2J59M

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
113
Chain Sequence
AAKEGWLHFRPLVPWKQMYVVLRGHSLYLYKDKREQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 33
structure length 113
sequence length 133
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j59M02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j59M01
2J0MA 2ELAA 4A5KA 3G3ZA 1WGUA 1Y5OA 2ROVA 2RLOA 1NI2A 1QC6A 4A6KA 3SV1A 1RRPB 2KUPA 4A6FA 2WSCH 2RVBB 1V5UA 2PZ1A 1ZC4B 3PG7A 1GC6A 3VIAA 1OY2A 1UNQA 2Y7BA 1V88A 1NTVA 2YRYA 2DA0A 5L81A 1BAKA 2P0FA 2CY5A 3A98B 4GN1A 5D3WA 4EJNA 1LB1A 1P5TA 3DXCA 4HB3B 2L2IA 2N23A 2IYBA 2VRWB 1UPRA 1J0WA 2O01H 4KHOA 3PVWA 1X05A 1L0LK 1SQVK 2YF0A 4WSFA 2J59M 1SQXK 5J3YA 1GG3A 1EAZA 2NMBA 1ZC3B 4HAUB 2LKOA 1BTKA 2H7EA 3KZ1A 1XR0B 4IOYX 2DLWA 4WVFB 2GCLA 1DBHA 3AJ4A 1I7AA 4XWXA 3OANA 3DXDA 1FHWA 2LOZA 2CRFA 3PSCA 2WSFH 4CYEA 2D9XA 3D8FA 1DDWA 2EMSA 4HATB 3BJIA 1KZ7A 2CAYA 1NTKK 3M1IB 1MK9B 3AU5A 3V5WA 2COCA 3CXBB 3BINA 1SGHA 5KLVK 3RCPA 5JHGA 4TYZA 3ODXA 2ADZA 2VKIA 2P8VA 3KRWA 3PEGA 1SQBK 2J0KA 5C5BA 2LG1A 4A6HA 1PLSA 2Z0OA 1RJ2A 3MDBC 4GXBA 2E2XA 3WA0A 5CLQB 5FI0A 1DDMA 1FAOA 5DHFB 2M38A 3A8QA 2DKQA 1X1GA 1UNRA 4K17A 5HE3A 1WGQA 1ZVRA 2XQNM 1WI1A 2D9WA 1EF1A 1V61A 1NTYA 1MKEA 2YS1A 2HE7A 5HE1A 3ODOA 3LW5H 3AU4A 4ZRJA 2WSEH 1XKEA 2ROZB 3D8EA 5C79A 1X11A 3O96A 1MIXA 2EC1A 2EMTA 1U2BA 2OARA 3SO6A 2R0DA 4KHBB 5C16A 2P0DA 2RUKB 2GCJA 4DX90 1W1DA 2DX5A 5DHAB 1V5MA 4HDOA 4GZUA 1M7RA 2P0HA 4NSWA 2N0YA 2Y8GA 2BCJA 5KCVA 3T06A 2NZ8B 1P6SA 2Z0PA 3HK0A 1AWEA 3KY9A 2COFA 1WJMA 3QBVB 1XODA 2UVMA 1SHCA 5DIFB 1NTMK 1Y19B 1LW3A 1B55A 2DN6A 2FJLA 3WYFB 1WVHA 1ZSQA 2DFKA 3KRXA 2D10A 3TO1A 2LKMA 3TVVA 4EKUA 4PNKA 4GMVA 2K2UA 1DROA 1TJ6A 1UNPA 2D4QA 2COAA 2FYUK 3KSYA 2ZPYA 2ELBA 2W2XD 4IAPA 1J19A 1U5EA 4IFDK 5J3QA 4D0NB 1U29A 4HDQA 2YSZA 2EJ8A 2GS0A 1TXDA 4PQ0A 4HB0B 3M9QA 4F7UP 1NU1K 2MDXA 3PVUA 4H8SA 2DTCA 2Z0QA 4Y94A 1I2HA 3HQCA 2LOXA 4ZRIA 4HAWB 3CLQA 2YS5A 5LONB 5J3TA 1AQCA 1V89A 5KQ1A 1ZM0A 1K5GB 2CY4A 3DXEA 1MK7B 1GC7A 4KVGB 2DHKA 2LYDA 3ML4A 2OQBA 1OMWA 4K2OA 4MT7A 4MK0A 1BTNA 1K5DB 3ULCA 1WG7A 2M14A 1NTZK 1E5WA 5CLLB 4ZRKA 3GYPA 2V76A 2J0JA 3GYOA 4DX8A 1EGXA 4L6EA 2R09A 2YS3A 4K81A 4A6FB 1KZGA 2I1KA 2GJYA 3SUZA 3ODWA 1DYNA 2VSZA 1Q67A 2DHIA 3F5RA 3FM8C 2OTXA 4YL8A 3FEHA 4HAYB 5EFXA 4F7GA 2G35A 3CIKA 4IFSA 1MIZB 1UPQA 3HW2B 2KCJA 2D9VA 2RSGA 4DBBA 4GPTB 2K2JA 2JP2A 5KQ4A 5JP4A 1XCGA 1MAIA 1MPHA 1X86A 2UZSA 1BWNA 4BBKA 3P6AA 5D3YA 5C6RA 3SNHA 3ULBA 1V5PA 1P3RA 3PZDA 1FGZA 3P7ZA 3VOQA 1QQGA 1L0NK 2MKRA 4WJ7A 5GOWB 1FHXA 1PMSA 4HAVB 1XX0A 4K2PA 2D2QA 1H4RA 3PP2A 1U27A 5DH9B 3TW1A 3ZVRA 2UZRA 3FSSA 1X1FA 1U5GA 3IVFA 4YONA 1DDVA 3X23A 1H10A 3F0WA 2KGXB 1UEFA 1FGYA 2HTHB 5D3XA 2I1JA 2YT1A 3SYXA 2D11A 2Q13A 2DHJA 4HAZB 5JHHA 2CODA 4NY0A 2RNRB 5LOPB 1IRSA 5C5BB 3U8ZA 5HE2A 1NU2A 2MFQA 2MWNB 4HAXB 4CHMA 5HE0A 3LJUX 5D3VA 4P7IA 2QKLA 3QIJA 5DI9B 2DYQA 2D9YA 3TFMA 3D8DA 1WJ1A 2YT0A 1U5FA 5D27A 4TKNA 2K00A 2D9ZA 2H7DA 3PVLA 1M7EA 2W2XC 5JLJB 3A8PA 3U7DA 4CHJA 2X18A 4F7HA 4EMOA 1N3HA 1SQQK 2I5CA 2IFSA 2LULA 1W1HA 1PFJA 2Y8FA 4C0AA 4DXAB 1XD4A 2DKPA 2DX1A 3N7CA 4Z2NA 2DYNA 3NSUA 3ZDTA 1EVHA 3MPXA 1SQPK 1OQNA 4HB2B 1U5DA 4GMXB 2I5FA 3G9WA 2AL6A 4MY6A 1ISNA 4HB4B 5FI1A 2QKMA 3UZTA 1Z87A 2YVCA 3TCAA 4B6HA 4Z2MB 2AEHA 1KI1B 3QWMA 2L1CA 4HHVA 4KAXB 1FHOA 1FB8A 1W1GA 2W2WA 4KHAA 1FOEA 1TQZA 2RGNB
chains in the Genus database with same CATH superfamily
2J0MA 2ELAA 1DEBA 1X79B 5CBOA 1NI2A 3A2AA 1QC6A 2HLOA 3I5CA 2C9LY 2RVBB 2LXCB 2E76C 1ZC4B 4WB4A 3L74E 1GK4A 1IFMA 1W2BO 3AE5C 1URQD 1UNQA 2N1TA 1OVVA 1L0NE 3CCUP 4LGDE 2YRYA 2P0FA 3A98B 5D3WA 3T97B 1PIXA 1NH4A 2IYBA 3CXHH 1S1CX 2A06D 2YMKA 1GZLA 1SQVG 1KYOI 3PVWA 1SQXG 3H1KD 1YJNP 4H44D 5KTBA 1J1DB 1W2EA 2YKPA 3RBXA 3L72J 3CCMP 1GG3A 2LKOA 4IOYX 5CCHA 1RE3C 2Q6QA 3PRJA 2DLWA 4WVFB 3HE4B 1DBHA 3U59A 1RF0C 2NPSC 2B89A 3L70J 1H8AA 1KB9D 2CK3H 3CX5D 2CRFA 3N4XA 2W6JH 4CYEA 2WSFJ 3NWDA 4IOIH 3U12A 1JY3P 3OA7A 1FBMA 1KZ7A 5AW7B 1PP9D 5AVWB 3V5WA 2E75C 2WT7B 2E74C 1NTKE 1SQPJ 3RCPA 1ZRTD 3VMXA 2VKIA 1QL2A 3TGUD 2J0KA 1SQPG 1PLSA 2KI7B 4U7JA 3SFEC 3L75E 1KN7A 3R2PA 1M90Q 4GXBA 1LT9A 2E2XA 3WA0A 2QEXP 3M91A 1DDMA 1PPJE 3OW2O 2D2CC 2A45I 1AQTA 1X1GA 2KXPB 5CJ4A 1FDIA 5KKZB 1NTYA 2HE7A 5HE1A 1M1KQ 1IC2A 5KAFH 3L74J 4QJ5B 1P84H 3HSAA 2K8EA 2WPVB 3MGNA 1YIJP 2XNXA 2ROZB 1L0NJ 3D8EA 1FS0E 2EC1A 5AW6B 2EMTA 1VQ5P 4CSQA 4OVNF 1LTGC 2RUKB 1FZCA 1J1EB 2BEZF 3H1IE 2LR2A 1KYOH 1KC8Q 1W1DA 1JY2P 5DHAB 4HDOA 4GZUA 1GW4A 1GDTA 4NSWA 1VQPP 2AXTH 1L0LJ 1ZLLA 3JCUH 3T06A 5CCGC 5TISE 4K35A 3A0HH 2E5TA 1L0LG 3M0DC 4HB1A 2IBZI 3GG2A 4L76A 1B55A 2KIGA 3B5ND 5AVRB 1VQ7P 1FDMA 1WVHA 1T6AA 2WZ7A 3L71E 3KRXA 1NTME 3L72D 2LKMA 1NKZB 1HUCA 3TVVA 4EKUA 2HODA 2K2UA 1Q82Q 1TJ6A 1UNPA 4JBZA 2D4QA 1VF5D 1M1JC 1NTKJ 2ELBA 2GUVA 4DCKA 4IAPA 5KJ7A 1FZAA 2R32A 3L70D 4IFDK 5J3QA 2R5BA 4HDQA 3BCCJ 4R4LA 3A5TA 1NTKG 2GS0A 3H1LE 1HWTC 4KHXA 1U57A 2MDXA 3BCCG 1LTJB 2C0WA 2KSEA 1OIPA 2Z0QA 2XZRA 3HQCA 3GLMA 2LOXA 2A45H 1QX8A 1SQPD 3W67A 3CLQA 4RESB 2QJKC 4NPEA 1AQCA 4WBAA 1JOCA 1N7LA 2P58A 1K5GB 1SQBE 3HD7C 2Z59A 2KLUA 3CMAP 1MK7B 1RF1A 3ML4A 1CI6A 2KNCB 2YMYA 1BTNA 1QVGO 1PV3A 2XU6A 1LTAC 1PFIA 2M14A 1NTZK 2BCCE 3GYPA 2K37A 3GYOA 4DX8A 1JCCA 2YS3A 4H13B 3WU2H 3IR9A 1DYNA 1N86A 2DHIA 3L74D 2YIUB 2M3EA 1EXIA 3CIKA 5M1BA 1JCDA 2N1TB 2POHA 1L0ND 1X8YA 1UPQA 1EZVE 3KZIH 4A7PA 3CC4P 2D9VA 3C9IA 2RSGA 1YQ3C 2K2JA 1OXZA 3AEEC 2N9BA 1HGZA 2KS1A 3MUDC 5AW5B 2ZJSE 3I56P 1OZHA 2G8YA 4PV1D 5B5EH 1X86A 1BE3J 1BWNA 3P6AA 3CWBE 5C6RA 2B9BA 3USSA 3QWOC 3SNHA 3ULBA 1NTMJ 2V7QH 2PAJA 2O01N 1FGZA 1BE3G 1L0LD 1QQGA 3AE8C 1L0NK 1Q86Q 5GOWB 1FC2C 1XX0A 1RY3A 1U27A 5DH9B 1LT1A 3MD0A 5AVUB 1URQC 2IZ1A 1S5LE 1X1FA 3IVFA 1EDIA 1NU1J 1SFCD 1H10A 1NTKD 4C7RA 1JM0A 3Q5RA 1UEFA 2Z13A 1AFOA 2PP6A 1NU1G 2ZVOB 2HTHB 5H2FH 1J2JB 3BCCD 2KYVA 2QE7H 2JWDA 2P1JA 2DHJA 3E1RA 2IPPA 2FFDC 3RK3E 2A06E 4OGQB 1G2CA 1QLED 5HE2A 2MFQA 2MWNB 4CHMA 1PPJD 2J58A 1LT9B 3LJUX 2D9YA 3D8DA 1WJ1A 5D27A 2BCCJ 4TKNA 2D9ZA 2KR0A 5JLJB 3HTKA 3CCVP 5APWA 1RF0A 2NPSA 1S9KE 4WVZA 1MUUA 5APQA 1VQKP 2YO3A 2GM4A 1N73B 4OH8B 2BASA 1BCCG 3RK2B 3A0BH 3ZDTA 2WPSA 1OQNA 2QM7A 1U5DA 3G9WA 1ISNA 1DH3A 2GUMA 3CCLP 3B8EB 2KUQA 5KLIC 5FI1A 3AEDC 1H0TA 1FZCB 3TCAA 3CWBJ 3F89A 4I7ZB 4N78E 1E79H 4KHAA 1GU5A 2RGNB 2NBVA 1KD1Q 1WRGA 4UB6E 1JB0J 1WGUA 1Y5OA 2ROVA 2RLOA 3V6IA 4A6KA 1RRPB 1RQUA 1BE3D 2HG5D 2PZ1A 2HPCA 4WY4D 1NTMD 3VIAA 3LIEA 2HODB 2Y7BA 2GA1A 1V88A 4HJGH 5L81A 1ZR2A 2FYNB 1Y9BA 4GN1A 5C39A 1S4XA 4EJNA 1LB1A 1P5TA 5CHXA 3RL0D 3B71A 2VRWB 3MZWB 2IYOA 2O01H 4KHOA 1T2KD 3CCQP 1NU1D 4W7YA 5J3YA 1RQVA 5AW3B 5GTHE 2NMBA 1ZC3B 4HAUB 1SQVE 5CCGA 1SQXE 5I2MA 2WSSH 3AJ4A 4HYTB 1I7AA 5KAIH 3CXHI 5AVSB 4DJGA 2W6BA 3B5NC 3O8ZA 3M0DA 3V2NA 3L37A 3U1CA 1RF1B 1HF9A 1CI6B 1VF5C 3BJIA 1PGPA 3M1IB 1GL2D 1MK9B 3AU5A 2QJPC 4H0LD 2BCCD 2JO1A 1EDLA 2IZ0A 3BINA 1SGHA 2QJYC 1M8OB 2IFMA 4RO0A 1SQBK 5KLVE 5C5BA 1QVFO 1USDA 1LTJA 2A45G 2KLVA 1H89A 1K05A 5CLQB 1BGYE 1EZVD 1SQPE 1K9MQ 2DKQA 2P7JA 1UNRA 5CMZA 1ZVRA 2XQNM 2KS1B 2R5DA 2XDJA 3HD7A 4U3FG 2PFXA 3CWBD 2YS1A 1VQMP 2Z5HA 3LW5J 2WSEH 4UB8E 1P84D 1X11A 1IO4A 1U2BA 2OARA 3SO6A 2R0DA 1RHZB 3VMZA 5C16A 4ASWA 1N7SD 3G71P 2E76B 4DX90 1P84I 2ZYDA 2OYIC 5E79H 3CCSP 3H1HE 1SLQA 1KYOD 2P0HA 2AEMA 1VQOP 3S1KA 1SQVJ 2Y8GA 2BCJA 5KCVA 2IBZG 1SQXJ 1XTCC 2V7QJ 2NZ8B 2Z0PA 2ZT9D 4PV1C 1AWEA 3KY9A 2COFA 3RK3D 1OX3A 4HSIA 1SHCA 1G2CB 3NXSA 5DIFB 1HJBA 1LW3A 3NFQA 1L0LE 2D10A 2Y0CA 1EC5A 1JEKA 4GMVA 1FZBA 3NW8A 4I2LC 2COAA 4PD4H 2ZPYA 4EIJA 1J19A 3HTKB 4PJ0E 1S9KD 2NPSB 1MI1A 1DEEG 1OVRA 2EJ8A 5KLVJ 1SP4A 4PQ0A 1D7MA 3V2RA 3M9QA 2Z5IA 1SFCC 1URQA 3NWFA 1LTTC 2VRSA 3PVUA 5KLVG 4H8SA 5GTIH 2O1KA 1BGYJ 3GMAA 1I2HA 1OVUA 2E75B 2FBWC 3WMM0 2E74B 1T3UA 2YS5A 4BXLA 3BCCE 1BGYG 3NMDA 5J3TA 1JMMA 2XNDH 1H0TB 5B66E 5AW8B 1ZYIA 2FFDA 4JF7A 3D70A 4N78D 1NO4A 3FWNA 1DD4A 1FOSE 1GC7A 2WPQA 3KXDA 2DHKA 2LYDA 2OQBA 2ZAEB 2JR8A 4MT7A 4EYYQ 4MK0A 1NTZG 3D71A 2QA4P 1WG7A 2D2CB 4ZRKA 2DW3A 2J0JA 2FYZA 2R09A 3A58A 2Q7CA 1KZGA 3FWLA 3SUZA 1N73A 3CC2P 1UIIA 5BVZA 2L5GB 2HPCB 2OTXA 3FM8C 4YL8A 3CL3D 3H1HJ 2B88A 3G9RA 1NOHA 1JMBA 4XE5B 3H1HG 1AV1A 1T77A 2FY8A 4DBBA 2HYNA 3D6YA 3Q2YA 1L4AD 3TNUA 3WUTA 3AEAC 2KP8A 1MPHA 4GT1A 5D3YA 2IBZD 4AUWA 3JSVC 4CPGA 1T3JA 3V4WA 1LWUC 2E42A 1V5PA 1GTWA 2Z4DA 2ZYAA 1SQVD 1SQXD 2MKRA 3P32A 3VYIA 1FHXA 4B86A 3MP7B 2D2QA 2OTJP 4KHBA 1BE3E 4WY4C 1ZXGA 4GOFA 3E1IA 2E5YA 2N9YB 2FYUG 2Y0EA 3WUVA 3L73E 4YONA 1DDVA 3X23A 2FXOA 1KMIZ 3H1JJ 1YBKA 4N6JA 5D3XA 3AEGC 3RL0C 2YT1A 5KLVD 1LJ2A 3AEBC 3H1JG 2Q13A 3V2QA 1T2KC 4NY0A 2RNRB 1IRSA 1KB9H 5C5BB 3A3YB 3CX5H 2FJUB 3CMEP 3U8ZA 4AQRD 2Y0DA 1NU1E 1BGYD 4HAXB 1OWAA 1L2PA 3AE6C 5D3VA 1NYHA 4P7IA 3SWKA 2YT0A 3TK1A 1RE4C 3P8MC 1SS1A 2QJKB 2J5UA 3PVLA 2AEJA 3A8PA 4CHJA 1DD3A 3SFDC 3ZDMA 4ZNCA 2X18A 1MV8A 3I55P 3B5NA 3HD7B 3MTUE 4DOJA 1GL2C 1N8RQ 1VQ4P 4H0LC 5APTA 2DX1A 3N7CA 1KILD 1YTZI 2DYNA 2GUSA 1MFZA 1OW8A 1EVHA 1SQPK 1MKMA 2OTLP 2WPRA 4HB4B 1BCCE 3UZTA 2R3SA 3HIEA 3AE9C 1ZW0A 4HKZH 4Z2MB 2AEHA 3Q5SA 3H1HD 1KI1B 3QWMA 1PZQA 2OYHA 3E7KA 1FOEA 1TQZA 1ZV8A 3FVCA 4A5KA 5M4YB 4ZMDA 2B87A 4IL6H 2WSEJ 3AE7C 1EDJA 2KIEA 4XFJA 3O6QA 2KUPA 1CZQA 2WSCH 1V5UA 1YHQP 2PGDA 3L73J 5KAFE 1OY2A 1M57D 1P84E 2WVRA 4N3YB 2AXCA 1NTVA 2Y9ZA 1UIXA 3L73G 3PHLA 3AE3C 1N7SC 3L36A 2Q3EA 3CCRP 1N2DC 4TT3H 3HUSC 4Z1MH 1LTBC 1URQB 1UPRA 1KYOE 2SPZA 2OYIA 2CPBA 1L0LK 2YF0A 4WSFA 2JJLA 2J59M 3V2PA 4ZKUA 2WITA 3H1JD 2ZT9C 1EAZA 1NJIQ 2WMMA 1KTMA 3B77A 2AXTE 3RK3C 3MIWA 4WWIA 2ZYGA 1BTKA 2H7EA 2K49A 3JCUE 1S72P 2UWJE 5I2SA 4D6TJ 3A0HE 4ASVA 3AE1C 3H6PA 4XWXA 2FFDB 3MHVA 3DXDA 2P67A 1FHWA 4H44B 2WSFH 3H32A 4D6TG 1FZGA 4JPZB 2EMSA 5AW1B 1AVOA 1NTKK 3KDPB 1QGKB 1RE3A 2YXRB 3AE2C 4OWFA 1FZFA 3HE5A 1LTIC 3CXBB 1SQQG 1LT9C 1JTHA 1FOSF 1BCCJ 5JHGA 4TYZA 4IFFA 4D6WA 3ODXA 1OFCX 3FGAD 1T8ZA 3KRWA 1YYCA 3Q5PA 3FX0A 4A6HA 1SFCA 1SVFA 2Z0OA 1RJ2A 3MDBC 1Q2NA 3Q1MA 4KT0J 4NPDA 1FAOA 5DHFB 1HVVA 2OQQA 1YJ9P 1OMIA 3A8QA 4K17A 5HE3A 2PRRA 1WGQA 1NKNA 2IX7C 5KLIB 3TNUB 2O3JA 2D9WA 4GDOA 1EF1A 1PL5A 1MKEA 3P7KA 3CCEP 2YO2A 5IRSA 2Q9IA 1LP1B 3AU4A 4ZRJA 1KZUB 1XKEA 2NZ2A 1GW3A 4U3FE 5C79A 1VQNP 4LC1A 3B4SA 4KHBB 3IN6A 3D6ZA 3WU2E 3VN0A 4EDFA 2W83C 3L73D 2DX5A 1V5MA 1Q81Q 1M7RA 2QRXA 3CPWO 1M7LA 2Q5UA 1L4AC 4M3LA 1GK6A 1W5CE 3KZIE 3HK0A 3V4QA 1NVOA 1U7JA 2M0BA 3VP8A 1PGQA 2IBZE 1OW7A 3CXHD 1NTMK 3R4YA 5B5EE 2FJLA 4W7ZA 2ZKMX 2DFKA 5AW4B 5AVQB 1LWUA 1FJKA 4PNKA 3PTZA 5AVZB 4Y99C 3M9BA 4GIFA 4D6TD 1U5EA 2HR3A 1U29A 4WY4A 3S9OA 3B5NB 2YSZA 3II6A 3H1KG 1TXDA 1CW5A 4F7UP 1NU1K 2IDBA 1WT6A 5AW2B 1VF5B 2RMZA 1M1JA 2DTCA 2H89C 2QJPB 1BDDA 4PD4I 4IFMA 1FU1A 4ZRIA 4HAWB 1NAFA 1BCCD 3AEFC 2E43A 2QJYB 3OHMB 1AVYA 5H2FE 5TJHA 5AVVB 1VPCA 2G3AA 2MKVA 1V89A 1ZM0A 1KQFB 2CY4A 3DXEA 1QEXA 1PP9G 1VQ6P 4H13D 3IF4A 1BSNA 4KVGB 2OYHB 4K2OA 4U3FJ 3PLNA 3ULCA 1RE4A 2B87B 4ZKPA 3W68A 2IFNA 3TGUG 2N1TD 5AW0B 2V4HA 4L1RA 4L6EA 3O6QB 4K81A 1NTZE 2I1KA 3L4FA 3OAKA 1KILC 1FDOA 2JEEA 2VSZA 3PP5A 1KILE 1GL2A 3GHGC 1A02J 3H25A 3FEHA 4HAYB 2G35A 2XV5A 3C8VA 3A0BE 2H8PD 4IFSA 1TU3F 2Y9YA 5TISH 1FE6A 4GPTB 2CPSA 5KQ4A 1XCGA 1AQ5A 1IZNB 1PGJA 5CCHD 1KQSO 3BRTB 2UZSA 2OYIB 1GD2E 1HH0A 1KQGB 2WSCJ 2FXPA 4IL6X 1AJYA 1P3RA 1IK7A 3BRVB 2KIKA 4C46A 2QM8A 3MUDA 3VP9A 1ZR4A 4PV1B 1PMSA 4HAVB 4K2PA 3VTPC 1HTLC 4MN4C 2O1JA 4TLFA 1NAYA 3Q3DA 3H32B 3TW1A 2UZRA 3EWKA 3FSSA 1U5GA 2M8RA 4OGQD 3EFGA 1J1DC 2OTKE 1JO5A 3HE5B 2W6AA 3F0WA 2KGXB 2FYUE 3KQGA 1FGYA 1JTHB 1N7SA 3SWFA 1USEA 1Q7YQ 3SYXA 2D11A 5DJTB 4HAZB 2CODA 3HUSA 3L72G 1SFCB 3F5HA 1NU2A 3H1JE 1VQ8P 5HE0A 1Z56A 3CC7P 4QJ3B 4YXDC 3AECC 2BEQD 2DYQA 5DI9B 1ZP0C 2XKMA 3L70G 1HJ0A 3RK2D 2K00A 4QMAA 2H7DA 2W2XC 1G1JA 3U7DA 1IFNA 4HH2A 1KQLA 1KB9I 1NTZJ 3OJAB 3CX5I 1EQ7A 1IFDA 5KAIE 2IFSA 2LULA 2WTYA 1GU4A 4C0AA 4Z2NA 2DKPA 4U3FD 3MPXA 4HB2B 3N7NA 3RBZA 2AEFA 5DJUB 2I5FA 3DCXA 2AL6A 4MY6A 4DIXA 2QG4A 2HFED 3BVHA 5KKZC 4I1LA 4B6HA 1HGVA 4KAXB 1FHOA 2FXMA 5APVA 2KSJA 2C0XA 4Y28J 2KZJA 5BU8B 1KFNA 3G3ZA 2JKVA 5CJ0A 5CBNA 1A02F 3L74G 3V5BA 3SV1A 2K3RA 4A6FA 1FAVA 1J1EC 5KJ7D 1DIPA 1LP1A 3P8CD 3PG7A 1L0NG 1S5LH 4EOTA 4L75A 1GC6A 1LWUB 4R4MA 1JUNA 2FYUJ 1JY3N 2DA0A 1BAKA 2CY5A 2YNYA 3TDKA 2Q3IA 2OGUA 4NPFX 4WY4B 3DXCA 4HB3B 1ZMEC 2L2IA 2N23A 3RGUA 1X9VA 1VQ9P 1J0WA 1X05A 1S2EA 2O01J 1M1JB 1SQVK 2RN0A 4JQ0D 2R3CA 5E79E 3ITKA 1SQXK 2RRFA 1L4AA 3KZ1A 1XR0B 4GKGA 3U1AA 1PGOA 3RL0B 1IFJA 2GCLA 1R5LA 4GODA 4OSNA 2K1AA 2YKQA 3CXHE 3OANA 2LOZA 3PSCA 1KFMA 1NWQA 2RKLA 3CD6P 2D9XA 2M5AA 3D8FA 1VL2A 1DDWA 4HATB 2KZIA 1H88A 1LTJC 2ZXXA 2CAYA 4L74A 4YTPC 3L75J 3M0AA 3M06A 2COCA 3A7OA 2Z4EA 4D6TE 2WQYC 2P2UA 4PD4E 3WUUA 5KLVK 3G4SP 1NTZD 3L75G 3RL0g 5BU5A 2ADZA 2P8VA 3PEGA 1PPJG 1SQQE 2LG1A 1IFIA 1Y47A 1GL2B 4L73A 3S4RA 4H0LB 1R8EA 3KYQA 4UB6H 1GMJA 3GF7A 1Q90D 5GTIE 5FI0A 4DZOA 4QJ4B 1JY2N 4YXWH 2M38A 2K9JA 1VDFA 2QIWA 1XTGB 2W27A 4H13C 1WI1A 1JY3O 2KK7A 1V61A 3IFMA 4DT0A 4C7NA 2IYPA 3ODOA 3LW5H 3H1IJ 2YIUC 4KJMA 2M3BA 2E76D 3SSUA 2MJZA 2N1TC 4GOUA 3H1IG 1BDCA 1MIXA 3O96A 4RKUJ 1QL1A 1OW6A 1EDKA 2P0DA 3K5BA 3CCJP 1Y8AA 1KV4A 1KILA 2GCJA 4BRYA 5K5GB 3GHGA 1HBWA 2ZVNB 3NTNA 1NGMB 2I8DA 5APUA 5GTHH 2FYUD 2N0YA 3L71J 1X0TA 1N7SB 1P6SA 5CCHC 2JWAA 3L71G 1WJMA 1CSBA 1XODA 3BASA 3QBVB 4K3AA 1NTMG 3HUSB 2UVMA 2JDIH 1AA0A 1K04A 1Y19B 2NPSD 3H1LJ 3FXDA 2DN6A 3WYFB 1ZSQA 4GOEA 4RJTA 3TO1A 3KHUA 2ZT9B 2H7HA 2ZFCA 1DROA 3H1LG 2FYUK 3RK3B 3KSYA 5L8RJ 1NHLA 1MZ9A 1WMKA 3VMAA 2W2XD 1G1IA 2E75D 5AVYB 2E74D 4D0NB 1JY2O 3ABVC 3T97A 1SQQJ 4HB0B 4OGQC 2L91A 3G6EP 1IJDB 1IK9A 4QXAB 4I6MC 1SQBJ 3CI9A 4H44C 3L75D 5LG4B 3H1KE 4Y94A 2QVAA 1SQBG 1KORA 5APXA 3KPEA 5LONB 3C1LA 3HE4A 2KOGA 2D2CD 5KQ1A 3TF5A 3TYYA 3IAOA 2W90A 1KB9E 3CX5E 2BCCG 4BWNA 1N73C 1OMWA 3RK2C 3HRNA 1K5DB 4UB8H 5AVTB 1K73Q 3TSIA 2C9NY 2Q1KA 1PP9E 2KUBA 2WT7A 1E5WA 3SWYA 1YI2P 5CLLB 2V76A 2Z14A 1EGXA 3EQ2A 4O9BA 2R2YA 4A6FB 1ZRTE 1FZCC 2GJYA 3ODWA 3GF3A 1Q67A 3F5RA 3TGUE 1EZVG 2LXBA 3H1ID 4I7ZC 1MFTA 5AVXB 5EFXA 1YITP 2K9YA 4F7GA 1MIZB 3HW2B 2KCJA 1YQ4C 2ITAA 3QH9A 3CWBG 2JP2A 1VQLP 1BSHA 5JP4A 2WWWA 1MAIA 5CCGD 1EXJA 5APSA 2OYOA 4BBKA 5EFWB 4YPCA 3LIDA 1FZEA 2YXQB 1R5SA 1U7MA 3PZDA 3P7ZA 3L71D 3VOQA 1L4AB 3PJSK 4PJ0H 4WJ7A 3JC22 4AYCA 4OT1A 2K88A 4IL6E 5KJ7C 4W80A 2FYNC 2W8ZA 1H4RA 1S5LX 1S3JA 3PP2A 3P8CE 3NWAA 2RH0A 3ZVRA 3H1LD 2ZXEB 2M5AB 4XA4A 2FKWB 3H1KJ 1K8AQ 2R44A 2KB7P 2H43A 2P10A 2A06G 5AW9B 4PD4D 1LNQA 4Y99B 1FJPA 2YKOA 1ZN5A 2I1JA 5B66H 4GNKB 1SQQD 5JHHA 3VMYA 5LOPB 1RH5B 3UIAA 1SQBD 2JP3A 3GW6A 1RF1C 3HD7D 1IFPA 1YTZT 2QKLA 3QIJA 3FXEA 3BATA 4LLHA 1PP9J 3L72E 3TFMA 2K9JB 1U5FA 4JYCA 1LTSC 1YJWP 1M56D 3M9HA 1M7EA 1DX7A 2QSIA 4F7HA 4EMOA 3L70E 1N3HA 1SQQK 2I5CA 3TGUJ 3AE4C 4C7NB 1W1HA 1PFJA 2Y8FA 4DXAB 1XD4A 5APYA 3NSUA 3EFFK 4GMXB 2H88C 2OYHC 3VOPA 2YT2A 3PH0A 2NRGA 1X22A 3L35A 2QKMA 1Z87A 2YVCA 1KILB 1ZOYC 4BRYB 1LGHB 3GHGB 4JYBA 2L1CA 4HHVA 1JNMA 1FB8A 1EZVI 1W1GA 2W2WA 2KNCA 4EI2A
chains in the Genus database with same CATH topology
2J0MA 2ELAA 5BU8B 4A5KA 1KFNA 3G3ZA 1WGUA 5CJ0A 1Y5OA 2ROVA 1DEBA 2RLOA 1X79B 1A02F 1NI2A 3A2AA 1QC6A 4A6KA 2HLOA 3V5BA 3SV1A 1RRPB 3I5CA 2KUPA 4A6FA 2C9LY 1FAVA 1J1EC 1CZQA 5KJ7D 2WSCH 2HG5D 2RVBB 1V5UA 3P8CD 2PZ1A 1ZC4B 3PG7A 2HPCA 4WB4A 4WY4D 4EOTA 1GC6A 1GK4A 1LWUB 3LIEA 3VIAA 1OY2A 1IFMA 1URQD 2HODB 2N1TA 1JUNA 1UNQA 4N3YB 2Y7BA 1JY3N 1NTVA 1V88A 4LGDE 2YRYA 2DA0A 1N7SC 5L81A 1BAKA 1ZR2A 2P0FA 2CY5A 2YNYA 3L36A 3A98B 2Q3IA 4GN1A 5D3WA 4WY4B 4EJNA 4EKUA 1LB1A 1NH4A 1N2DC 1P5TA 3DXCA 4HB3B 3HUSC 2L2IA 5CHXA 2N23A 3RL0D 2IYBA 1X9VA 2VRWB 1LTBC 1URQB 1GZLA 1UPRA 1J0WA 2O01H 4KHOA 3PVWA 1T2KD 1X05A 2OYIA 2CPBA 1M1JB 1L0LK 1SQVK 4W7YA 2YF0A 2JJLA 2R3CA 2J59M 5KTBA 4WSFA 3V2PA 1J1DB 1SQXK 4ZKUA 5J3YA 1W2EA 2WITA 2YKPA 1GG3A 1EAZA 5AW3B 2NMBA 1ZC3B 1L4AA 3RK3C 3MIWA 4HAUB 2LKOA 1BTKA 2H7EA 3KZ1A 5CCGA 1XR0B 4IOYX 4GKGA 3U1AA 5CCHA 1RE3C 3RL0B 2DLWA 4WVFB 1IFJA 2GCLA 3HE4B 1DBHA 3U59A 3AJ4A 1RF0C 2NPSC 4HYTB 3H6PA 1I7AA 4XWXA 2YKQA 5AVSB 1H8AA 2W6BA 2FFDB 3B5NC 3DXDA 3OANA 2P67A 3M0DA 3O8ZA 3V2NA 1FHWA 3L37A 3N4XA 2CRFA 2WSFH 2LOZA 3PSCA 4CYEA 3H32A 1KFMA 1NWQA 3U1CA 1FZGA 2D9XA 1RF1B 3D8FA 1JY3P 5AW1B 1DDWA 2EMSA 4HATB 3OA7A 1CI6B 1H88A 1FBMA 1KZ7A 3BJIA 1LTJC 2CAYA 1NTKK 5AW7B 3KDPB 3M1IB 1GL2D 1MK9B 3AU5A 5AVWB 1RE3A 3V5WA 3M0AA 1FZFA 3HE5A 3M06A 2COCA 3A7OA 1LTIC 2Z4EA 3CXBB 2WT7B 3BINA 1LT9C 2P2UA 1SGHA 1JTHA 5KLVK 1FOSF 3RCPA 5JHGA 4TYZA 4IFFA 2IFMA 5BU5A 3ODXA 2ADZA 1T8ZA 3VMXA 2P8VA 2VKIA 3KRWA 3PEGA 1QL2A 1SQBK 1YYCA 2J0KA 5C5BA 2LG1A 1LTJA 1IFIA 4A6HA 1PLSA 1SFCA 1GL2B 1SVFA 2A45G 2Z0OA 1RJ2A 2KLVA 3R2PA 3KYQA 1H89A 3MDBC 4GXBA 1LT9A 2E2XA 3WA0A 3M91A 5CLQB 5FI0A 1DDMA 4DZOA 1FAOA 5DHFB 1HVVA 1JY2N 2M38A 3A8QA 2DKQA 2A45I 2P7JA 1VDFA 1UNRA 1X1GA 4K17A 5HE3A 1WGQA 1NKNA 2IX7C 5CMZA 1ZVRA 1XTGB 2XQNM 3TNUB 2W27A 2R5DA 2XDJA 1WI1A 1JY3O 5CJ4A 1EF1A 2D9WA 3HD7A 1V61A 3IFMA 1NTYA 1MKEA 2YS1A 2HE7A 3P7KA 4C7NA 2YO2A 5HE1A 2Q9IA 3ODOA 1IC2A 3LW5H 4Z2NA 2Z5HA 3AU4A 4ZRJA 2M3BA 2WSEH 1KZUB 1XKEA 2MJZA 1GW3A 2N1TC 3MGNA 2XNXA 2ROZB 3D8EA 5C79A 1X11A 3O96A 1MIXA 2EC1A 5AW6B 4LC1A 1IO4A 2EMTA 1U2BA 1QL1A 2OARA 1LTGC 3SO6A 2R0DA 4KHBB 3VMZA 5C16A 2P0DA 2RUKB 1FZCA 1J1EB 1N7SD 1KILA 2GCJA 3VN0A 4DX90 3GHGA 1W1DA 1JY2P 1HBWA 2DX5A 5DHAB 1V5MA 2OYIC 4HDOA 3NTNA 1SLQA 4GZUA 1M7RA 1GW4A 1GDTA 2P0HA 4NSWA 5APUA 1M7LA 2N0YA 2Q5UA 2Y8GA 1ZLLA 2BCJA 5KCVA 1L4AC 4M3LA 1GK6A 3T06A 1XTCC 2NZ8B 1N7SB 5CCGC 1P6SA 2Z0PA 3HK0A 3V4QA 5CCHC 1AWEA 3KY9A 2COFA 3RK3D 1WJMA 1CSBA 1XODA 3BASA 3QBVB 3HUSB 3VP8A 2UVMA 3M0DC 1G2CB 1SHCA 3NXSA 5DIFB 1NTMK 1Y19B 1HJBA 2NPSD 1LW3A 3NFQA 1B55A 3B5ND 5AVRB 2DN6A 1FDMA 4W7ZA 2FJLA 3WYFB 1WVHA 1ZSQA 2DFKA 5AW4B 2WZ7A 2D10A 5AVQB 3KRXA 1LWUA 3TO1A 2LKMA 1NKZB 1HUCA 2H7HA 1FJKA 2HODA 4GMVA 2ZFCA 2K2UA 1FZBA 3TVVA 4PNKA 5AVZB 1TJ6A 1UNPA 4I2LC 1DROA 2D4QA 2COAA 2FYUK 3RK3B 3KSYA 1M1JC 1NHLA 4Y99C 2ELBA 2ZPYA 3M9BA 1MZ9A 4EIJA 2GUVA 2W2XD 4GIFA 4IAPA 1J19A 3HTKB 5KJ7A 1G1IA 1U5EA 1FZAA 2R32A 4IFDK 5AVYB 2NPSB 1S9KD 2R5BA 1JY2O 1U29A 4D0NB 4WY4A 4HDQA 5J3QA 3B5NB 3T97A 3A5TA 3II6A 2EJ8A 1SP4A 2GS0A 1TXDA 2YSZA 4PQ0A 1HWTC 3V2RA 4HB0B 4KHXA 3M9QA 1CW5A 4F7UP 2Z5IA 1IJDB 1IK9A 1NU1K 1SFCC 4I6MC 1URQA 2MDXA 1LTTC 2VRSA 1WT6A 5AW2B 3PVUA 3CI9A 4H8SA 1M1JA 1LTJB 2O1KA 2DTCA 2C0WA 2Z0QA 4Y94A 2XZRA 1I2HA 3HQCA 4IFMA 1FU1A 2A45H 2LOXA 1NAFA 3WMM0 4HAWB 4ZRIA 5APXA 3KPEA 3CLQA 1T3UA 2YS5A 2E43A 4RESB 3NMDA 5LONB 5J3TA 1JMMA 1AQCA 3HE4A 2KOGA 4WBAA 5AVVB 1VPCA 1V89A 5KQ1A 5AW8B 1ZM0A 1JOCA 1N7LA 3TYYA 2FFDA 1K5GB 3HD7C 4JF7A 2CY4A 3DXEA 4N78D 1NO4A 1MK7B 1FOSE 1RF1A 1GC7A 4KVGB 2WPQA 2DHKA 2OYHB 2LYDA 1N73C 2OQBA 1OMWA 3ML4A 1CI6A 2YMYA 3RK2C 4K2OA 3HRNA 4MT7A 4MK0A 1BTNA 1K5DB 5AVTB 2C9NY 3TSIA 2XU6A 3ULCA 1LTAC 1RE4A 1WG7A 1PFIA 2M14A 1NTZK 4ZKPA 2WT7A 1E5WA 3SWYA 2IFNA 5CLLB 4ZRKA 3GYPA 2V76A 2J0JA 2FYZA 2N1TD 5AW0B 3GYOA 4DX8A 1JCCA 1EGXA 4L6EA 3EQ2A 4O9BA 2R09A 2YS3A 4K81A 4A6FB 2Q7CA 1KZGA 2I1KA 3IR9A 1FZCC 3L4FA 2GJYA 3OAKA 1KILC 1N73A 3ODWA 3SUZA 1DYNA 1N86A 2JEEA 2VSZA 1Q67A 3PP5A 2DHIA 3F5RA 2L5GB 5BVZA 2HPCB 2OTXA 1GL2A 3GHGC 1A02J 3CL3D 5AVXB 3FM8C 3FEHA 4HAYB 4YL8A 5EFXA 4F7GA 2G35A 3CIKA 1JCDA 2XV5A 2N1TB 1NOHA 2H8PD 2POHA 1X8YA 4IFSA 1MIZB 1UPQA 3HW2B 4XE5B 2KCJA 2D9VA 3C9IA 2RSGA 4DBBA 4GPTB 2HYNA 2K2JA 2JP2A 2CPSA 5KQ4A 1OXZA 5JP4A 1XCGA 2N9BA 1HGZA 1L4AD 2WWWA 3TNUA 1AQ5A 5AW5B 1MAIA 5CCGD 2KP8A 5CCHD 5APSA 3BRTB 1MPHA 4GT1A 1X86A 2UZSA 1BWNA 4BBKA 3P6AA 5D3YA 4AUWA 2OYIB 1GD2E 1HH0A 5C6RA 3LIDA 3SNHA 3ULBA 2PAJA 1FZEA 1T3JA 1LWUC 3V4WA 2E42A 1V5PA 1GTWA 1P3RA 1FGZA 3P7ZA 3PZDA 3VOQA 3BRVB 4C46A 1QQGA 1L0NK 1L4AB 2QM8A 3MUDA 2MKRA 3P32A 3VP9A 4WJ7A 5GOWB 3VYIA 1ZR4A 4AYCA 5KJ7C 1FHXA 1PMSA 4B86A 4HAVB 1XX0A 4W80A 4K2PA 3VTPC 2D2QA 1HTLC 1H4RA 1RY3A 4WY4C 3PP2A 3P8CE 1U27A 2O1JA 5DH9B 3E1IA 1WRGA 3H32B 3TW1A 3ZVRA 3MD0A 2ZXEB 2UZRA 5AVUB 1URQC 4XA4A 2FKWB 3FSSA 1X1FA 1U5GA 2M8RA 3IVFA 3EFGA 4YONA 1DDVA 3X23A 1SFCD 1J1DC 1H10A 2KB7P 1JO5A 3HE5B 2W6AA 2H43A 4C7RA 3F0WA 5AW9B 2KGXB 4Y99B 1UEFA 3KQGA 1FJPA 1FGYA 1JTHB 4N6JA 1N7SA 2PP6A 2YKOA 3SWFA 1AFOA 2HTHB 5D3XA 1J2JB 1ZN5A 2I1JA 3RL0C 2YT1A 2KYVA 3SYXA 2D11A 2Q13A 2P1JA 3V2QA 2DHJA 4HAZB 2IPPA 1T2KC 2CODA 4NY0A 3HUSA 2FFDC 3VMYA 2RNRB 1IRSA 5C5BB 5JHHA 3A3YB 5LOPB 1G2CA 3U8ZA 3UIAA 4AQRD 1SFCB 5HE2A 1NU2A 1RF1C 2MFQA 3HD7D 2MWNB 4HAXB 1OWAA 4CHMA 2J58A 5HE0A 1LT9B 1Z56A 3LJUX 5D3VA 4P7IA 2QKLA 1YTZT 3QIJA 5DI9B 2DYQA 3BATA 2D9YA 2XKMA 4LLHA 1WJ1A 2YT0A 3D8DA 3TK1A 1U5FA 1RE4C 3P8MC 4JYCA 5D27A 1LTSC 3RK2D 4TKNA 2K00A 2D9ZA 2H7DA 3M9HA 3PVLA 1M7EA 2W2XC 1G1JA 1DX7A 5JLJB 3HTKA 3A8PA 3U7DA 4CHJA 1IFNA 4HH2A 2X18A 1KQLA 3OJAB 5APWA 1MV8A 1RF0A 2NPSA 3B5NA 4F7HA 3HD7B 1N3HA 1S9KE 4EMOA 1EQ7A 1IFDA 1SQQK 3MTUE 2I5CA 1MUUA 5APQA 4C7NB 1FHOA 2IFSA 2LULA 1W1HA 2YO3A 2WTYA 4DOJA 1GL2C 1PFJA 2Y8FA 2GM4A 1GU4A 4C0AA 5APTA 4DXAB 1XD4A 1N73B 1KILD 4OH8B 2DKPA 1YTZI 5APYA 2BASA 2DYNA 2DX1A 3N7CA 3RK2B 3NSUA 3ZDTA 2GUSA 1MFZA 2WPSA 1EVHA 3MPXA 1SQPK 1OQNA 4HB2B 2QM7A 3N7NA 1U5DA 4GMXB 2I5FA 2OYHC 3G9WA 2AL6A 3VOPA 4MY6A 1ISNA 1DH3A 2WPRA 4HB4B 3B8EB 5FI1A 3L35A 2QKMA 3UZTA 1FZCB 1Z87A 2YVCA 3TCAA 2HFED 1KILB 3BVHA 4I1LA 3TFMA 1LGHB 4B6HA 1HGVA 3GHGB 2AEHA 4Z2MB 1KI1B 4JYBA 3QWMA 2L1CA 4HHVA 4N78E 1JNMA 4KAXB 2FXMA 2OYHA 1FB8A 1W1GA 1GU5A 5APVA 1FOEA 2W2WA 4KHAA 1TQZA 1ZV8A 2RGNB 2KSJA 2C0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0M A;  2ELA A;  4A5K A;  3G3Z A;  1WGU A;  1Y5O A;  2ROV A;  2RLO A;  1NI2 A;  1QC6 A;  4A6K A;  3SV1 A;  1RRP B;  2KUP A;  4A6F A;  2WSC H;  2RVB B;  1V5U A;  2PZ1 A;  1ZC4 B;  3PG7 A;  1GC6 A;  3VIA A;  1OY2 A;  1UNQ A;  2Y7B A;  1V88 A;  1NTV A;  2YRY A;  2DA0 A;  5L81 A;  1BAK A;  2P0F A;  2CY5 A;  3A98 B;  4GN1 A;  5D3W A;  4EJN A;  1LB1 A;  1P5T A;  3DXC A;  4HB3 B;  2L2I A;  2N23 A;  2IYB A;  2VRW B;  1UPR A;  1J0W A;  2O01 H;  4KHO A;  3PVW A;  1X05 A;  1L0L K;  1SQV K;  2YF0 A;  4WSF A;  2J59 M;  1SQX K;  5J3Y A;  1GG3 A;  1EAZ A;  2NMB A;  1ZC3 B;  4HAU B;  2LKO A;  1BTK A;  2H7E A;  3KZ1 A;  1XR0 B;  4IOY X;  2DLW A;  4WVF B;  2GCL A;  1DBH A;  3AJ4 A;  1I7A A;  4XWX A;  3OAN A;  3DXD A;  1FHW A;  2LOZ A;  2CRF A;  3PSC A;  2WSF H;  4CYE A;  2D9X A;  3D8F A;  1DDW A;  2EMS A;  4HAT B;  3BJI A;  1KZ7 A;  2CAY A;  1NTK K;  3M1I B;  1MK9 B;  3AU5 A;  3V5W A;  2COC A;  3CXB B;  3BIN A;  1SGH A;  5KLV K;  3RCP A;  5JHG A;  4TYZ A;  3ODX A;  2ADZ A;  2VKI A;  2P8V A;  3KRW A;  3PEG A;  1SQB K;  2J0K A;  5C5B A;  2LG1 A;  4A6H A;  1PLS A;  2Z0O A;  1RJ2 A;  3MDB C;  4GXB A;  2E2X A;  3WA0 A;  5CLQ B;  5FI0 A;  1DDM A;  1FAO A;  5DHF B;  2M38 A;  3A8Q A;  2DKQ A;  1X1G A;  1UNR A;  4K17 A;  5HE3 A;  1WGQ A;  1ZVR A;  2XQN M;  1WI1 A;  2D9W A;  1EF1 A;  1V61 A;  1NTY A;  1MKE A;  2YS1 A;  2HE7 A;  5HE1 A;  3ODO A;  3LW5 H;  3AU4 A;  4ZRJ A;  2WSE H;  1XKE A;  2ROZ B;  3D8E A;  5C79 A;  1X11 A;  3O96 A;  1MIX A;  2EC1 A;  2EMT A;  1U2B A;  2OAR A;  3SO6 A;  2R0D A;  4KHB B;  5C16 A;  2P0D A;  2RUK B;  2GCJ A;  4DX9 0;  1W1D A;  2DX5 A;  5DHA B;  1V5M A;  4HDO A;  4GZU A;  1M7R A;  2P0H A;  4NSW A;  2N0Y A;  2Y8G A;  2BCJ A;  5KCV A;  3T06 A;  2NZ8 B;  1P6S A;  2Z0P A;  3HK0 A;  1AWE A;  3KY9 A;  2COF A;  1WJM A;  3QBV B;  1XOD A;  2UVM A;  1SHC A;  5DIF B;  1NTM K;  1Y19 B;  1LW3 A;  1B55 A;  2DN6 A;  2FJL A;  3WYF B;  1WVH A;  1ZSQ A;  2DFK A;  3KRX A;  2D10 A;  3TO1 A;  2LKM A;  3TVV A;  4EKU A;  4PNK A;  4GMV A;  2K2U A;  1DRO A;  1TJ6 A;  1UNP A;  2D4Q A;  2COA A;  2FYU K;  3KSY A;  2ZPY A;  2ELB A;  2W2X D;  4IAP A;  1J19 A;  1U5E A;  4IFD K;  5J3Q A;  4D0N B;  1U29 A;  4HDQ A;  2YSZ A;  2EJ8 A;  2GS0 A;  1TXD A;  4PQ0 A;  4HB0 B;  3M9Q A;  4F7U P;  1NU1 K;  2MDX A;  3PVU A;  4H8S A;  2DTC A;  2Z0Q A;  4Y94 A;  1I2H A;  3HQC A;  2LOX A;  4ZRI A;  4HAW B;  3CLQ A;  2YS5 A;  5LON B;  5J3T A;  1AQC A;  1V89 A;  5KQ1 A;  1ZM0 A;  1K5G B;  2CY4 A;  3DXE A;  1MK7 B;  1GC7 A;  4KVG B;  2DHK A;  2LYD A;  3ML4 A;  2OQB A;  1OMW A;  4K2O A;  4MT7 A;  4MK0 A;  1BTN A;  1K5D B;  3ULC A;  1WG7 A;  2M14 A;  1NTZ K;  1E5W A;  5CLL B;  4ZRK A;  3GYP A;  2V76 A;  2J0J A;  3GYO A;  4DX8 A;  1EGX A;  4L6E A;  2R09 A;  2YS3 A;  4K81 A;  4A6F B;  1KZG A;  2I1K A;  2GJY A;  3SUZ A;  3ODW A;  1DYN A;  2VSZ A;  1Q67 A;  2DHI A;  3F5R A;  3FM8 C;  2OTX A;  4YL8 A;  3FEH A;  4HAY B;  5EFX A;  4F7G A;  2G35 A;  3CIK A;  4IFS A;  1MIZ B;  1UPQ A;  3HW2 B;  2KCJ A;  2D9V A;  2RSG A;  4DBB A;  4GPT B;  2K2J A;  2JP2 A;  5KQ4 A;  5JP4 A;  1XCG A;  1MAI A;  1MPH A;  1X86 A;  2UZS A;  1BWN A;  4BBK A;  3P6A A;  5D3Y A;  5C6R A;  3SNH A;  3ULB A;  1V5P A;  1P3R A;  3PZD A;  1FGZ A;  3P7Z A;  3VOQ A;  1QQG A;  1L0N K;  2MKR A;  4WJ7 A;  5GOW B;  1FHX A;  1PMS A;  4HAV B;  1XX0 A;  4K2P A;  2D2Q A;  1H4R A;  3PP2 A;  1U27 A;  5DH9 B;  3TW1 A;  3ZVR A;  2UZR A;  3FSS A;  1X1F A;  1U5G A;  3IVF A;  4YON A;  1DDV A;  3X23 A;  1H10 A;  3F0W A;  2KGX B;  1UEF A;  1FGY A;  2HTH B;  5D3X A;  2I1J A;  2YT1 A;  3SYX A;  2D11 A;  2Q13 A;  2DHJ A;  4HAZ B;  5JHH A;  2COD A;  4NY0 A;  2RNR B;  5LOP B;  1IRS A;  5C5B B;  3U8Z A;  5HE2 A;  1NU2 A;  2MFQ A;  2MWN B;  4HAX B;  4CHM A;  5HE0 A;  3LJU X;  5D3V A;  4P7I A;  2QKL A;  3QIJ A;  5DI9 B;  2DYQ A;  2D9Y A;  3TFM A;  3D8D A;  1WJ1 A;  2YT0 A;  1U5F A;  5D27 A;  4TKN A;  2K00 A;  2D9Z A;  2H7D A;  3PVL A;  1M7E A;  2W2X C;  5JLJ B;  3A8P A;  3U7D A;  4CHJ A;  2X18 A;  4F7H A;  4EMO A;  1N3H A;  1SQQ K;  2I5C A;  2IFS A;  2LUL A;  1W1H A;  1PFJ A;  2Y8F A;  4C0A A;  4DXA B;  1XD4 A;  2DKP A;  2DX1 A;  3N7C A;  4Z2N A;  2DYN A;  3NSU A;  3ZDT A;  1EVH A;  3MPX A;  1SQP K;  1OQN A;  4HB2 B;  1U5D A;  4GMX B;  2I5F A;  3G9W A;  2AL6 A;  4MY6 A;  1ISN A;  4HB4 B;  5FI1 A;  2QKM A;  3UZT A;  1Z87 A;  2YVC A;  3TCA A;  4B6H A;  4Z2M B;  2AEH A;  1KI1 B;  3QWM A;  2L1C A;  4HHV A;  4KAX B;  1FHO A;  1FB8 A;  1W1G A;  2W2W A;  4KHA A;  1FOE A;  1TQZ A;  2RGN B; 
#chains in the Genus database with same CATH topology
 2J0M A;  2ELA A;  1DEB A;  1X79 B;  5CBO A;  1NI2 A;  3A2A A;  1QC6 A;  2HLO A;  3I5C A;  2C9L Y;  2RVB B;  2LXC B;  2E76 C;  1ZC4 B;  4WB4 A;  3L74 E;  1GK4 A;  1IFM A;  1W2B O;  3AE5 C;  1URQ D;  1UNQ A;  2N1T A;  1OVV A;  1L0N E;  3CCU P;  4LGD E;  2YRY A;  2P0F A;  3A98 B;  5D3W A;  3T97 B;  1PIX A;  1NH4 A;  2IYB A;  3CXH H;  1S1C X;  2A06 D;  2YMK A;  1GZL A;  1SQV G;  1KYO I;  3PVW A;  1SQX G;  3H1K D;  1YJN P;  4H44 D;  5KTB A;  1J1D B;  1W2E A;  2YKP A;  3RBX A;  3L72 J;  3CCM P;  1GG3 A;  2LKO A;  4IOY X;  5CCH A;  1RE3 C;  2Q6Q A;  3PRJ A;  2DLW A;  4WVF B;  3HE4 B;  1DBH A;  3U59 A;  1RF0 C;  2NPS C;  2B89 A;  3L70 J;  1H8A A;  1KB9 D;  2CK3 H;  3CX5 D;  2CRF A;  3N4X A;  2W6J H;  4CYE A;  2WSF J;  3NWD A;  4IOI H;  3U12 A;  1JY3 P;  3OA7 A;  1FBM A;  1KZ7 A;  5AW7 B;  1PP9 D;  5AVW B;  3V5W A;  2E75 C;  2WT7 B;  2E74 C;  1NTK E;  1SQP J;  3RCP A;  1ZRT D;  3VMX A;  2VKI A;  1QL2 A;  3TGU D;  2J0K A;  1SQP G;  1PLS A;  2KI7 B;  4U7J A;  3SFE C;  3L75 E;  1KN7 A;  3R2P A;  1M90 Q;  4GXB A;  1LT9 A;  2E2X A;  3WA0 A;  2QEX P;  3M91 A;  1DDM A;  1PPJ E;  3OW2 O;  2D2C C;  2A45 I;  1AQT A;  1X1G A;  2KXP B;  5CJ4 A;  1FDI A;  5KKZ B;  1NTY A;  2HE7 A;  5HE1 A;  1M1K Q;  1IC2 A;  5KAF H;  3L74 J;  4QJ5 B;  1P84 H;  3HSA A;  2K8E A;  2WPV B;  3MGN A;  1YIJ P;  2XNX A;  2ROZ B;  1L0N J;  3D8E A;  1FS0 E;  2EC1 A;  5AW6 B;  2EMT A;  1VQ5 P;  4CSQ A;  4OVN F;  1LTG C;  2RUK B;  1FZC A;  1J1E B;  2BEZ F;  3H1I E;  2LR2 A;  1KYO H;  1KC8 Q;  1W1D A;  1JY2 P;  5DHA B;  4HDO A;  4GZU A;  1GW4 A;  1GDT A;  4NSW A;  1VQP P;  2AXT H;  1L0L J;  1ZLL A;  3JCU H;  3T06 A;  5CCG C;  5TIS E;  4K35 A;  3A0H H;  2E5T A;  1L0L G;  3M0D C;  4HB1 A;  2IBZ I;  3GG2 A;  4L76 A;  1B55 A;  2KIG A;  3B5N D;  5AVR B;  1VQ7 P;  1FDM A;  1WVH A;  1T6A A;  2WZ7 A;  3L71 E;  3KRX A;  1NTM E;  3L72 D;  2LKM A;  1NKZ B;  1HUC A;  3TVV A;  4EKU A;  2HOD A;  2K2U A;  1Q82 Q;  1TJ6 A;  1UNP A;  4JBZ A;  2D4Q A;  1VF5 D;  1M1J C;  1NTK J;  2ELB A;  2GUV A;  4DCK A;  4IAP A;  5KJ7 A;  1FZA A;  2R32 A;  3L70 D;  4IFD K;  5J3Q A;  2R5B A;  4HDQ A;  3BCC J;  4R4L A;  3A5T A;  1NTK G;  2GS0 A;  3H1L E;  1HWT C;  4KHX A;  1U57 A;  2MDX A;  3BCC G;  1LTJ B;  2C0W A;  2KSE A;  1OIP A;  2Z0Q A;  2XZR A;  3HQC A;  3GLM A;  2LOX A;  2A45 H;  1QX8 A;  1SQP D;  3W67 A;  3CLQ A;  4RES B;  2QJK C;  4NPE A;  1AQC A;  4WBA A;  1JOC A;  1N7L A;  2P58 A;  1K5G B;  1SQB E;  3HD7 C;  2Z59 A;  2KLU A;  3CMA P;  1MK7 B;  1RF1 A;  3ML4 A;  1CI6 A;  2KNC B;  2YMY A;  1BTN A;  1QVG O;  1PV3 A;  2XU6 A;  1LTA C;  1PFI A;  2M14 A;  1NTZ K;  2BCC E;  3GYP A;  2K37 A;  3GYO A;  4DX8 A;  1JCC A;  2YS3 A;  4H13 B;  3WU2 H;  3IR9 A;  1DYN A;  1N86 A;  2DHI A;  3L74 D;  2YIU B;  2M3E A;  1EXI A;  3CIK A;  5M1B A;  1JCD A;  2N1T B;  2POH A;  1L0N D;  1X8Y A;  1UPQ A;  1EZV E;  3KZI H;  4A7P A;  3CC4 P;  2D9V A;  3C9I A;  2RSG A;  1YQ3 C;  2K2J A;  1OXZ A;  3AEE C;  2N9B A;  1HGZ A;  2KS1 A;  3MUD C;  5AW5 B;  2ZJS E;  3I56 P;  1OZH A;  2G8Y A;  4PV1 D;  5B5E H;  1X86 A;  1BE3 J;  1BWN A;  3P6A A;  3CWB E;  5C6R A;  2B9B A;  3USS A;  3QWO C;  3SNH A;  3ULB A;  1NTM J;  2V7Q H;  2PAJ A;  2O01 N;  1FGZ A;  1BE3 G;  1L0L D;  1QQG A;  3AE8 C;  1L0N K;  1Q86 Q;  5GOW B;  1FC2 C;  1XX0 A;  1RY3 A;  1U27 A;  5DH9 B;  1LT1 A;  3MD0 A;  5AVU B;  1URQ C;  2IZ1 A;  1S5L E;  1X1F A;  3IVF A;  1EDI A;  1NU1 J;  1SFC D;  1H10 A;  1NTK D;  4C7R A;  1JM0 A;  3Q5R A;  1UEF A;  2Z13 A;  1AFO A;  2PP6 A;  1NU1 G;  2ZVO B;  2HTH B;  5H2F H;  1J2J B;  3BCC D;  2KYV A;  2QE7 H;  2JWD A;  2P1J A;  2DHJ A;  3E1R A;  2IPP A;  2FFD C;  3RK3 E;  2A06 E;  4OGQ B;  1G2C A;  1QLE D;  5HE2 A;  2MFQ A;  2MWN B;  4CHM A;  1PPJ D;  2J58 A;  1LT9 B;  3LJU X;  2D9Y A;  3D8D A;  1WJ1 A;  5D27 A;  2BCC J;  4TKN A;  2D9Z A;  2KR0 A;  5JLJ B;  3HTK A;  3CCV P;  5APW A;  1RF0 A;  2NPS A;  1S9K E;  4WVZ A;  1MUU A;  5APQ A;  1VQK P;  2YO3 A;  2GM4 A;  1N73 B;  4OH8 B;  2BAS A;  1BCC G;  3RK2 B;  3A0B H;  3ZDT A;  2WPS A;  1OQN A;  2QM7 A;  1U5D A;  3G9W A;  1ISN A;  1DH3 A;  2GUM A;  3CCL P;  3B8E B;  2KUQ A;  5KLI C;  5FI1 A;  3AED C;  1H0T A;  1FZC B;  3TCA A;  3CWB J;  3F89 A;  4I7Z B;  4N78 E;  1E79 H;  4KHA A;  1GU5 A;  2RGN B;  2NBV A;  1KD1 Q;  1WRG A;  4UB6 E;  1JB0 J;  1WGU A;  1Y5O A;  2ROV A;  2RLO A;  3V6I A;  4A6K A;  1RRP B;  1RQU A;  1BE3 D;  2HG5 D;  2PZ1 A;  2HPC A;  4WY4 D;  1NTM D;  3VIA A;  3LIE A;  2HOD B;  2Y7B A;  2GA1 A;  1V88 A;  4HJG H;  5L81 A;  1ZR2 A;  2FYN B;  1Y9B A;  4GN1 A;  5C39 A;  1S4X A;  4EJN A;  1LB1 A;  1P5T A;  5CHX A;  3RL0 D;  3B71 A;  2VRW B;  3MZW B;  2IYO A;  2O01 H;  4KHO A;  1T2K D;  3CCQ P;  1NU1 D;  4W7Y A;  5J3Y A;  1RQV A;  5AW3 B;  5GTH E;  2NMB A;  1ZC3 B;  4HAU B;  1SQV E;  5CCG A;  1SQX E;  5I2M A;  2WSS H;  3AJ4 A;  4HYT B;  1I7A A;  5KAI H;  3CXH I;  5AVS B;  4DJG A;  2W6B A;  3B5N C;  3O8Z A;  3M0D A;  3V2N A;  3L37 A;  3U1C A;  1RF1 B;  1HF9 A;  1CI6 B;  1VF5 C;  3BJI A;  1PGP A;  3M1I B;  1GL2 D;  1MK9 B;  3AU5 A;  2QJP C;  4H0L D;  2BCC D;  2JO1 A;  1EDL A;  2IZ0 A;  3BIN A;  1SGH A;  2QJY C;  1M8O B;  2IFM A;  4RO0 A;  1SQB K;  5KLV E;  5C5B A;  1QVF O;  1USD A;  1LTJ A;  2A45 G;  2KLV A;  1H89 A;  1K05 A;  5CLQ B;  1BGY E;  1EZV D;  1SQP E;  1K9M Q;  2DKQ A;  2P7J A;  1UNR A;  5CMZ A;  1ZVR A;  2XQN M;  2KS1 B;  2R5D A;  2XDJ A;  3HD7 A;  4U3F G;  2PFX A;  3CWB D;  2YS1 A;  1VQM P;  2Z5H A;  3LW5 J;  2WSE H;  4UB8 E;  1P84 D;  1X11 A;  1IO4 A;  1U2B A;  2OAR A;  3SO6 A;  2R0D A;  1RHZ B;  3VMZ A;  5C16 A;  4ASW A;  1N7S D;  3G71 P;  2E76 B;  4DX9 0;  1P84 I;  2ZYD A;  2OYI C;  5E79 H;  3CCS P;  3H1H E;  1SLQ A;  1KYO D;  2P0H A;  2AEM A;  1VQO P;  3S1K A;  1SQV J;  2Y8G A;  2BCJ A;  5KCV A;  2IBZ G;  1SQX J;  1XTC C;  2V7Q J;  2NZ8 B;  2Z0P A;  2ZT9 D;  4PV1 C;  1AWE A;  3KY9 A;  2COF A;  3RK3 D;  1OX3 A;  4HSI A;  1SHC A;  1G2C B;  3NXS A;  5DIF B;  1HJB A;  1LW3 A;  3NFQ A;  1L0L E;  2D10 A;  2Y0C A;  1EC5 A;  1JEK A;  4GMV A;  1FZB A;  3NW8 A;  4I2L C;  2COA A;  4PD4 H;  2ZPY A;  4EIJ A;  1J19 A;  3HTK B;  4PJ0 E;  1S9K D;  2NPS B;  1MI1 A;  1DEE G;  1OVR A;  2EJ8 A;  5KLV J;  1SP4 A;  4PQ0 A;  1D7M A;  3V2R A;  3M9Q A;  2Z5I A;  1SFC C;  1URQ A;  3NWF A;  1LTT C;  2VRS A;  3PVU A;  5KLV G;  4H8S A;  5GTI H;  2O1K A;  1BGY J;  3GMA A;  1I2H A;  1OVU A;  2E75 B;  2FBW C;  3WMM 0;  2E74 B;  1T3U A;  2YS5 A;  4BXL A;  3BCC E;  1BGY G;  3NMD A;  5J3T A;  1JMM A;  2XND H;  1H0T B;  5B66 E;  5AW8 B;  1ZYI A;  2FFD A;  4JF7 A;  3D70 A;  4N78 D;  1NO4 A;  3FWN A;  1DD4 A;  1FOS E;  1GC7 A;  2WPQ A;  3KXD A;  2DHK A;  2LYD A;  2OQB A;  2ZAE B;  2JR8 A;  4MT7 A;  4EYY Q;  4MK0 A;  1NTZ G;  3D71 A;  2QA4 P;  1WG7 A;  2D2C B;  4ZRK A;  2DW3 A;  2J0J A;  2FYZ A;  2R09 A;  3A58 A;  2Q7C A;  1KZG A;  3FWL A;  3SUZ A;  1N73 A;  3CC2 P;  1UII A;  5BVZ A;  2L5G B;  2HPC B;  2OTX A;  3FM8 C;  4YL8 A;  3CL3 D;  3H1H J;  2B88 A;  3G9R A;  1NOH A;  1JMB A;  4XE5 B;  3H1H G;  1AV1 A;  1T77 A;  2FY8 A;  4DBB A;  2HYN A;  3D6Y A;  3Q2Y A;  1L4A D;  3TNU A;  3WUT A;  3AEA C;  2KP8 A;  1MPH A;  4GT1 A;  5D3Y A;  2IBZ D;  4AUW A;  3JSV C;  4CPG A;  1T3J A;  3V4W A;  1LWU C;  2E42 A;  1V5P A;  1GTW A;  2Z4D A;  2ZYA A;  1SQV D;  1SQX D;  2MKR A;  3P32 A;  3VYI A;  1FHX A;  4B86 A;  3MP7 B;  2D2Q A;  2OTJ P;  4KHB A;  1BE3 E;  4WY4 C;  1ZXG A;  4GOF A;  3E1I A;  2E5Y A;  2N9Y B;  2FYU G;  2Y0E A;  3WUV A;  3L73 E;  4YON A;  1DDV A;  3X23 A;  2FXO A;  1KMI Z;  3H1J J;  1YBK A;  4N6J A;  5D3X A;  3AEG C;  3RL0 C;  2YT1 A;  5KLV D;  1LJ2 A;  3AEB C;  3H1J G;  2Q13 A;  3V2Q A;  1T2K C;  4NY0 A;  2RNR B;  1IRS A;  1KB9 H;  5C5B B;  3A3Y B;  3CX5 H;  2FJU B;  3CME P;  3U8Z A;  4AQR D;  2Y0D A;  1NU1 E;  1BGY D;  4HAX B;  1OWA A;  1L2P A;  3AE6 C;  5D3V A;  1NYH A;  4P7I A;  3SWK A;  2YT0 A;  3TK1 A;  1RE4 C;  3P8M C;  1SS1 A;  2QJK B;  2J5U A;  3PVL A;  2AEJ A;  3A8P A;  4CHJ A;  1DD3 A;  3SFD C;  3ZDM A;  4ZNC A;  2X18 A;  1MV8 A;  3I55 P;  3B5N A;  3HD7 B;  3MTU E;  4DOJ A;  1GL2 C;  1N8R Q;  1VQ4 P;  4H0L C;  5APT A;  2DX1 A;  3N7C A;  1KIL D;  1YTZ I;  2DYN A;  2GUS A;  1MFZ A;  1OW8 A;  1EVH A;  1SQP K;  1MKM A;  2OTL P;  2WPR A;  4HB4 B;  1BCC E;  3UZT A;  2R3S A;  3HIE A;  3AE9 C;  1ZW0 A;  4HKZ H;  4Z2M B;  2AEH A;  3Q5S A;  3H1H D;  1KI1 B;  3QWM A;  1PZQ A;  2OYH A;  3E7K A;  1FOE A;  1TQZ A;  1ZV8 A;  3FVC A;  4A5K A;  5M4Y B;  4ZMD A;  2B87 A;  4IL6 H;  2WSE J;  3AE7 C;  1EDJ A;  2KIE A;  4XFJ A;  3O6Q A;  2KUP A;  1CZQ A;  2WSC H;  1V5U A;  1YHQ P;  2PGD A;  3L73 J;  5KAF E;  1OY2 A;  1M57 D;  1P84 E;  2WVR A;  4N3Y B;  2AXC A;  1NTV A;  2Y9Z A;  1UIX A;  3L73 G;  3PHL A;  3AE3 C;  1N7S C;  3L36 A;  2Q3E A;  3CCR P;  1N2D C;  4TT3 H;  3HUS C;  4Z1M H;  1LTB C;  1URQ B;  1UPR A;  1KYO E;  2SPZ A;  2OYI A;  2CPB A;  1L0L K;  2YF0 A;  4WSF A;  2JJL A;  2J59 M;  3V2P A;  4ZKU A;  2WIT A;  3H1J D;  2ZT9 C;  1EAZ A;  1NJI Q;  2WMM A;  1KTM A;  3B77 A;  2AXT E;  3RK3 C;  3MIW A;  4WWI A;  2ZYG A;  1BTK A;  2H7E A;  2K49 A;  3JCU E;  1S72 P;  2UWJ E;  5I2S A;  4D6T J;  3A0H E;  4ASV A;  3AE1 C;  3H6P A;  4XWX A;  2FFD B;  3MHV A;  3DXD A;  2P67 A;  1FHW A;  4H44 B;  2WSF H;  3H32 A;  4D6T G;  1FZG A;  4JPZ B;  2EMS A;  5AW1 B;  1AVO A;  1NTK K;  3KDP B;  1QGK B;  1RE3 A;  2YXR B;  3AE2 C;  4OWF A;  1FZF A;  3HE5 A;  1LTI C;  3CXB B;  1SQQ G;  1LT9 C;  1JTH A;  1FOS F;  1BCC J;  5JHG A;  4TYZ A;  4IFF A;  4D6W A;  3ODX A;  1OFC X;  3FGA D;  1T8Z A;  3KRW A;  1YYC A;  3Q5P A;  3FX0 A;  4A6H A;  1SFC A;  1SVF A;  2Z0O A;  1RJ2 A;  3MDB C;  1Q2N A;  3Q1M A;  4KT0 J;  4NPD A;  1FAO A;  5DHF B;  1HVV A;  2OQQ A;  1YJ9 P;  1OMI A;  3A8Q A;  4K17 A;  5HE3 A;  2PRR A;  1WGQ A;  1NKN A;  2IX7 C;  5KLI B;  3TNU B;  2O3J A;  2D9W A;  4GDO A;  1EF1 A;  1PL5 A;  1MKE A;  3P7K A;  3CCE P;  2YO2 A;  5IRS A;  2Q9I A;  1LP1 B;  3AU4 A;  4ZRJ A;  1KZU B;  1XKE A;  2NZ2 A;  1GW3 A;  4U3F E;  5C79 A;  1VQN P;  4LC1 A;  3B4S A;  4KHB B;  3IN6 A;  3D6Z A;  3WU2 E;  3VN0 A;  4EDF A;  2W83 C;  3L73 D;  2DX5 A;  1V5M A;  1Q81 Q;  1M7R A;  2QRX A;  3CPW O;  1M7L A;  2Q5U A;  1L4A C;  4M3L A;  1GK6 A;  1W5C E;  3KZI E;  3HK0 A;  3V4Q A;  1NVO A;  1U7J A;  2M0B A;  3VP8 A;  1PGQ A;  2IBZ E;  1OW7 A;  3CXH D;  1NTM K;  3R4Y A;  5B5E E;  2FJL A;  4W7Z A;  2ZKM X;  2DFK A;  5AW4 B;  5AVQ B;  1LWU A;  1FJK A;  4PNK A;  3PTZ A;  5AVZ B;  4Y99 C;  3M9B A;  4GIF A;  4D6T D;  1U5E A;  2HR3 A;  1U29 A;  4WY4 A;  3S9O A;  3B5N B;  2YSZ A;  3II6 A;  3H1K G;  1TXD A;  1CW5 A;  4F7U P;  1NU1 K;  2IDB A;  1WT6 A;  5AW2 B;  1VF5 B;  2RMZ A;  1M1J A;  2DTC A;  2H89 C;  2QJP B;  1BDD A;  4PD4 I;  4IFM A;  1FU1 A;  4ZRI A;  4HAW B;  1NAF A;  1BCC D;  3AEF C;  2E43 A;  2QJY B;  3OHM B;  1AVY A;  5H2F E;  5TJH A;  5AVV B;  1VPC A;  2G3A A;  2MKV A;  1V89 A;  1ZM0 A;  1KQF B;  2CY4 A;  3DXE A;  1QEX A;  1PP9 G;  1VQ6 P;  4H13 D;  3IF4 A;  1BSN A;  4KVG B;  2OYH B;  4K2O A;  4U3F J;  3PLN A;  3ULC A;  1RE4 A;  2B87 B;  4ZKP A;  3W68 A;  2IFN A;  3TGU G;  2N1T D;  5AW0 B;  2V4H A;  4L1R A;  4L6E A;  3O6Q B;  4K81 A;  1NTZ E;  2I1K A;  3L4F A;  3OAK A;  1KIL C;  1FDO A;  2JEE A;  2VSZ A;  3PP5 A;  1KIL E;  1GL2 A;  3GHG C;  1A02 J;  3H25 A;  3FEH A;  4HAY B;  2G35 A;  2XV5 A;  3C8V A;  3A0B E;  2H8P D;  4IFS A;  1TU3 F;  2Y9Y A;  5TIS H;  1FE6 A;  4GPT B;  2CPS A;  5KQ4 A;  1XCG A;  1AQ5 A;  1IZN B;  1PGJ A;  5CCH D;  1KQS O;  3BRT B;  2UZS A;  2OYI B;  1GD2 E;  1HH0 A;  1KQG B;  2WSC J;  2FXP A;  4IL6 X;  1AJY A;  1P3R A;  1IK7 A;  3BRV B;  2KIK A;  4C46 A;  2QM8 A;  3MUD A;  3VP9 A;  1ZR4 A;  4PV1 B;  1PMS A;  4HAV B;  4K2P A;  3VTP C;  1HTL C;  4MN4 C;  2O1J A;  4TLF A;  1NAY A;  3Q3D A;  3H32 B;  3TW1 A;  2UZR A;  3EWK A;  3FSS A;  1U5G A;  2M8R A;  4OGQ D;  3EFG A;  1J1D C;  2OTK E;  1JO5 A;  3HE5 B;  2W6A A;  3F0W A;  2KGX B;  2FYU E;  3KQG A;  1FGY A;  1JTH B;  1N7S A;  3SWF A;  1USE A;  1Q7Y Q;  3SYX A;  2D11 A;  5DJT B;  4HAZ B;  2COD A;  3HUS A;  3L72 G;  1SFC B;  3F5H A;  1NU2 A;  3H1J E;  1VQ8 P;  5HE0 A;  1Z56 A;  3CC7 P;  4QJ3 B;  4YXD C;  3AEC C;  2BEQ D;  2DYQ A;  5DI9 B;  1ZP0 C;  2XKM A;  3L70 G;  1HJ0 A;  3RK2 D;  2K00 A;  4QMA A;  2H7D A;  2W2X C;  1G1J A;  3U7D A;  1IFN A;  4HH2 A;  1KQL A;  1KB9 I;  1NTZ J;  3OJA B;  3CX5 I;  1EQ7 A;  1IFD A;  5KAI E;  2IFS A;  2LUL A;  2WTY A;  1GU4 A;  4C0A A;  4Z2N A;  2DKP A;  4U3F D;  3MPX A;  4HB2 B;  3N7N A;  3RBZ A;  2AEF A;  5DJU B;  2I5F A;  3DCX A;  2AL6 A;  4MY6 A;  4DIX A;  2QG4 A;  2HFE D;  3BVH A;  5KKZ C;  4I1L A;  4B6H A;  1HGV A;  4KAX B;  1FHO A;  2FXM A;  5APV A;  2KSJ A;  2C0X A;  4Y28 J;  2KZJ A;  5BU8 B;  1KFN A;  3G3Z A;  2JKV A;  5CJ0 A;  5CBN A;  1A02 F;  3L74 G;  3V5B A;  3SV1 A;  2K3R A;  4A6F A;  1FAV A;  1J1E C;  5KJ7 D;  1DIP A;  1LP1 A;  3P8C D;  3PG7 A;  1L0N G;  1S5L H;  4EOT A;  4L75 A;  1GC6 A;  1LWU B;  4R4M A;  1JUN A;  2FYU J;  1JY3 N;  2DA0 A;  1BAK A;  2CY5 A;  2YNY A;  3TDK A;  2Q3I A;  2OGU A;  4NPF X;  4WY4 B;  3DXC A;  4HB3 B;  1ZME C;  2L2I A;  2N23 A;  3RGU A;  1X9V A;  1VQ9 P;  1J0W A;  1X05 A;  1S2E A;  2O01 J;  1M1J B;  1SQV K;  2RN0 A;  4JQ0 D;  2R3C A;  5E79 E;  3ITK A;  1SQX K;  2RRF A;  1L4A A;  3KZ1 A;  1XR0 B;  4GKG A;  3U1A A;  1PGO A;  3RL0 B;  1IFJ A;  2GCL A;  1R5L A;  4GOD A;  4OSN A;  2K1A A;  2YKQ A;  3CXH E;  3OAN A;  2LOZ A;  3PSC A;  1KFM A;  1NWQ A;  2RKL A;  3CD6 P;  2D9X A;  2M5A A;  3D8F A;  1VL2 A;  1DDW A;  4HAT B;  2KZI A;  1H88 A;  1LTJ C;  2ZXX A;  2CAY A;  4L74 A;  4YTP C;  3L75 J;  3M0A A;  3M06 A;  2COC A;  3A7O A;  2Z4E A;  4D6T E;  2WQY C;  2P2U A;  4PD4 E;  3WUU A;  5KLV K;  3G4S P;  1NTZ D;  3L75 G;  3RL0 g;  5BU5 A;  2ADZ A;  2P8V A;  3PEG A;  1PPJ G;  1SQQ E;  2LG1 A;  1IFI A;  1Y47 A;  1GL2 B;  4L73 A;  3S4R A;  4H0L B;  1R8E A;  3KYQ A;  4UB6 H;  1GMJ A;  3GF7 A;  1Q90 D;  5GTI E;  5FI0 A;  4DZO A;  4QJ4 B;  1JY2 N;  4YXW H;  2M38 A;  2K9J A;  1VDF A;  2QIW A;  1XTG B;  2W27 A;  4H13 C;  1WI1 A;  1JY3 O;  2KK7 A;  1V61 A;  3IFM A;  4DT0 A;  4C7N A;  2IYP A;  3ODO A;  3LW5 H;  3H1I J;  2YIU C;  4KJM A;  2M3B A;  2E76 D;  3SSU A;  2MJZ A;  2N1T C;  4GOU A;  3H1I G;  1BDC A;  1MIX A;  3O96 A;  4RKU J;  1QL1 A;  1OW6 A;  1EDK A;  2P0D A;  3K5B A;  3CCJ P;  1Y8A A;  1KV4 A;  1KIL A;  2GCJ A;  4BRY A;  5K5G B;  3GHG A;  1HBW A;  2ZVN B;  3NTN A;  1NGM B;  2I8D A;  5APU A;  5GTH H;  2FYU D;  2N0Y A;  3L71 J;  1X0T A;  1N7S B;  1P6S A;  5CCH C;  2JWA A;  3L71 G;  1WJM A;  1CSB A;  1XOD A;  3BAS A;  3QBV B;  4K3A A;  1NTM G;  3HUS B;  2UVM A;  2JDI H;  1AA0 A;  1K04 A;  1Y19 B;  2NPS D;  3H1L J;  3FXD A;  2DN6 A;  3WYF B;  1ZSQ A;  4GOE A;  4RJT A;  3TO1 A;  3KHU A;  2ZT9 B;  2H7H A;  2ZFC A;  1DRO A;  3H1L G;  2FYU K;  3RK3 B;  3KSY A;  5L8R J;  1NHL A;  1MZ9 A;  1WMK A;  3VMA A;  2W2X D;  1G1I A;  2E75 D;  5AVY B;  2E74 D;  4D0N B;  1JY2 O;  3ABV C;  3T97 A;  1SQQ J;  4HB0 B;  4OGQ C;  2L91 A;  3G6E P;  1IJD B;  1IK9 A;  4QXA B;  4I6M C;  1SQB J;  3CI9 A;  4H44 C;  3L75 D;  5LG4 B;  3H1K E;  4Y94 A;  2QVA A;  1SQB G;  1KOR A;  5APX A;  3KPE A;  5LON B;  3C1L A;  3HE4 A;  2KOG A;  2D2C D;  5KQ1 A;  3TF5 A;  3TYY A;  3IAO A;  2W90 A;  1KB9 E;  3CX5 E;  2BCC G;  4BWN A;  1N73 C;  1OMW A;  3RK2 C;  3HRN A;  1K5D B;  4UB8 H;  5AVT B;  1K73 Q;  3TSI A;  2C9N Y;  2Q1K A;  1PP9 E;  2KUB A;  2WT7 A;  1E5W A;  3SWY A;  1YI2 P;  5CLL B;  2V76 A;  2Z14 A;  1EGX A;  3EQ2 A;  4O9B A;  2R2Y A;  4A6F B;  1ZRT E;  1FZC C;  2GJY A;  3ODW A;  3GF3 A;  1Q67 A;  3F5R A;  3TGU E;  1EZV G;  2LXB A;  3H1I D;  4I7Z C;  1MFT A;  5AVX B;  5EFX A;  1YIT P;  2K9Y A;  4F7G A;  1MIZ B;  3HW2 B;  2KCJ A;  1YQ4 C;  2ITA A;  3QH9 A;  3CWB G;  2JP2 A;  1VQL P;  1BSH A;  5JP4 A;  2WWW A;  1MAI A;  5CCG D;  1EXJ A;  5APS A;  2OYO A;  4BBK A;  5EFW B;  4YPC A;  3LID A;  1FZE A;  2YXQ B;  1R5S A;  1U7M A;  3PZD A;  3P7Z A;  3L71 D;  3VOQ A;  1L4A B;  3PJS K;  4PJ0 H;  4WJ7 A;  3JC2 2;  4AYC A;  4OT1 A;  2K88 A;  4IL6 E;  5KJ7 C;  4W80 A;  2FYN C;  2W8Z A;  1H4R A;  1S5L X;  1S3J A;  3PP2 A;  3P8C E;  3NWA A;  2RH0 A;  3ZVR A;  3H1L D;  2ZXE B;  2M5A B;  4XA4 A;  2FKW B;  3H1K J;  1K8A Q;  2R44 A;  2KB7 P;  2H43 A;  2P10 A;  2A06 G;  5AW9 B;  4PD4 D;  1LNQ A;  4Y99 B;  1FJP A;  2YKO A;  1ZN5 A;  2I1J A;  5B66 H;  4GNK B;  1SQQ D;  5JHH A;  3VMY A;  5LOP B;  1RH5 B;  3UIA A;  1SQB D;  2JP3 A;  3GW6 A;  1RF1 C;  3HD7 D;  1IFP A;  1YTZ T;  2QKL A;  3QIJ A;  3FXE A;  3BAT A;  4LLH A;  1PP9 J;  3L72 E;  3TFM A;  2K9J B;  1U5F A;  4JYC A;  1LTS C;  1YJW P;  1M56 D;  3M9H A;  1M7E A;  1DX7 A;  2QSI A;  4F7H A;  4EMO A;  3L70 E;  1N3H A;  1SQQ K;  2I5C A;  3TGU J;  3AE4 C;  4C7N B;  1W1H A;  1PFJ A;  2Y8F A;  4DXA B;  1XD4 A;  5APY A;  3NSU A;  3EFF K;  4GMX B;  2H88 C;  2OYH C;  3VOP A;  2YT2 A;  3PH0 A;  2NRG A;  1X22 A;  3L35 A;  2QKM A;  1Z87 A;  2YVC A;  1KIL B;  1ZOY C;  4BRY B;  1LGH B;  3GHG B;  4JYB A;  2L1C A;  4HHV A;  1JNM A;  1FB8 A;  1EZV I;  1W1G A;  2W2W A;  2KNC A;  4EI2 A; 
#chains in the Genus database with same CATH homology
 2J0M A;  2ELA A;  5BU8 B;  4A5K A;  1KFN A;  3G3Z A;  1WGU A;  5CJ0 A;  1Y5O A;  2ROV A;  1DEB A;  2RLO A;  1X79 B;  1A02 F;  1NI2 A;  3A2A A;  1QC6 A;  4A6K A;  2HLO A;  3V5B A;  3SV1 A;  1RRP B;  3I5C A;  2KUP A;  4A6F A;  2C9L Y;  1FAV A;  1J1E C;  1CZQ A;  5KJ7 D;  2WSC H;  2HG5 D;  2RVB B;  1V5U A;  3P8C D;  2PZ1 A;  1ZC4 B;  3PG7 A;  2HPC A;  4WB4 A;  4WY4 D;  4EOT A;  1GC6 A;  1GK4 A;  1LWU B;  3LIE A;  3VIA A;  1OY2 A;  1IFM A;  1URQ D;  2HOD B;  2N1T A;  1JUN A;  1UNQ A;  4N3Y B;  2Y7B A;  1JY3 N;  1NTV A;  1V88 A;  4LGD E;  2YRY A;  2DA0 A;  1N7S C;  5L81 A;  1BAK A;  1ZR2 A;  2P0F A;  2CY5 A;  2YNY A;  3L36 A;  3A98 B;  2Q3I A;  4GN1 A;  5D3W A;  4WY4 B;  4EJN A;  4EKU A;  1LB1 A;  1NH4 A;  1N2D C;  1P5T A;  3DXC A;  4HB3 B;  3HUS C;  2L2I A;  5CHX A;  2N23 A;  3RL0 D;  2IYB A;  1X9V A;  2VRW B;  1LTB C;  1URQ B;  1GZL A;  1UPR A;  1J0W A;  2O01 H;  4KHO A;  3PVW A;  1T2K D;  1X05 A;  2OYI A;  2CPB A;  1M1J B;  1L0L K;  1SQV K;  4W7Y A;  2YF0 A;  2JJL A;  2R3C A;  2J59 M;  5KTB A;  4WSF A;  3V2P A;  1J1D B;  1SQX K;  4ZKU A;  5J3Y A;  1W2E A;  2WIT A;  2YKP A;  1GG3 A;  1EAZ A;  5AW3 B;  2NMB A;  1ZC3 B;  1L4A A;  3RK3 C;  3MIW A;  4HAU B;  2LKO A;  1BTK A;  2H7E A;  3KZ1 A;  5CCG A;  1XR0 B;  4IOY X;  4GKG A;  3U1A A;  5CCH A;  1RE3 C;  3RL0 B;  2DLW A;  4WVF B;  1IFJ A;  2GCL A;  3HE4 B;  1DBH A;  3U59 A;  3AJ4 A;  1RF0 C;  2NPS C;  4HYT B;  3H6P A;  1I7A A;  4XWX A;  2YKQ A;  5AVS B;  1H8A A;  2W6B A;  2FFD B;  3B5N C;  3DXD A;  3OAN A;  2P67 A;  3M0D A;  3O8Z A;  3V2N A;  1FHW A;  3L37 A;  3N4X A;  2CRF A;  2WSF H;  2LOZ A;  3PSC A;  4CYE A;  3H32 A;  1KFM A;  1NWQ A;  3U1C A;  1FZG A;  2D9X A;  1RF1 B;  3D8F A;  1JY3 P;  5AW1 B;  1DDW A;  2EMS A;  4HAT B;  3OA7 A;  1CI6 B;  1H88 A;  1FBM A;  1KZ7 A;  3BJI A;  1LTJ C;  2CAY A;  1NTK K;  5AW7 B;  3KDP B;  3M1I B;  1GL2 D;  1MK9 B;  3AU5 A;  5AVW B;  1RE3 A;  3V5W A;  3M0A A;  1FZF A;  3HE5 A;  3M06 A;  2COC A;  3A7O A;  1LTI C;  2Z4E A;  3CXB B;  2WT7 B;  3BIN A;  1LT9 C;  2P2U A;  1SGH A;  1JTH A;  5KLV K;  1FOS F;  3RCP A;  5JHG A;  4TYZ A;  4IFF A;  2IFM A;  5BU5 A;  3ODX A;  2ADZ A;  1T8Z A;  3VMX A;  2P8V A;  2VKI A;  3KRW A;  3PEG A;  1QL2 A;  1SQB K;  1YYC A;  2J0K A;  5C5B A;  2LG1 A;  1LTJ A;  1IFI A;  4A6H A;  1PLS A;  1SFC A;  1GL2 B;  1SVF A;  2A45 G;  2Z0O A;  1RJ2 A;  2KLV A;  3R2P A;  3KYQ A;  1H89 A;  3MDB C;  4GXB A;  1LT9 A;  2E2X A;  3WA0 A;  3M91 A;  5CLQ B;  5FI0 A;  1DDM A;  4DZO A;  1FAO A;  5DHF B;  1HVV A;  1JY2 N;  2M38 A;  3A8Q A;  2DKQ A;  2A45 I;  2P7J A;  1VDF A;  1UNR A;  1X1G A;  4K17 A;  5HE3 A;  1WGQ A;  1NKN A;  2IX7 C;  5CMZ A;  1ZVR A;  1XTG B;  2XQN M;  3TNU B;  2W27 A;  2R5D A;  2XDJ A;  1WI1 A;  1JY3 O;  5CJ4 A;  1EF1 A;  2D9W A;  3HD7 A;  1V61 A;  3IFM A;  1NTY A;  1MKE A;  2YS1 A;  2HE7 A;  3P7K A;  4C7N A;  2YO2 A;  5HE1 A;  2Q9I A;  3ODO A;  1IC2 A;  3LW5 H;  4Z2N A;  2Z5H A;  3AU4 A;  4ZRJ A;  2M3B A;  2WSE H;  1KZU B;  1XKE A;  2MJZ A;  1GW3 A;  2N1T C;  3MGN A;  2XNX A;  2ROZ B;  3D8E A;  5C79 A;  1X11 A;  3O96 A;  1MIX A;  2EC1 A;  5AW6 B;  4LC1 A;  1IO4 A;  2EMT A;  1U2B A;  1QL1 A;  2OAR A;  1LTG C;  3SO6 A;  2R0D A;  4KHB B;  3VMZ A;  5C16 A;  2P0D A;  2RUK B;  1FZC A;  1J1E B;  1N7S D;  1KIL A;  2GCJ A;  3VN0 A;  4DX9 0;  3GHG A;  1W1D A;  1JY2 P;  1HBW A;  2DX5 A;  5DHA B;  1V5M A;  2OYI C;  4HDO A;  3NTN A;  1SLQ A;  4GZU A;  1M7R A;  1GW4 A;  1GDT A;  2P0H A;  4NSW A;  5APU A;  1M7L A;  2N0Y A;  2Q5U A;  2Y8G A;  1ZLL A;  2BCJ A;  5KCV A;  1L4A C;  4M3L A;  1GK6 A;  3T06 A;  1XTC C;  2NZ8 B;  1N7S B;  5CCG C;  1P6S A;  2Z0P A;  3HK0 A;  3V4Q A;  5CCH C;  1AWE A;  3KY9 A;  2COF A;  3RK3 D;  1WJM A;  1CSB A;  1XOD A;  3BAS A;  3QBV B;  3HUS B;  3VP8 A;  2UVM A;  3M0D C;  1G2C B;  1SHC A;  3NXS A;  5DIF B;  1NTM K;  1Y19 B;  1HJB A;  2NPS D;  1LW3 A;  3NFQ A;  1B55 A;  3B5N D;  5AVR B;  2DN6 A;  1FDM A;  4W7Z A;  2FJL A;  3WYF B;  1WVH A;  1ZSQ A;  2DFK A;  5AW4 B;  2WZ7 A;  2D10 A;  5AVQ B;  3KRX A;  1LWU A;  3TO1 A;  2LKM A;  1NKZ B;  1HUC A;  2H7H A;  1FJK A;  2HOD A;  4GMV A;  2ZFC A;  2K2U A;  1FZB A;  3TVV A;  4PNK A;  5AVZ B;  1TJ6 A;  1UNP A;  4I2L C;  1DRO A;  2D4Q A;  2COA A;  2FYU K;  3RK3 B;  3KSY A;  1M1J C;  1NHL A;  4Y99 C;  2ELB A;  2ZPY A;  3M9B A;  1MZ9 A;  4EIJ A;  2GUV A;  2W2X D;  4GIF A;  4IAP A;  1J19 A;  3HTK B;  5KJ7 A;  1G1I A;  1U5E A;  1FZA A;  2R32 A;  4IFD K;  5AVY B;  2NPS B;  1S9K D;  2R5B A;  1JY2 O;  1U29 A;  4D0N B;  4WY4 A;  4HDQ A;  5J3Q A;  3B5N B;  3T97 A;  3A5T A;  3II6 A;  2EJ8 A;  1SP4 A;  2GS0 A;  1TXD A;  2YSZ A;  4PQ0 A;  1HWT C;  3V2R A;  4HB0 B;  4KHX A;  3M9Q A;  1CW5 A;  4F7U P;  2Z5I A;  1IJD B;  1IK9 A;  1NU1 K;  1SFC C;  4I6M C;  1URQ A;  2MDX A;  1LTT C;  2VRS A;  1WT6 A;  5AW2 B;  3PVU A;  3CI9 A;  4H8S A;  1M1J A;  1LTJ B;  2O1K A;  2DTC A;  2C0W A;  2Z0Q A;  4Y94 A;  2XZR A;  1I2H A;  3HQC A;  4IFM A;  1FU1 A;  2A45 H;  2LOX A;  1NAF A;  3WMM 0;  4HAW B;  4ZRI A;  5APX A;  3KPE A;  3CLQ A;  1T3U A;  2YS5 A;  2E43 A;  4RES B;  3NMD A;  5LON B;  5J3T A;  1JMM A;  1AQC A;  3HE4 A;  2KOG A;  4WBA A;  5AVV B;  1VPC A;  1V89 A;  5KQ1 A;  5AW8 B;  1ZM0 A;  1JOC A;  1N7L A;  3TYY A;  2FFD A;  1K5G B;  3HD7 C;  4JF7 A;  2CY4 A;  3DXE A;  4N78 D;  1NO4 A;  1MK7 B;  1FOS E;  1RF1 A;  1GC7 A;  4KVG B;  2WPQ A;  2DHK A;  2OYH B;  2LYD A;  1N73 C;  2OQB A;  1OMW A;  3ML4 A;  1CI6 A;  2YMY A;  3RK2 C;  4K2O A;  3HRN A;  4MT7 A;  4MK0 A;  1BTN A;  1K5D B;  5AVT B;  2C9N Y;  3TSI A;  2XU6 A;  3ULC A;  1LTA C;  1RE4 A;  1WG7 A;  1PFI A;  2M14 A;  1NTZ K;  4ZKP A;  2WT7 A;  1E5W A;  3SWY A;  2IFN A;  5CLL B;  4ZRK A;  3GYP A;  2V76 A;  2J0J A;  2FYZ A;  2N1T D;  5AW0 B;  3GYO A;  4DX8 A;  1JCC A;  1EGX A;  4L6E A;  3EQ2 A;  4O9B A;  2R09 A;  2YS3 A;  4K81 A;  4A6F B;  2Q7C A;  1KZG A;  2I1K A;  3IR9 A;  1FZC C;  3L4F A;  2GJY A;  3OAK A;  1KIL C;  1N73 A;  3ODW A;  3SUZ A;  1DYN A;  1N86 A;  2JEE A;  2VSZ A;  1Q67 A;  3PP5 A;  2DHI A;  3F5R A;  2L5G B;  5BVZ A;  2HPC B;  2OTX A;  1GL2 A;  3GHG C;  1A02 J;  3CL3 D;  5AVX B;  3FM8 C;  3FEH A;  4HAY B;  4YL8 A;  5EFX A;  4F7G A;  2G35 A;  3CIK A;  1JCD A;  2XV5 A;  2N1T B;  1NOH A;  2H8P D;  2POH A;  1X8Y A;  4IFS A;  1MIZ B;  1UPQ A;  3HW2 B;  4XE5 B;  2KCJ A;  2D9V A;  3C9I A;  2RSG A;  4DBB A;  4GPT B;  2HYN A;  2K2J A;  2JP2 A;  2CPS A;  5KQ4 A;  1OXZ A;  5JP4 A;  1XCG A;  2N9B A;  1HGZ A;  1L4A D;  2WWW A;  3TNU A;  1AQ5 A;  5AW5 B;  1MAI A;  5CCG D;  2KP8 A;  5CCH D;  5APS A;  3BRT B;  1MPH A;  4GT1 A;  1X86 A;  2UZS A;  1BWN A;  4BBK A;  3P6A A;  5D3Y A;  4AUW A;  2OYI B;  1GD2 E;  1HH0 A;  5C6R A;  3LID A;  3SNH A;  3ULB A;  2PAJ A;  1FZE A;  1T3J A;  1LWU C;  3V4W A;  2E42 A;  1V5P A;  1GTW A;  1P3R A;  1FGZ A;  3P7Z A;  3PZD A;  3VOQ A;  3BRV B;  4C46 A;  1QQG A;  1L0N K;  1L4A B;  2QM8 A;  3MUD A;  2MKR A;  3P32 A;  3VP9 A;  4WJ7 A;  5GOW B;  3VYI A;  1ZR4 A;  4AYC A;  5KJ7 C;  1FHX A;  1PMS A;  4B86 A;  4HAV B;  1XX0 A;  4W80 A;  4K2P A;  3VTP C;  2D2Q A;  1HTL C;  1H4R A;  1RY3 A;  4WY4 C;  3PP2 A;  3P8C E;  1U27 A;  2O1J A;  5DH9 B;  3E1I A;  1WRG A;  3H32 B;  3TW1 A;  3ZVR A;  3MD0 A;  2ZXE B;  2UZR A;  5AVU B;  1URQ C;  4XA4 A;  2FKW B;  3FSS A;  1X1F A;  1U5G A;  2M8R A;  3IVF A;  3EFG A;  4YON A;  1DDV A;  3X23 A;  1SFC D;  1J1D C;  1H10 A;  2KB7 P;  1JO5 A;  3HE5 B;  2W6A A;  2H43 A;  4C7R A;  3F0W A;  5AW9 B;  2KGX B;  4Y99 B;  1UEF A;  3KQG A;  1FJP A;  1FGY A;  1JTH B;  4N6J A;  1N7S A;  2PP6 A;  2YKO A;  3SWF A;  1AFO A;  2HTH B;  5D3X A;  1J2J B;  1ZN5 A;  2I1J A;  3RL0 C;  2YT1 A;  2KYV A;  3SYX A;  2D11 A;  2Q13 A;  2P1J A;  3V2Q A;  2DHJ A;  4HAZ B;  2IPP A;  1T2K C;  2COD A;  4NY0 A;  3HUS A;  2FFD C;  3VMY A;  2RNR B;  1IRS A;  5C5B B;  5JHH A;  3A3Y B;  5LOP B;  1G2C A;  3U8Z A;  3UIA A;  4AQR D;  1SFC B;  5HE2 A;  1NU2 A;  1RF1 C;  2MFQ A;  3HD7 D;  2MWN B;  4HAX B;  1OWA A;  4CHM A;  2J58 A;  5HE0 A;  1LT9 B;  1Z56 A;  3LJU X;  5D3V A;  4P7I A;  2QKL A;  1YTZ T;  3QIJ A;  5DI9 B;  2DYQ A;  3BAT A;  2D9Y A;  2XKM A;  4LLH A;  1WJ1 A;  2YT0 A;  3D8D A;  3TK1 A;  1U5F A;  1RE4 C;  3P8M C;  4JYC A;  5D27 A;  1LTS C;  3RK2 D;  4TKN A;  2K00 A;  2D9Z A;  2H7D A;  3M9H A;  3PVL A;  1M7E A;  2W2X C;  1G1J A;  1DX7 A;  5JLJ B;  3HTK A;  3A8P A;  3U7D A;  4CHJ A;  1IFN A;  4HH2 A;  2X18 A;  1KQL A;  3OJA B;  5APW A;  1MV8 A;  1RF0 A;  2NPS A;  3B5N A;  4F7H A;  3HD7 B;  1N3H A;  1S9K E;  4EMO A;  1EQ7 A;  1IFD A;  1SQQ K;  3MTU E;  2I5C A;  1MUU A;  5APQ A;  4C7N B;  1FHO A;  2IFS A;  2LUL A;  1W1H A;  2YO3 A;  2WTY A;  4DOJ A;  1GL2 C;  1PFJ A;  2Y8F A;  2GM4 A;  1GU4 A;  4C0A A;  5APT A;  4DXA B;  1XD4 A;  1N73 B;  1KIL D;  4OH8 B;  2DKP A;  1YTZ I;  5APY A;  2BAS A;  2DYN A;  2DX1 A;  3N7C A;  3RK2 B;  3NSU A;  3ZDT A;  2GUS A;  1MFZ A;  2WPS A;  1EVH A;  3MPX A;  1SQP K;  1OQN A;  4HB2 B;  2QM7 A;  3N7N A;  1U5D A;  4GMX B;  2I5F A;  2OYH C;  3G9W A;  2AL6 A;  3VOP A;  4MY6 A;  1ISN A;  1DH3 A;  2WPR A;  4HB4 B;  3B8E B;  5FI1 A;  3L35 A;  2QKM A;  3UZT A;  1FZC B;  1Z87 A;  2YVC A;  3TCA A;  2HFE D;  1KIL B;  3BVH A;  4I1L A;  3TFM A;  1LGH B;  4B6H A;  1HGV A;  3GHG B;  2AEH A;  4Z2M B;  1KI1 B;  4JYB A;  3QWM A;  2L1C A;  4HHV A;  4N78 E;  1JNM A;  4KAX B;  2FXM A;  2OYH A;  1FB8 A;  1W1G A;  1GU5 A;  5APV A;  1FOE A;  2W2W A;  4KHA A;  1TQZ A;  1ZV8 A;  2RGN B;  2KSJ A;  2C0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...