3GYOA

Se-met rtt106p
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
225
Chain Sequence
MDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 48
structure length 225
sequence length 241
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gyoA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gyoA01
4IAPA 2GS0A 1W1HA 2KUPA 4DX8A 3DXDA 5J3YA 5J3QA 4KHBB 1V5UA 2DFKA 4K2PA 2QKMA 3FEHA 2R09A 2MFQA 1AWEA 3HW2B 1DROA 1K5GB 1DBHA 3VIAA 2DHKA 2KCJA 4HAZB 3RCPA 2NZ8B 2W2XD 2COCA 2D11A 3F0WA 3KSYA 3AU4A 2UZRA 2P0FA 1EVHA 2PZ1A 3P6AA 1OQNA 4HB4B 1LW3A 1U29A 1FB8A 3BJIA 2L2IA 2Z0PA 5HE0A 2LG1A 3D8DA 4C0AA 2M14A 2VRWB 2CY5A 4EKUA 3PP2A 3F5RA 1MK7B 2DHJA 5EFXA 2ZPYA 3FM8C 1BTKA 2I1KA 4DX90 4A6FB 1MIXA 5D3VA 3ODOA 2OTXA 3AJ4A 2D9XA 4K17A 3TCAA 2RGNB 4H8SA 1EF1A 3PZDA 4EMOA 2D10A 3DXEA 2J59M 3GYOA 1UNQA 2VKIA 1Q67A 2EMSA 1QQGA 2RVBB 1FAOA 1NTVA 2D9VA 2Q13A 2H7EA 5D3XA 1W1DA 4K81A 1ZC3B 1WG7A 3WA0A 1U27A 1EGXA 5C5BB 2MKRA 2GCJA 3SV1A 2V76A 2LOXA 4CHJA 3AU5A 1P6SA 4L6EA 5C79A 4HAWB 3SNHA 2NMBA 5CLQB 4KHOA 1EAZA 3PG7A 1H4RA 1PLSA 5DI9B 1FOEA 3V5WA 3IVFA 2ADZA 2HTHB 1XX0A 2KGXB 3PEGA 5CLLB 2LYDA 4MK0A 5KQ4A 1U5FA 2Z0OA 2JP2A 1PFJA 1TQZA 4GN1A 2DKPA 4HAYB 3U7DA 3ULBA 4MT7A 2G35A 3PVWA 2P0HA 3OANA 1GC6A 2LKOA 2FJLA 1U5EA 3LJUX 2RSGA 4F7HA 1DDVA 1DDMA 3A8PA 3O96A 4Z2MB 2AL6A 2Z0QA 3T06A 4PQ0A 1N3HA 2K00A 2Y8FA 4HDQA 3ODWA 3SYXA 1BTNA 5KQ1A 4HB2B 4GXBA 2I5CA 1IRSA 2DA0A 3G9WA 3X23A 2CY4A 3QWMA 3KRXA 4PNKA 4F7GA 4HB0B 5JHHA 2DHIA 1WI1A 2J0MA 3D8FA 4A6FA 3BINA 1P3RA 3KZ1A 3FSSA 3D8EA 2IYBA 3ULCA 3ZDTA 1V5MA 1TJ6A 2IFSA 4A6KA 3M1IB 5FI1A 1NU2A 2CODA 2LOZA 2COFA 3PSCA 4CHMA 4MY6A 4NSWA 4ZRKA 3P7ZA 2DX5A 1U2BA 1SHCA 2YT0A 3TFMA 4Z2NA 2YRYA 2W2WA 2L1CA 2XQNM 5DHAB 5FI0A 3HK0A 2D4QA 2EC1A 1GG3A 1KI1B 2N0YA 5J3TA 3GYPA 2BCJA 1XKEA 2DTCA 1OY2A 2DYQA 2P8VA 4HAUB 4B6HA 2Y7BA 1WJ1A 2R0DA 4TYZA 5KCVA 3VOQA 4HATB 1MIZB 1KZ7A 5C5BA 3CXBB 1XCGA 4WSFA 1FGZA 1XR0B 1DDWA 5DH9B 1ZC4B 1PMSA 3SUZA 4WVFB 2OQBA 4XWXA 1MK9B 5L81A 1UEFA 1MAIA 1RJ2A 1V61A 2ROZB 4DBBA 3MDBC 1M7EA 5JP4A 2K2JA 4HAVB 3ML4A 3HQCA 3QIJA 2AEHA 3NSUA 1B55A 1X1GA 2D9ZA 2YS5A 4HAXB 5HE3A 5DHFB 5C16A 4GMVA 3KRWA 1V89A 1U5DA 2RUKB 1RRPB 4GPTB 3TVVA 1QC6A 1NTYA 2J0JA 3MPXA 5C6RA 2YF0A 3A8QA 4KHAA 4K2OA 1UPRA 1FHWA 2D9YA 1X11A 2I5FA 3WYFB 1WGUA 1V5PA 4IFSA 4HDOA 2HE7A 2DYNA 1FHXA 1XD4A 2RNRB 1Y5OA 1KZGA 3QBVB 3CIKA 2MWNB 2X18A 2M38A 2W2XC 4YL8A 4EJNA 1H10A 1FGYA 1Y19B 1SGHA 1X05A 5HE1A 1ZSQA 2N23A 5D3WA 4TKNA 4CYEA 4DXAB 1UPQA 1J0WA 1GC7A 2COAA 1DYNA 2CRFA 3DXCA 4GZUA 2P0DA 1NI2A 2D2QA 2DN6A 4P7IA 1I7AA 2D9WA 4HB3B 2Y8GA 2UVMA 4NY0A 5JHGA 1K5DB 2UZSA 4A6HA 1W1GA 4ZRJA 1ZVRA 3PVLA 1BAKA 1MKEA 5JLJB 2J0KA 3ODXA 2MDXA 1XODA 2ELBA 4BBKA 4A5KA 2DLWA 2VSZA 3TO1A 5DIFB 1BWNA 1AQCA 2ELAA 2E2XA 1ISNA 1WJMA 2YS3A 1J19A 1U5GA 3PVUA 2I1JA 2DKQA 4GMXB 3SO6A 4Y94A 4IOYX 1X86A 1ZM0A 2YSZA 1UNPA 5LONB 3N7CA 4F7UP 1E5WA 2YVCA 4HHVA 5HE2A 1X1FA 2EMTA 4WJ7A 2ROVA 1OMWA 2EJ8A 1P5TA 4KAXB 3KY9A 3U8ZA 1I2HA 2YT1A 1MPHA 4YONA 1UNRA 3UZTA 2CAYA 1FHOA 1Z87A 2GCLA 2QKLA 2RLOA 1M7RA 5GOWB 2K2UA 4D0NB 4KVGB 1V88A 2H7DA 3TW1A 1WVHA 4ZRIA 3ZVRA 5D27A 2GJYA 1LB1A 2DX1A 5LOPB 1WGQA 1TXDA 2LULA 2YS1A 3A98B 5D3YA
chains in the Genus database with same CATH superfamily
4IAPA 2GS0A 1W1HA 2KUPA 4DX8A 3DXDA 2RRFA 4QXAB 4KHBB 5J3YA 1V5UA 2DFKA 2NBVA 2QKMA 4K2PA 4QJ5B 3FEHA 2R09A 2MFQA 1AWEA 3B77A 3HW2B 1DROA 1K5GB 1DBHA 3VIAA 2DHKA 2KCJA 2KIEA 4HAZB 3RCPA 2NZ8B 5LG4B 2W2XD 2COCA 2D11A 3F0WA 3KSYA 3AU4A 4OSNA 2UZRA 2P0FA 1EVHA 2PZ1A 3P6AA 4CSQA 1OQNA 4HSIA 4HB4B 1LW3A 1U29A 1FB8A 3BJIA 2L2IA 2Z0PA 5HE0A 2LG1A 3D8DA 4C0AA 2M14A 2VRWB 2CY5A 4EKUA 3PP2A 3F5RA 1MK7B 2DHJA 5EFXA 2ZPYA 3FM8C 1BTKA 2I1KA 3HIEA 4L1RA 4DX90 4A6FB 1MIXA 5D3VA 2YT2A 2OTXA 3AJ4A 3ODOA 2D9XA 4K17A 3TCAA 2RGNB 3DCXA 4H8SA 1EF1A 4OT1A 3PZDA 4EMOA 2D10A 3U12A 3DXEA 2J59M 3GYOA 1UNQA 2VKIA 1Q67A 2EMSA 1QQGA 4DIXA 2RVBB 1FAOA 1NTVA 2D9VA 3OHMB 2Q13A 4GOUA 2H7EA 5D3XA 1W1DA 4K81A 1ZC3B 1WG7A 3A58A 3WA0A 1U27A 5M4YB 1EGXA 5C5BB 2MKRA 2GCJA 3SV1A 5J3QA 2V76A 2LOXA 4CHJA 3AU5A 1P6SA 4L6EA 5C79A 4HAWB 3SNHA 2NMBA 5CLQB 4KHOA 1EAZA 2KIGA 3PG7A 1H4RA 1PLSA 5DI9B 1FOEA 3V5WA 3IVFA 2ADZA 2HTHB 3HSAA 1XX0A 2KGXB 3PEGA 5CLLB 3FVCA 2LYDA 4MK0A 5KQ4A 1U5FA 2Z0OA 2JP2A 1PFJA 1TQZA 4GN1A 2DKPA 4HAYB 3U7DA 3ULBA 4MT7A 2G35A 3PVWA 2P0HA 3OANA 1GC6A 2LKOA 2FJLA 1U5EA 3LJUX 2GUMA 2RSGA 4F7HA 1DDVA 1DDMA 3A8PA 3O96A 4Z2MB 2AL6A 2Z0QA 3T06A 4PQ0A 1N3HA 2K00A 2Y8FA 4HDQA 3ODWA 3SYXA 1BTNA 5KQ1A 4HB2B 4GXBA 2I5CA 1IRSA 2DA0A 3G9WA 3X23A 2CY4A 3QWMA 3KRXA 4PNKA 4F7GA 4HB0B 5JHHA 2DHIA 1WI1A 5I2MA 2J0MA 3D8FA 4A6FA 3BINA 2K8EA 1P3RA 3KZ1A 3FSSA 3D8EA 2IYBA 3ULCA 3ZDTA 1V5MA 1TJ6A 2IFSA 2Z14A 3M1IB 4A6KA 5FI1A 1NU2A 2CODA 2LOZA 2COFA 3PSCA 4CHMA 4MY6A 4NSWA 4ZRKA 3P7ZA 2DX5A 1U2BA 1SHCA 2YT0A 3TFMA 4Z2NA 2YRYA 2W2WA 2L1CA 2XQNM 5DHAB 5FI0A 2ZKMX 3HK0A 2D4QA 3NWFA 2EC1A 1GG3A 1KI1B 2N0YA 5J3TA 3GYPA 2BCJA 1XKEA 2DTCA 1OY2A 2DYQA 2P8VA 3NWDA 4HAUB 4B6HA 2Y7BA 1WJ1A 2R0DA 4TYZA 5KCVA 3VOQA 4HATB 1MIZB 1KZ7A 5IRSA 5C5BA 3CXBB 1XCGA 4WSFA 1FGZA 1XR0B 1DDWA 5DH9B 1ZC4B 1PMSA 3SUZA 4WVFB 2OQBA 4XWXA 1MK9B 5L81A 3NWAA 1UEFA 1MAIA 4GNKB 1RJ2A 1V61A 2ROZB 4DBBA 3MDBC 1M7EA 5JP4A 2K2JA 4HAVB 3ML4A 3HQCA 3QIJA 2AEHA 2KUQA 3NSUA 1B55A 1X1GA 2D9ZA 2YS5A 4HAXB 5HE3A 5DHFB 5C16A 4GMVA 3KRWA 1V89A 1U5DA 2KR0A 2RUKB 1RRPB 4GPTB 3TVVA 1QC6A 1NTYA 2J0JA 3MPXA 5C6RA 2YF0A 4D6WA 3A8QA 4KHAA 4K2OA 1T77A 1UPRA 1FHWA 2D9YA 1X11A 2I5FA 3WYFB 1WGUA 1V5PA 4IFSA 4HDOA 2HE7A 2R2YA 2DYNA 4QJ4B 1FHXA 1XD4A 2RNRB 1Y5OA 1KZGA 3QBVB 3CIKA 2MWNB 2X18A 2M38A 2W2XC 4YL8A 4EJNA 1H10A 1FGYA 1Y19B 1SGHA 1X05A 5HE1A 1ZSQA 2N23A 5D3WA 4TKNA 4CYEA 4DXAB 1UPQA 1J0WA 1GC7A 2COAA 1DYNA 2CRFA 3DXCA 4GZUA 2P0DA 1NI2A 2D2QA 2DN6A 2Z4DA 4P7IA 1I7AA 2D9WA 4HB3B 5I2SA 2Y8GA 2UVMA 4NY0A 5JHGA 1K5DB 2UZSA 4A6HA 1W1GA 4ZRJA 1ZVRA 3PVLA 1BAKA 1MKEA 5JLJB 2J0KA 3ODXA 2MDXA 1XODA 2ELBA 4BBKA 4A5KA 3NW8A 2DLWA 2Z59A 2VSZA 3TO1A 2K49A 5DIFB 1BWNA 1AQCA 2ELAA 2E2XA 2Z13A 1ISNA 1WJMA 2YS3A 1J19A 4QJ3B 1U5GA 3PVUA 1ZYIA 2I1JA 2DKQA 4GMXB 3SO6A 4Y94A 4IOYX 1X86A 1ZM0A 2YSZA 1UNPA 5LONB 3N7CA 4F7UP 1E5WA 2YVCA 4HHVA 5HE2A 1X1FA 2EMTA 4WJ7A 2ROVA 2FJUB 1OMWA 2EJ8A 1P5TA 4KAXB 3KY9A 3U8ZA 1I2HA 2YT1A 1MPHA 4YONA 1UNRA 3UZTA 2CAYA 1FHOA 1Z87A 2GCLA 2QKLA 2RLOA 1M7RA 5GOWB 2K2UA 4D0NB 4KVGB 1V88A 2H7DA 3TW1A 1WVHA 4ZRIA 3ZVRA 5D27A 2GJYA 1MI1A 1LB1A 2DX1A 5LOPB 1WGQA 1TXDA 2LULA 2YS1A 3A98B 5D3YA 4KHBA
chains in the Genus database with same CATH topology
4IAPA 2GS0A 1W1HA 2KUPA 4DX8A 3DXDA 5J3YA 5J3QA 4KHBB 2RRFA 1V5UA 2DFKA 4K2PA 2QKMA 2NBVA 4QXAB 4QJ5B 3FEHA 2R09A 2MFQA 1AWEA 3HW2B 1DROA 1K5GB 1DBHA 3VIAA 2DHKA 2KCJA 2KIEA 4HAZB 3RCPA 2NZ8B 5LG4B 2W2XD 2COCA 2D11A 3F0WA 3KSYA 3AU4A 4OSNA 2UZRA 2P0FA 1EVHA 2PZ1A 3P6AA 4CSQA 1OQNA 4HSIA 4HB4B 1LW3A 1U29A 1FB8A 3BJIA 2L2IA 2Z0PA 5HE0A 2LG1A 3D8DA 4C0AA 2M14A 2VRWB 2CY5A 4EKUA 3PP2A 3F5RA 1MK7B 2DHJA 5EFXA 2ZPYA 3FM8C 1BTKA 2I1KA 3HIEA 4L1RA 4DX90 4A6FB 1MIXA 5D3VA 3ODOA 2OTXA 3AJ4A 2YT2A 2D9XA 4K17A 3TCAA 2RGNB 4H8SA 1EF1A 4OT1A 3PZDA 4EMOA 2D10A 3U12A 3DXEA 2J59M 3GYOA 1UNQA 2VKIA 1Q67A 2EMSA 1QQGA 4DIXA 2RVBB 1FAOA 1NTVA 2D9VA 3OHMB 2Q13A 4GOUA 2H7EA 5D3XA 1W1DA 4K81A 1ZC3B 1WG7A 3A58A 3WA0A 1U27A 5M4YB 1EGXA 5C5BB 2MKRA 2GCJA 3SV1A 2V76A 2LOXA 4CHJA 3AU5A 1P6SA 4L6EA 5C79A 4HAWB 3SNHA 2NMBA 5CLQB 4KHOA 1EAZA 2KIGA 3PG7A 1H4RA 1PLSA 5DI9B 1FOEA 3V5WA 3IVFA 2ADZA 2HTHB 1XX0A 2KGXB 3PEGA 5CLLB 3FVCA 2LYDA 4MK0A 5KQ4A 1U5FA 2Z0OA 2JP2A 1PFJA 1TQZA 4GN1A 2DKPA 4HAYB 3U7DA 3ULBA 4MT7A 2G35A 3PVWA 2P0HA 3OANA 1GC6A 2LKOA 2FJLA 1U5EA 3LJUX 2GUMA 2RSGA 4F7HA 1DDVA 1DDMA 3A8PA 3O96A 4Z2MB 2AL6A 2Z0QA 3T06A 4PQ0A 1N3HA 2K00A 2Y8FA 4HDQA 3ODWA 3SYXA 1BTNA 5KQ1A 4HB2B 4GXBA 2I5CA 1IRSA 2DA0A 3G9WA 3X23A 2CY4A 3QWMA 3KRXA 4PNKA 4F7GA 4HB0B 5JHHA 2DHIA 1WI1A 5I2MA 2J0MA 3D8FA 4A6FA 3BINA 2K8EA 1P3RA 3KZ1A 3FSSA 3D8EA 2IYBA 3ULCA 3ZDTA 1V5MA 1TJ6A 2IFSA 4A6KA 3M1IB 2Z14A 5FI1A 1NU2A 2CODA 2LOZA 2COFA 3PSCA 4CHMA 4MY6A 4NSWA 4ZRKA 3P7ZA 2DX5A 1U2BA 1SHCA 2YT0A 3TFMA 4Z2NA 2YRYA 2W2WA 2L1CA 2XQNM 5DHAB 5FI0A 2ZKMX 3HK0A 2D4QA 3NWFA 2EC1A 1GG3A 1KI1B 2N0YA 5J3TA 3GYPA 2BCJA 1XKEA 2DTCA 1OY2A 2DYQA 2P8VA 3NWDA 4HAUB 4B6HA 2Y7BA 1WJ1A 2R0DA 4TYZA 5KCVA 3VOQA 4HATB 1MIZB 1KZ7A 5IRSA 5C5BA 3CXBB 1XCGA 4WSFA 1FGZA 1XR0B 1DDWA 5DH9B 1ZC4B 1PMSA 3SUZA 4WVFB 2OQBA 4XWXA 1MK9B 5L81A 3NWAA 1UEFA 1MAIA 4GNKB 1RJ2A 1V61A 2ROZB 4DBBA 3MDBC 1M7EA 5JP4A 2K2JA 4HAVB 3ML4A 3HQCA 3QIJA 2AEHA 2KUQA 3NSUA 1B55A 1X1GA 2D9ZA 2YS5A 4HAXB 5HE3A 5DHFB 5C16A 4GMVA 3KRWA 1V89A 1U5DA 2RUKB 2KR0A 1RRPB 4GPTB 3TVVA 1QC6A 1NTYA 2J0JA 3MPXA 5C6RA 2YF0A 4D6WA 3A8QA 4KHAA 4K2OA 1UPRA 1FHWA 2D9YA 1X11A 2I5FA 3WYFB 1WGUA 1V5PA 4IFSA 4HDOA 2HE7A 2R2YA 2DYNA 4QJ4B 1FHXA 1XD4A 2RNRB 1Y5OA 1KZGA 3QBVB 3CIKA 2MWNB 2X18A 2M38A 2W2XC 4YL8A 4EJNA 1H10A 1FGYA 1Y19B 1SGHA 1X05A 5HE1A 1ZSQA 2N23A 5D3WA 4TKNA 4CYEA 4DXAB 1UPQA 1J0WA 1GC7A 2COAA 1DYNA 2CRFA 3DXCA 4GZUA 2P0DA 1NI2A 2D2QA 2DN6A 4P7IA 2Z4DA 1I7AA 2D9WA 4HB3B 5I2SA 2Y8GA 2UVMA 4NY0A 5JHGA 1K5DB 2UZSA 4A6HA 1W1GA 4ZRJA 1ZVRA 3PVLA 1BAKA 1MKEA 5JLJB 2J0KA 3ODXA 2MDXA 1XODA 2ELBA 4BBKA 4A5KA 3NW8A 2DLWA 2Z59A 2VSZA 3TO1A 5DIFB 2K49A 1BWNA 1AQCA 2ELAA 2E2XA 2Z13A 1ISNA 1WJMA 2YS3A 1J19A 4QJ3B 1U5GA 3PVUA 1ZYIA 2I1JA 2DKQA 4GMXB 3SO6A 4Y94A 4IOYX 1X86A 1ZM0A 2YSZA 1UNPA 5LONB 3N7CA 4F7UP 1E5WA 2YVCA 4HHVA 5HE2A 1X1FA 2EMTA 4WJ7A 2ROVA 2FJUB 1OMWA 2EJ8A 1P5TA 4KAXB 3KY9A 3U8ZA 1I2HA 2YT1A 1MPHA 4YONA 1UNRA 3UZTA 2CAYA 1FHOA 1Z87A 2GCLA 2QKLA 2RLOA 1M7RA 5GOWB 2K2UA 4D0NB 4KVGB 1V88A 2H7DA 3TW1A 1WVHA 4ZRIA 3ZVRA 5D27A 2GJYA 1LB1A 2DX1A 5LOPB 1WGQA 1TXDA 2LULA 2YS1A 3A98B 5D3YA 4KHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  2GS0 A;  1W1H A;  2KUP A;  4DX8 A;  3DXD A;  5J3Y A;  5J3Q A;  4KHB B;  1V5U A;  2DFK A;  4K2P A;  2QKM A;  3FEH A;  2R09 A;  2MFQ A;  1AWE A;  3HW2 B;  1DRO A;  1K5G B;  1DBH A;  3VIA A;  2DHK A;  2KCJ A;  4HAZ B;  3RCP A;  2NZ8 B;  2W2X D;  2COC A;  2D11 A;  3F0W A;  3KSY A;  3AU4 A;  2UZR A;  2P0F A;  1EVH A;  2PZ1 A;  3P6A A;  1OQN A;  4HB4 B;  1LW3 A;  1U29 A;  1FB8 A;  3BJI A;  2L2I A;  2Z0P A;  5HE0 A;  2LG1 A;  3D8D A;  4C0A A;  2M14 A;  2VRW B;  2CY5 A;  4EKU A;  3PP2 A;  3F5R A;  1MK7 B;  2DHJ A;  5EFX A;  2ZPY A;  3FM8 C;  1BTK A;  2I1K A;  4DX9 0;  4A6F B;  1MIX A;  5D3V A;  3ODO A;  2OTX A;  3AJ4 A;  2D9X A;  4K17 A;  3TCA A;  2RGN B;  4H8S A;  1EF1 A;  3PZD A;  4EMO A;  2D10 A;  3DXE A;  2J59 M;  3GYO A;  1UNQ A;  2VKI A;  1Q67 A;  2EMS A;  1QQG A;  2RVB B;  1FAO A;  1NTV A;  2D9V A;  2Q13 A;  2H7E A;  5D3X A;  1W1D A;  4K81 A;  1ZC3 B;  1WG7 A;  3WA0 A;  1U27 A;  1EGX A;  5C5B B;  2MKR A;  2GCJ A;  3SV1 A;  2V76 A;  2LOX A;  4CHJ A;  3AU5 A;  1P6S A;  4L6E A;  5C79 A;  4HAW B;  3SNH A;  2NMB A;  5CLQ B;  4KHO A;  1EAZ A;  3PG7 A;  1H4R A;  1PLS A;  5DI9 B;  1FOE A;  3V5W A;  3IVF A;  2ADZ A;  2HTH B;  1XX0 A;  2KGX B;  3PEG A;  5CLL B;  2LYD A;  4MK0 A;  5KQ4 A;  1U5F A;  2Z0O A;  2JP2 A;  1PFJ A;  1TQZ A;  4GN1 A;  2DKP A;  4HAY B;  3U7D A;  3ULB A;  4MT7 A;  2G35 A;  3PVW A;  2P0H A;  3OAN A;  1GC6 A;  2LKO A;  2FJL A;  1U5E A;  3LJU X;  2RSG A;  4F7H A;  1DDV A;  1DDM A;  3A8P A;  3O96 A;  4Z2M B;  2AL6 A;  2Z0Q A;  3T06 A;  4PQ0 A;  1N3H A;  2K00 A;  2Y8F A;  4HDQ A;  3ODW A;  3SYX A;  1BTN A;  5KQ1 A;  4HB2 B;  4GXB A;  2I5C A;  1IRS A;  2DA0 A;  3G9W A;  3X23 A;  2CY4 A;  3QWM A;  3KRX A;  4PNK A;  4F7G A;  4HB0 B;  5JHH A;  2DHI A;  1WI1 A;  2J0M A;  3D8F A;  4A6F A;  3BIN A;  1P3R A;  3KZ1 A;  3FSS A;  3D8E A;  2IYB A;  3ULC A;  3ZDT A;  1V5M A;  1TJ6 A;  2IFS A;  4A6K A;  3M1I B;  5FI1 A;  1NU2 A;  2COD A;  2LOZ A;  2COF A;  3PSC A;  4CHM A;  4MY6 A;  4NSW A;  4ZRK A;  3P7Z A;  2DX5 A;  1U2B A;  1SHC A;  2YT0 A;  3TFM A;  4Z2N A;  2YRY A;  2W2W A;  2L1C A;  2XQN M;  5DHA B;  5FI0 A;  3HK0 A;  2D4Q A;  2EC1 A;  1GG3 A;  1KI1 B;  2N0Y A;  5J3T A;  3GYP A;  2BCJ A;  1XKE A;  2DTC A;  1OY2 A;  2DYQ A;  2P8V A;  4HAU B;  4B6H A;  2Y7B A;  1WJ1 A;  2R0D A;  4TYZ A;  5KCV A;  3VOQ A;  4HAT B;  1MIZ B;  1KZ7 A;  5C5B A;  3CXB B;  1XCG A;  4WSF A;  1FGZ A;  1XR0 B;  1DDW A;  5DH9 B;  1ZC4 B;  1PMS A;  3SUZ A;  4WVF B;  2OQB A;  4XWX A;  1MK9 B;  5L81 A;  1UEF A;  1MAI A;  1RJ2 A;  1V61 A;  2ROZ B;  4DBB A;  3MDB C;  1M7E A;  5JP4 A;  2K2J A;  4HAV B;  3ML4 A;  3HQC A;  3QIJ A;  2AEH A;  3NSU A;  1B55 A;  1X1G A;  2D9Z A;  2YS5 A;  4HAX B;  5HE3 A;  5DHF B;  5C16 A;  4GMV A;  3KRW A;  1V89 A;  1U5D A;  2RUK B;  1RRP B;  4GPT B;  3TVV A;  1QC6 A;  1NTY A;  2J0J A;  3MPX A;  5C6R A;  2YF0 A;  3A8Q A;  4KHA A;  4K2O A;  1UPR A;  1FHW A;  2D9Y A;  1X11 A;  2I5F A;  3WYF B;  1WGU A;  1V5P A;  4IFS A;  4HDO A;  2HE7 A;  2DYN A;  1FHX A;  1XD4 A;  2RNR B;  1Y5O A;  1KZG A;  3QBV B;  3CIK A;  2MWN B;  2X18 A;  2M38 A;  2W2X C;  4YL8 A;  4EJN A;  1H10 A;  1FGY A;  1Y19 B;  1SGH A;  1X05 A;  5HE1 A;  1ZSQ A;  2N23 A;  5D3W A;  4TKN A;  4CYE A;  4DXA B;  1UPQ A;  1J0W A;  1GC7 A;  2COA A;  1DYN A;  2CRF A;  3DXC A;  4GZU A;  2P0D A;  1NI2 A;  2D2Q A;  2DN6 A;  4P7I A;  1I7A A;  2D9W A;  4HB3 B;  2Y8G A;  2UVM A;  4NY0 A;  5JHG A;  1K5D B;  2UZS A;  4A6H A;  1W1G A;  4ZRJ A;  1ZVR A;  3PVL A;  1BAK A;  1MKE A;  5JLJ B;  2J0K A;  3ODX A;  2MDX A;  1XOD A;  2ELB A;  4BBK A;  4A5K A;  2DLW A;  2VSZ A;  3TO1 A;  5DIF B;  1BWN A;  1AQC A;  2ELA A;  2E2X A;  1ISN A;  1WJM A;  2YS3 A;  1J19 A;  1U5G A;  3PVU A;  2I1J A;  2DKQ A;  4GMX B;  3SO6 A;  4Y94 A;  4IOY X;  1X86 A;  1ZM0 A;  2YSZ A;  1UNP A;  5LON B;  3N7C A;  4F7U P;  1E5W A;  2YVC A;  4HHV A;  5HE2 A;  1X1F A;  2EMT A;  4WJ7 A;  2ROV A;  1OMW A;  2EJ8 A;  1P5T A;  4KAX B;  3KY9 A;  3U8Z A;  1I2H A;  2YT1 A;  1MPH A;  4YON A;  1UNR A;  3UZT A;  2CAY A;  1FHO A;  1Z87 A;  2GCL A;  2QKL A;  2RLO A;  1M7R A;  5GOW B;  2K2U A;  4D0N B;  4KVG B;  1V88 A;  2H7D A;  3TW1 A;  1WVH A;  4ZRI A;  3ZVR A;  5D27 A;  2GJY A;  1LB1 A;  2DX1 A;  5LOP B;  1WGQ A;  1TXD A;  2LUL A;  2YS1 A;  3A98 B;  5D3Y A; 
#chains in the Genus database with same CATH topology
 4IAP A;  2GS0 A;  1W1H A;  2KUP A;  4DX8 A;  3DXD A;  2RRF A;  4QXA B;  4KHB B;  5J3Y A;  1V5U A;  2DFK A;  2NBV A;  2QKM A;  4K2P A;  4QJ5 B;  3FEH A;  2R09 A;  2MFQ A;  1AWE A;  3B77 A;  3HW2 B;  1DRO A;  1K5G B;  1DBH A;  3VIA A;  2DHK A;  2KCJ A;  2KIE A;  4HAZ B;  3RCP A;  2NZ8 B;  5LG4 B;  2W2X D;  2COC A;  2D11 A;  3F0W A;  3KSY A;  3AU4 A;  4OSN A;  2UZR A;  2P0F A;  1EVH A;  2PZ1 A;  3P6A A;  4CSQ A;  1OQN A;  4HSI A;  4HB4 B;  1LW3 A;  1U29 A;  1FB8 A;  3BJI A;  2L2I A;  2Z0P A;  5HE0 A;  2LG1 A;  3D8D A;  4C0A A;  2M14 A;  2VRW B;  2CY5 A;  4EKU A;  3PP2 A;  3F5R A;  1MK7 B;  2DHJ A;  5EFX A;  2ZPY A;  3FM8 C;  1BTK A;  2I1K A;  3HIE A;  4L1R A;  4DX9 0;  4A6F B;  1MIX A;  5D3V A;  2YT2 A;  2OTX A;  3AJ4 A;  3ODO A;  2D9X A;  4K17 A;  3TCA A;  2RGN B;  3DCX A;  4H8S A;  1EF1 A;  4OT1 A;  3PZD A;  4EMO A;  2D10 A;  3U12 A;  3DXE A;  2J59 M;  3GYO A;  1UNQ A;  2VKI A;  1Q67 A;  2EMS A;  1QQG A;  4DIX A;  2RVB B;  1FAO A;  1NTV A;  2D9V A;  3OHM B;  2Q13 A;  4GOU A;  2H7E A;  5D3X A;  1W1D A;  4K81 A;  1ZC3 B;  1WG7 A;  3A58 A;  3WA0 A;  1U27 A;  5M4Y B;  1EGX A;  5C5B B;  2MKR A;  2GCJ A;  3SV1 A;  5J3Q A;  2V76 A;  2LOX A;  4CHJ A;  3AU5 A;  1P6S A;  4L6E A;  5C79 A;  4HAW B;  3SNH A;  2NMB A;  5CLQ B;  4KHO A;  1EAZ A;  2KIG A;  3PG7 A;  1H4R A;  1PLS A;  5DI9 B;  1FOE A;  3V5W A;  3IVF A;  2ADZ A;  2HTH B;  3HSA A;  1XX0 A;  2KGX B;  3PEG A;  5CLL B;  3FVC A;  2LYD A;  4MK0 A;  5KQ4 A;  1U5F A;  2Z0O A;  2JP2 A;  1PFJ A;  1TQZ A;  4GN1 A;  2DKP A;  4HAY B;  3U7D A;  3ULB A;  4MT7 A;  2G35 A;  3PVW A;  2P0H A;  3OAN A;  1GC6 A;  2LKO A;  2FJL A;  1U5E A;  3LJU X;  2GUM A;  2RSG A;  4F7H A;  1DDV A;  1DDM A;  3A8P A;  3O96 A;  4Z2M B;  2AL6 A;  2Z0Q A;  3T06 A;  4PQ0 A;  1N3H A;  2K00 A;  2Y8F A;  4HDQ A;  3ODW A;  3SYX A;  1BTN A;  5KQ1 A;  4HB2 B;  4GXB A;  2I5C A;  1IRS A;  2DA0 A;  3G9W A;  3X23 A;  2CY4 A;  3QWM A;  3KRX A;  4PNK A;  4F7G A;  4HB0 B;  5JHH A;  2DHI A;  1WI1 A;  5I2M A;  2J0M A;  3D8F A;  4A6F A;  3BIN A;  2K8E A;  1P3R A;  3KZ1 A;  3FSS A;  3D8E A;  2IYB A;  3ULC A;  3ZDT A;  1V5M A;  1TJ6 A;  2IFS A;  2Z14 A;  3M1I B;  4A6K A;  5FI1 A;  1NU2 A;  2COD A;  2LOZ A;  2COF A;  3PSC A;  4CHM A;  4MY6 A;  4NSW A;  4ZRK A;  3P7Z A;  2DX5 A;  1U2B A;  1SHC A;  2YT0 A;  3TFM A;  4Z2N A;  2YRY A;  2W2W A;  2L1C A;  2XQN M;  5DHA B;  5FI0 A;  2ZKM X;  3HK0 A;  2D4Q A;  3NWF A;  2EC1 A;  1GG3 A;  1KI1 B;  2N0Y A;  5J3T A;  3GYP A;  2BCJ A;  1XKE A;  2DTC A;  1OY2 A;  2DYQ A;  2P8V A;  3NWD A;  4HAU B;  4B6H A;  2Y7B A;  1WJ1 A;  2R0D A;  4TYZ A;  5KCV A;  3VOQ A;  4HAT B;  1MIZ B;  1KZ7 A;  5IRS A;  5C5B A;  3CXB B;  1XCG A;  4WSF A;  1FGZ A;  1XR0 B;  1DDW A;  5DH9 B;  1ZC4 B;  1PMS A;  3SUZ A;  4WVF B;  2OQB A;  4XWX A;  1MK9 B;  5L81 A;  3NWA A;  1UEF A;  1MAI A;  4GNK B;  1RJ2 A;  1V61 A;  2ROZ B;  4DBB A;  3MDB C;  1M7E A;  5JP4 A;  2K2J A;  4HAV B;  3ML4 A;  3HQC A;  3QIJ A;  2AEH A;  2KUQ A;  3NSU A;  1B55 A;  1X1G A;  2D9Z A;  2YS5 A;  4HAX B;  5HE3 A;  5DHF B;  5C16 A;  4GMV A;  3KRW A;  1V89 A;  1U5D A;  2KR0 A;  2RUK B;  1RRP B;  4GPT B;  3TVV A;  1QC6 A;  1NTY A;  2J0J A;  3MPX A;  5C6R A;  2YF0 A;  4D6W A;  3A8Q A;  4KHA A;  4K2O A;  1T77 A;  1UPR A;  1FHW A;  2D9Y A;  1X11 A;  2I5F A;  3WYF B;  1WGU A;  1V5P A;  4IFS A;  4HDO A;  2HE7 A;  2R2Y A;  2DYN A;  4QJ4 B;  1FHX A;  1XD4 A;  2RNR B;  1Y5O A;  1KZG A;  3QBV B;  3CIK A;  2MWN B;  2X18 A;  2M38 A;  2W2X C;  4YL8 A;  4EJN A;  1H10 A;  1FGY A;  1Y19 B;  1SGH A;  1X05 A;  5HE1 A;  1ZSQ A;  2N23 A;  5D3W A;  4TKN A;  4CYE A;  4DXA B;  1UPQ A;  1J0W A;  1GC7 A;  2COA A;  1DYN A;  2CRF A;  3DXC A;  4GZU A;  2P0D A;  1NI2 A;  2D2Q A;  2DN6 A;  2Z4D A;  4P7I A;  1I7A A;  2D9W A;  4HB3 B;  5I2S A;  2Y8G A;  2UVM A;  4NY0 A;  5JHG A;  1K5D B;  2UZS A;  4A6H A;  1W1G A;  4ZRJ A;  1ZVR A;  3PVL A;  1BAK A;  1MKE A;  5JLJ B;  2J0K A;  3ODX A;  2MDX A;  1XOD A;  2ELB A;  4BBK A;  4A5K A;  3NW8 A;  2DLW A;  2Z59 A;  2VSZ A;  3TO1 A;  2K49 A;  5DIF B;  1BWN A;  1AQC A;  2ELA A;  2E2X A;  2Z13 A;  1ISN A;  1WJM A;  2YS3 A;  1J19 A;  4QJ3 B;  1U5G A;  3PVU A;  1ZYI A;  2I1J A;  2DKQ A;  4GMX B;  3SO6 A;  4Y94 A;  4IOY X;  1X86 A;  1ZM0 A;  2YSZ A;  1UNP A;  5LON B;  3N7C A;  4F7U P;  1E5W A;  2YVC A;  4HHV A;  5HE2 A;  1X1F A;  2EMT A;  4WJ7 A;  2ROV A;  2FJU B;  1OMW A;  2EJ8 A;  1P5T A;  4KAX B;  3KY9 A;  3U8Z A;  1I2H A;  2YT1 A;  1MPH A;  4YON A;  1UNR A;  3UZT A;  2CAY A;  1FHO A;  1Z87 A;  2GCL A;  2QKL A;  2RLO A;  1M7R A;  5GOW B;  2K2U A;  4D0N B;  4KVG B;  1V88 A;  2H7D A;  3TW1 A;  1WVH A;  4ZRI A;  3ZVR A;  5D27 A;  2GJY A;  1MI1 A;  1LB1 A;  2DX1 A;  5LOP B;  1WGQ A;  1TXD A;  2LUL A;  2YS1 A;  3A98 B;  5D3Y A;  4KHB A; 
#chains in the Genus database with same CATH homology
 4IAP A;  2GS0 A;  1W1H A;  2KUP A;  4DX8 A;  3DXD A;  5J3Y A;  5J3Q A;  4KHB B;  2RRF A;  1V5U A;  2DFK A;  4K2P A;  2QKM A;  2NBV A;  4QXA B;  4QJ5 B;  3FEH A;  2R09 A;  2MFQ A;  1AWE A;  3HW2 B;  1DRO A;  1K5G B;  1DBH A;  3VIA A;  2DHK A;  2KCJ A;  2KIE A;  4HAZ B;  3RCP A;  2NZ8 B;  5LG4 B;  2W2X D;  2COC A;  2D11 A;  3F0W A;  3KSY A;  3AU4 A;  4OSN A;  2UZR A;  2P0F A;  1EVH A;  2PZ1 A;  3P6A A;  4CSQ A;  1OQN A;  4HSI A;  4HB4 B;  1LW3 A;  1U29 A;  1FB8 A;  3BJI A;  2L2I A;  2Z0P A;  5HE0 A;  2LG1 A;  3D8D A;  4C0A A;  2M14 A;  2VRW B;  2CY5 A;  4EKU A;  3PP2 A;  3F5R A;  1MK7 B;  2DHJ A;  5EFX A;  2ZPY A;  3FM8 C;  1BTK A;  2I1K A;  3HIE A;  4L1R A;  4DX9 0;  4A6F B;  1MIX A;  5D3V A;  3ODO A;  2OTX A;  3AJ4 A;  2YT2 A;  2D9X A;  4K17 A;  3TCA A;  2RGN B;  4H8S A;  1EF1 A;  4OT1 A;  3PZD A;  4EMO A;  2D10 A;  3U12 A;  3DXE A;  2J59 M;  3GYO A;  1UNQ A;  2VKI A;  1Q67 A;  2EMS A;  1QQG A;  4DIX A;  2RVB B;  1FAO A;  1NTV A;  2D9V A;  3OHM B;  2Q13 A;  4GOU A;  2H7E A;  5D3X A;  1W1D A;  4K81 A;  1ZC3 B;  1WG7 A;  3A58 A;  3WA0 A;  1U27 A;  5M4Y B;  1EGX A;  5C5B B;  2MKR A;  2GCJ A;  3SV1 A;  2V76 A;  2LOX A;  4CHJ A;  3AU5 A;  1P6S A;  4L6E A;  5C79 A;  4HAW B;  3SNH A;  2NMB A;  5CLQ B;  4KHO A;  1EAZ A;  2KIG A;  3PG7 A;  1H4R A;  1PLS A;  5DI9 B;  1FOE A;  3V5W A;  3IVF A;  2ADZ A;  2HTH B;  1XX0 A;  2KGX B;  3PEG A;  5CLL B;  3FVC A;  2LYD A;  4MK0 A;  5KQ4 A;  1U5F A;  2Z0O A;  2JP2 A;  1PFJ A;  1TQZ A;  4GN1 A;  2DKP A;  4HAY B;  3U7D A;  3ULB A;  4MT7 A;  2G35 A;  3PVW A;  2P0H A;  3OAN A;  1GC6 A;  2LKO A;  2FJL A;  1U5E A;  3LJU X;  2GUM A;  2RSG A;  4F7H A;  1DDV A;  1DDM A;  3A8P A;  3O96 A;  4Z2M B;  2AL6 A;  2Z0Q A;  3T06 A;  4PQ0 A;  1N3H A;  2K00 A;  2Y8F A;  4HDQ A;  3ODW A;  3SYX A;  1BTN A;  5KQ1 A;  4HB2 B;  4GXB A;  2I5C A;  1IRS A;  2DA0 A;  3G9W A;  3X23 A;  2CY4 A;  3QWM A;  3KRX A;  4PNK A;  4F7G A;  4HB0 B;  5JHH A;  2DHI A;  1WI1 A;  5I2M A;  2J0M A;  3D8F A;  4A6F A;  3BIN A;  2K8E A;  1P3R A;  3KZ1 A;  3FSS A;  3D8E A;  2IYB A;  3ULC A;  3ZDT A;  1V5M A;  1TJ6 A;  2IFS A;  4A6K A;  3M1I B;  2Z14 A;  5FI1 A;  1NU2 A;  2COD A;  2LOZ A;  2COF A;  3PSC A;  4CHM A;  4MY6 A;  4NSW A;  4ZRK A;  3P7Z A;  2DX5 A;  1U2B A;  1SHC A;  2YT0 A;  3TFM A;  4Z2N A;  2YRY A;  2W2W A;  2L1C A;  2XQN M;  5DHA B;  5FI0 A;  2ZKM X;  3HK0 A;  2D4Q A;  3NWF A;  2EC1 A;  1GG3 A;  1KI1 B;  2N0Y A;  5J3T A;  3GYP A;  2BCJ A;  1XKE A;  2DTC A;  1OY2 A;  2DYQ A;  2P8V A;  3NWD A;  4HAU B;  4B6H A;  2Y7B A;  1WJ1 A;  2R0D A;  4TYZ A;  5KCV A;  3VOQ A;  4HAT B;  1MIZ B;  1KZ7 A;  5IRS A;  5C5B A;  3CXB B;  1XCG A;  4WSF A;  1FGZ A;  1XR0 B;  1DDW A;  5DH9 B;  1ZC4 B;  1PMS A;  3SUZ A;  4WVF B;  2OQB A;  4XWX A;  1MK9 B;  5L81 A;  3NWA A;  1UEF A;  1MAI A;  4GNK B;  1RJ2 A;  1V61 A;  2ROZ B;  4DBB A;  3MDB C;  1M7E A;  5JP4 A;  2K2J A;  4HAV B;  3ML4 A;  3HQC A;  3QIJ A;  2AEH A;  2KUQ A;  3NSU A;  1B55 A;  1X1G A;  2D9Z A;  2YS5 A;  4HAX B;  5HE3 A;  5DHF B;  5C16 A;  4GMV A;  3KRW A;  1V89 A;  1U5D A;  2RUK B;  2KR0 A;  1RRP B;  4GPT B;  3TVV A;  1QC6 A;  1NTY A;  2J0J A;  3MPX A;  5C6R A;  2YF0 A;  4D6W A;  3A8Q A;  4KHA A;  4K2O A;  1UPR A;  1FHW A;  2D9Y A;  1X11 A;  2I5F A;  3WYF B;  1WGU A;  1V5P A;  4IFS A;  4HDO A;  2HE7 A;  2R2Y A;  2DYN A;  4QJ4 B;  1FHX A;  1XD4 A;  2RNR B;  1Y5O A;  1KZG A;  3QBV B;  3CIK A;  2MWN B;  2X18 A;  2M38 A;  2W2X C;  4YL8 A;  4EJN A;  1H10 A;  1FGY A;  1Y19 B;  1SGH A;  1X05 A;  5HE1 A;  1ZSQ A;  2N23 A;  5D3W A;  4TKN A;  4CYE A;  4DXA B;  1UPQ A;  1J0W A;  1GC7 A;  2COA A;  1DYN A;  2CRF A;  3DXC A;  4GZU A;  2P0D A;  1NI2 A;  2D2Q A;  2DN6 A;  4P7I A;  2Z4D A;  1I7A A;  2D9W A;  4HB3 B;  5I2S A;  2Y8G A;  2UVM A;  4NY0 A;  5JHG A;  1K5D B;  2UZS A;  4A6H A;  1W1G A;  4ZRJ A;  1ZVR A;  3PVL A;  1BAK A;  1MKE A;  5JLJ B;  2J0K A;  3ODX A;  2MDX A;  1XOD A;  2ELB A;  4BBK A;  4A5K A;  3NW8 A;  2DLW A;  2Z59 A;  2VSZ A;  3TO1 A;  5DIF B;  2K49 A;  1BWN A;  1AQC A;  2ELA A;  2E2X A;  2Z13 A;  1ISN A;  1WJM A;  2YS3 A;  1J19 A;  4QJ3 B;  1U5G A;  3PVU A;  1ZYI A;  2I1J A;  2DKQ A;  4GMX B;  3SO6 A;  4Y94 A;  4IOY X;  1X86 A;  1ZM0 A;  2YSZ A;  1UNP A;  5LON B;  3N7C A;  4F7U P;  1E5W A;  2YVC A;  4HHV A;  5HE2 A;  1X1F A;  2EMT A;  4WJ7 A;  2ROV A;  2FJU B;  1OMW A;  2EJ8 A;  1P5T A;  4KAX B;  3KY9 A;  3U8Z A;  1I2H A;  2YT1 A;  1MPH A;  4YON A;  1UNR A;  3UZT A;  2CAY A;  1FHO A;  1Z87 A;  2GCL A;  2QKL A;  2RLO A;  1M7R A;  5GOW B;  2K2U A;  4D0N B;  4KVG B;  1V88 A;  2H7D A;  3TW1 A;  1WVH A;  4ZRI A;  3ZVR A;  5D27 A;  2GJY A;  1LB1 A;  2DX1 A;  5LOP B;  1WGQ A;  1TXD A;  2LUL A;  2YS1 A;  3A98 B;  5D3Y A;  4KHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...