3GYOA

Se-met rtt106p
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
225
Chain Sequence
MDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 225
sequence length 241
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gyoA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gyoA01
1UNPA 5HE0A 3AJ4A 1U5FA 1J0WA 2W2XC 2E2XA 3D8FA 3TVVA 1W1HA 2UVMA 2COCA 2D9YA 5KCVA 3GYOA 2KGXB 4YL8A 2RNRB 2I1JA 3U8ZA 5JP4A 1MAIA 2YVCA 4MK0A 2R09A 1U27A 4KHOA 4PNKA 1U29A 4D0NB 3TCAA 1UNQA 3HQCA 2W2XD 1LB1A 1X1GA 3A98B 4HDQA 4DBBA 1X86A 2DTCA 2QKLA 3ULBA 5LOPB 2J59M 2D4QA 1W1DA 3TW1A 2QKMA 4DXAB 4K2OA 2LOXA 2NZ8B 4KVGB 2Y8GA 1OY2A 3PEGA 1BTKA 4K81A 2FJLA 3ODWA 1V5MA 2H7EA 3D8DA 1U5DA 4GPTB 1KZ7A 4DX90 4WSFA 5HE1A 1K5DB 2DA0A 3TO1A 2YS1A 2VKIA 2HE7A 4ZRKA 2CY5A 2CODA 3HK0A 1V5PA 3QWMA 4MY6A 5KQ1A 2D9ZA 2DYNA 1KZGA 2OQBA 1WG7A 4HAWB 4IOYX 2D10A 2D2QA 2DKPA 1LW3A 2DHKA 4CHJA 3ZDTA 4MT7A 4GMVA 1FGZA 4ZRJA 5JHGA 1ZM0A 3KSYA 1PFJA 4TYZA 2P0DA 2Z0QA 5D27A 4Y94A 3UZTA 1FB8A 1EAZA 1MPHA 3ULCA 2YS3A 2Z0PA 4CYEA 3U7DA 3T06A 3ML4A 1Q67A 5J3QA 1MIZB 2VSZA 1V88A 1KI1B 2IYBA 2YT1A 2P0FA 5GOWB 3ODOA 1K5GB 1X1FA 1FHOA 3DXEA 1XR0B 2XQNM 1RRPB 1XX0A 1NTYA 4HAXB 3WA0A 3QBVB 2AL6A 4NSWA 2I1KA 2DN6A 3KRWA 2D9WA 5DH9B 1DDWA 4HAUB 2LKOA 3WYFB 1V5UA 2EMSA 2H7DA 2RLOA 2GJYA 2JP2A 2UZRA 1V89A 3SUZA 3D8EA 4HHVA 2K2UA 3LJUX 4A6FA 1DDMA 4EJNA 3BJIA 1I2HA 3SV1A 4C0AA 4HB0B 5C5BA 5DIFB 2LYDA 3M1IB 2DFKA 4GXBA 1ISNA 2CRFA 3KY9A 3FSSA 3MDBC 2V76A 2J0KA 3PG7A 4NY0A 1NI2A 5HE2A 3DXCA 4K2PA 4WVFB 1ZVRA 2GS0A 1MK7B 2IFSA 1OQNA 2K2JA 2N23A 2I5FA 2DYQA 1PLSA 1GC7A 4HAYB 4KHBB 4PQ0A 2I5CA 5J3YA 2GCJA 1SGHA 1U5GA 4A6KA 5LONB 1BAKA 2COFA 2K00A 3BINA 2CY4A 1ZC3B 3SO6A 4EKUA 1P3RA 2KUPA 1Y19B 4WJ7A 2NMBA 4F7GA 4B6HA 5EFXA 3VOQA 2ELAA 2DHJA 4A6HA 1I7AA 2D9VA 2YRYA 1X11A 1FHWA 5DI9B 4EMOA 3VIAA 1WGUA 2PZ1A 3ODXA 1PMSA 3MPXA 4A6FB 3AU5A 2DHIA 3SYXA 3CIKA 4HDOA 1NTVA 5C16A 4HB4B 4K17A 2DLWA 2ADZA 1GG3A 5C5BB 2X18A 2P0HA 1QC6A 2W2WA 3F0WA 4HATB 4GZUA 5DHAB 4YONA 1MKEA 5CLQB 5JLJB 2L2IA 3P6AA 4Z2NA 2MKRA 5D3YA 1U5EA 2Y7BA 4CHMA 3FM8C 3KZ1A 1P6SA 1RJ2A 2ROZB 3N7CA 4GMXB 1TQZA 2YT0A 1MIXA 5KQ4A 2D11A 1UPQA 3PVWA 3SNHA 2RUKB 3X23A 2Y8FA 2MFQA 3PVUA 4P7IA 2D9XA 2RGNB 2YF0A 4HAVB 3AU4A 2LG1A 1FHXA 2GCLA 1Z87A 3G9WA 1WJMA 5C6RA 2DX1A 2YSZA 2KCJA 2EJ8A 5D3XA 2UZSA 4A5KA 1TXDA 4IAPA 4HB2B 3V5WA 3IVFA 5D3WA 1OMWA 3A8PA 3DXDA 1DYNA 5FI1A 5L81A 1U2BA 3RCPA 1E5WA 3A8QA 5HE3A 2Z0OA 1DROA 2COAA 2ROVA 3F5RA 2LULA 4IFSA 3FEHA 4XWXA 4TKNA 2VRWB 1B55A 1IRSA 1BTNA 2EC1A 2Q13A 1QQGA 1FGYA 1ZC4B 1H10A 1DBHA 2DKQA 1M7RA 1V61A 2CAYA 1GC6A 1J19A 2RSGA 3QIJA 1AQCA 3ZVRA 5JHHA 4DX8A 2EMTA 1M7EA 1XCGA 1NU2A 2ELBA 4Z2MB 1WJ1A 1BWNA 1SHCA 1UNRA 2BCJA 2L1CA 3PVLA 2HTHB 1Y5OA 4KAXB 1ZSQA 5D3VA 4BBKA 1MK9B 1UEFA 2YS5A 3CXBB 4L6EA 1EVHA 2MDXA 5FI0A 4HB3B 5J3TA 1WGQA 1WVHA 1FAOA 1XODA 4GN1A 1UPRA 3PSCA 1P5TA 1WI1A 2DX5A 1FOEA 1W1GA 2MWNB 3GYPA 1EF1A 3PP2A 2AEHA 2N0YA 2J0JA 3TFMA 1TJ6A 1N3HA 5DHFB 2G35A 4KHAA 3NSUA 2P8VA 3HW2B 5C79A 1XKEA 3PZDA 4ZRIA 1EGXA 1XD4A 3O96A 1AWEA 2R0DA 2ZPYA 4F7UP 3OANA 2OTXA 2LOZA 1DDVA 2J0MA 2RVBB 5CLLB 1X05A 3P7ZA 1H4RA 2M14A 4F7HA 3KRXA 2M38A 4HAZB 4H8SA
chains in the Genus database with same CATH superfamily
1UNPA 5M4YB 5HE0A 3AJ4A 1U5FA 5IRSA 1J0WA 2W2XC 2E2XA 3D8FA 3TVVA 1W1HA 4QJ3B 2UVMA 2COCA 2D9YA 5KCVA 3GYOA 2KGXB 4YL8A 2RNRB 2I1JA 3U8ZA 5JP4A 1MAIA 2YVCA 1ZYIA 4MK0A 2R09A 1U27A 4KHOA 4PNKA 1U29A 4D0NB 3TCAA 1UNQA 3HQCA 4CSQA 2W2XD 1LB1A 1X1GA 3A98B 4HDQA 2Z13A 4DBBA 1X86A 2DTCA 2QKLA 3ULBA 5LOPB 2J59M 2D4QA 1W1DA 3TW1A 2QKMA 4DXAB 4K2OA 2LOXA 2NZ8B 4KVGB 2Y8GA 1OY2A 3B77A 3PEGA 1T77A 1BTKA 2KR0A 5LG4B 4K81A 2FJLA 3ODWA 1V5MA 2H7EA 3D8DA 1U5DA 4GPTB 1KZ7A 4DX90 4WSFA 5HE1A 1K5DB 3U12A 2DA0A 3TO1A 2YS1A 2VKIA 2HE7A 4ZRKA 2CY5A 2CODA 3HK0A 1V5PA 3QWMA 4MY6A 5KQ1A 2D9ZA 2DYNA 1KZGA 2KIGA 1WG7A 2OQBA 2KUQA 4HAWB 4IOYX 2D10A 2D2QA 2DKPA 1LW3A 2DHKA 4CHJA 3ZDTA 4MT7A 4GMVA 1FGZA 4ZRJA 5JHGA 1ZM0A 3KSYA 1PFJA 2Z59A 4TYZA 2P0DA 2Z0QA 5D27A 4Y94A 3UZTA 1FB8A 1EAZA 1MPHA 3ULCA 2YS3A 3NWFA 2Z0PA 4CYEA 3U7DA 3T06A 3ML4A 1Q67A 5J3QA 1MIZB 2VSZA 1V88A 1KI1B 2IYBA 2YT1A 2P0FA 5GOWB 3ODOA 2YT2A 1K5GB 1X1FA 1FHOA 3DXEA 1XR0B 2XQNM 1RRPB 1XX0A 1NTYA 4HAXB 3WA0A 3QBVB 4HSIA 2AL6A 4NSWA 2I1KA 2DN6A 3KRWA 2D9WA 5DH9B 1DDWA 4HAUB 2NBVA 2LKOA 3WYFB 1V5UA 2EMSA 2H7DA 2RLOA 2GJYA 2JP2A 2UZRA 1V89A 3SUZA 3D8EA 4DIXA 2K8EA 4HHVA 2Z14A 2K2UA 3LJUX 4A6FA 3FVCA 1DDMA 4EJNA 3BJIA 1I2HA 3SV1A 4C0AA 4HB0B 3HSAA 5C5BA 5DIFB 2LYDA 3M1IB 2DFKA 4GXBA 1ISNA 2CRFA 3KY9A 3FSSA 3MDBC 2V76A 2J0KA 3PG7A 3NWDA 4D6WA 4NY0A 1NI2A 5HE2A 3DXCA 4K2PA 4WVFB 1ZVRA 2GS0A 3NWAA 1MK7B 2IFSA 1OQNA 2K2JA 2N23A 2I5FA 2DYQA 1PLSA 1GC7A 4HAYB 4KHBB 4PQ0A 2I5CA 5J3YA 2GCJA 1SGHA 1U5GA 4A6KA 5LONB 1BAKA 2FJUB 2COFA 2K00A 3BINA 2CY4A 1ZC3B 3SO6A 4EKUA 1P3RA 2KUPA 1Y19B 4WJ7A 2NMBA 4F7GA 2R2YA 4B6HA 5EFXA 3VOQA 5I2SA 2ELAA 2DHJA 4A6HA 1I7AA 2D9VA 2YRYA 1X11A 1FHWA 5DI9B 4EMOA 3VIAA 1WGUA 2PZ1A 3ODXA 1PMSA 3MPXA 4A6FB 3AU5A 2DHIA 3SYXA 3CIKA 4HDOA 1NTVA 5C16A 4HB4B 4K17A 2DLWA 2ADZA 1GG3A 4QJ5B 5C5BB 2Z4DA 2X18A 3NW8A 2P0HA 1QC6A 2W2WA 3F0WA 4HATB 4GZUA 5DHAB 4YONA 1MKEA 5CLQB 5JLJB 2L2IA 3P6AA 4Z2NA 2MKRA 5D3YA 1U5EA 2Y7BA 4CHMA 4KHBA 3FM8C 3KZ1A 1P6SA 1RJ2A 2ROZB 3N7CA 4GMXB 3OHMB 1TQZA 2YT0A 1MIXA 5KQ4A 2D11A 1UPQA 3PVWA 3SNHA 2K49A 2RUKB 3X23A 2Y8FA 2MFQA 3A58A 4QJ4B 3HIEA 3PVUA 4P7IA 2YF0A 2D9XA 2RGNB 4HAVB 3AU4A 2LG1A 1FHXA 2RRFA 2GCLA 1Z87A 3G9WA 1WJMA 5C6RA 2DX1A 2YSZA 2KCJA 2EJ8A 5D3XA 2UZSA 4A5KA 1TXDA 4IAPA 4HB2B 3V5WA 3IVFA 5D3WA 1OMWA 3A8PA 3DXDA 1DYNA 5FI1A 4GNKB 5L81A 2KIEA 1U2BA 1E5WA 3RCPA 3A8QA 5HE3A 2Z0OA 1DROA 2COAA 2ROVA 3F5RA 2LULA 4IFSA 3FEHA 4XWXA 4L1RA 4TKNA 2VRWB 1B55A 1IRSA 1BTNA 2EC1A 2Q13A 1QQGA 1FGYA 1ZC4B 1H10A 4OSNA 1DBHA 4OT1A 2DKQA 1M7RA 1V61A 2CAYA 1GC6A 1J19A 2RSGA 3QIJA 1AQCA 3ZVRA 5JHHA 4DX8A 2EMTA 1M7EA 1XCGA 1NU2A 2ELBA 4Z2MB 1WJ1A 1BWNA 1SHCA 1UNRA 4GOUA 2BCJA 2L1CA 3PVLA 2HTHB 1Y5OA 4KAXB 1ZSQA 5D3VA 4BBKA 1MK9B 1UEFA 2ZKMX 2YS5A 3CXBB 4L6EA 1EVHA 2MDXA 5FI0A 4HB3B 5J3TA 1WGQA 2GUMA 1MI1A 1WVHA 1FAOA 1XODA 4GN1A 1UPRA 3PSCA 1P5TA 1WI1A 2DX5A 1FOEA 1W1GA 2MWNB 3GYPA 1EF1A 2AEHA 2N0YA 3PP2A 2J0JA 3TFMA 1TJ6A 1N3HA 5DHFB 5I2MA 2G35A 4KHAA 3NSUA 2P8VA 3HW2B 5C79A 3DCXA 1XKEA 3PZDA 4ZRIA 1EGXA 1XD4A 3O96A 1AWEA 2R0DA 2ZPYA 4F7UP 3OANA 2OTXA 2LOZA 1DDVA 2J0MA 2RVBB 5CLLB 4QXAB 1X05A 3P7ZA 1H4RA 2M14A 4F7HA 3KRXA 2M38A 4HAZB 4H8SA
chains in the Genus database with same CATH topology
1UNPA 5M4YB 5HE0A 3AJ4A 1U5FA 5IRSA 1J0WA 2W2XC 2E2XA 3D8FA 3TVVA 1W1HA 4QJ3B 2UVMA 2COCA 2D9YA 5KCVA 3GYOA 2KGXB 4YL8A 2RNRB 2I1JA 3U8ZA 5JP4A 1MAIA 2YVCA 1ZYIA 4MK0A 2R09A 1U27A 4KHOA 4PNKA 1U29A 4D0NB 3TCAA 1UNQA 3HQCA 4CSQA 2W2XD 1LB1A 1X1GA 3A98B 4HDQA 2Z13A 4DBBA 1X86A 2DTCA 2QKLA 3ULBA 5LOPB 2J59M 2D4QA 1W1DA 3TW1A 2QKMA 4DXAB 4K2OA 2LOXA 2NZ8B 4KVGB 2Y8GA 1OY2A 3PEGA 1BTKA 2KR0A 5LG4B 4K81A 2FJLA 3ODWA 1V5MA 2H7EA 3D8DA 1U5DA 4GPTB 1KZ7A 4DX90 4WSFA 5HE1A 1K5DB 3U12A 2DA0A 3TO1A 2YS1A 2VKIA 2HE7A 4ZRKA 2CY5A 2CODA 3HK0A 1V5PA 3QWMA 4MY6A 5KQ1A 2D9ZA 2DYNA 1KZGA 2OQBA 1WG7A 2KIGA 2KUQA 4HAWB 4IOYX 2D10A 2D2QA 2DKPA 1LW3A 2DHKA 4CHJA 3ZDTA 4MT7A 4GMVA 1FGZA 4ZRJA 5JHGA 1ZM0A 3KSYA 1PFJA 2Z59A 4TYZA 2P0DA 2Z0QA 5D27A 4Y94A 3UZTA 1FB8A 1EAZA 1MPHA 3ULCA 2YS3A 3NWFA 2Z0PA 4CYEA 3U7DA 3T06A 3ML4A 1Q67A 5J3QA 1MIZB 2VSZA 1V88A 1KI1B 2IYBA 2YT1A 2P0FA 5GOWB 3ODOA 2YT2A 1K5GB 1X1FA 1FHOA 3DXEA 1XR0B 2XQNM 1RRPB 1XX0A 1NTYA 4HAXB 3WA0A 3QBVB 4HSIA 2AL6A 4NSWA 2I1KA 2DN6A 3KRWA 2D9WA 5DH9B 1DDWA 4HAUB 2NBVA 2LKOA 3WYFB 1V5UA 2EMSA 2H7DA 2RLOA 2GJYA 2JP2A 2UZRA 1V89A 3SUZA 3D8EA 4DIXA 2K8EA 4HHVA 2Z14A 2K2UA 3LJUX 4A6FA 3FVCA 1DDMA 4EJNA 3BJIA 1I2HA 3SV1A 4C0AA 4HB0B 5C5BA 5DIFB 2LYDA 3M1IB 2DFKA 4GXBA 1ISNA 2CRFA 3KY9A 3FSSA 3MDBC 2V76A 2J0KA 3PG7A 3NWDA 4D6WA 4NY0A 1NI2A 5HE2A 3DXCA 4K2PA 4WVFB 1ZVRA 2GS0A 3NWAA 1MK7B 2IFSA 1OQNA 2K2JA 2N23A 2I5FA 2DYQA 1PLSA 1GC7A 4HAYB 4KHBB 4PQ0A 2I5CA 5J3YA 2GCJA 1SGHA 1U5GA 4A6KA 5LONB 1BAKA 2FJUB 2COFA 2K00A 3BINA 2CY4A 1ZC3B 3SO6A 4EKUA 1P3RA 2KUPA 1Y19B 4WJ7A 2NMBA 4F7GA 2R2YA 4B6HA 5EFXA 3VOQA 5I2SA 2ELAA 2DHJA 4A6HA 1I7AA 2D9VA 2YRYA 1X11A 1FHWA 5DI9B 4EMOA 3VIAA 1WGUA 2PZ1A 3ODXA 1PMSA 3MPXA 4A6FB 3AU5A 2DHIA 3SYXA 3CIKA 4HDOA 1NTVA 5C16A 4HB4B 4K17A 2DLWA 2ADZA 1GG3A 4QJ5B 5C5BB 2Z4DA 2X18A 3NW8A 2P0HA 1QC6A 2W2WA 3F0WA 4HATB 4GZUA 5DHAB 4YONA 1MKEA 5CLQB 5JLJB 2L2IA 3P6AA 4Z2NA 2MKRA 5D3YA 1U5EA 2Y7BA 4CHMA 4KHBA 3FM8C 3KZ1A 1P6SA 1RJ2A 2ROZB 3N7CA 4GMXB 3OHMB 1TQZA 2YT0A 1MIXA 5KQ4A 2D11A 1UPQA 3PVWA 3SNHA 2K49A 2RUKB 3X23A 2Y8FA 2MFQA 3A58A 4QJ4B 3HIEA 3PVUA 4P7IA 2D9XA 2RGNB 2YF0A 4HAVB 3AU4A 2LG1A 1FHXA 2RRFA 2GCLA 1Z87A 3G9WA 1WJMA 5C6RA 2DX1A 2YSZA 2KCJA 2EJ8A 5D3XA 2UZSA 4A5KA 1TXDA 4IAPA 4HB2B 3V5WA 3IVFA 5D3WA 1OMWA 3A8PA 3DXDA 1DYNA 5FI1A 4GNKB 5L81A 1U2BA 3RCPA 1E5WA 2KIEA 3A8QA 5HE3A 2Z0OA 1DROA 2COAA 2ROVA 3F5RA 2LULA 4IFSA 3FEHA 4XWXA 4TKNA 4L1RA 2VRWB 1B55A 1IRSA 1BTNA 2EC1A 2Q13A 1QQGA 1FGYA 1ZC4B 1H10A 4OSNA 1DBHA 4OT1A 2DKQA 1M7RA 1V61A 2CAYA 1GC6A 1J19A 2RSGA 3QIJA 1AQCA 3ZVRA 5JHHA 4DX8A 2EMTA 1M7EA 1XCGA 1NU2A 2ELBA 4Z2MB 1WJ1A 1BWNA 1SHCA 1UNRA 4GOUA 2BCJA 2L1CA 3PVLA 2HTHB 1Y5OA 4KAXB 1ZSQA 5D3VA 4BBKA 1MK9B 1UEFA 2ZKMX 2YS5A 3CXBB 4L6EA 1EVHA 2MDXA 5FI0A 4HB3B 5J3TA 1WGQA 2GUMA 1WVHA 1FAOA 1XODA 4GN1A 1UPRA 3PSCA 1P5TA 1WI1A 2DX5A 1FOEA 1W1GA 2MWNB 3GYPA 1EF1A 3PP2A 2AEHA 2N0YA 2J0JA 3TFMA 1TJ6A 1N3HA 5DHFB 5I2MA 2G35A 4KHAA 3NSUA 2P8VA 3HW2B 5C79A 1XKEA 3PZDA 4ZRIA 1EGXA 1XD4A 3O96A 1AWEA 2R0DA 2ZPYA 4F7UP 3OANA 2OTXA 2LOZA 1DDVA 2J0MA 2RVBB 5CLLB 4QXAB 1X05A 3P7ZA 1H4RA 2M14A 4F7HA 3KRXA 2M38A 4HAZB 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNP A;  5HE0 A;  3AJ4 A;  1U5F A;  1J0W A;  2W2X C;  2E2X A;  3D8F A;  3TVV A;  1W1H A;  2UVM A;  2COC A;  2D9Y A;  5KCV A;  3GYO A;  2KGX B;  4YL8 A;  2RNR B;  2I1J A;  3U8Z A;  5JP4 A;  1MAI A;  2YVC A;  4MK0 A;  2R09 A;  1U27 A;  4KHO A;  4PNK A;  1U29 A;  4D0N B;  3TCA A;  1UNQ A;  3HQC A;  2W2X D;  1LB1 A;  1X1G A;  3A98 B;  4HDQ A;  4DBB A;  1X86 A;  2DTC A;  2QKL A;  3ULB A;  5LOP B;  2J59 M;  2D4Q A;  1W1D A;  3TW1 A;  2QKM A;  4DXA B;  4K2O A;  2LOX A;  2NZ8 B;  4KVG B;  2Y8G A;  1OY2 A;  3PEG A;  1BTK A;  4K81 A;  2FJL A;  3ODW A;  1V5M A;  2H7E A;  3D8D A;  1U5D A;  4GPT B;  1KZ7 A;  4DX9 0;  4WSF A;  5HE1 A;  1K5D B;  2DA0 A;  3TO1 A;  2YS1 A;  2VKI A;  2HE7 A;  4ZRK A;  2CY5 A;  2COD A;  3HK0 A;  1V5P A;  3QWM A;  4MY6 A;  5KQ1 A;  2D9Z A;  2DYN A;  1KZG A;  2OQB A;  1WG7 A;  4HAW B;  4IOY X;  2D10 A;  2D2Q A;  2DKP A;  1LW3 A;  2DHK A;  4CHJ A;  3ZDT A;  4MT7 A;  4GMV A;  1FGZ A;  4ZRJ A;  5JHG A;  1ZM0 A;  3KSY A;  1PFJ A;  4TYZ A;  2P0D A;  2Z0Q A;  5D27 A;  4Y94 A;  3UZT A;  1FB8 A;  1EAZ A;  1MPH A;  3ULC A;  2YS3 A;  2Z0P A;  4CYE A;  3U7D A;  3T06 A;  3ML4 A;  1Q67 A;  5J3Q A;  1MIZ B;  2VSZ A;  1V88 A;  1KI1 B;  2IYB A;  2YT1 A;  2P0F A;  5GOW B;  3ODO A;  1K5G B;  1X1F A;  1FHO A;  3DXE A;  1XR0 B;  2XQN M;  1RRP B;  1XX0 A;  1NTY A;  4HAX B;  3WA0 A;  3QBV B;  2AL6 A;  4NSW A;  2I1K A;  2DN6 A;  3KRW A;  2D9W A;  5DH9 B;  1DDW A;  4HAU B;  2LKO A;  3WYF B;  1V5U A;  2EMS A;  2H7D A;  2RLO A;  2GJY A;  2JP2 A;  2UZR A;  1V89 A;  3SUZ A;  3D8E A;  4HHV A;  2K2U A;  3LJU X;  4A6F A;  1DDM A;  4EJN A;  3BJI A;  1I2H A;  3SV1 A;  4C0A A;  4HB0 B;  5C5B A;  5DIF B;  2LYD A;  3M1I B;  2DFK A;  4GXB A;  1ISN A;  2CRF A;  3KY9 A;  3FSS A;  3MDB C;  2V76 A;  2J0K A;  3PG7 A;  4NY0 A;  1NI2 A;  5HE2 A;  3DXC A;  4K2P A;  4WVF B;  1ZVR A;  2GS0 A;  1MK7 B;  2IFS A;  1OQN A;  2K2J A;  2N23 A;  2I5F A;  2DYQ A;  1PLS A;  1GC7 A;  4HAY B;  4KHB B;  4PQ0 A;  2I5C A;  5J3Y A;  2GCJ A;  1SGH A;  1U5G A;  4A6K A;  5LON B;  1BAK A;  2COF A;  2K00 A;  3BIN A;  2CY4 A;  1ZC3 B;  3SO6 A;  4EKU A;  1P3R A;  2KUP A;  1Y19 B;  4WJ7 A;  2NMB A;  4F7G A;  4B6H A;  5EFX A;  3VOQ A;  2ELA A;  2DHJ A;  4A6H A;  1I7A A;  2D9V A;  2YRY A;  1X11 A;  1FHW A;  5DI9 B;  4EMO A;  3VIA A;  1WGU A;  2PZ1 A;  3ODX A;  1PMS A;  3MPX A;  4A6F B;  3AU5 A;  2DHI A;  3SYX A;  3CIK A;  4HDO A;  1NTV A;  5C16 A;  4HB4 B;  4K17 A;  2DLW A;  2ADZ A;  1GG3 A;  5C5B B;  2X18 A;  2P0H A;  1QC6 A;  2W2W A;  3F0W A;  4HAT B;  4GZU A;  5DHA B;  4YON A;  1MKE A;  5CLQ B;  5JLJ B;  2L2I A;  3P6A A;  4Z2N A;  2MKR A;  5D3Y A;  1U5E A;  2Y7B A;  4CHM A;  3FM8 C;  3KZ1 A;  1P6S A;  1RJ2 A;  2ROZ B;  3N7C A;  4GMX B;  1TQZ A;  2YT0 A;  1MIX A;  5KQ4 A;  2D11 A;  1UPQ A;  3PVW A;  3SNH A;  2RUK B;  3X23 A;  2Y8F A;  2MFQ A;  3PVU A;  4P7I A;  2D9X A;  2RGN B;  2YF0 A;  4HAV B;  3AU4 A;  2LG1 A;  1FHX A;  2GCL A;  1Z87 A;  3G9W A;  1WJM A;  5C6R A;  2DX1 A;  2YSZ A;  2KCJ A;  2EJ8 A;  5D3X A;  2UZS A;  4A5K A;  1TXD A;  4IAP A;  4HB2 B;  3V5W A;  3IVF A;  5D3W A;  1OMW A;  3A8P A;  3DXD A;  1DYN A;  5FI1 A;  5L81 A;  1U2B A;  3RCP A;  1E5W A;  3A8Q A;  5HE3 A;  2Z0O A;  1DRO A;  2COA A;  2ROV A;  3F5R A;  2LUL A;  4IFS A;  3FEH A;  4XWX A;  4TKN A;  2VRW B;  1B55 A;  1IRS A;  1BTN A;  2EC1 A;  2Q13 A;  1QQG A;  1FGY A;  1ZC4 B;  1H10 A;  1DBH A;  2DKQ A;  1M7R A;  1V61 A;  2CAY A;  1GC6 A;  1J19 A;  2RSG A;  3QIJ A;  1AQC A;  3ZVR A;  5JHH A;  4DX8 A;  2EMT A;  1M7E A;  1XCG A;  1NU2 A;  2ELB A;  4Z2M B;  1WJ1 A;  1BWN A;  1SHC A;  1UNR A;  2BCJ A;  2L1C A;  3PVL A;  2HTH B;  1Y5O A;  4KAX B;  1ZSQ A;  5D3V A;  4BBK A;  1MK9 B;  1UEF A;  2YS5 A;  3CXB B;  4L6E A;  1EVH A;  2MDX A;  5FI0 A;  4HB3 B;  5J3T A;  1WGQ A;  1WVH A;  1FAO A;  1XOD A;  4GN1 A;  1UPR A;  3PSC A;  1P5T A;  1WI1 A;  2DX5 A;  1FOE A;  1W1G A;  2MWN B;  3GYP A;  1EF1 A;  3PP2 A;  2AEH A;  2N0Y A;  2J0J A;  3TFM A;  1TJ6 A;  1N3H A;  5DHF B;  2G35 A;  4KHA A;  3NSU A;  2P8V A;  3HW2 B;  5C79 A;  1XKE A;  3PZD A;  4ZRI A;  1EGX A;  1XD4 A;  3O96 A;  1AWE A;  2R0D A;  2ZPY A;  4F7U P;  3OAN A;  2OTX A;  2LOZ A;  1DDV A;  2J0M A;  2RVB B;  5CLL B;  1X05 A;  3P7Z A;  1H4R A;  2M14 A;  4F7H A;  3KRX A;  2M38 A;  4HAZ B;  4H8S A; 
#chains in the Genus database with same CATH topology
 1UNP A;  5M4Y B;  5HE0 A;  3AJ4 A;  1U5F A;  5IRS A;  1J0W A;  2W2X C;  2E2X A;  3D8F A;  3TVV A;  1W1H A;  4QJ3 B;  2UVM A;  2COC A;  2D9Y A;  5KCV A;  3GYO A;  2KGX B;  4YL8 A;  2RNR B;  2I1J A;  3U8Z A;  5JP4 A;  1MAI A;  2YVC A;  1ZYI A;  4MK0 A;  2R09 A;  1U27 A;  4KHO A;  4PNK A;  1U29 A;  4D0N B;  3TCA A;  1UNQ A;  3HQC A;  4CSQ A;  2W2X D;  1LB1 A;  1X1G A;  3A98 B;  4HDQ A;  2Z13 A;  4DBB A;  1X86 A;  2DTC A;  2QKL A;  3ULB A;  5LOP B;  2J59 M;  2D4Q A;  1W1D A;  3TW1 A;  2QKM A;  4DXA B;  4K2O A;  2LOX A;  2NZ8 B;  4KVG B;  2Y8G A;  1OY2 A;  3B77 A;  3PEG A;  1T77 A;  1BTK A;  2KR0 A;  5LG4 B;  4K81 A;  2FJL A;  3ODW A;  1V5M A;  2H7E A;  3D8D A;  1U5D A;  4GPT B;  1KZ7 A;  4DX9 0;  4WSF A;  5HE1 A;  1K5D B;  3U12 A;  2DA0 A;  3TO1 A;  2YS1 A;  2VKI A;  2HE7 A;  4ZRK A;  2CY5 A;  2COD A;  3HK0 A;  1V5P A;  3QWM A;  4MY6 A;  5KQ1 A;  2D9Z A;  2DYN A;  1KZG A;  2KIG A;  1WG7 A;  2OQB A;  2KUQ A;  4HAW B;  4IOY X;  2D10 A;  2D2Q A;  2DKP A;  1LW3 A;  2DHK A;  4CHJ A;  3ZDT A;  4MT7 A;  4GMV A;  1FGZ A;  4ZRJ A;  5JHG A;  1ZM0 A;  3KSY A;  1PFJ A;  2Z59 A;  4TYZ A;  2P0D A;  2Z0Q A;  5D27 A;  4Y94 A;  3UZT A;  1FB8 A;  1EAZ A;  1MPH A;  3ULC A;  2YS3 A;  3NWF A;  2Z0P A;  4CYE A;  3U7D A;  3T06 A;  3ML4 A;  1Q67 A;  5J3Q A;  1MIZ B;  2VSZ A;  1V88 A;  1KI1 B;  2IYB A;  2YT1 A;  2P0F A;  5GOW B;  3ODO A;  2YT2 A;  1K5G B;  1X1F A;  1FHO A;  3DXE A;  1XR0 B;  2XQN M;  1RRP B;  1XX0 A;  1NTY A;  4HAX B;  3WA0 A;  3QBV B;  4HSI A;  2AL6 A;  4NSW A;  2I1K A;  2DN6 A;  3KRW A;  2D9W A;  5DH9 B;  1DDW A;  4HAU B;  2NBV A;  2LKO A;  3WYF B;  1V5U A;  2EMS A;  2H7D A;  2RLO A;  2GJY A;  2JP2 A;  2UZR A;  1V89 A;  3SUZ A;  3D8E A;  4DIX A;  2K8E A;  4HHV A;  2Z14 A;  2K2U A;  3LJU X;  4A6F A;  3FVC A;  1DDM A;  4EJN A;  3BJI A;  1I2H A;  3SV1 A;  4C0A A;  4HB0 B;  3HSA A;  5C5B A;  5DIF B;  2LYD A;  3M1I B;  2DFK A;  4GXB A;  1ISN A;  2CRF A;  3KY9 A;  3FSS A;  3MDB C;  2V76 A;  2J0K A;  3PG7 A;  3NWD A;  4D6W A;  4NY0 A;  1NI2 A;  5HE2 A;  3DXC A;  4K2P A;  4WVF B;  1ZVR A;  2GS0 A;  3NWA A;  1MK7 B;  2IFS A;  1OQN A;  2K2J A;  2N23 A;  2I5F A;  2DYQ A;  1PLS A;  1GC7 A;  4HAY B;  4KHB B;  4PQ0 A;  2I5C A;  5J3Y A;  2GCJ A;  1SGH A;  1U5G A;  4A6K A;  5LON B;  1BAK A;  2FJU B;  2COF A;  2K00 A;  3BIN A;  2CY4 A;  1ZC3 B;  3SO6 A;  4EKU A;  1P3R A;  2KUP A;  1Y19 B;  4WJ7 A;  2NMB A;  4F7G A;  2R2Y A;  4B6H A;  5EFX A;  3VOQ A;  5I2S A;  2ELA A;  2DHJ A;  4A6H A;  1I7A A;  2D9V A;  2YRY A;  1X11 A;  1FHW A;  5DI9 B;  4EMO A;  3VIA A;  1WGU A;  2PZ1 A;  3ODX A;  1PMS A;  3MPX A;  4A6F B;  3AU5 A;  2DHI A;  3SYX A;  3CIK A;  4HDO A;  1NTV A;  5C16 A;  4HB4 B;  4K17 A;  2DLW A;  2ADZ A;  1GG3 A;  4QJ5 B;  5C5B B;  2Z4D A;  2X18 A;  3NW8 A;  2P0H A;  1QC6 A;  2W2W A;  3F0W A;  4HAT B;  4GZU A;  5DHA B;  4YON A;  1MKE A;  5CLQ B;  5JLJ B;  2L2I A;  3P6A A;  4Z2N A;  2MKR A;  5D3Y A;  1U5E A;  2Y7B A;  4CHM A;  4KHB A;  3FM8 C;  3KZ1 A;  1P6S A;  1RJ2 A;  2ROZ B;  3N7C A;  4GMX B;  3OHM B;  1TQZ A;  2YT0 A;  1MIX A;  5KQ4 A;  2D11 A;  1UPQ A;  3PVW A;  3SNH A;  2K49 A;  2RUK B;  3X23 A;  2Y8F A;  2MFQ A;  3A58 A;  4QJ4 B;  3HIE A;  3PVU A;  4P7I A;  2YF0 A;  2D9X A;  2RGN B;  4HAV B;  3AU4 A;  2LG1 A;  1FHX A;  2RRF A;  2GCL A;  1Z87 A;  3G9W A;  1WJM A;  5C6R A;  2DX1 A;  2YSZ A;  2KCJ A;  2EJ8 A;  5D3X A;  2UZS A;  4A5K A;  1TXD A;  4IAP A;  4HB2 B;  3V5W A;  3IVF A;  5D3W A;  1OMW A;  3A8P A;  3DXD A;  1DYN A;  5FI1 A;  4GNK B;  5L81 A;  2KIE A;  1U2B A;  1E5W A;  3RCP A;  3A8Q A;  5HE3 A;  2Z0O A;  1DRO A;  2COA A;  2ROV A;  3F5R A;  2LUL A;  4IFS A;  3FEH A;  4XWX A;  4L1R A;  4TKN A;  2VRW B;  1B55 A;  1IRS A;  1BTN A;  2EC1 A;  2Q13 A;  1QQG A;  1FGY A;  1ZC4 B;  1H10 A;  4OSN A;  1DBH A;  4OT1 A;  2DKQ A;  1M7R A;  1V61 A;  2CAY A;  1GC6 A;  1J19 A;  2RSG A;  3QIJ A;  1AQC A;  3ZVR A;  5JHH A;  4DX8 A;  2EMT A;  1M7E A;  1XCG A;  1NU2 A;  2ELB A;  4Z2M B;  1WJ1 A;  1BWN A;  1SHC A;  1UNR A;  4GOU A;  2BCJ A;  2L1C A;  3PVL A;  2HTH B;  1Y5O A;  4KAX B;  1ZSQ A;  5D3V A;  4BBK A;  1MK9 B;  1UEF A;  2ZKM X;  2YS5 A;  3CXB B;  4L6E A;  1EVH A;  2MDX A;  5FI0 A;  4HB3 B;  5J3T A;  1WGQ A;  2GUM A;  1MI1 A;  1WVH A;  1FAO A;  1XOD A;  4GN1 A;  1UPR A;  3PSC A;  1P5T A;  1WI1 A;  2DX5 A;  1FOE A;  1W1G A;  2MWN B;  3GYP A;  1EF1 A;  2AEH A;  2N0Y A;  3PP2 A;  2J0J A;  3TFM A;  1TJ6 A;  1N3H A;  5DHF B;  5I2M A;  2G35 A;  4KHA A;  3NSU A;  2P8V A;  3HW2 B;  5C79 A;  3DCX A;  1XKE A;  3PZD A;  4ZRI A;  1EGX A;  1XD4 A;  3O96 A;  1AWE A;  2R0D A;  2ZPY A;  4F7U P;  3OAN A;  2OTX A;  2LOZ A;  1DDV A;  2J0M A;  2RVB B;  5CLL B;  4QXA B;  1X05 A;  3P7Z A;  1H4R A;  2M14 A;  4F7H A;  3KRX A;  2M38 A;  4HAZ B;  4H8S A; 
#chains in the Genus database with same CATH homology
 1UNP A;  5M4Y B;  5HE0 A;  3AJ4 A;  1U5F A;  5IRS A;  1J0W A;  2W2X C;  2E2X A;  3D8F A;  3TVV A;  1W1H A;  4QJ3 B;  2UVM A;  2COC A;  2D9Y A;  5KCV A;  3GYO A;  2KGX B;  4YL8 A;  2RNR B;  2I1J A;  3U8Z A;  5JP4 A;  1MAI A;  2YVC A;  1ZYI A;  4MK0 A;  2R09 A;  1U27 A;  4KHO A;  4PNK A;  1U29 A;  4D0N B;  3TCA A;  1UNQ A;  3HQC A;  4CSQ A;  2W2X D;  1LB1 A;  1X1G A;  3A98 B;  4HDQ A;  2Z13 A;  4DBB A;  1X86 A;  2DTC A;  2QKL A;  3ULB A;  5LOP B;  2J59 M;  2D4Q A;  1W1D A;  3TW1 A;  2QKM A;  4DXA B;  4K2O A;  2LOX A;  2NZ8 B;  4KVG B;  2Y8G A;  1OY2 A;  3PEG A;  1BTK A;  2KR0 A;  5LG4 B;  4K81 A;  2FJL A;  3ODW A;  1V5M A;  2H7E A;  3D8D A;  1U5D A;  4GPT B;  1KZ7 A;  4DX9 0;  4WSF A;  5HE1 A;  1K5D B;  3U12 A;  2DA0 A;  3TO1 A;  2YS1 A;  2VKI A;  2HE7 A;  4ZRK A;  2CY5 A;  2COD A;  3HK0 A;  1V5P A;  3QWM A;  4MY6 A;  5KQ1 A;  2D9Z A;  2DYN A;  1KZG A;  2OQB A;  1WG7 A;  2KIG A;  2KUQ A;  4HAW B;  4IOY X;  2D10 A;  2D2Q A;  2DKP A;  1LW3 A;  2DHK A;  4CHJ A;  3ZDT A;  4MT7 A;  4GMV A;  1FGZ A;  4ZRJ A;  5JHG A;  1ZM0 A;  3KSY A;  1PFJ A;  2Z59 A;  4TYZ A;  2P0D A;  2Z0Q A;  5D27 A;  4Y94 A;  3UZT A;  1FB8 A;  1EAZ A;  1MPH A;  3ULC A;  2YS3 A;  3NWF A;  2Z0P A;  4CYE A;  3U7D A;  3T06 A;  3ML4 A;  1Q67 A;  5J3Q A;  1MIZ B;  2VSZ A;  1V88 A;  1KI1 B;  2IYB A;  2YT1 A;  2P0F A;  5GOW B;  3ODO A;  2YT2 A;  1K5G B;  1X1F A;  1FHO A;  3DXE A;  1XR0 B;  2XQN M;  1RRP B;  1XX0 A;  1NTY A;  4HAX B;  3WA0 A;  3QBV B;  4HSI A;  2AL6 A;  4NSW A;  2I1K A;  2DN6 A;  3KRW A;  2D9W A;  5DH9 B;  1DDW A;  4HAU B;  2NBV A;  2LKO A;  3WYF B;  1V5U A;  2EMS A;  2H7D A;  2RLO A;  2GJY A;  2JP2 A;  2UZR A;  1V89 A;  3SUZ A;  3D8E A;  4DIX A;  2K8E A;  4HHV A;  2Z14 A;  2K2U A;  3LJU X;  4A6F A;  3FVC A;  1DDM A;  4EJN A;  3BJI A;  1I2H A;  3SV1 A;  4C0A A;  4HB0 B;  5C5B A;  5DIF B;  2LYD A;  3M1I B;  2DFK A;  4GXB A;  1ISN A;  2CRF A;  3KY9 A;  3FSS A;  3MDB C;  2V76 A;  2J0K A;  3PG7 A;  3NWD A;  4D6W A;  4NY0 A;  1NI2 A;  5HE2 A;  3DXC A;  4K2P A;  4WVF B;  1ZVR A;  2GS0 A;  3NWA A;  1MK7 B;  2IFS A;  1OQN A;  2K2J A;  2N23 A;  2I5F A;  2DYQ A;  1PLS A;  1GC7 A;  4HAY B;  4KHB B;  4PQ0 A;  2I5C A;  5J3Y A;  2GCJ A;  1SGH A;  1U5G A;  4A6K A;  5LON B;  1BAK A;  2FJU B;  2COF A;  2K00 A;  3BIN A;  2CY4 A;  1ZC3 B;  3SO6 A;  4EKU A;  1P3R A;  2KUP A;  1Y19 B;  4WJ7 A;  2NMB A;  4F7G A;  2R2Y A;  4B6H A;  5EFX A;  3VOQ A;  5I2S A;  2ELA A;  2DHJ A;  4A6H A;  1I7A A;  2D9V A;  2YRY A;  1X11 A;  1FHW A;  5DI9 B;  4EMO A;  3VIA A;  1WGU A;  2PZ1 A;  3ODX A;  1PMS A;  3MPX A;  4A6F B;  3AU5 A;  2DHI A;  3SYX A;  3CIK A;  4HDO A;  1NTV A;  5C16 A;  4HB4 B;  4K17 A;  2DLW A;  2ADZ A;  1GG3 A;  4QJ5 B;  5C5B B;  2Z4D A;  2X18 A;  3NW8 A;  2P0H A;  1QC6 A;  2W2W A;  3F0W A;  4HAT B;  4GZU A;  5DHA B;  4YON A;  1MKE A;  5CLQ B;  5JLJ B;  2L2I A;  3P6A A;  4Z2N A;  2MKR A;  5D3Y A;  1U5E A;  2Y7B A;  4CHM A;  4KHB A;  3FM8 C;  3KZ1 A;  1P6S A;  1RJ2 A;  2ROZ B;  3N7C A;  4GMX B;  3OHM B;  1TQZ A;  2YT0 A;  1MIX A;  5KQ4 A;  2D11 A;  1UPQ A;  3PVW A;  3SNH A;  2K49 A;  2RUK B;  3X23 A;  2Y8F A;  2MFQ A;  3A58 A;  4QJ4 B;  3HIE A;  3PVU A;  4P7I A;  2D9X A;  2RGN B;  2YF0 A;  4HAV B;  3AU4 A;  2LG1 A;  1FHX A;  2RRF A;  2GCL A;  1Z87 A;  3G9W A;  1WJM A;  5C6R A;  2DX1 A;  2YSZ A;  2KCJ A;  2EJ8 A;  5D3X A;  2UZS A;  4A5K A;  1TXD A;  4IAP A;  4HB2 B;  3V5W A;  3IVF A;  5D3W A;  1OMW A;  3A8P A;  3DXD A;  1DYN A;  5FI1 A;  4GNK B;  5L81 A;  1U2B A;  3RCP A;  1E5W A;  2KIE A;  3A8Q A;  5HE3 A;  2Z0O A;  1DRO A;  2COA A;  2ROV A;  3F5R A;  2LUL A;  4IFS A;  3FEH A;  4XWX A;  4TKN A;  4L1R A;  2VRW B;  1B55 A;  1IRS A;  1BTN A;  2EC1 A;  2Q13 A;  1QQG A;  1FGY A;  1ZC4 B;  1H10 A;  4OSN A;  1DBH A;  4OT1 A;  2DKQ A;  1M7R A;  1V61 A;  2CAY A;  1GC6 A;  1J19 A;  2RSG A;  3QIJ A;  1AQC A;  3ZVR A;  5JHH A;  4DX8 A;  2EMT A;  1M7E A;  1XCG A;  1NU2 A;  2ELB A;  4Z2M B;  1WJ1 A;  1BWN A;  1SHC A;  1UNR A;  4GOU A;  2BCJ A;  2L1C A;  3PVL A;  2HTH B;  1Y5O A;  4KAX B;  1ZSQ A;  5D3V A;  4BBK A;  1MK9 B;  1UEF A;  2ZKM X;  2YS5 A;  3CXB B;  4L6E A;  1EVH A;  2MDX A;  5FI0 A;  4HB3 B;  5J3T A;  1WGQ A;  2GUM A;  1WVH A;  1FAO A;  1XOD A;  4GN1 A;  1UPR A;  3PSC A;  1P5T A;  1WI1 A;  2DX5 A;  1FOE A;  1W1G A;  2MWN B;  3GYP A;  1EF1 A;  3PP2 A;  2AEH A;  2N0Y A;  2J0J A;  3TFM A;  1TJ6 A;  1N3H A;  5DHF B;  5I2M A;  2G35 A;  4KHA A;  3NSU A;  2P8V A;  3HW2 B;  5C79 A;  1XKE A;  3PZD A;  4ZRI A;  1EGX A;  1XD4 A;  3O96 A;  1AWE A;  2R0D A;  2ZPY A;  4F7U P;  3OAN A;  2OTX A;  2LOZ A;  1DDV A;  2J0M A;  2RVB B;  5CLL B;  4QXA B;  1X05 A;  3P7Z A;  1H4R A;  2M14 A;  4F7H A;  3KRX A;  2M38 A;  4HAZ B;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...