3GYOA

Se-met rtt106p
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
225
Chain Sequence
b'MDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 48
structure length 225
sequence length 241
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gyoA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gyoA01
2LG1A 1MAIA 2DLWA 2Z0PA 3A8PA 1UPRA 2G35A 5LOPB 4KHOA 2K2JA 3DXCA 3LJUX 3PG7A 4C0AA 4HB4B 1M7RA 1H10A 3CIKA 3TVVA 4D0NB 2YS5A 3DXDA 3D8EA 2RUKB 1MIZB 2DX5A 2MKRA 2AL6A 4YL8A 1BAKA 5CLQB 2DHKA 4HDOA 1MIXA 1ZVRA 3PVLA 2VSZA 3T06A 1ZM0A 2N23A 3AU4A 1K5DB 2QKMA 3KRWA 3KSYA 1U29A 3X23A 1UNPA 2H7EA 1EVHA 2Y7BA 2Y8GA 2FJLA 3KY9A 4NY0A 1ZC3B 1EGXA 3VOQA 4GMVA 3PEGA 1V5MA 2Z0QA 2DTCA 3UZTA 1XCGA 4B6HA 3M1IB 1W1GA 4MY6A 4ZRJA 1FHWA 1IRSA 4KHAA 3ODOA 2ADZA 1W1HA 3U7DA 4IAPA 4KHBB 5KQ1A 5DH9B 2D9XA 3N7CA 1Z87A 2BCJA 1U5GA 1GG3A 2Y8FA 2ZPYA 1SGHA 4WVFB 2COFA 2OTXA 3WYFB 5L81A 4A6HA 1DYNA 3QIJA 4MK0A 4HB2B 3QBVB 5C16A 4GXBA 1V5UA 1V61A 2W2XC 5JHHA 5KCVA 4WJ7A 3A8QA 4ZRKA 4HAYB 3WA0A 1RRPB 2LULA 2RVBB 1XX0A 2M38A 1U27A 2QKLA 3ZVRA 1EF1A 2GJYA 3D8FA 2V76A 3PVUA 3TCAA 2DHJA 4A6FB 4EMOA 5JLJB 2MWNB 1OMWA 1I2HA 2DX1A 2I5FA 2AEHA 2Q13A 5DI9B 2KCJA 1X1FA 4CHJA 1LW3A 1UNQA 1U5DA 1LB1A 2NMBA 1Q67A 5CLLB 2KGXB 5EFXA 2RLOA 1TQZA 2X18A 1GC6A 4DX90 1XKEA 2YF0A 5J3QA 1TJ6A 1U2BA 3SV1A 4PQ0A 2GCLA 2IYBA 3FSSA 3SYXA 4TKNA 5DHFB 4Y94A 3PP2A 2HTHB 2CY4A 3TW1A 4Z2NA 1P6SA 2RSGA 4XWXA 5D3VA 3ML4A 2HE7A 2VRWB 2D9VA 2IFSA 2KUPA 3GYOA 1FB8A 1NTVA 2CAYA 2ELAA 3A98B 2I5CA 4HAZB 3FEHA 4GMXB 3SO6A 2W2WA 3SUZA 1KZGA 1J19A 1KZ7A 1MK9B 1FGYA 4A6FA 5C5BB 2RNRB 1U5EA 1OY2A 1MKEA 1ZSQA 2UZRA 4NSWA 2J59M 1DDVA 1WJMA 2YSZA 1XD4A 4Z2MB 5HE0A 1M7EA 2COCA 1RJ2A 1WJ1A 1WGQA 3ODXA 4DBBA 2EC1A 1UEFA 4K17A 1B55A 2D9YA 2D4QA 3ULCA 2W2XD 4GPTB 2GS0A 1PFJA 1DBHA 1H4RA 4F7HA 2I1JA 2CRFA 3PZDA 5JHGA 1WVHA 1P3RA 2M14A 3P6AA 4F7UP 1WG7A 2EMTA 3ULBA 2UVMA 1E5WA 1V88A 3AU5A 2P0HA 1ZC4B 1FHOA 4K2OA 1PMSA 1KI1B 3AJ4A 1AQCA 2P0DA 4HDQA 2YS1A 4EJNA 5C79A 1XODA 2UZSA 5HE1A 1N3HA 5C5BA 4HB0B 2DHIA 3DXEA 4WSFA 4GZUA 3MPXA 2J0KA 2E2XA 1SHCA 2LKOA 1DDMA 2YRYA 3GYPA 3QWMA 3ODWA 2MFQA 2OQBA 1NTYA 1PLSA 3KRXA 2L2IA 3MDBC 2Z0OA 3HK0A 1Y19B 5KQ4A 1FOEA 1GC7A 3BINA 1AWEA 4H8SA 2DYQA 2DFKA 4P7IA 4A6KA 3KZ1A 4PNKA 3RCPA 2COAA 1XR0B 3ZDTA 1P5TA 5D3YA 1BTKA 1X05A 4A5KA 2EMSA 2R0DA 4DX8A 3G9WA 5HE2A 2D10A 3PSCA 5JP4A 3OANA 1OQNA 2RGNB 1X86A 1NU2A 4CHMA 5D3WA 1X1GA 4GN1A 2LYDA 2YVCA 1UPQA 3V5WA 2DKPA 5D3XA 2YS3A 4YONA 3FM8C 1X11A 4HHVA 1NI2A 1WGUA 2J0JA 2R09A 3PVWA 2L1CA 1MK7B 2JP2A 2XQNM 3HW2B 5DHAB 1V5PA 2DKQA 4CYEA 4DXAB 1Y5OA 3CXBB 1W1DA 2DYNA 1WI1A 1QC6A 2VKIA 2D9ZA 1DROA 4HAUB 1J0WA 2YT1A 4HAXB 5HE3A 4K2PA 4ZRIA 2D9WA 4HATB 2D11A 1FGZA 5D27A 4L6EA 3TFMA 1EAZA 2D2QA 3U8ZA 2CY5A 2DN6A 2I1KA 3VIAA 4HB3B 4MT7A 5FI0A 3IVFA 3O96A 1UNRA 4EKUA 3NSUA 1FHXA 5LONB 1BWNA 3HQCA 2ROZB 2DA0A 2LOZA 2YT0A 4HAWB 5GOWB 4KVGB 2ROVA 3F0WA 4K81A 2MDXA 5C6RA 4TYZA 5J3TA 2P0FA 1MPHA 1ISNA 1DDWA 2J0MA 1TXDA 1K5GB 3D8DA 3TO1A 2P8VA 4HAVB 4BBKA 3BJIA 4IFSA 2ELBA 2N0YA 2GCJA 2H7DA 2K2UA 5DIFB 2PZ1A 4IOYX 2EJ8A 5J3YA 1I7AA 3P7ZA 1V89A 3SNHA 1BTNA 2LOXA 1U5FA 4KAXB 1QQGA 4F7GA 2CODA 2NZ8B 1FAOA 3F5RA 2K00A 5FI1A
chains in the Genus database with same CATH superfamily
2LG1A 1MAIA 2DLWA 2Z0PA 3A8PA 1UPRA 2G35A 5LOPB 4KHOA 4QJ5B 3U12A 2K2JA 3DXCA 4OSNA 3LJUX 3PG7A 4C0AA 5M4YB 4HB4B 1M7RA 1H10A 3CIKA 3TVVA 4D0NB 2YS5A 3DXDA 3D8EA 2RUKB 1MIZB 2DX5A 2KIGA 2MKRA 2AL6A 4YL8A 1BAKA 5CLQB 2DHKA 4HDOA 1MIXA 1ZVRA 3PVLA 2VSZA 3T06A 1ZM0A 2N23A 3AU4A 1K5DB 2QKMA 3KRWA 3KSYA 1U29A 3X23A 1UNPA 2H7EA 1EVHA 2Y7BA 5LG4B 2Y8GA 2FJLA 3KY9A 4NY0A 1ZC3B 5I2SA 1EGXA 3VOQA 4GMVA 3PEGA 1V5MA 2Z0QA 2DTCA 3UZTA 1XCGA 4B6HA 3M1IB 1W1GA 4MY6A 4ZRJA 1FHWA 1IRSA 4KHAA 2NBVA 3ODOA 2ADZA 1W1HA 2YT2A 3U7DA 4IAPA 4KHBB 4L1RA 5KQ1A 5DH9B 2D9XA 3N7CA 1Z87A 2BCJA 1U5GA 1GG3A 2Y8FA 2ZPYA 1SGHA 4CSQA 2Z14A 2COFA 4WVFB 2OTXA 3WYFB 5L81A 3DCXA 4A6HA 1DYNA 3QIJA 4MK0A 4HB2B 3QBVB 5C16A 4GXBA 1V5UA 1V61A 2W2XC 5JHHA 5KCVA 4WJ7A 3A8QA 3FVCA 4ZRKA 4HAYB 3WA0A 1RRPB 2LULA 2RVBB 1XX0A 2M38A 1U27A 2QKLA 3ZVRA 1EF1A 2GJYA 3D8FA 2V76A 3PVUA 3TCAA 2DHJA 4A6FB 2K49A 4EMOA 5JLJB 2MWNB 1OMWA 1I2HA 2DX1A 2I5FA 2AEHA 2Q13A 5DI9B 2KCJA 1X1FA 4CHJA 1LW3A 1UNQA 1U5DA 1LB1A 2KUQA 2NMBA 1Q67A 5CLLB 2KGXB 5EFXA 2RLOA 4KHBA 1TQZA 2X18A 1GC6A 4DX90 1XKEA 2YF0A 1T77A 5J3QA 2KIEA 1TJ6A 1U2BA 3SV1A 4PQ0A 2GCLA 2IYBA 3FSSA 3SYXA 4TKNA 5DHFB 4Y94A 3NWFA 3PP2A 2HTHB 3NWAA 2CY4A 3TW1A 4QJ3B 4Z2NA 1MI1A 1P6SA 2RSGA 4XWXA 5D3VA 3ML4A 2HE7A 2VRWB 2D9VA 2IFSA 2KUPA 3GYOA 1FB8A 1NTVA 2CAYA 2ELAA 3A98B 2I5CA 4HAZB 3FEHA 2GUMA 4D6WA 4GMXB 3SO6A 2W2WA 3SUZA 1KZGA 1J19A 1KZ7A 1MK9B 1FGYA 4A6FA 5C5BB 2RNRB 1U5EA 1OY2A 4GNKB 1MKEA 1ZSQA 2UZRA 4NSWA 2R2YA 2J59M 1DDVA 1WJMA 2Z59A 2YSZA 1XD4A 4Z2MB 5HE0A 1M7EA 2COCA 1RJ2A 1WJ1A 1WGQA 3ODXA 4DBBA 2EC1A 1UEFA 4K17A 1B55A 2D9YA 2D4QA 3NW8A 5I2MA 3ULCA 2W2XD 4GPTB 2GS0A 1PFJA 1DBHA 1H4RA 4F7HA 2I1JA 2CRFA 3PZDA 5JHGA 1WVHA 1P3RA 2M14A 3P6AA 4F7UP 1WG7A 2EMTA 3ULBA 2UVMA 4QXAB 1E5WA 1V88A 3AU5A 2P0HA 1ZC4B 1FHOA 4K2OA 1PMSA 1KI1B 3AJ4A 1AQCA 2P0DA 4HDQA 3OHMB 2YS1A 4EJNA 5C79A 1XODA 2UZSA 5HE1A 4GOUA 1N3HA 5C5BA 4HB0B 2DHIA 3DXEA 4WSFA 4GZUA 3MPXA 2J0KA 2E2XA 1SHCA 2LKOA 1DDMA 3B77A 2YRYA 3GYPA 2RRFA 3ODWA 3QWMA 2MFQA 2OQBA 1NTYA 1PLSA 3KRXA 2ZKMX 2L2IA 3MDBC 2Z0OA 3HK0A 1Y19B 5KQ4A 1FOEA 1GC7A 3BINA 5IRSA 2KR0A 1AWEA 4H8SA 4OT1A 2DYQA 4DIXA 2DFKA 3A58A 4P7IA 4A6KA 3KZ1A 4PNKA 3RCPA 2COAA 1XR0B 3ZDTA 1P5TA 3HSAA 5D3YA 1BTKA 1X05A 4A5KA 2EMSA 2R0DA 2Z13A 4DX8A 3G9WA 5HE2A 2D10A 3PSCA 5JP4A 3OANA 1OQNA 2RGNB 1X86A 1NU2A 4CHMA 5D3WA 1X1GA 4GN1A 2LYDA 2YVCA 1UPQA 3V5WA 2DKPA 5D3XA 2YS3A 4YONA 3FM8C 1X11A 4HHVA 1NI2A 1WGUA 2J0JA 2R09A 3PVWA 2L1CA 1MK7B 2JP2A 2XQNM 3HW2B 5DHAB 1V5PA 2DKQA 4CYEA 4HSIA 4DXAB 1Y5OA 3CXBB 1W1DA 2DYNA 1WI1A 1QC6A 2VKIA 2K8EA 2D9ZA 1DROA 4HAUB 1J0WA 2YT1A 4HAXB 5HE3A 4K2PA 3HIEA 4ZRIA 2D9WA 4HATB 2D11A 1FGZA 5D27A 4L6EA 3TFMA 1EAZA 2D2QA 3U8ZA 2CY5A 2DN6A 2I1KA 3VIAA 3NWDA 4HB3B 4MT7A 5FI0A 3IVFA 3O96A 1UNRA 4EKUA 3NSUA 1FHXA 5LONB 1BWNA 3HQCA 2ROZB 2DA0A 2LOZA 2YT0A 4HAWB 2Z4DA 5GOWB 4KVGB 2ROVA 3F0WA 4K81A 2MDXA 4QJ4B 5C6RA 4TYZA 5J3TA 2P0FA 1MPHA 1ISNA 1DDWA 2J0MA 1TXDA 1K5GB 3D8DA 3TO1A 2P8VA 4HAVB 4BBKA 3BJIA 4IFSA 2ELBA 2N0YA 2GCJA 2FJUB 2H7DA 2K2UA 5DIFB 2PZ1A 4IOYX 2EJ8A 5J3YA 1I7AA 3P7ZA 1V89A 3SNHA 1BTNA 2LOXA 1U5FA 4KAXB 1ZYIA 1QQGA 4F7GA 2CODA 2NZ8B 1FAOA 3F5RA 2K00A 5FI1A
chains in the Genus database with same CATH topology
2LG1A 1MAIA 2DLWA 2Z0PA 3A8PA 1UPRA 2G35A 5LOPB 4KHOA 4QJ5B 3U12A 2K2JA 3DXCA 4OSNA 3LJUX 3PG7A 4C0AA 5M4YB 4HB4B 1M7RA 1H10A 3CIKA 3TVVA 4D0NB 2YS5A 3DXDA 3D8EA 2RUKB 1MIZB 2DX5A 2MKRA 2KIGA 2AL6A 4YL8A 1BAKA 5CLQB 2DHKA 4HDOA 1MIXA 1ZVRA 3PVLA 2VSZA 3T06A 1ZM0A 2N23A 3AU4A 1K5DB 2QKMA 3KRWA 3KSYA 1U29A 3X23A 1UNPA 2H7EA 1EVHA 2Y7BA 5LG4B 2Y8GA 2FJLA 3KY9A 4NY0A 1ZC3B 5I2SA 1EGXA 3VOQA 4GMVA 3PEGA 1V5MA 2Z0QA 2DTCA 3UZTA 1XCGA 4B6HA 3M1IB 1W1GA 4MY6A 4ZRJA 1FHWA 1IRSA 4KHAA 2NBVA 3ODOA 2ADZA 1W1HA 3U7DA 2YT2A 4IAPA 4KHBB 5KQ1A 4L1RA 5DH9B 2D9XA 3N7CA 1Z87A 2BCJA 1U5GA 1GG3A 2Y8FA 2ZPYA 1SGHA 4CSQA 4WVFB 2COFA 2Z14A 2OTXA 3WYFB 5L81A 4A6HA 1DYNA 3QIJA 4MK0A 4HB2B 3QBVB 5C16A 4GXBA 1V5UA 1V61A 2W2XC 5JHHA 5KCVA 4WJ7A 3A8QA 4ZRKA 3FVCA 4HAYB 3WA0A 1RRPB 2LULA 2RVBB 1XX0A 2M38A 1U27A 2QKLA 3ZVRA 1EF1A 2GJYA 3D8FA 2V76A 3PVUA 3TCAA 2DHJA 4A6FB 4EMOA 5JLJB 2K49A 2MWNB 1OMWA 1I2HA 2DX1A 2I5FA 2AEHA 2Q13A 5DI9B 2KCJA 1X1FA 4CHJA 1LW3A 1UNQA 1U5DA 1LB1A 2KUQA 2NMBA 1Q67A 5CLLB 2KGXB 5EFXA 2RLOA 4KHBA 1TQZA 2X18A 1GC6A 4DX90 1XKEA 2YF0A 5J3QA 2KIEA 1TJ6A 1U2BA 3SV1A 4PQ0A 2GCLA 2IYBA 3FSSA 3SYXA 4TKNA 5DHFB 4Y94A 3NWFA 3PP2A 2HTHB 3NWAA 2CY4A 3TW1A 4QJ3B 4Z2NA 1P6SA 2RSGA 4XWXA 5D3VA 3ML4A 2HE7A 2VRWB 2D9VA 2IFSA 2KUPA 3GYOA 1FB8A 1NTVA 2CAYA 2ELAA 3A98B 2I5CA 4HAZB 3FEHA 2GUMA 4D6WA 4GMXB 3SO6A 2W2WA 3SUZA 1KZGA 1J19A 1KZ7A 1MK9B 1FGYA 4A6FA 5C5BB 2RNRB 1U5EA 1OY2A 4GNKB 1MKEA 1ZSQA 2UZRA 4NSWA 2R2YA 2J59M 1DDVA 1WJMA 2Z59A 2YSZA 1XD4A 4Z2MB 5HE0A 1M7EA 2COCA 1RJ2A 1WJ1A 1WGQA 3ODXA 4DBBA 2EC1A 1UEFA 4K17A 1B55A 2D9YA 2D4QA 3NW8A 5I2MA 3ULCA 2W2XD 4GPTB 2GS0A 1PFJA 1DBHA 1H4RA 4F7HA 2I1JA 2CRFA 3PZDA 5JHGA 1WVHA 1P3RA 2M14A 3P6AA 4F7UP 1WG7A 2EMTA 3ULBA 2UVMA 4QXAB 1E5WA 1V88A 3AU5A 2P0HA 1ZC4B 1FHOA 4K2OA 1PMSA 1KI1B 3AJ4A 1AQCA 2P0DA 4HDQA 3OHMB 2YS1A 4EJNA 5C79A 1XODA 2UZSA 5HE1A 4GOUA 1N3HA 5C5BA 4HB0B 2DHIA 3DXEA 4WSFA 4GZUA 3MPXA 2J0KA 2E2XA 1SHCA 2LKOA 1DDMA 2YRYA 3GYPA 3QWMA 3ODWA 2RRFA 2MFQA 2OQBA 1NTYA 1PLSA 3KRXA 2ZKMX 2L2IA 3MDBC 2Z0OA 3HK0A 1Y19B 5KQ4A 1FOEA 1GC7A 3BINA 5IRSA 2KR0A 1AWEA 4H8SA 4OT1A 2DYQA 4DIXA 2DFKA 3A58A 4P7IA 4A6KA 3KZ1A 4PNKA 3RCPA 2COAA 1XR0B 3ZDTA 1P5TA 5D3YA 1BTKA 1X05A 4A5KA 2EMSA 2R0DA 2Z13A 4DX8A 3G9WA 5HE2A 2D10A 3PSCA 5JP4A 3OANA 1OQNA 2RGNB 1X86A 1NU2A 4CHMA 5D3WA 1X1GA 4GN1A 2LYDA 2YVCA 1UPQA 3V5WA 2DKPA 5D3XA 2YS3A 4YONA 3FM8C 1X11A 4HHVA 1NI2A 1WGUA 2J0JA 2R09A 3PVWA 2L1CA 1MK7B 2JP2A 2XQNM 3HW2B 5DHAB 1V5PA 2DKQA 4CYEA 4HSIA 4DXAB 1Y5OA 3CXBB 1W1DA 2DYNA 1WI1A 1QC6A 2VKIA 2K8EA 2D9ZA 1DROA 4HAUB 1J0WA 2YT1A 4HAXB 5HE3A 4K2PA 3HIEA 4ZRIA 2D9WA 4HATB 2D11A 1FGZA 5D27A 4L6EA 3TFMA 1EAZA 2D2QA 3U8ZA 2CY5A 2DN6A 2I1KA 3VIAA 3NWDA 4HB3B 4MT7A 5FI0A 3IVFA 3O96A 1UNRA 4EKUA 3NSUA 1FHXA 5LONB 1BWNA 3HQCA 2ROZB 2DA0A 2LOZA 2YT0A 4HAWB 2Z4DA 5GOWB 4KVGB 2ROVA 3F0WA 4K81A 2MDXA 4QJ4B 5C6RA 4TYZA 5J3TA 2P0FA 1MPHA 1ISNA 1DDWA 2J0MA 1TXDA 1K5GB 3D8DA 3TO1A 2P8VA 4HAVB 4BBKA 3BJIA 4IFSA 2ELBA 2N0YA 2GCJA 2H7DA 2K2UA 2FJUB 5DIFB 2PZ1A 4IOYX 2EJ8A 5J3YA 1I7AA 3P7ZA 1V89A 3SNHA 1BTNA 2LOXA 1U5FA 4KAXB 1ZYIA 1QQGA 4F7GA 2CODA 2NZ8B 1FAOA 3F5RA 2K00A 5FI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LG1 A;  1MAI A;  2DLW A;  2Z0P A;  3A8P A;  1UPR A;  2G35 A;  5LOP B;  4KHO A;  2K2J A;  3DXC A;  3LJU X;  3PG7 A;  4C0A A;  4HB4 B;  1M7R A;  1H10 A;  3CIK A;  3TVV A;  4D0N B;  2YS5 A;  3DXD A;  3D8E A;  2RUK B;  1MIZ B;  2DX5 A;  2MKR A;  2AL6 A;  4YL8 A;  1BAK A;  5CLQ B;  2DHK A;  4HDO A;  1MIX A;  1ZVR A;  3PVL A;  2VSZ A;  3T06 A;  1ZM0 A;  2N23 A;  3AU4 A;  1K5D B;  2QKM A;  3KRW A;  3KSY A;  1U29 A;  3X23 A;  1UNP A;  2H7E A;  1EVH A;  2Y7B A;  2Y8G A;  2FJL A;  3KY9 A;  4NY0 A;  1ZC3 B;  1EGX A;  3VOQ A;  4GMV A;  3PEG A;  1V5M A;  2Z0Q A;  2DTC A;  3UZT A;  1XCG A;  4B6H A;  3M1I B;  1W1G A;  4MY6 A;  4ZRJ A;  1FHW A;  1IRS A;  4KHA A;  3ODO A;  2ADZ A;  1W1H A;  3U7D A;  4IAP A;  4KHB B;  5KQ1 A;  5DH9 B;  2D9X A;  3N7C A;  1Z87 A;  2BCJ A;  1U5G A;  1GG3 A;  2Y8F A;  2ZPY A;  1SGH A;  4WVF B;  2COF A;  2OTX A;  3WYF B;  5L81 A;  4A6H A;  1DYN A;  3QIJ A;  4MK0 A;  4HB2 B;  3QBV B;  5C16 A;  4GXB A;  1V5U A;  1V61 A;  2W2X C;  5JHH A;  5KCV A;  4WJ7 A;  3A8Q A;  4ZRK A;  4HAY B;  3WA0 A;  1RRP B;  2LUL A;  2RVB B;  1XX0 A;  2M38 A;  1U27 A;  2QKL A;  3ZVR A;  1EF1 A;  2GJY A;  3D8F A;  2V76 A;  3PVU A;  3TCA A;  2DHJ A;  4A6F B;  4EMO A;  5JLJ B;  2MWN B;  1OMW A;  1I2H A;  2DX1 A;  2I5F A;  2AEH A;  2Q13 A;  5DI9 B;  2KCJ A;  1X1F A;  4CHJ A;  1LW3 A;  1UNQ A;  1U5D A;  1LB1 A;  2NMB A;  1Q67 A;  5CLL B;  2KGX B;  5EFX A;  2RLO A;  1TQZ A;  2X18 A;  1GC6 A;  4DX9 0;  1XKE A;  2YF0 A;  5J3Q A;  1TJ6 A;  1U2B A;  3SV1 A;  4PQ0 A;  2GCL A;  2IYB A;  3FSS A;  3SYX A;  4TKN A;  5DHF B;  4Y94 A;  3PP2 A;  2HTH B;  2CY4 A;  3TW1 A;  4Z2N A;  1P6S A;  2RSG A;  4XWX A;  5D3V A;  3ML4 A;  2HE7 A;  2VRW B;  2D9V A;  2IFS A;  2KUP A;  3GYO A;  1FB8 A;  1NTV A;  2CAY A;  2ELA A;  3A98 B;  2I5C A;  4HAZ B;  3FEH A;  4GMX B;  3SO6 A;  2W2W A;  3SUZ A;  1KZG A;  1J19 A;  1KZ7 A;  1MK9 B;  1FGY A;  4A6F A;  5C5B B;  2RNR B;  1U5E A;  1OY2 A;  1MKE A;  1ZSQ A;  2UZR A;  4NSW A;  2J59 M;  1DDV A;  1WJM A;  2YSZ A;  1XD4 A;  4Z2M B;  5HE0 A;  1M7E A;  2COC A;  1RJ2 A;  1WJ1 A;  1WGQ A;  3ODX A;  4DBB A;  2EC1 A;  1UEF A;  4K17 A;  1B55 A;  2D9Y A;  2D4Q A;  3ULC A;  2W2X D;  4GPT B;  2GS0 A;  1PFJ A;  1DBH A;  1H4R A;  4F7H A;  2I1J A;  2CRF A;  3PZD A;  5JHG A;  1WVH A;  1P3R A;  2M14 A;  3P6A A;  4F7U P;  1WG7 A;  2EMT A;  3ULB A;  2UVM A;  1E5W A;  1V88 A;  3AU5 A;  2P0H A;  1ZC4 B;  1FHO A;  4K2O A;  1PMS A;  1KI1 B;  3AJ4 A;  1AQC A;  2P0D A;  4HDQ A;  2YS1 A;  4EJN A;  5C79 A;  1XOD A;  2UZS A;  5HE1 A;  1N3H A;  5C5B A;  4HB0 B;  2DHI A;  3DXE A;  4WSF A;  4GZU A;  3MPX A;  2J0K A;  2E2X A;  1SHC A;  2LKO A;  1DDM A;  2YRY A;  3GYP A;  3QWM A;  3ODW A;  2MFQ A;  2OQB A;  1NTY A;  1PLS A;  3KRX A;  2L2I A;  3MDB C;  2Z0O A;  3HK0 A;  1Y19 B;  5KQ4 A;  1FOE A;  1GC7 A;  3BIN A;  1AWE A;  4H8S A;  2DYQ A;  2DFK A;  4P7I A;  4A6K A;  3KZ1 A;  4PNK A;  3RCP A;  2COA A;  1XR0 B;  3ZDT A;  1P5T A;  5D3Y A;  1BTK A;  1X05 A;  4A5K A;  2EMS A;  2R0D A;  4DX8 A;  3G9W A;  5HE2 A;  2D10 A;  3PSC A;  5JP4 A;  3OAN A;  1OQN A;  2RGN B;  1X86 A;  1NU2 A;  4CHM A;  5D3W A;  1X1G A;  4GN1 A;  2LYD A;  2YVC A;  1UPQ A;  3V5W A;  2DKP A;  5D3X A;  2YS3 A;  4YON A;  3FM8 C;  1X11 A;  4HHV A;  1NI2 A;  1WGU A;  2J0J A;  2R09 A;  3PVW A;  2L1C A;  1MK7 B;  2JP2 A;  2XQN M;  3HW2 B;  5DHA B;  1V5P A;  2DKQ A;  4CYE A;  4DXA B;  1Y5O A;  3CXB B;  1W1D A;  2DYN A;  1WI1 A;  1QC6 A;  2VKI A;  2D9Z A;  1DRO A;  4HAU B;  1J0W A;  2YT1 A;  4HAX B;  5HE3 A;  4K2P A;  4ZRI A;  2D9W A;  4HAT B;  2D11 A;  1FGZ A;  5D27 A;  4L6E A;  3TFM A;  1EAZ A;  2D2Q A;  3U8Z A;  2CY5 A;  2DN6 A;  2I1K A;  3VIA A;  4HB3 B;  4MT7 A;  5FI0 A;  3IVF A;  3O96 A;  1UNR A;  4EKU A;  3NSU A;  1FHX A;  5LON B;  1BWN A;  3HQC A;  2ROZ B;  2DA0 A;  2LOZ A;  2YT0 A;  4HAW B;  5GOW B;  4KVG B;  2ROV A;  3F0W A;  4K81 A;  2MDX A;  5C6R A;  4TYZ A;  5J3T A;  2P0F A;  1MPH A;  1ISN A;  1DDW A;  2J0M A;  1TXD A;  1K5G B;  3D8D A;  3TO1 A;  2P8V A;  4HAV B;  4BBK A;  3BJI A;  4IFS A;  2ELB A;  2N0Y A;  2GCJ A;  2H7D A;  2K2U A;  5DIF B;  2PZ1 A;  4IOY X;  2EJ8 A;  5J3Y A;  1I7A A;  3P7Z A;  1V89 A;  3SNH A;  1BTN A;  2LOX A;  1U5F A;  4KAX B;  1QQG A;  4F7G A;  2COD A;  2NZ8 B;  1FAO A;  3F5R A;  2K00 A;  5FI1 A; 
#chains in the Genus database with same CATH topology
 2LG1 A;  1MAI A;  2DLW A;  2Z0P A;  3A8P A;  1UPR A;  2G35 A;  5LOP B;  4KHO A;  4QJ5 B;  3U12 A;  2K2J A;  3DXC A;  4OSN A;  3LJU X;  3PG7 A;  4C0A A;  5M4Y B;  4HB4 B;  1M7R A;  1H10 A;  3CIK A;  3TVV A;  4D0N B;  2YS5 A;  3DXD A;  3D8E A;  2RUK B;  1MIZ B;  2DX5 A;  2KIG A;  2MKR A;  2AL6 A;  4YL8 A;  1BAK A;  5CLQ B;  2DHK A;  4HDO A;  1MIX A;  1ZVR A;  3PVL A;  2VSZ A;  3T06 A;  1ZM0 A;  2N23 A;  3AU4 A;  1K5D B;  2QKM A;  3KRW A;  3KSY A;  1U29 A;  3X23 A;  1UNP A;  2H7E A;  1EVH A;  2Y7B A;  5LG4 B;  2Y8G A;  2FJL A;  3KY9 A;  4NY0 A;  1ZC3 B;  5I2S A;  1EGX A;  3VOQ A;  4GMV A;  3PEG A;  1V5M A;  2Z0Q A;  2DTC A;  3UZT A;  1XCG A;  4B6H A;  3M1I B;  1W1G A;  4MY6 A;  4ZRJ A;  1FHW A;  1IRS A;  4KHA A;  2NBV A;  3ODO A;  2ADZ A;  1W1H A;  2YT2 A;  3U7D A;  4IAP A;  4KHB B;  4L1R A;  5KQ1 A;  5DH9 B;  2D9X A;  3N7C A;  1Z87 A;  2BCJ A;  1U5G A;  1GG3 A;  2Y8F A;  2ZPY A;  1SGH A;  4CSQ A;  2Z14 A;  2COF A;  4WVF B;  2OTX A;  3WYF B;  5L81 A;  3DCX A;  4A6H A;  1DYN A;  3QIJ A;  4MK0 A;  4HB2 B;  3QBV B;  5C16 A;  4GXB A;  1V5U A;  1V61 A;  2W2X C;  5JHH A;  5KCV A;  4WJ7 A;  3A8Q A;  3FVC A;  4ZRK A;  4HAY B;  3WA0 A;  1RRP B;  2LUL A;  2RVB B;  1XX0 A;  2M38 A;  1U27 A;  2QKL A;  3ZVR A;  1EF1 A;  2GJY A;  3D8F A;  2V76 A;  3PVU A;  3TCA A;  2DHJ A;  4A6F B;  2K49 A;  4EMO A;  5JLJ B;  2MWN B;  1OMW A;  1I2H A;  2DX1 A;  2I5F A;  2AEH A;  2Q13 A;  5DI9 B;  2KCJ A;  1X1F A;  4CHJ A;  1LW3 A;  1UNQ A;  1U5D A;  1LB1 A;  2KUQ A;  2NMB A;  1Q67 A;  5CLL B;  2KGX B;  5EFX A;  2RLO A;  4KHB A;  1TQZ A;  2X18 A;  1GC6 A;  4DX9 0;  1XKE A;  2YF0 A;  1T77 A;  5J3Q A;  2KIE A;  1TJ6 A;  1U2B A;  3SV1 A;  4PQ0 A;  2GCL A;  2IYB A;  3FSS A;  3SYX A;  4TKN A;  5DHF B;  4Y94 A;  3NWF A;  3PP2 A;  2HTH B;  3NWA A;  2CY4 A;  3TW1 A;  4QJ3 B;  4Z2N A;  1MI1 A;  1P6S A;  2RSG A;  4XWX A;  5D3V A;  3ML4 A;  2HE7 A;  2VRW B;  2D9V A;  2IFS A;  2KUP A;  3GYO A;  1FB8 A;  1NTV A;  2CAY A;  2ELA A;  3A98 B;  2I5C A;  4HAZ B;  3FEH A;  2GUM A;  4D6W A;  4GMX B;  3SO6 A;  2W2W A;  3SUZ A;  1KZG A;  1J19 A;  1KZ7 A;  1MK9 B;  1FGY A;  4A6F A;  5C5B B;  2RNR B;  1U5E A;  1OY2 A;  4GNK B;  1MKE A;  1ZSQ A;  2UZR A;  4NSW A;  2R2Y A;  2J59 M;  1DDV A;  1WJM A;  2Z59 A;  2YSZ A;  1XD4 A;  4Z2M B;  5HE0 A;  1M7E A;  2COC A;  1RJ2 A;  1WJ1 A;  1WGQ A;  3ODX A;  4DBB A;  2EC1 A;  1UEF A;  4K17 A;  1B55 A;  2D9Y A;  2D4Q A;  3NW8 A;  5I2M A;  3ULC A;  2W2X D;  4GPT B;  2GS0 A;  1PFJ A;  1DBH A;  1H4R A;  4F7H A;  2I1J A;  2CRF A;  3PZD A;  5JHG A;  1WVH A;  1P3R A;  2M14 A;  3P6A A;  4F7U P;  1WG7 A;  2EMT A;  3ULB A;  2UVM A;  4QXA B;  1E5W A;  1V88 A;  3AU5 A;  2P0H A;  1ZC4 B;  1FHO A;  4K2O A;  1PMS A;  1KI1 B;  3AJ4 A;  1AQC A;  2P0D A;  4HDQ A;  3OHM B;  2YS1 A;  4EJN A;  5C79 A;  1XOD A;  2UZS A;  5HE1 A;  4GOU A;  1N3H A;  5C5B A;  4HB0 B;  2DHI A;  3DXE A;  4WSF A;  4GZU A;  3MPX A;  2J0K A;  2E2X A;  1SHC A;  2LKO A;  1DDM A;  3B77 A;  2YRY A;  3GYP A;  2RRF A;  3ODW A;  3QWM A;  2MFQ A;  2OQB A;  1NTY A;  1PLS A;  3KRX A;  2ZKM X;  2L2I A;  3MDB C;  2Z0O A;  3HK0 A;  1Y19 B;  5KQ4 A;  1FOE A;  1GC7 A;  3BIN A;  5IRS A;  2KR0 A;  1AWE A;  4H8S A;  4OT1 A;  2DYQ A;  4DIX A;  2DFK A;  3A58 A;  4P7I A;  4A6K A;  3KZ1 A;  4PNK A;  3RCP A;  2COA A;  1XR0 B;  3ZDT A;  1P5T A;  3HSA A;  5D3Y A;  1BTK A;  1X05 A;  4A5K A;  2EMS A;  2R0D A;  2Z13 A;  4DX8 A;  3G9W A;  5HE2 A;  2D10 A;  3PSC A;  5JP4 A;  3OAN A;  1OQN A;  2RGN B;  1X86 A;  1NU2 A;  4CHM A;  5D3W A;  1X1G A;  4GN1 A;  2LYD A;  2YVC A;  1UPQ A;  3V5W A;  2DKP A;  5D3X A;  2YS3 A;  4YON A;  3FM8 C;  1X11 A;  4HHV A;  1NI2 A;  1WGU A;  2J0J A;  2R09 A;  3PVW A;  2L1C A;  1MK7 B;  2JP2 A;  2XQN M;  3HW2 B;  5DHA B;  1V5P A;  2DKQ A;  4CYE A;  4HSI A;  4DXA B;  1Y5O A;  3CXB B;  1W1D A;  2DYN A;  1WI1 A;  1QC6 A;  2VKI A;  2K8E A;  2D9Z A;  1DRO A;  4HAU B;  1J0W A;  2YT1 A;  4HAX B;  5HE3 A;  4K2P A;  3HIE A;  4ZRI A;  2D9W A;  4HAT B;  2D11 A;  1FGZ A;  5D27 A;  4L6E A;  3TFM A;  1EAZ A;  2D2Q A;  3U8Z A;  2CY5 A;  2DN6 A;  2I1K A;  3VIA A;  3NWD A;  4HB3 B;  4MT7 A;  5FI0 A;  3IVF A;  3O96 A;  1UNR A;  4EKU A;  3NSU A;  1FHX A;  5LON B;  1BWN A;  3HQC A;  2ROZ B;  2DA0 A;  2LOZ A;  2YT0 A;  4HAW B;  2Z4D A;  5GOW B;  4KVG B;  2ROV A;  3F0W A;  4K81 A;  2MDX A;  4QJ4 B;  5C6R A;  4TYZ A;  5J3T A;  2P0F A;  1MPH A;  1ISN A;  1DDW A;  2J0M A;  1TXD A;  1K5G B;  3D8D A;  3TO1 A;  2P8V A;  4HAV B;  4BBK A;  3BJI A;  4IFS A;  2ELB A;  2N0Y A;  2GCJ A;  2FJU B;  2H7D A;  2K2U A;  5DIF B;  2PZ1 A;  4IOY X;  2EJ8 A;  5J3Y A;  1I7A A;  3P7Z A;  1V89 A;  3SNH A;  1BTN A;  2LOX A;  1U5F A;  4KAX B;  1ZYI A;  1QQG A;  4F7G A;  2COD A;  2NZ8 B;  1FAO A;  3F5R A;  2K00 A;  5FI1 A; 
#chains in the Genus database with same CATH homology
 2LG1 A;  1MAI A;  2DLW A;  2Z0P A;  3A8P A;  1UPR A;  2G35 A;  5LOP B;  4KHO A;  4QJ5 B;  3U12 A;  2K2J A;  3DXC A;  4OSN A;  3LJU X;  3PG7 A;  4C0A A;  5M4Y B;  4HB4 B;  1M7R A;  1H10 A;  3CIK A;  3TVV A;  4D0N B;  2YS5 A;  3DXD A;  3D8E A;  2RUK B;  1MIZ B;  2DX5 A;  2MKR A;  2KIG A;  2AL6 A;  4YL8 A;  1BAK A;  5CLQ B;  2DHK A;  4HDO A;  1MIX A;  1ZVR A;  3PVL A;  2VSZ A;  3T06 A;  1ZM0 A;  2N23 A;  3AU4 A;  1K5D B;  2QKM A;  3KRW A;  3KSY A;  1U29 A;  3X23 A;  1UNP A;  2H7E A;  1EVH A;  2Y7B A;  5LG4 B;  2Y8G A;  2FJL A;  3KY9 A;  4NY0 A;  1ZC3 B;  5I2S A;  1EGX A;  3VOQ A;  4GMV A;  3PEG A;  1V5M A;  2Z0Q A;  2DTC A;  3UZT A;  1XCG A;  4B6H A;  3M1I B;  1W1G A;  4MY6 A;  4ZRJ A;  1FHW A;  1IRS A;  4KHA A;  2NBV A;  3ODO A;  2ADZ A;  1W1H A;  3U7D A;  2YT2 A;  4IAP A;  4KHB B;  5KQ1 A;  4L1R A;  5DH9 B;  2D9X A;  3N7C A;  1Z87 A;  2BCJ A;  1U5G A;  1GG3 A;  2Y8F A;  2ZPY A;  1SGH A;  4CSQ A;  4WVF B;  2COF A;  2Z14 A;  2OTX A;  3WYF B;  5L81 A;  4A6H A;  1DYN A;  3QIJ A;  4MK0 A;  4HB2 B;  3QBV B;  5C16 A;  4GXB A;  1V5U A;  1V61 A;  2W2X C;  5JHH A;  5KCV A;  4WJ7 A;  3A8Q A;  4ZRK A;  3FVC A;  4HAY B;  3WA0 A;  1RRP B;  2LUL A;  2RVB B;  1XX0 A;  2M38 A;  1U27 A;  2QKL A;  3ZVR A;  1EF1 A;  2GJY A;  3D8F A;  2V76 A;  3PVU A;  3TCA A;  2DHJ A;  4A6F B;  4EMO A;  5JLJ B;  2K49 A;  2MWN B;  1OMW A;  1I2H A;  2DX1 A;  2I5F A;  2AEH A;  2Q13 A;  5DI9 B;  2KCJ A;  1X1F A;  4CHJ A;  1LW3 A;  1UNQ A;  1U5D A;  1LB1 A;  2KUQ A;  2NMB A;  1Q67 A;  5CLL B;  2KGX B;  5EFX A;  2RLO A;  4KHB A;  1TQZ A;  2X18 A;  1GC6 A;  4DX9 0;  1XKE A;  2YF0 A;  5J3Q A;  2KIE A;  1TJ6 A;  1U2B A;  3SV1 A;  4PQ0 A;  2GCL A;  2IYB A;  3FSS A;  3SYX A;  4TKN A;  5DHF B;  4Y94 A;  3NWF A;  3PP2 A;  2HTH B;  3NWA A;  2CY4 A;  3TW1 A;  4QJ3 B;  4Z2N A;  1P6S A;  2RSG A;  4XWX A;  5D3V A;  3ML4 A;  2HE7 A;  2VRW B;  2D9V A;  2IFS A;  2KUP A;  3GYO A;  1FB8 A;  1NTV A;  2CAY A;  2ELA A;  3A98 B;  2I5C A;  4HAZ B;  3FEH A;  2GUM A;  4D6W A;  4GMX B;  3SO6 A;  2W2W A;  3SUZ A;  1KZG A;  1J19 A;  1KZ7 A;  1MK9 B;  1FGY A;  4A6F A;  5C5B B;  2RNR B;  1U5E A;  1OY2 A;  4GNK B;  1MKE A;  1ZSQ A;  2UZR A;  4NSW A;  2R2Y A;  2J59 M;  1DDV A;  1WJM A;  2Z59 A;  2YSZ A;  1XD4 A;  4Z2M B;  5HE0 A;  1M7E A;  2COC A;  1RJ2 A;  1WJ1 A;  1WGQ A;  3ODX A;  4DBB A;  2EC1 A;  1UEF A;  4K17 A;  1B55 A;  2D9Y A;  2D4Q A;  3NW8 A;  5I2M A;  3ULC A;  2W2X D;  4GPT B;  2GS0 A;  1PFJ A;  1DBH A;  1H4R A;  4F7H A;  2I1J A;  2CRF A;  3PZD A;  5JHG A;  1WVH A;  1P3R A;  2M14 A;  3P6A A;  4F7U P;  1WG7 A;  2EMT A;  3ULB A;  2UVM A;  4QXA B;  1E5W A;  1V88 A;  3AU5 A;  2P0H A;  1ZC4 B;  1FHO A;  4K2O A;  1PMS A;  1KI1 B;  3AJ4 A;  1AQC A;  2P0D A;  4HDQ A;  3OHM B;  2YS1 A;  4EJN A;  5C79 A;  1XOD A;  2UZS A;  5HE1 A;  4GOU A;  1N3H A;  5C5B A;  4HB0 B;  2DHI A;  3DXE A;  4WSF A;  4GZU A;  3MPX A;  2J0K A;  2E2X A;  1SHC A;  2LKO A;  1DDM A;  2YRY A;  3GYP A;  3QWM A;  3ODW A;  2RRF A;  2MFQ A;  2OQB A;  1NTY A;  1PLS A;  3KRX A;  2ZKM X;  2L2I A;  3MDB C;  2Z0O A;  3HK0 A;  1Y19 B;  5KQ4 A;  1FOE A;  1GC7 A;  3BIN A;  5IRS A;  2KR0 A;  1AWE A;  4H8S A;  4OT1 A;  2DYQ A;  4DIX A;  2DFK A;  3A58 A;  4P7I A;  4A6K A;  3KZ1 A;  4PNK A;  3RCP A;  2COA A;  1XR0 B;  3ZDT A;  1P5T A;  5D3Y A;  1BTK A;  1X05 A;  4A5K A;  2EMS A;  2R0D A;  2Z13 A;  4DX8 A;  3G9W A;  5HE2 A;  2D10 A;  3PSC A;  5JP4 A;  3OAN A;  1OQN A;  2RGN B;  1X86 A;  1NU2 A;  4CHM A;  5D3W A;  1X1G A;  4GN1 A;  2LYD A;  2YVC A;  1UPQ A;  3V5W A;  2DKP A;  5D3X A;  2YS3 A;  4YON A;  3FM8 C;  1X11 A;  4HHV A;  1NI2 A;  1WGU A;  2J0J A;  2R09 A;  3PVW A;  2L1C A;  1MK7 B;  2JP2 A;  2XQN M;  3HW2 B;  5DHA B;  1V5P A;  2DKQ A;  4CYE A;  4HSI A;  4DXA B;  1Y5O A;  3CXB B;  1W1D A;  2DYN A;  1WI1 A;  1QC6 A;  2VKI A;  2K8E A;  2D9Z A;  1DRO A;  4HAU B;  1J0W A;  2YT1 A;  4HAX B;  5HE3 A;  4K2P A;  3HIE A;  4ZRI A;  2D9W A;  4HAT B;  2D11 A;  1FGZ A;  5D27 A;  4L6E A;  3TFM A;  1EAZ A;  2D2Q A;  3U8Z A;  2CY5 A;  2DN6 A;  2I1K A;  3VIA A;  3NWD A;  4HB3 B;  4MT7 A;  5FI0 A;  3IVF A;  3O96 A;  1UNR A;  4EKU A;  3NSU A;  1FHX A;  5LON B;  1BWN A;  3HQC A;  2ROZ B;  2DA0 A;  2LOZ A;  2YT0 A;  4HAW B;  2Z4D A;  5GOW B;  4KVG B;  2ROV A;  3F0W A;  4K81 A;  2MDX A;  4QJ4 B;  5C6R A;  4TYZ A;  5J3T A;  2P0F A;  1MPH A;  1ISN A;  1DDW A;  2J0M A;  1TXD A;  1K5G B;  3D8D A;  3TO1 A;  2P8V A;  4HAV B;  4BBK A;  3BJI A;  4IFS A;  2ELB A;  2N0Y A;  2GCJ A;  2H7D A;  2K2U A;  2FJU B;  5DIF B;  2PZ1 A;  4IOY X;  2EJ8 A;  5J3Y A;  1I7A A;  3P7Z A;  1V89 A;  3SNH A;  1BTN A;  2LOX A;  1U5F A;  4KAX B;  1ZYI A;  1QQG A;  4F7G A;  2COD A;  2NZ8 B;  1FAO A;  3F5R A;  2K00 A;  5FI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...