 2N0YA 1RQVA 4D0NB 4HAYB 2M8RA 3WYFB 1M57D 1XODA 2KS1B 2WMMA 2K9JB 3E1IA 5C16A 1SGHA 3KRWA 5KLIC 3FX0A 4KVGB 3PVWA 1GW4A 3L74D 3CCQP 2MDXA 3OW2O 1R5LA 3MPXA 1LW3A 4D6TE 3H1ID 1KV4A 5CJ0A 1SLQA 1DD4A 1OX3A 1JEKA 2K9JA 2DHKA 2A06E 1KB9H 4NY0A 1BCCD 4ASVA 1FE6A 5DHFB 5APQA 3L35A 1DH3A 2UZSA 3CCVP 1NU1K 3VP9A 2GUVA 4KAXB 4WY4D 1VF5D 1FZEA 1V61A 2IFMA 1M1KQ 3L4FA 1UNPA 4JF7A 2A06D 1TU3F 1N3HA 5EFWB 4OH8B 3CPWO 1QQGA 4A7PA 3M9HA 2L2IA 2OARA 3CXHH 1I7AA 2HPCB 2BEQD 2Z5HA 2GCJA 3MHVA 2YKOA 2IYBA 1S5LH 2Y8FA 1L0ND 3A3YB 3L72G 1LWUB 5LONB 3TDKA 5DJTB 1EDKA 3B5NB 1AFOA 2OQBA 3RL0g 4OWFA 4AYCA 2G8YA 3A58A 1NH4A 1ZV8A 1LTIC 2HPCA 2OYHB 2CY5A 1X1FA 2D9VA 1W1DA 4H8SA 3HTKB 1VQ7P 1JM0A 1VQ9P 3BJIA 5E79E 2Z59A 2IBZI 2LULA 2P58A 5JP4A 5JHGA 1MIZB 5APWA 2FYNC 2P0DA 1UPRA 2AXTH 2E75D 1I2HA 2N23A 4B86A 4HB3B 1LT1A 1YJ9P 3M1IB 3VYIA 2OYHA 1W1HA 2Z4EA 4IFMA 3D6YA 1BSNA 1PFJA 2YT0A 1SQVD 2H43A 5GTIE 2OTKE 2Z13A 4H13D 4HYTB 2FYUJ 1EGXA 1WG7A 3TGUE 2QJKB 1AJYA 3B77A 1FDOA 3FVCA 1LTJC 4GODA 2CPSA 4WB4A 4N78D 3H1HD 3FSSA 2K88A 1JNMA 2KZJA 1NAFA 1SQBD 1MI1A 2WQYC 1KB9D 2KOGA 1RJ2A 2KGXB 1L4AA 5APUA 1S5LE 2AXTE 3I56P 2POHA 5CJ4A 2Q13A 4MK0A 5HE3A 4PJ0E 2ZXXA 5APTA 3WUTA 3RK2D 2B88A 2OQQA 2Y8GA 2E76C 3TGUJ 3A0BH 1KQLA 3ZDMA 3CXHI 5DHAB 1OW7A 3L71D 3HSAA 5IRSA 3GHGC 2V4HA 1J1EC 1P6SA 4K17A 5CCGC 3PH0A 1DEEG 5DH9B 3HUSB 1SQPG 1SQBK 1FHXA 2GUSA 2QE7H 3U12A 2YT2A 4N78E 3PRJA 4Y99B 2D9XA 1LP1B 3K5BA 5B66H 1NYHA 1BGYJ 4RKUJ 1EDJA 3B5NA 1KB9I 1S9KE 1NVOA 3P8MC 2KIKA 2O01N 3C1LA 1KILD 2D2CC 1T8ZA 2RVBB 1NU1G 1JY2N 2QJPB 2RUKB 2D9ZA 3M9BA 1X0TA 3CWBE 1GMJA 3HD7A 1XX0A 1NO4A 4F7GA 2B9BA 5J3QA 5J3YA 2NBVA 2QJKC 1PPJG 1EQ7A 1OZHA 4DXAB 3IF4A 3BCCD 3V2NA 3H1IG 1L0LE 2O01J 2FJUB 1FZGA 3ZVRA 1BWNA 3HD7D 2IYPA 1EZVI 2FFDA 5TJHA 3SNHA 3ODWA 1IO4A 3L36A 1VL2A 3DXEA 3VIAA 2I5FA 4GZUA 1W1GA 5CBOA 1NKZB 1S1CX 3L73D 2D9WA 1LB1A 3SWYA 1X86A 2HTHB 3CXBB 1GD2E 2DW3A 5H2FE 3V6IA 4DX8A 1OVVA 1LP1A 2GM4A 1FGYA 2XKMA 1S4XA 3HW2B 4D6TJ 3EFFK 1YIJP 4PNKA 1IFNA 2YS3A 2EMSA 2I1JA 1NTMD 3R2PA 1RF0A 3AE8C 2ZVNB 5KAFH 1UNQA 5CLQB 3LJUX 4HB2B 1V5UA 1N73C 3HUSA 1B55A 3L70J 2P67A 1MK7B 1SFCB 4GDOA 1WRGA 2R32A 3L37A 2QKLA 3NSUA 3MIWA 5FI1A 2O3JA 4Y99C 4A6KA 2KUPA 1HJ0A 3H1IE 2KUBA 1MKMA 2B89A 1H88A 2VRSA 1SQPE 2I1KA 4PV1B 2E5YA 2K1AA 3TO1A 2WSEJ 2J0KA 4JPZB 5FI0A 5LOPB 3VMYA 2D2CB 1U29A 5D3VA 2N1TC 4WWIA 2YO2A 1OW6A 4KT0J 3T97B 1IRSA 4RO0A 2IBZD 2E5TA 1PMSA 3H1HE 3QWMA 2V76A 3RK3E 2IFSA 3S9OA 3EWKA 1MIXA 3IN6A 1EDIA 1Q82Q 1NTZG 3U8ZA 1FDIA 1RRPB 3H1JD 2XQNM 5AVUB 3D6ZA 1T3UA 3WMM0 3SWKA 2KIEA 3L74J 1LWUC 3ODXA 5AW1B 4WJ7A 5I2SA 3V4QA 1E5WA 3GF3A 1SQBG 1SQPK 4LLHA 4EDFA 3AEBC 2A45I 5KKZC 1SQQD 1URQB 3W67A 3NW8A 2D2QA 1P3RA 3B71A 1M8OB 5B66E 3HRNA 1AA0A 1NTVA 4TLFA 3H1KG 4H44B 3TF5A 5APSA 3M0AA 5KCVA 2COCA 1FJPA 2AEMA 1DDMA 2QM8A 3W68A 3AECC 1FZFA 3V4WA 2D9YA 5AW6B 3HE5B 2LOZA 3H1LE 3QIJA 1TXDA 4R4MA 3I5CA 2DX5A 2N1TA 1MAIA 2O1JA 4GOUA 1QLED 2QKMA 2E75B 1U27A 2J0JA 1NTYA 1FZCA 2HR3A 2KSJA 2Z0QA 4A6HA 1QGKB 4QXAB 3IAOA 1XKEA 1SQPD 2CAYA 1SFCC 1OVRA 2H88C 1PL5A 1Q81Q 3KZIH 1SQXJ 2WPVB 1NTZE 2KUQA 2IFNA 4I1LA 2XNDH 1W5CE 3N4XA 3A7OA 3CD6P 4NPFX 1RE3A 2HODB 1PGJA 3GW6A 3KQGA 4PD4I 1VQ8P 4WY4A 3AEFC 2DFKA 3RK2B 1PP9E 4Z2MB 2DN6A 1GL2A 1SQQG 4OGQC 2XNXA 2LR2A 2R2YA 2Q3IA 3AU4A 3FXEA 3NTNA 2H7EA 1W2EA 4YTPC 4WVZA 3U1AA 2M3EA 3BCCE 3Q1MA 2WTYA 2C9LY 2ADZA 3T97A 1IFMA 4Z2NA 3SYXA 3ML4A 2ZT9D 1QL1A 1HWTC 4N3YB 2M3BA 2P8VA 2LYDA 1USDA 1BSHA 1IZNB 1S2EA 2B87A 1JY2O 1L0NE 2DHJA 3CI9A 3CC7P 2E76D 1G1IA 5B5EH 1IK7A 4UB6E 1IC2A 3H1HJ 4W7ZA 3P8CE 4IFDK 1JB0J 1GG3A 3RL0C 2YXRB 4I7ZC 4M3LA 1KMIZ 1FDMA 1LTJA 3JSVC 1GZLA 3T06A 2YMKA 1MPHA 3MD0A 4EI2A 1VQNP 1KYOD 2WWWA 4EIJA 4C7NA 2COFA 1K04A 3CWBD 1OQNA 1YQ4C 4IL6X 4L73A 1UPQA 3L71E 1G1JA 3AE6C 4K35A 3HQCA 1A02J 1NTKE 2KLUA 2B87B 2AL6A 3BRTB 5AW5B 2KS1A 2FKWB 2OYIA 4A6FB 5HE1A 2WSFH 3L72J 3KSYA 2W6AA 2Y9ZA 1QEXA 1ZC4B 4IOYX 1BGYD 2H8PD 3AEEC 1N7LA 2KNCA 5KLVE 1NWQA 3D8DA 4QJ4B 3M91A 2BCJA 4EYYQ 2W90A 1UIXA 1A02F 1K73Q 3NXSA 3A8PA 2QVAA 1S72P 2N1TD 1OW8A 2ITAA 1KILA 1SQQE 2NPSB 1L4AD 3CMAP 2P0FA 2LOXA 1SQVE 1KYOI 1SQQK 3V2RA 3G3ZA 4U3FJ 1IFDA 3PEGA 1L0LJ 3A8QA 1VQ4P 4TKNA
chains in the Genus database with same CATH topology
1YYCA 1MUUA 5CCHD 1J1EC 2IPPA 2CY4A 3SO6A 1P6SA 1M1JB 2GCLA 1U5DA 5CCHC 5CCGC 4K17A 2UZRA 1T2KC 1ZVRA 2MWNB 5AVZB 2ZXEB 3CLQA 1GL2D 4C7NB 1JTHA 1T2KD 1HBWA 1M7EA 2D10A 5DH9B 3HUSB 5AW9B 1N73B 4F7HA 5KLVK 1SQBK 1FHXA 3D8FA 1X9VA 3IFMA 2PAJA 2GUSA 2AEHA 3RL0B 4A6FA 4GMVA 4K81A 1IJDB 2YMYA 5HE2A 1X79B 1G2CB 4N78E 3X23A 2R3CA 4Y99B 2D9XA 1AQ5A 1Y5OA 3ULBA 4WY4B 1ZSQA 3WA0A 1FOSF 3V5BA 5C6RA 5HE0A 3P7ZA 5C79A 2ZPYA 4LC1A 1H8AA 3B5NA 1FOEA 1S9KE 1LT9C 2WPSA 3EFGA 3OA7A 4I6MC 1LTSC 1X8YA 3P8MC 3SWFA 2L5GB 1X11A 2YT1A 1SFCD 3GYPA 1V89A 1EAZA 1KFMA 4Y94A 3A5TA 2Q5UA 1U2BA 1KILD 3HD7C 2NPSD 1WVHA 1KILC 1T8ZA 5CHXA 2RVBB 1CZQA 5GOWB 3VMXA 4JYCA 1NTKK 1JY2N 2XU6A 1FGZA 1PFIA 2RUKB 2C9NY 4XWXA 2D9ZA 3M9BA 3AJ4A 3V5WA 3VOPA 5AVTB 4LGDE 4ZRKA 3HD7A 3O8ZA 1XX0A 3H32B 1FZCB 1NO4A 3B8EB 4F7GA 2CODA 3C9IA 5J3QA 4K2OA 1WGQA 1LTBC 1QL2A 5J3YA 1L4AC 2VRWB 1MZ9A 2XV5A 3M0DC 1MK9B 1EQ7A 4GIFA 4XA4A 4DXAB 3LIEA 1OMWA 2PP6A 3V2NA 1LTJB 5BU8B 2WT7A 1FZGA 1JY2P 1VDFA 3A2AA 1BWNA 3HD7D 2DX1A 1AQCA 3ZVRA 1XD4A 1XTCC 1NKNA 4GN1A 4IFSA 2O1KA 5CMZA 2RLOA 1JUNA 3MDBC 2FFDA 1J1DB 2O01H 4I2LC 2GJYA 3SNHA 3LW5H 1N7SD 3PP5A 3RK3B 2DLWA 2FFDC 3ODWA 1YTZI 2W6BA 1IO4A 4W7YA 1JCCA 3B5ND 3RCPA 3L36A 2YRYA 2P2UA 1GU4A 4TYZA 3TFMA 3DXEA 3VIAA 1DDWA 3V2PA 5BVZA 4HAVB 2D11A 2I5FA 1M7RA 3KYQA 4GKGA 2I5CA 4GZUA 2HLOA 2R09A 4WBAA 1H89A 1W1GA 2HODA 2K2JA 2A45H 1NKZB 2Z5IA 1Z87A 2EC1A 4EKUA 1RF1C 3BVHA 3U59A 4P7IA 2D9WA 3PG7A 1LB1A 3N7NA 3SWYA 4C7RA 1X86A 1L0NK 2J58A 2HTHB 1TQZA 3CXBB 4HHVA 1GD2E 5D3XA 1GC6A 2KCJA 4DX8A 4ZRJA 3SUZA 4N6JA 2GM4A 1U5FA 1FGYA 2XKMA 5C5BA 1HGZA 1N7SC 1NTMK 1SHCA 1Q67A 2DA0A 2CRFA 3HW2B 2NPSC 4PNKA 1IFNA 3NFQA 2K00A 2YS3A 2QM7A 1HTLC 1DROA 1BAKA 4PQ0A 3UIAA 5AVVB 5CLLB 2EMSA 2RGNB 2LG1A 4HAWB 1CSBA 1GL2B 2I1JA 1LGHB 2P1JA 2W2WA 3G9WA 3R2PA 2YS1A 1RF0A 3GHGB 3M06A 1JY3P 3VN0A 2WPRA 1M1JC 3BINA 2WITA 2OYIC 1BTKA 1CI6A 5APVA 1CI6B 1UNQA 3A98B 3KZ1A 5CLQB 2J59M 1JY3O 4KHBB 2WPQA 3LJUX 3TSIA 3HUSC 1V5UA 2K2UA 1N73C 3FM8C 4HB2B 5L81A 1Y19B 2H7DA 3HUSA 1B55A 1XTGB 2P67A 1MK7B 3CL3D 1SFCB 3F0WA 1HGVA 2P7JA 1V5MA 1FU1A 1M1JA 1HVVA 1WRGA 2R32A 3L37A 2QKLA 3NSUA 3MIWA 1V88A 5FI1A 4Y99C 2KP8A 4A6KA 2KUPA 4DX90 4WY4C 1GTWA 1T3JA 3ZDTA 2RSGA 2YKQA 5JHHA 1IFJA 2OTXA 3N7CA 3UZTA 3TYYA 1KI1B 2H7HA 1JMMA 1LT9B 4GT1A 3P32A 2VRSA 1H88A 2BASA 4GMXB 1FOSE 2R5DA 2E2XA 2E43A 3OANA 2I1KA 5AW4B 3TO1A 3IR9A 2CPBA 3RL0D 2MJZA 2J0KA 5FI0A 5LOPB 2YO3A 4HDQA 3VMYA 1U29A 1SFCA 5D3VA 1DBHA 5D3YA 2N1TC 3RK2C 2DTCA 1UEFA 4RESB 1OWAA 3BATA 2JP2A 2ROZB 4K2PA 2YO2A 4B6HA 1SP4A 2W2XD 2PZ1A 3DXCA 1AWEA 3OJAB 1FB8A 2LKOA 3DXDA 1IRSA 2HYNA 1N2DC 1PMSA 1N73A 5KJ7C 1WJ1A 2M38A 5AVQB 2G35A 3QWMA 2V76A 2WZ7A 2IFSA 1L4AB 3GHGA 1EVHA 1K5DB 3HE4B 1JTHB 1MIXA 2ELBA 4HAUB 3H6PA 2FJLA 3U8ZA 3U7DA 1OY2A 1RRPB 1SQVK 4A5KA 2XQNM 3KPEA 3U1CA 5AVUB 1JO5A 5DIFB 2DKPA 4ZRIA 1RF1A 1T3UA 3WMM0 4DBBA 1LWUC 3VP8A 3ODXA 1J1DC 1HUCA 5AW1B 4WJ7A 3V4QA 3M9QA 3RK3C 1E5WA 2A45G 4KHXA 1SQPK 1FZAA 3NMDA 4LLHA 1LTGC 1MV8A 2OYHC 5AVWB 4BBKA 4CYEA 2A45I 2WSEH 5AW0B 1URQB 3VOQA 1N86A 4GXBA 3BASA 1PLSA 4JYBA 4DZOA 2D2QA 1FBMA 1ZR4A 1GK4A 3QBVB 3VTPC 1P3RA 2E42A 1LTTC 4ZKUA 5AVXB 1CW5A 3HRNA 1RF1B 4ZKPA 1WJMA 4IAPA 1NTVA 4EMOA 3EQ2A 2UVMA 1J19A 3ULCA 1GC7A 4HH2A 1ZM0A 4HB4B 4CHMA 5KJ7A 5D3WA 1U5EA 1URQD 5AW3B 5APSA 5AVRB 3M0AA 4KHOA 5KCVA 2COCA 1FJPA 1DDMA 2QM8A 3PZDA 1DYNA 1J2JB 1JCDA 1N7SB 3RK3D 1N7SA 2XZRA 1H10A 1BTNA 4AQRD 1FZFA 3V4WA 2D9YA 1KZ7A 1HH0A 5AW6B 3HE5B 2MFQA 5AW7B 1YTZT 2DKQA 2LOZA 3QIJA 1TXDA 1NOHA 1XR0B 2N0YA 2KB7P 5CCGD 4D0NB 4HAYB 3KDPB 2M8RA 1GL2C 2N1TA 3I5CA 2O1JA 1MAIA 2DX5A 4MT7A 3WYFB 2IX7C 2QKMA 1XODA 2NZ8B 3TCAA 4EJNA 1Z56A 2OYIB 1KZGA 1U27A 2W2XC 2J0JA 1NTYA 1FZCA 2VSZA 3P7KA 2YSZA 2Z0QA 2KSJA 1LWUA 3E1IA 1SGHA 4A6HA 5C16A 3KRWA 4KVGB 1FJKA 1RY3A 1GW3A 3V2QA 3PVWA 1XKEA 3O96A 1GW4A 2CAYA 1SFCC 3P6AA 2MDXA 3MPXA 1LW3A 1FHWA 4HDOA 2Q9IA 5CJ0A 1SLQA 1DEBA 2DHKA 2IFNA 4I1LA 1IK9A 3CIKA 3N4XA 2C0XA 4NY0A 3A7OA 1RE3A 2HODB 5KJ7D 5DHFB 2Q7CA 5AW2B 5APQA 3KQGA 3L35A 2HFED 3GYOA 1DH3A 2UZSA 2EMTA 1NU1K 3P8CD 3MUDA 3VP9A 2GUVA 3KY9A 4WY4A 4KHAA 2DFKA 4KAXB 1WT6A 3TK1A 1JOCA 2N1TB 3RK2B 4WY4D 4Z2MB 2DN6A 1L0LK 1GL2A 3VMZA 1FZEA 1V61A 4YL8A 5J3TA 2IFMA 4L6EA 3L4FA 2XNXA 3HK0A 2JEEA 2Q3IA 3AU4A 1UNPA 4JF7A 3NTNA 2H7EA 1W2EA 1NI2A 1TJ6A 1N3HA 2DHIA 2YS5A 3F5RA 4AUWA 1RF0C 4OH8B 3U1AA 1QQGA 2C9LY 2WTYA 2ADZA 3T97A 1IFMA 3M9HA 4Z2NA 4HB0B 3MGNA 2L2IA 2OARA 1UNRA 3SYXA 5C5BB 1LT9A 1I7AA 3TVVA 5CCGA 1FZBA 2HPCB 1WGUA 2M14A 3ML4A 2Z5HA 2GCJA 5AVYB 2YKOA 2IYBA 2YKPA 2Y8FA 1QL1A 1RE4A 1SQXK 1HWTC 2HG5D 3A3YB 4N3YB 2M3BA 1LWUB 2P8VA 2LYDA 4CHJA 1GDTA 1MFZA 5LONB 3TNUA 1JY2O 4WSFA 1NHLA 3B5NB 1AFOA 2OQBA 2DHJA 2J0MA 3CI9A 1KFNA 3LIDA 4HATB 1J1EB 4AYCA 3KRXA 1G1IA 1KZUB 1NH4A 1ZV8A 1DX7A 1LTIC 5BU5A 1G2CA 2HPCA 1IC2A 2OYHB 3AU5A 1NU2A 2NMBA 4W7ZA 5D27A 2CY5A 1URQC 3P8CE 2FYUK 4IFDK 1X1FA 1FAVA 1GG3A 2D9VA 3HE4A 4C46A 1W1DA 1GK6A 1VPCA 3PSCA 4H8SA 3HTKB 3RL0C 1MKEA 2Z0PA 2KYVA 4M3LA 3BJIA 2FYZA 1IFIA 1FDMA 1LTJA 3HTKA 2YNYA 3II6A 2FXMA 2LULA 1GZLA 5JP4A 1K5GB 3T06A 2N9BA 5JHGA 1MIZB 1X1GA 1MPHA 5APWA 2LKMA 3MD0A 2WT7B 4EOTA 2P0DA 1H4RA 1ZR2A 2D4QA 3HE5A 2KLVA 2WWWA 1UPRA 2GS0A 2X18A 2XDJA 1I2HA 4EIJA 5JLJB 4C7NA 5DI9B 2N23A 3MTUE 2DYNA 2COFA 4B86A 1OQNA 3TNUB 4HB3B 3HD7B 2ROVA 1KILB 1ZLLA 4GPTB 3M1IB 2Y7BA 1FAOA 1UPQA 5AW8B 2Z0OA 1V5PA 2ELAA 2R5BA 1G1JA 3VYIA 2OYHA 3PVUA 4F7UP 1W1HA 2Z4EA 4IFMA 3HQCA 4HAXB 1A02J 1PFJA 1P5TA 2HE7A 2YT0A 3PP2A 2H43A 1FZCC 1ZN5A 5APXA 4HYTB 1JY3N 1EGXA 2AL6A 1OXZA 1WG7A 3BRTB 5AW5B 2FKWB 2YVCA 1J0WA 2DYQA 2EJ8A 1WI1A 4C0AA 1ZC3B 1LTJC 2CPSA 4WB4A 4YONA 4N78D 2OYIA 3TW1A 2R0DA 3FSSA 5KQ4A 1M7LA 3PVLA 5CCHA 4A6FB 3IVFA 1JNMA 3BRVB 5EFXA 1NAFA 2WSCH 2WSFH 1DDVA 5HE1A 3KSYA 2W6AA 4XE5B 2FFDB 2KOGA 4HAZB 2L1CA 3H32A 4DOJA 1RJ2A 1ZC4B 2KGXB 5KTBA 1ISNA 1L4AA 4IOYX 2H8PD 1S9KD 1N7LA 5APUA 1U5GA 5APYA 1NWQA 3D8DA 2COAA 3M91A 2BCJA 1RE3C 2POHA 5CJ4A 4MY6A 1A02F 2Q13A 4MK0A 3FEHA 5HE3A 5APTA 3SV1A 3NXSA 1XCGA 2P0HA 3A8PA 1HJBA 3OAKA 1NTZK 2N1TD 3M0DA 4IFFA 3RK2D 2MKRA 2NPSA 5KQ1A 2ZFCA 4W80A 5AVSB 1URQA 1KILA 2Y8GA 2NPSB 1L4AD 1QC6A 4O9BA 2P0FA 2LOXA 1LTAC 1GU5A 1SQQK 2W27A 1KQLA 1RE4C 1X05A 2RNRB 2VKIA 2YF0A 4NSWA 3D8EA 3V2RA 4TKNA 3G3ZA 1FHOA 1IFDA 3PEGA 5DHAB 3A8QA 4WVFB 1EF1A 2C0WA 1SVFA 3B5NC 2JJLA 3ODOA 3GHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SO6 A;  2CY4 A;  1P6S A;  2GCL A;  1U5D A;  4K17 A;  2UZR A;  1ZVR A;  2MWN B;  2HE7 A;  3CLQ A;  2D10 A;  1M7E A;  5DH9 B;  4F7H A;  5KLV K;  1SQB K;  1FHX A;  3D8F A;  2AEH A;  4A6F A;  4GMV A;  4K81 A;  5HE2 A;  3X23 A;  2D9X A;  3ULB A;  1Y5O A;  1ZSQ A;  3WA0 A;  5C6R A;  5C79 A;  5HE0 A;  3P7Z A;  2ZPY A;  1FOE A;  1X11 A;  2YT1 A;  3GYP A;  1V89 A;  1EAZ A;  4Y94 A;  1U2B A;  1WVH A;  2RVB B;  5GOW B;  1NTK K;  1FGZ A;  2RUK B;  4XWX A;  2D9Z A;  3AJ4 A;  4ZRK A;  1XX0 A;  4F7G A;  2COD A;  5J3Q A;  4K2O A;  1WGQ A;  5J3Y A;  2VRW B;  1MK9 B;  4DXA B;  1OMW A;  3ZVR A;  1BWN A;  2DX1 A;  1AQC A;  1XD4 A;  4GN1 A;  4IFS A;  2RLO A;  3MDB C;  2GJY A;  2O01 H;  3SNH A;  3LW5 H;  3V5W A;  2DLW A;  3ODW A;  3RCP A;  2YRY A;  4TYZ A;  3TFM A;  3DXE A;  3VIA A;  1DDW A;  4HAV B;  2D11 A;  2I5F A;  1M7R A;  4GZU A;  2I5C A;  2R09 A;  1W1G A;  2K2J A;  1Z87 A;  2EC1 A;  4EKU A;  4P7I A;  2D9W A;  3PG7 A;  1LB1 A;  1X86 A;  1L0N K;  2HTH B;  3CXB B;  1TQZ A;  4HHV A;  5D3X A;  1GC6 A;  2KCJ A;  4DX8 A;  4ZRJ A;  3SUZ A;  1U5F A;  1FGY A;  5C5B A;  1NTM K;  1SHC A;  1Q67 A;  2DA0 A;  2CRF A;  3HW2 B;  4PNK A;  2K00 A;  2YS3 A;  1DRO A;  1BAK A;  4PQ0 A;  5CLL B;  2EMS A;  2RGN B;  2LG1 A;  4HAW B;  2I1J A;  2W2W A;  3G9W A;  2YS1 A;  3BIN A;  1BTK A;  3KZ1 A;  1UNQ A;  3A98 B;  5CLQ B;  2J59 M;  4KHB B;  3LJU X;  3FM8 C;  4HB2 B;  1V5U A;  2K2U A;  5L81 A;  1Y19 B;  2H7D A;  1B55 A;  1MK7 B;  3F0W A;  1V5M A;  2QKL A;  3NSU A;  1V88 A;  5FI1 A;  4A6K A;  2KUP A;  4DX9 0;  3ZDT A;  5JHH A;  2RSG A;  3UZT A;  2OTX A;  3N7C A;  1KI1 B;  4GMX B;  2E2X A;  3OAN A;  2I1K A;  3TO1 A;  2J0K A;  5FI0 A;  5LOP B;  4HDQ A;  1U29 A;  5D3V A;  1DBH A;  5D3Y A;  2DTC A;  1UEF A;  2JP2 A;  2ROZ B;  4K2P A;  4B6H A;  2W2X D;  2PZ1 A;  3DXC A;  1AWE A;  1FB8 A;  2LKO A;  3DXD A;  1IRS A;  1PMS A;  1WJ1 A;  2M38 A;  2G35 A;  3QWM A;  2V76 A;  2IFS A;  1EVH A;  1K5D B;  1MIX A;  2ELB A;  4HAU B;  2FJL A;  3U8Z A;  3U7D A;  1OY2 A;  1RRP B;  1SQV K;  4A5K A;  2XQN M;  5DIF B;  4ZRI A;  2DKP A;  4DBB A;  3ODX A;  4WJ7 A;  3M9Q A;  1E5W A;  1SQP K;  4BBK A;  4CYE A;  2WSE H;  3VOQ A;  4GXB A;  1PLS A;  2D2Q A;  3QBV B;  1P3R A;  1WJM A;  4IAP A;  1NTV A;  4EMO A;  2UVM A;  1J19 A;  3ULC A;  1GC7 A;  1ZM0 A;  4HB4 B;  4CHM A;  5D3W A;  1U5E A;  4KHO A;  5KCV A;  2COC A;  1DDM A;  3PZD A;  1DYN A;  1H10 A;  1BTN A;  2D9Y A;  1KZ7 A;  2MFQ A;  2DKQ A;  2LOZ A;  3QIJ A;  1TXD A;  1XR0 B;  2N0Y A;  4D0N B;  4HAY B;  2DX5 A;  1MAI A;  3WYF B;  4MT7 A;  2QKM A;  1XOD A;  2NZ8 B;  3TCA A;  4EJN A;  1KZG A;  1U27 A;  2W2X C;  2J0J A;  1NTY A;  2VSZ A;  2YSZ A;  2Z0Q A;  5C16 A;  1SGH A;  4A6H A;  3KRW A;  4KVG B;  3PVW A;  1XKE A;  3O96 A;  2CAY A;  3P6A A;  2MDX A;  3MPX A;  1LW3 A;  1FHW A;  4HDO A;  2DHK A;  3CIK A;  4NY0 A;  5DHF B;  3GYO A;  2UZS A;  2EMT A;  1NU1 K;  3KY9 A;  4KHA A;  2DFK A;  4KAX B;  4Z2M B;  2DN6 A;  1L0L K;  1V61 A;  4YL8 A;  5J3T A;  4L6E A;  3HK0 A;  3AU4 A;  1UNP A;  2H7E A;  1NI2 A;  1TJ6 A;  1N3H A;  2DHI A;  2YS5 A;  3F5R A;  1QQG A;  2ADZ A;  4Z2N A;  4HB0 B;  2L2I A;  2OAR A;  1UNR A;  3SYX A;  5C5B B;  3TVV A;  1I7A A;  1WGU A;  2M14 A;  3ML4 A;  2GCJ A;  2IYB A;  2Y8F A;  1SQX K;  4CHJ A;  2P8V A;  2LYD A;  5LON B;  4WSF A;  2OQB A;  2DHJ A;  2J0M A;  4HAT B;  3KRX A;  3AU5 A;  1NU2 A;  2NMB A;  5D27 A;  2CY5 A;  2FYU K;  4IFD K;  1X1F A;  2D9V A;  1GG3 A;  1W1D A;  3PSC A;  4H8S A;  1MKE A;  2Z0P A;  3BJI A;  2LUL A;  5JP4 A;  1K5G B;  3T06 A;  5JHG A;  1MIZ B;  1X1G A;  1MPH A;  2LKM A;  2P0D A;  1H4R A;  2D4Q A;  1UPR A;  2GS0 A;  2X18 A;  1I2H A;  5JLJ B;  5DI9 B;  2N23 A;  2DYN A;  2COF A;  1OQN A;  4HB3 B;  2ROV A;  4GPT B;  3M1I B;  2Y7B A;  1FAO A;  1UPQ A;  2Z0O A;  1V5P A;  2ELA A;  3PVU A;  4F7U P;  1W1H A;  3HQC A;  4HAX B;  1PFJ A;  1P5T A;  2YT0 A;  3PP2 A;  1EGX A;  2AL6 A;  1WG7 A;  2YVC A;  1J0W A;  2DYQ A;  2EJ8 A;  1WI1 A;  4C0A A;  1ZC3 B;  4YON A;  3TW1 A;  2R0D A;  3FSS A;  5KQ4 A;  3PVL A;  4A6F B;  3IVF A;  5EFX A;  2WSC H;  1DDV A;  2WSF H;  5HE1 A;  3KSY A;  4HAZ B;  2L1C A;  1RJ2 A;  1ZC4 B;  2KGX B;  1ISN A;  4IOY X;  1U5G A;  3D8D A;  2COA A;  2BCJ A;  4MY6 A;  2Q13 A;  4MK0 A;  3FEH A;  5HE3 A;  3SV1 A;  1XCG A;  2P0H A;  3A8P A;  1NTZ K;  2MKR A;  5KQ1 A;  2Y8G A;  1QC6 A;  2P0F A;  2LOX A;  2VKI A;  1SQQ K;  1X05 A;  2RNR B;  4NSW A;  2YF0 A;  3D8E A;  4TKN A;  3G3Z A;  1FHO A;  3PEG A;  5DHA B;  3A8Q A;  4WVF B;  1EF1 A;  3ODO A; 
#chains in the Genus database with same CATH topology
 1YYC A;  5CCH D;  2V7Q J;  1ZME C;  2UZR A;  1ZVR A;  2MWN B;  1T2K D;  2IYO A;  5AW9 B;  1N73 B;  5KLV K;  1K9M Q;  1DD3 A;  2OTJ P;  4K81 A;  1ZSQ A;  3V5B A;  1EZV G;  3H1K D;  5C79 A;  4LC1 A;  1BDD A;  1W2B O;  4BWN A;  4I6M C;  2JDI H;  3SWF A;  2L5G B;  4PV1 C;  1RQU A;  2YT1 A;  3L73 J;  3MP7 B;  2Z14 A;  1EAZ A;  4OGQ D;  2Q5U A;  1U2B A;  2NPS D;  1KIL C;  5GOW B;  3VMX A;  1BE3 J;  1FGZ A;  1P84 I;  4ZRK A;  4H13 B;  1FZC B;  3O6Q B;  2COD A;  3C9I A;  4K2O A;  1QL2 A;  4U7J A;  1L4A C;  2VRW B;  2XV5 A;  3M0D C;  4GIF A;  1VF5 C;  5BU8 B;  2R3S A;  1RH5 B;  3A2A A;  2DX1 A;  1XD4 A;  1XTC C;  1NKN A;  1R5S A;  2O1K A;  5CMZ A;  2RLO A;  1JUN A;  1J1D B;  2O01 H;  3LW5 H;  3V5W A;  2DLW A;  5GTH E;  4W7Y A;  1JCC A;  1GU4 A;  1PP9 D;  1DDW A;  5BVZ A;  1BDC A;  4HAV B;  3KYQ A;  2WSS H;  2HLO A;  2R09 A;  4WBA A;  2Z5I A;  3L70 E;  4EKU A;  1RF1 C;  2KK7 A;  3U59 A;  2KR0 A;  3AE1 C;  4C7R A;  1NTK D;  2Y0E A;  5D3X A;  4H44 C;  3AE7 C;  4ZRJ A;  4N6J A;  5C5B A;  2QG4 A;  1SHC A;  1Q67 A;  2DA0 A;  2CRF A;  2NPS C;  2E76 B;  1HTL C;  4H44 D;  3L71 G;  1DRO A;  4PQ0 A;  3UIA A;  5AVV B;  5CLL B;  3SSU A;  2RGN B;  2PRR A;  1GL2 B;  2BCC D;  2P1J A;  3GHG B;  1JY3 P;  1NU1 J;  1CI6 A;  1PGO A;  3TSI A;  5L81 A;  2K2U A;  3D71 A;  1PIX A;  2WSF J;  2P7J A;  3L75 J;  1FU1 A;  1V5M A;  3WU2 E;  4DX9 0;  2RSG A;  1SQQ J;  1IFJ A;  2OTX A;  4HJG H;  3TYY A;  2H7H A;  3PJS K;  4GMX B;  1UII A;  5TIS H;  3NWF A;  2CPB A;  3RL0 D;  1S3J A;  3D70 A;  2YO3 A;  4GNK B;  4HDQ A;  1DBH A;  3RK2 C;  2DTC A;  2FXO A;  4RES B;  1EZV E;  2ROZ B;  3OHM B;  3OJA B;  2ZKM X;  2LKO A;  3PLN A;  4JQ0 D;  3L72 E;  2HYN A;  1N2D C;  5KJ7 C;  2M38 A;  5AVQ B;  2Z4D A;  2WZ7 A;  3HE4 B;  1KC8 Q;  3H6P A;  2OGU A;  2AXC A;  3GLM A;  3KPE A;  5DIF B;  4ZRI A;  4DBB A;  1H0T B;  3VP8 A;  1LNQ A;  2A45 G;  4KHX A;  3NMD A;  1Q90 D;  2AEJ A;  4CYE A;  5AW0 B;  1NTZ D;  3F89 A;  1PLS A;  2K3R A;  1FBM A;  1ZR4 A;  1LTT C;  4ZKU A;  1CW5 A;  1RF1 B;  4ZKP A;  1WJM A;  2BEZ F;  2Y0C A;  1J19 A;  3WU2 H;  1URQ D;  4KHO A;  1NTM J;  3AE5 C;  1J2J B;  1N7S A;  2XZR A;  1H10 A;  3CCS P;  2FY8 A;  1ZW0 A;  1K05 A;  2Y9Y A;  5C39 A;  1OVU A;  1XR0 B;  1KYO H;  5CCG D;  2MKV A;  3KDP B;  1KD1 Q;  1GL2 C;  4MT7 A;  2IX7 C;  4YXW H;  1KTM A;  1Z56 A;  1KZG A;  2W2X C;  2VSZ A;  3P7K A;  1L0N J;  1P84 H;  2IDB A;  2ZT9 B;  1FJK A;  2JO1 A;  1GW3 A;  3P6A A;  2IBZ E;  1VQP P;  1IK9 A;  1EZV D;  4PD4 E;  3B4S A;  2FYU D;  5KJ7 D;  2Q7C A;  3H25 A;  3CME P;  4KHB A;  4XFJ A;  4KHA A;  1WT6 A;  1YJW P;  1JOC A;  2N1T B;  4K3A A;  2RN0 A;  4YL8 A;  2QIW A;  2OTL P;  4CSQ A;  1Y9B A;  2YS5 A;  4AUW A;  4UB8 H;  3CCE P;  1AVY A;  3MGN A;  1UNR A;  5C5B B;  1LT9 A;  5CCG A;  1WGU A;  2M14 A;  5AVY B;  1SQV J;  2YKP A;  1RE4 A;  2HG5 D;  4CHJ A;  1GDT A;  3TNU A;  2IZ1 A;  4WSF A;  2J0M A;  2E74 C;  1KFN A;  3LID A;  3AEG C;  1NJI Q;  4HAT B;  1ZRT D;  1J1E B;  3KRX A;  1DX7 A;  4DCK A;  5BU5 A;  1G2C A;  2NMB A;  5D27 A;  4ZNC A;  5KAI E;  1URQ C;  2FYU K;  4L76 A;  3HE4 A;  1GK6 A;  2QA4 P;  1MKE A;  2FYZ A;  2YNY A;  1NU1 E;  1NTK G;  1BE3 G;  1X1G A;  2LKM A;  2WT7 B;  4EOT A;  4OT1 A;  1H4R A;  1ZR2 A;  1EDL A;  5KAI H;  2D4Q A;  3HE5 A;  2X18 A;  2XDJ A;  5B5E E;  1PV3 A;  4GOF A;  5JLJ B;  3I55 P;  5DI9 B;  3MTU E;  2DYN A;  1HF9 A;  2ROV A;  3C8V A;  1FAO A;  2BCC G;  2KI7 B;  2Z0O A;  1V5P A;  2QJP C;  3USS A;  3PVU A;  4F7U P;  4HAX B;  1P5T A;  1Q86 Q;  5KLI B;  4H13 C;  3PP2 A;  1BCC J;  1FZC C;  1ZN5 A;  2PFX A;  3CCM P;  3L71 J;  4RJT A;  2DYQ A;  3PTZ A;  1ZC3 B;  4YON A;  1N8R Q;  1VQK P;  2R0D A;  5KQ4 A;  2M0B A;  5CCH A;  3JCU H;  3CC4 P;  4YXD C;  5EFX A;  1KIL E;  3CCL P;  2IBZ G;  3H32 A;  4DOJ A;  1ISN A;  1D7M A;  5APY A;  1KB9 E;  2COA A;  3Q5R A;  2JKV A;  4MY6 A;  1DIP A;  3SV1 A;  2P0H A;  1HJB A;  4L1R A;  2IZ0 A;  4IFF A;  1NTZ K;  2RKL A;  1BE3 D;  2NPS A;  1BE3 E;  4W80 A;  1AQT A;  1LTA C;  1GU5 A;  2W27 A;  3D8E A;  1FHO A;  3RGU A;  2W6J H;  3B5N C;  2JJL A;  3CCR P;  1MUU A;  3SO6 A;  2IPP A;  2BCC E;  2GCL A;  5CCH C;  2KNC B;  5AVZ B;  2ZXE B;  2HE7 A;  4H0L C;  4C7N B;  1M7E A;  3D8F A;  1X9V A;  3IFM A;  2AEH A;  3CX5 I;  1S5L X;  3RL0 B;  2A06 G;  2YMY A;  5HE2 A;  1X79 B;  1G2C B;  4ZMD A;  2R3C A;  3X23 A;  1AQ5 A;  5C6R A;  3P7Z A;  3WUU A;  2ZPY A;  5KLV D;  1LT9 C;  2WPS A;  3EFG A;  3OA7 A;  3L74 G;  1LTS C;  1X8Y A;  3CCU P;  3GYP A;  1QVG O;  3CX5 E;  4Y94 A;  2KIG A;  1AVO A;  2K9Y A;  2K49 A;  3AE9 C;  1OMI A;  5CHX A;  2XU6 A;  2Y0D A;  2C9N Y;  3AJ4 A;  3VOP A;  4YPC A;  5L8R J;  3TGU D;  3O8Z A;  2ZYG A;  4MN4 C;  3CXH E;  3B8E B;  1SQB J;  1LTB C;  1WGQ A;  3HIE A;  1MZ9 A;  2V7Q H;  4XA4 A;  1L2P A;  3LIE A;  1OMW A;  1JY2 P;  1VDF A;  2GA1 A;  4GN1 A;  4IFS A;  4OVN F;  4I2L C;  3L75 D;  1N7S D;  3PP5 A;  3RK3 B;  2FFD C;  2W6B A;  3RCP A;  4HKZ H;  1PGQ A;  1KYO E;  3TFM A;  3H1J J;  3GF7 A;  3V2P A;  3RBZ A;  1M7R A;  1AV1 A;  1KOR A;  1H89 A;  3GG2 A;  2HOD A;  2K2J A;  2A45 H;  3QWO C;  4PD4 H;  2PGD A;  3PG7 A;  3N7N A;  1KN7 A;  2ZYA A;  2J58 A;  4HHV A;  1GC6 A;  2KCJ A;  2WSC J;  2QJY B;  3SUZ A;  3AE3 C;  1HGZ A;  1N7S C;  4L74 A;  3L74 E;  2K00 A;  1BAK A;  2JWA A;  3JC2 2;  2LG1 A;  1LGH B;  3DCX A;  2YS1 A;  4JBZ A;  1YBK A;  3VN0 A;  1M1J C;  2WIT A;  2OYI C;  1BTK A;  3KZ1 A;  1CI6 B;  1YQ3 C;  3A98 B;  1JY3 O;  4KHB B;  1M56 D;  3A0H E;  3HUS C;  1EC5 A;  1ZYI A;  2H7D A;  1XTG B;  3LW5 J;  3CL3 D;  3F0W A;  1HGV A;  1SS1 A;  4PD4 D;  3G6E P;  1HVV A;  1V88 A;  3H1K E;  2KP8 A;  4WY4 C;  3ZDT A;  5JHH A;  2YKQ A;  4L75 A;  1JMM A;  2BAS A;  1FOS E;  3OAN A;  1SQP J;  1WMK A;  1KQS O;  2FXP A;  3IR9 A;  3S1K A;  1BCC E;  1UEF A;  1OWA A;  4OGQ B;  1USE A;  2JP2 A;  4K2P A;  4B6H A;  3BCC J;  1FB8 A;  2QSI A;  2W83 C;  2P10 A;  1WJ1 A;  5H2F H;  5I2M A;  1L4A B;  3GHG A;  1EVH A;  1VF5 B;  1JTH B;  4IL6 H;  2ELB A;  4HAU B;  2G3A A;  1PP9 J;  2FJL A;  3U7D A;  1Q2N A;  1SQV K;  4A5K A;  4HSI A;  1Y8A A;  1BGY G;  2DKP A;  1RF1 A;  2CK3 H;  4DT0 A;  3M9Q A;  3O6Q A;  3RK3 C;  1FZA A;  1YIT P;  1LTG C;  1MV8 A;  2YXQ B;  5AVW B;  2WSE H;  2YIU B;  3VOQ A;  4GXB A;  1EXJ A;  4JYB A;  4DZO A;  1GK4 A;  3VTP C;  4D6T D;  4HB1 A;  4EMO A;  3ULC A;  1GC7 A;  4HB4 B;  1X22 A;  4Y28 J;  5KJ7 A;  5D3W A;  5AW3 B;  4NPE A;  1YI2 P;  2JWD A;  3PZD A;  3Q5S A;  1JCD A;  3G71 P;  1BTN A;  4AQR D;  2KXP B;  1HH0 A;  2MFQ A;  3H1L J;  5AW7 B;  1YTZ T;  2DKQ A;  2KB7 P;  4H0L D;  5GTH H;  1YHQ P;  1PGP A;  2NZ8 B;  3A0B E;  3TCA A;  3R4Y A;  2OYI B;  4EJN A;  1JMB A;  2LXB A;  2YSZ A;  1T6A A;  1LWU A;  1NAY A;  1RY3 A;  3V2Q A;  5CBN A;  2RH0 A;  3CWB J;  3O96 A;  1L0L G;  2OYO A;  3L73 G;  3Q5P A;  1FHW A;  3E1R A;  3CCJ P;  3FGA D;  1FC2 C;  4HDO A;  2Q9I A;  3PHL A;  1DEB A;  5M1B A;  3CIK A;  1VQO P;  1BGY E;  2C0X A;  2H89 C;  5AW2 B;  4QJ5 B;  1PPJ D;  3GYO A;  2HFE D;  2EMT A;  3P8C D;  3MUD A;  2RRF A;  1ZXG A;  3KHU A;  1RHZ B;  4ASW A;  1E79 H;  1EXI A;  2AEF A;  3KY9 A;  3TK1 A;  3CX5 H;  1L0L K;  3VMZ A;  3JCU E;  1KQG B;  1FS0 E;  5J3T A;  4L6E A;  4D6T G;  3HK0 A;  2JEE A;  1YJN P;  4U3F G;  1NI2 A;  1TJ6 A;  3F5R A;  2DHI A;  1RF0 C;  2UWJ E;  4HB0 B;  3TVV A;  4KJM A;  5DJU B;  1FZB A;  1NTM E;  3E7K A;  1SQX K;  3H1L G;  1MFZ A;  1NHL A;  4PV1 D;  3H1I J;  1KZU B;  3AU5 A;  1NU2 A;  1SQX D;  4H0L B;  3CX5 D;  3NWA A;  1FAV A;  4C46 A;  1VPC A;  3PSC A;  2Z0P A;  2ZVO B;  2QRX A;  3QH9 A;  2KYV A;  3L73 E;  5E79 H;  1IFI A;  3HTK A;  3II6 A;  2FXM A;  1K5G B;  2N9B A;  3ITK A;  3SFE C;  3TGU G;  2KLV A;  2GS0 A;  1SQV G;  2K8E A;  1U7M A;  1OIP A;  3MUD C;  3TNU B;  2FYU E;  3HD7 B;  1KIL B;  1ZLL A;  1R8E A;  4GPT B;  3H1K J;  1PP9 G;  2Y7B A;  3WUV A;  1P84 D;  2KSE A;  5AW8 B;  2ZYD A;  2ELA A;  2E75 C;  2R5B A;  3H1H G;  4U3F E;  5APX A;  1JY3 N;  2Q3E A;  1OXZ A;  2YVC A;  1J0W A;  2EJ8 A;  4PJ0 H;  1WI1 A;  4C0A A;  5GTI H;  4OSN A;  3TW1 A;  2R44 A;  1M7L A;  3PVL A;  2Q1K A;  3IVF A;  3BRV B;  3L70 G;  4UB6 H;  2WSC H;  1DDV A;  3KXD A;  3L75 E;  4XE5 B;  2FFD B;  4HAZ B;  2GUM A;  2N9Y B;  1NGM B;  2L1C A;  4IOI H;  5KTB A;  1Y47 A;  1S9K D;  1SQX G;  1U5G A;  1ZOY C;  2D2C D;  1RE3 C;  3Q2Y A;  3FEH A;  3G9R A;  3H1J E;  1XCG A;  3CXH D;  3OAK A;  2MKR A;  3M0D A;  2QJY C;  3AE2 C;  5KQ1 A;  2ZFC A;  5AVS B;  1URQ A;  1QC6 A;  4O9B A;  2M5A B;  2VKI A;  1X05 A;  2RNR B;  4NSW A;  1RE4 C;  2YF0 A;  2RMZ A;  4WVF B;  1EF1 A;  2C0W A;  2ZAE B;  1SVF A;  3ODO A;  3BCC G;  1IFP A;  2CY4 A;  1M1J B;  1U5D A;  3G4S P;  1T2K C;  3CLQ A;  1HBW A;  1GL2 D;  2D10 A;  1JTH A;  3GMA A;  3AE4 C;  4F7H A;  2K37 A;  1VQM P;  2WVR A;  2PAJ A;  1U57 A;  3KZI E;  2I8D A;  4A6F A;  4GMV A;  1PZQ A;  3L72 D;  1IJD B;  4BXL A;  1Y5O A;  3ULB A;  1NU1 D;  4WY4 B;  3WA0 A;  1FOS F;  5HE0 A;  1H8A A;  1K8A Q;  1FOE A;  3MZW B;  2NZ2 A;  2JP3 A;  3RBX A;  3L70 D;  1X11 A;  1SFC D;  1V89 A;  1KFM A;  1MFT A;  3A5T A;  3HD7 C;  1WVH A;  1CZQ A;  4JYC A;  1ZP0 C;  1NTK K;  1PFI A;  5KLV G;  4XWX A;  5AVT B;  4LGD E;  4IL6 E;  4DIX A;  4BRY A;  3H32 B;  2KZI A;  1OFC X;  1L0L D;  2FYU G;  4UB8 E;  1NTM G;  3FWN A;  1MK9 B;  2PP6 A;  1LTJ B;  2WT7 A;  1T77 A;  1L0N G;  1AQC A;  2FBW C;  1U7J A;  4DJG A;  3MDB C;  2GJY A;  1YTZ I;  3CWB G;  3B5N D;  3CC2 P;  4NPD A;  2YRY A;  2P2U A;  4TYZ A;  1ZRT E;  2NRG A;  5KKZ B;  2YIU C;  2D11 A;  4GKG A;  2I5C A;  4BRY B;  1PPJ E;  1Z87 A;  2EC1 A;  3BVH A;  4P7I A;  1M90 Q;  3L75 G;  4TT3 H;  1L0N K;  4U3F D;  1TQZ A;  1NTZ J;  1U5F A;  1SQX E;  1NTM K;  1VQ6 P;  1P84 E;  3NFQ A;  2QM7 A;  5KAF E;  4HAW B;  1CSB A;  2W2W A;  3G9W A;  4QJ3 B;  3M06 A;  2J5U A;  2WPR A;  3BIN A;  5TIS E;  5APV A;  2J59 M;  5KLV J;  2WPQ A;  1KQF B;  3FM8 C;  5M4Y B;  2ZT9 C;  1Y19 B;  1QVF O;  4CPG A;  1M1J A;  3AEA C;  3NWD A;  3FWL A;  1GTW A;  1T3J A;  3F5H A;  3UZT A;  3N7C A;  1KI1 B;  1LT9 B;  4GT1 A;  3P32 A;  2E2X A;  1LJ2 A;  2M5A A;  2R5D A;  2E43 A;  5AW4 B;  5LG4 B;  2MJZ A;  3Q3D A;  1SFC A;  5D3Y A;  1NTK J;  2SPZ A;  3BAT A;  4Z1M H;  2JR8 A;  1SP4 A;  2W2X D;  3H1J G;  2PZ1 A;  3DXC A;  1AWE A;  1SQB E;  2W8Z A;  3DXD A;  3VMA A;  3H1L D;  3FXD A;  1N73 A;  2G35 A;  1K5D B;  3SFD C;  4D6W A;  1OY2 A;  1VQ5 P;  3U1C A;  1JO5 A;  3A0H H;  1BCC G;  5K5G B;  1J1D C;  1HUC A;  3AED C;  2ZJS E;  1QX8 A;  4R4L A;  2E74 D;  4GOE A;  1VQL P;  2E74 B;  2Q6Q A;  2OYH C;  4BBK A;  1N86 A;  3BAS A;  3S4R A;  2LXC B;  3QBV B;  3ABV C;  2E42 A;  5AVX B;  4IAP A;  3EQ2 A;  4I7Z B;  2UVM A;  4HH2 A;  1H0T A;  1ZM0 A;  4CHM A;  1U5E A;  5AVR B;  2BCC J;  1DYN A;  2FYN B;  1N7S B;  3RK3 D;  4QMA A;  1KZ7 A;  1Q7Y Q;  2QEX P;  1NOH A;  2L91 A;  2N0Y A;  1RQV A;  4D0N B;  4HAY B;  2M8R A;  3WYF B;  1M57 D;  1XOD A;  2KS1 B;  2WMM A;  2K9J B;  3E1I A;  5C16 A;  1SGH A;  3KRW A;  5KLI C;  3FX0 A;  4KVG B;  3PVW A;  1GW4 A;  3L74 D;  3CCQ P;  2MDX A;  3OW2 O;  1R5L A;  3MPX A;  1LW3 A;  4D6T E;  3H1I D;  1KV4 A;  5CJ0 A;  1SLQ A;  1DD4 A;  1OX3 A;  1JEK A;  2K9J A;  2DHK A;  2A06 E;  1KB9 H;  4NY0 A;  1BCC D;  4ASV A;  1FE6 A;  5DHF B;  5APQ A;  3L35 A;  1DH3 A;  2UZS A;  3CCV P;  1NU1 K;  3VP9 A;  2GUV A;  4KAX B;  4WY4 D;  1VF5 D;  1FZE A;  1V61 A;  2IFM A;  1M1K Q;  3L4F A;  1UNP A;  4JF7 A;  2A06 D;  1TU3 F;  1N3H A;  5EFW B;  4OH8 B;  3CPW O;  1QQG A;  4A7P A;  3M9H A;  2L2I A;  2OAR A;  3CXH H;  1I7A A;  2HPC B;  2BEQ D;  2Z5H A;  2GCJ A;  3MHV A;  2YKO A;  2IYB A;  1S5L H;  2Y8F A;  1L0N D;  3A3Y B;  3L72 G;  1LWU B;  5LON B;  3TDK A;  5DJT B;  1EDK A;  3B5N B;  1AFO A;  2OQB A;  3RL0 g;  4OWF A;  4AYC A;  2G8Y A;  3A58 A;  1NH4 A;  1ZV8 A;  1LTI C;  2HPC A;  2OYH B;  2CY5 A;  1X1F A;  2D9V A;  1W1D A;  4H8S A;  3HTK B;  1VQ7 P;  1JM0 A;  1VQ9 P;  3BJI A;  5E79 E;  2Z59 A;  2IBZ I;  2LUL A;  2P58 A;  5JP4 A;  5JHG A;  1MIZ B;  5APW A;  2FYN C;  2P0D A;  1UPR A;  2AXT H;  2E75 D;  1I2H A;  2N23 A;  4B86 A;  4HB3 B;  1LT1 A;  1YJ9 P;  3M1I B;  3VYI A;  2OYH A;  1W1H A;  2Z4E A;  4IFM A;  3D6Y A;  1BSN A;  1PFJ A;  2YT0 A;  1SQV D;  2H43 A;  5GTI E;  2OTK E;  2Z13 A;  4H13 D;  4HYT B;  2FYU J;  1EGX A;  1WG7 A;  3TGU E;  2QJK B;  1AJY A;  3B77 A;  1FDO A;  3FVC A;  1LTJ C;  4GOD A;  2CPS A;  4WB4 A;  4N78 D;  3H1H D;  3FSS A;  2K88 A;  1JNM A;  2KZJ A;  1NAF A;  1SQB D;  1MI1 A;  2WQY C;  1KB9 D;  2KOG A;  1RJ2 A;  2KGX B;  1L4A A;  5APU A;  1S5L E;  2AXT E;  3I56 P;  2POH A;  5CJ4 A;  2Q13 A;  4MK0 A;  5HE3 A;  4PJ0 E;  2ZXX A;  5APT A;  3WUT A;  3RK2 D;  2B88 A;  2OQQ A;  2Y8G A;  2E76 C;  3TGU J;  3A0B H;  1KQL A;  3ZDM A;  3CXH I;  5DHA B;  1OW7 A;  3L71 D;  3HSA A;  5IRS A;  3GHG C;  2V4H A;  1J1E C;  1P6S A;  4K17 A;  5CCG C;  3PH0 A;  1DEE G;  5DH9 B;  3HUS B;  1SQP G;  1SQB K;  1FHX A;  2GUS A;  2QE7 H;  3U12 A;  2YT2 A;  4N78 E;  3PRJ A;  4Y99 B;  2D9X A;  1LP1 B;  3K5B A;  5B66 H;  1NYH A;  1BGY J;  4RKU J;  1EDJ A;  3B5N A;  1KB9 I;  1S9K E;  1NVO A;  3P8M C;  2KIK A;  2O01 N;  3C1L A;  1KIL D;  2D2C C;  1T8Z A;  2RVB B;  1NU1 G;  1JY2 N;  2QJP B;  2RUK B;  2D9Z A;  3M9B A;  1X0T A;  3CWB E;  1GMJ A;  3HD7 A;  1XX0 A;  1NO4 A;  4F7G A;  2B9B A;  5J3Q A;  5J3Y A;  2NBV A;  2QJK C;  1PPJ G;  1EQ7 A;  1OZH A;  4DXA B;  3IF4 A;  3BCC D;  3V2N A;  3H1I G;  1L0L E;  2O01 J;  2FJU B;  1FZG A;  3ZVR A;  1BWN A;  3HD7 D;  2IYP A;  1EZV I;  2FFD A;  5TJH A;  3SNH A;  3ODW A;  1IO4 A;  3L36 A;  1VL2 A;  3DXE A;  3VIA A;  2I5F A;  4GZU A;  1W1G A;  5CBO A;  1NKZ B;  1S1C X;  3L73 D;  2D9W A;  1LB1 A;  3SWY A;  1X86 A;  2HTH B;  3CXB B;  1GD2 E;  2DW3 A;  5H2F E;  3V6I A;  4DX8 A;  1OVV A;  1LP1 A;  2GM4 A;  1FGY A;  2XKM A;  1S4X A;  3HW2 B;  4D6T J;  3EFF K;  1YIJ P;  4PNK A;  1IFN A;  2YS3 A;  2EMS A;  2I1J A;  1NTM D;  3R2P A;  1RF0 A;  3AE8 C;  2ZVN B;  5KAF H;  1UNQ A;  5CLQ B;  3LJU X;  4HB2 B;  1V5U A;  1N73 C;  3HUS A;  1B55 A;  3L70 J;  2P67 A;  1MK7 B;  1SFC B;  4GDO A;  1WRG A;  2R32 A;  3L37 A;  2QKL A;  3NSU A;  3MIW A;  5FI1 A;  2O3J A;  4Y99 C;  4A6K A;  2KUP A;  1HJ0 A;  3H1I E;  2KUB A;  1MKM A;  2B89 A;  1H88 A;  2VRS A;  1SQP E;  2I1K A;  4PV1 B;  2E5Y A;  2K1A A;  3TO1 A;  2WSE J;  2J0K A;  4JPZ B;  5FI0 A;  5LOP B;  3VMY A;  2D2C B;  1U29 A;  5D3V A;  2N1T C;  4WWI A;  2YO2 A;  1OW6 A;  4KT0 J;  3T97 B;  1IRS A;  4RO0 A;  2IBZ D;  2E5T A;  1PMS A;  3H1H E;  3QWM A;  2V76 A;  3RK3 E;  2IFS A;  3S9O A;  3EWK A;  1MIX A;  3IN6 A;  1EDI A;  1Q82 Q;  1NTZ G;  3U8Z A;  1FDI A;  1RRP B;  3H1J D;  2XQN M;  5AVU B;  3D6Z A;  1T3U A;  3WMM 0;  3SWK A;  2KIE A;  3L74 J;  1LWU C;  3ODX A;  5AW1 B;  4WJ7 A;  5I2S A;  3V4Q A;  1E5W A;  3GF3 A;  1SQB G;  1SQP K;  4LLH A;  4EDF A;  3AEB C;  2A45 I;  5KKZ C;  1SQQ D;  1URQ B;  3W67 A;  3NW8 A;  2D2Q A;  1P3R A;  3B71 A;  1M8O B;  5B66 E;  3HRN A;  1AA0 A;  1NTV A;  4TLF A;  3H1K G;  4H44 B;  3TF5 A;  5APS A;  3M0A A;  5KCV A;  2COC A;  1FJP A;  2AEM A;  1DDM A;  2QM8 A;  3W68 A;  3AEC C;  1FZF A;  3V4W A;  2D9Y A;  5AW6 B;  3HE5 B;  2LOZ A;  3H1L E;  3QIJ A;  1TXD A;  4R4M A;  3I5C A;  2DX5 A;  2N1T A;  1MAI A;  2O1J A;  4GOU A;  1QLE D;  2QKM A;  2E75 B;  1U27 A;  2J0J A;  1NTY A;  1FZC A;  2HR3 A;  2KSJ A;  2Z0Q A;  4A6H A;  1QGK B;  4QXA B;  3IAO A;  1XKE A;  1SQP D;  2CAY A;  1SFC C;  1OVR A;  2H88 C;  1PL5 A;  1Q81 Q;  3KZI H;  1SQX J;  2WPV B;  1NTZ E;  2KUQ A;  2IFN A;  4I1L A;  2XND H;  1W5C E;  3N4X A;  3A7O A;  3CD6 P;  4NPF X;  1RE3 A;  2HOD B;  1PGJ A;  3GW6 A;  3KQG A;  4PD4 I;  1VQ8 P;  4WY4 A;  3AEF C;  2DFK A;  3RK2 B;  1PP9 E;  4Z2M B;  2DN6 A;  1GL2 A;  1SQQ G;  4OGQ C;  2XNX A;  2LR2 A;  2R2Y A;  2Q3I A;  3AU4 A;  3FXE A;  3NTN A;  2H7E A;  1W2E A;  4YTP C;  4WVZ A;  3U1A A;  2M3E A;  3BCC E;  3Q1M A;  2WTY A;  2C9L Y;  2ADZ A;  3T97 A;  1IFM A;  4Z2N A;  3SYX A;  3ML4 A;  2ZT9 D;  1QL1 A;  1HWT C;  4N3Y B;  2M3B A;  2P8V A;  2LYD A;  1USD A;  1BSH A;  1IZN B;  1S2E A;  2B87 A;  1JY2 O;  1L0N E;  2DHJ A;  3CI9 A;  3CC7 P;  2E76 D;  1G1I A;  5B5E H;  1IK7 A;  4UB6 E;  1IC2 A;  3H1H J;  4W7Z A;  3P8C E;  4IFD K;  1JB0 J;  1GG3 A;  3RL0 C;  2YXR B;  4I7Z C;  4M3L A;  1KMI Z;  1FDM A;  1LTJ A;  3JSV C;  1GZL A;  3T06 A;  2YMK A;  1MPH A;  3MD0 A;  4EI2 A;  1VQN P;  1KYO D;  2WWW A;  4EIJ A;  4C7N A;  2COF A;  1K04 A;  3CWB D;  1OQN A;  1YQ4 C;  4IL6 X;  4L73 A;  1UPQ A;  3L71 E;  1G1J A;  3AE6 C;  4K35 A;  3HQC A;  1A02 J;  1NTK E;  2KLU A;  2B87 B;  2AL6 A;  3BRT B;  5AW5 B;  2KS1 A;  2FKW B;  2OYI A;  4A6F B;  5HE1 A;  2WSF H;  3L72 J;  3KSY A;  2W6A A;  2Y9Z A;  1QEX A;  1ZC4 B;  4IOY X;  1BGY D;  2H8P D;  3AEE C;  1N7L A;  2KNC A;  5KLV E;  1NWQ A;  3D8D A;  4QJ4 B;  3M91 A;  2BCJ A;  4EYY Q;  2W90 A;  1UIX A;  1A02 F;  1K73 Q;  3NXS A;  3A8P A;  2QVA A;  1S72 P;  2N1T D;  1OW8 A;  2ITA A;  1KIL A;  1SQQ E;  2NPS B;  1L4A D;  3CMA P;  2P0F A;  2LOX A;  1SQV E;  1KYO I;  1SQQ K;  3V2R A;  3G3Z A;  4U3F J;  1IFD A;  3PEG A;  1L0L J;  3A8Q A;  1VQ4 P;  4TKN A; 
#chains in the Genus database with same CATH homology
 1YYC A;  1MUU A;  5CCH D;  1J1E C;  2IPP A;  2CY4 A;  3SO6 A;  1P6S A;  1M1J B;  2GCL A;  1U5D A;  5CCH C;  5CCG C;  4K17 A;  2UZR A;  1T2K C;  1ZVR A;  2MWN B;  5AVZ B;  2ZXE B;  3CLQ A;  1GL2 D;  4C7N B;  1JTH A;  1T2K D;  1HBW A;  1M7E A;  2D10 A;  5DH9 B;  3HUS B;  5AW9 B;  1N73 B;  4F7H A;  5KLV K;  1SQB K;  1FHX A;  3D8F A;  1X9V A;  3IFM A;  2PAJ A;  2GUS A;  2AEH A;  3RL0 B;  4A6F A;  4GMV A;  4K81 A;  1IJD B;  2YMY A;  5HE2 A;  1X79 B;  1G2C B;  4N78 E;  3X23 A;  2R3C A;  4Y99 B;  2D9X A;  1AQ5 A;  1Y5O A;  3ULB A;  4WY4 B;  1ZSQ A;  3WA0 A;  1FOS F;  3V5B A;  5C6R A;  5HE0 A;  3P7Z A;  5C79 A;  2ZPY A;  4LC1 A;  1H8A A;  3B5N A;  1FOE A;  1S9K E;  1LT9 C;  2WPS A;  3EFG A;  3OA7 A;  4I6M C;  1LTS C;  1X8Y A;  3P8M C;  3SWF A;  2L5G B;  1X11 A;  2YT1 A;  1SFC D;  3GYP A;  1V89 A;  1EAZ A;  1KFM A;  4Y94 A;  3A5T A;  2Q5U A;  1U2B A;  1KIL D;  3HD7 C;  2NPS D;  1WVH A;  1KIL C;  1T8Z A;  5CHX A;  2RVB B;  1CZQ A;  5GOW B;  3VMX A;  4JYC A;  1NTK K;  1JY2 N;  2XU6 A;  1FGZ A;  1PFI A;  2RUK B;  2C9N Y;  4XWX A;  2D9Z A;  3M9B A;  3AJ4 A;  3V5W A;  3VOP A;  5AVT B;  4LGD E;  4ZRK A;  3HD7 A;  3O8Z A;  1XX0 A;  3H32 B;  1FZC B;  1NO4 A;  3B8E B;  4F7G A;  2COD A;  3C9I A;  5J3Q A;  4K2O A;  1WGQ A;  1LTB C;  1QL2 A;  5J3Y A;  1L4A C;  2VRW B;  1MZ9 A;  2XV5 A;  3M0D C;  1MK9 B;  1EQ7 A;  4GIF A;  4XA4 A;  4DXA B;  3LIE A;  1OMW A;  2PP6 A;  3V2N A;  1LTJ B;  5BU8 B;  2WT7 A;  1FZG A;  1JY2 P;  1VDF A;  3A2A A;  1BWN A;  3HD7 D;  2DX1 A;  1AQC A;  3ZVR A;  1XD4 A;  1XTC C;  1NKN A;  4GN1 A;  4IFS A;  2O1K A;  5CMZ A;  2RLO A;  1JUN A;  3MDB C;  2FFD A;  1J1D B;  2O01 H;  4I2L C;  2GJY A;  3SNH A;  3LW5 H;  1N7S D;  3PP5 A;  3RK3 B;  2DLW A;  2FFD C;  3ODW A;  1YTZ I;  2W6B A;  1IO4 A;  4W7Y A;  1JCC A;  3B5N D;  3RCP A;  3L36 A;  2YRY A;  2P2U A;  1GU4 A;  4TYZ A;  3TFM A;  3DXE A;  3VIA A;  1DDW A;  3V2P A;  5BVZ A;  4HAV B;  2D11 A;  2I5F A;  1M7R A;  3KYQ A;  4GKG A;  2I5C A;  4GZU A;  2HLO A;  2R09 A;  4WBA A;  1H89 A;  1W1G A;  2HOD A;  2K2J A;  2A45 H;  1NKZ B;  2Z5I A;  1Z87 A;  2EC1 A;  4EKU A;  1RF1 C;  3BVH A;  3U59 A;  4P7I A;  2D9W A;  3PG7 A;  1LB1 A;  3N7N A;  3SWY A;  4C7R A;  1X86 A;  1L0N K;  2J58 A;  2HTH B;  1TQZ A;  3CXB B;  4HHV A;  1GD2 E;  5D3X A;  1GC6 A;  2KCJ A;  4DX8 A;  4ZRJ A;  3SUZ A;  4N6J A;  2GM4 A;  1U5F A;  1FGY A;  2XKM A;  5C5B A;  1HGZ A;  1N7S C;  1NTM K;  1SHC A;  1Q67 A;  2DA0 A;  2CRF A;  3HW2 B;  2NPS C;  4PNK A;  1IFN A;  3NFQ A;  2K00 A;  2YS3 A;  2QM7 A;  1HTL C;  1DRO A;  1BAK A;  4PQ0 A;  3UIA A;  5AVV B;  5CLL B;  2EMS A;  2RGN B;  2LG1 A;  4HAW B;  1CSB A;  1GL2 B;  2I1J A;  1LGH B;  2P1J A;  2W2W A;  3G9W A;  3R2P A;  2YS1 A;  1RF0 A;  3GHG B;  3M06 A;  1JY3 P;  3VN0 A;  2WPR A;  1M1J C;  3BIN A;  2WIT A;  2OYI C;  1BTK A;  1CI6 A;  5APV A;  1CI6 B;  1UNQ A;  3A98 B;  3KZ1 A;  5CLQ B;  2J59 M;  1JY3 O;  4KHB B;  2WPQ A;  3LJU X;  3TSI A;  3HUS C;  1V5U A;  2K2U A;  1N73 C;  3FM8 C;  4HB2 B;  5L81 A;  1Y19 B;  2H7D A;  3HUS A;  1B55 A;  1XTG B;  2P67 A;  1MK7 B;  3CL3 D;  1SFC B;  3F0W A;  1HGV A;  2P7J A;  1V5M A;  1FU1 A;  1M1J A;  1HVV A;  1WRG A;  2R32 A;  3L37 A;  2QKL A;  3NSU A;  3MIW A;  1V88 A;  5FI1 A;  4Y99 C;  2KP8 A;  4A6K A;  2KUP A;  4DX9 0;  4WY4 C;  1GTW A;  1T3J A;  3ZDT A;  2RSG A;  2YKQ A;  5JHH A;  1IFJ A;  2OTX A;  3N7C A;  3UZT A;  3TYY A;  1KI1 B;  2H7H A;  1JMM A;  1LT9 B;  4GT1 A;  3P32 A;  2VRS A;  1H88 A;  2BAS A;  4GMX B;  1FOS E;  2R5D A;  2E2X A;  2E43 A;  3OAN A;  2I1K A;  5AW4 B;  3TO1 A;  3IR9 A;  2CPB A;  3RL0 D;  2MJZ A;  2J0K A;  5FI0 A;  5LOP B;  2YO3 A;  4HDQ A;  3VMY A;  1U29 A;  1SFC A;  5D3V A;  1DBH A;  5D3Y A;  2N1T C;  3RK2 C;  2DTC A;  1UEF A;  4RES B;  1OWA A;  3BAT A;  2JP2 A;  2ROZ B;  4K2P A;  2YO2 A;  4B6H A;  1SP4 A;  2W2X D;  2PZ1 A;  3DXC A;  1AWE A;  3OJA B;  1FB8 A;  2LKO A;  3DXD A;  1IRS A;  2HYN A;  1N2D C;  1PMS A;  1N73 A;  5KJ7 C;  1WJ1 A;  2M38 A;  5AVQ B;  2G35 A;  3QWM A;  2V76 A;  2WZ7 A;  2IFS A;  1L4A B;  3GHG A;  1EVH A;  1K5D B;  3HE4 B;  1JTH B;  1MIX A;  2ELB A;  4HAU B;  3H6P A;  2FJL A;  3U8Z A;  3U7D A;  1OY2 A;  1RRP B;  1SQV K;  4A5K A;  2XQN M;  3KPE A;  3U1C A;  5AVU B;  1JO5 A;  5DIF B;  2DKP A;  4ZRI A;  1RF1 A;  1T3U A;  3WMM 0;  4DBB A;  1LWU C;  3VP8 A;  3ODX A;  1J1D C;  1HUC A;  5AW1 B;  4WJ7 A;  3V4Q A;  3M9Q A;  3RK3 C;  1E5W A;  2A45 G;  4KHX A;  1SQP K;  1FZA A;  3NMD A;  4LLH A;  1LTG C;  1MV8 A;  2OYH C;  5AVW B;  4BBK A;  4CYE A;  2A45 I;  2WSE H;  5AW0 B;  1URQ B;  3VOQ A;  1N86 A;  4GXB A;  3BAS A;  1PLS A;  4JYB A;  4DZO A;  2D2Q A;  1FBM A;  1ZR4 A;  1GK4 A;  3QBV B;  3VTP C;  1P3R A;  2E42 A;  1LTT C;  4ZKU A;  5AVX B;  1CW5 A;  3HRN A;  1RF1 B;  4ZKP A;  1WJM A;  4IAP A;  1NTV A;  4EMO A;  3EQ2 A;  2UVM A;  1J19 A;  3ULC A;  1GC7 A;  4HH2 A;  1ZM0 A;  4HB4 B;  4CHM A;  5KJ7 A;  5D3W A;  1U5E A;  1URQ D;  5AW3 B;  5APS A;  5AVR B;  3M0A A;  4KHO A;  5KCV A;  2COC A;  1FJP A;  1DDM A;  2QM8 A;  3PZD A;  1DYN A;  1J2J B;  1JCD A;  1N7S B;  3RK3 D;  1N7S A;  2XZR A;  1H10 A;  1BTN A;  4AQR D;  1FZF A;  3V4W A;  2D9Y A;  1KZ7 A;  1HH0 A;  5AW6 B;  3HE5 B;  2MFQ A;  5AW7 B;  1YTZ T;  2DKQ A;  2LOZ A;  3QIJ A;  1TXD A;  1NOH A;  1XR0 B;  2N0Y A;  2KB7 P;  5CCG D;  4D0N B;  4HAY B;  3KDP B;  2M8R A;  1GL2 C;  2N1T A;  3I5C A;  2O1J A;  1MAI A;  2DX5 A;  4MT7 A;  3WYF B;  2IX7 C;  2QKM A;  1XOD A;  2NZ8 B;  3TCA A;  4EJN A;  1Z56 A;  2OYI B;  1KZG A;  1U27 A;  2W2X C;  2J0J A;  1NTY A;  1FZC A;  2VSZ A;  3P7K A;  2YSZ A;  2Z0Q A;  2KSJ A;  1LWU A;  3E1I A;  1SGH A;  4A6H A;  5C16 A;  3KRW A;  4KVG B;  1FJK A;  1RY3 A;  1GW3 A;  3V2Q A;  3PVW A;  1XKE A;  3O96 A;  1GW4 A;  2CAY A;  1SFC C;  3P6A A;  2MDX A;  3MPX A;  1LW3 A;  1FHW A;  4HDO A;  2Q9I A;  5CJ0 A;  1SLQ A;  1DEB A;  2DHK A;  2IFN A;  4I1L A;  1IK9 A;  3CIK A;  3N4X A;  2C0X A;  4NY0 A;  3A7O A;  1RE3 A;  2HOD B;  5KJ7 D;  5DHF B;  2Q7C A;  5AW2 B;  5APQ A;  3KQG A;  3L35 A;  2HFE D;  3GYO A;  1DH3 A;  2UZS A;  2EMT A;  1NU1 K;  3P8C D;  3MUD A;  3VP9 A;  2GUV A;  3KY9 A;  4WY4 A;  4KHA A;  2DFK A;  4KAX B;  1WT6 A;  3TK1 A;  1JOC A;  2N1T B;  3RK2 B;  4WY4 D;  4Z2M B;  2DN6 A;  1L0L K;  1GL2 A;  3VMZ A;  1FZE A;  1V61 A;  4YL8 A;  5J3T A;  2IFM A;  4L6E A;  3L4F A;  2XNX A;  3HK0 A;  2JEE A;  2Q3I A;  3AU4 A;  1UNP A;  4JF7 A;  3NTN A;  2H7E A;  1W2E A;  1NI2 A;  1TJ6 A;  1N3H A;  2DHI A;  2YS5 A;  3F5R A;  4AUW A;  1RF0 C;  4OH8 B;  3U1A A;  1QQG A;  2C9L Y;  2WTY A;  2ADZ A;  3T97 A;  1IFM A;  3M9H A;  4Z2N A;  4HB0 B;  3MGN A;  2L2I A;  2OAR A;  1UNR A;  3SYX A;  5C5B B;  1LT9 A;  1I7A A;  3TVV A;  5CCG A;  1FZB A;  2HPC B;  1WGU A;  2M14 A;  3ML4 A;  2Z5H A;  2GCJ A;  5AVY B;  2YKO A;  2IYB A;  2YKP A;  2Y8F A;  1QL1 A;  1RE4 A;  1SQX K;  1HWT C;  2HG5 D;  3A3Y B;  4N3Y B;  2M3B A;  1LWU B;  2P8V A;  2LYD A;  4CHJ A;  1GDT A;  1MFZ A;  5LON B;  3TNU A;  1JY2 O;  4WSF A;  1NHL A;  3B5N B;  1AFO A;  2OQB A;  2DHJ A;  2J0M A;  3CI9 A;  1KFN A;  3LID A;  4HAT B;  1J1E B;  4AYC A;  3KRX A;  1G1I A;  1KZU B;  1NH4 A;  1ZV8 A;  1DX7 A;  1LTI C;  5BU5 A;  1G2C A;  2HPC A;  1IC2 A;  2OYH B;  3AU5 A;  1NU2 A;  2NMB A;  4W7Z A;  5D27 A;  2CY5 A;  1URQ C;  3P8C E;  2FYU K;  4IFD K;  1X1F A;  1FAV A;  1GG3 A;  2D9V A;  3HE4 A;  4C46 A;  1W1D A;  1GK6 A;  1VPC A;  3PSC A;  4H8S A;  3HTK B;  3RL0 C;  1MKE A;  2Z0P A;  2KYV A;  4M3L A;  3BJI A;  2FYZ A;  1IFI A;  1FDM A;  1LTJ A;  3HTK A;  2YNY A;  3II6 A;  2FXM A;  2LUL A;  1GZL A;  5JP4 A;  1K5G B;  3T06 A;  2N9B A;  5JHG A;  1MIZ B;  1X1G A;  1MPH A;  5APW A;  2LKM A;  3MD0 A;  2WT7 B;  4EOT A;  2P0D A;  1H4R A;  1ZR2 A;  2D4Q A;  3HE5 A;  2KLV A;  2WWW A;  1UPR A;  2GS0 A;  2X18 A;  2XDJ A;  1I2H A;  4EIJ A;  5JLJ B;  4C7N A;  5DI9 B;  2N23 A;  3MTU E;  2DYN A;  2COF A;  4B86 A;  1OQN A;  3TNU B;  4HB3 B;  3HD7 B;  2ROV A;  1KIL B;  1ZLL A;  4GPT B;  3M1I B;  2Y7B A;  1FAO A;  1UPQ A;  5AW8 B;  2Z0O A;  1V5P A;  2ELA A;  2R5B A;  1G1J A;  3VYI A;  2OYH A;  3PVU A;  4F7U P;  1W1H A;  2Z4E A;  4IFM A;  3HQC A;  4HAX B;  1A02 J;  1PFJ A;  1P5T A;  2HE7 A;  2YT0 A;  3PP2 A;  2H43 A;  1FZC C;  1ZN5 A;  5APX A;  4HYT B;  1JY3 N;  1EGX A;  2AL6 A;  1OXZ A;  1WG7 A;  3BRT B;  5AW5 B;  2FKW B;  2YVC A;  1J0W A;  2DYQ A;  2EJ8 A;  1WI1 A;  4C0A A;  1ZC3 B;  1LTJ C;  2CPS A;  4WB4 A;  4YON A;  4N78 D;  2OYI A;  3TW1 A;  2R0D A;  3FSS A;  5KQ4 A;  1M7L A;  3PVL A;  5CCH A;  4A6F B;  3IVF A;  1JNM A;  3BRV B;  5EFX A;  1NAF A;  2WSC H;  2WSF H;  1DDV A;  5HE1 A;  3KSY A;  2W6A A;  4XE5 B;  2FFD B;  2KOG A;  4HAZ B;  2L1C A;  3H32 A;  4DOJ A;  1RJ2 A;  1ZC4 B;  2KGX B;  5KTB A;  1ISN A;  1L4A A;  4IOY X;  2H8P D;  1S9K D;  1N7L A;  5APU A;  1U5G A;  5APY A;  1NWQ A;  3D8D A;  2COA A;  3M91 A;  2BCJ A;  1RE3 C;  2POH A;  5CJ4 A;  4MY6 A;  1A02 F;  2Q13 A;  4MK0 A;  3FEH A;  5HE3 A;  5APT A;  3SV1 A;  3NXS A;  1XCG A;  2P0H A;  3A8P A;  1HJB A;  3OAK A;  1NTZ K;  2N1T D;  3M0D A;  4IFF A;  3RK2 D;  2MKR A;  2NPS A;  5KQ1 A;  2ZFC A;  4W80 A;  5AVS B;  1URQ A;  1KIL A;  2Y8G A;  2NPS B;  1L4A D;  1QC6 A;  4O9B A;  2P0F A;  2LOX A;  1LTA C;  1GU5 A;  1SQQ K;  2W27 A;  1KQL A;  1RE4 C;  1X05 A;  2RNR B;  2VKI A;  2YF0 A;  4NSW A;  3D8E A;  3V2R A;  4TKN A;  3G3Z A;  1FHO A;  1IFD A;  3PEG A;  5DHA B;  3A8Q A;  4WVF B;  1EF1 A;  2C0W A;  1SVF A;  3B5N C;  2JJL A;  3ODO A;  3GHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...