5KQ1A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
total genus 36
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq1A00
2COFA 2DKPA 5FI0A 3ODWA 3V5WA 1UNRA 2LYDA 4A6KA 3KRXA 2M38A 3OANA 2ELAA 2DYQA 3AU5A 4GN1A 3LJUX 1H4RA 1J0WA 1K5DB 4GZUA 2DX5A 2YRYA 4HB3B 1SHCA 5C6RA 2R0DA 4K81A 5C79A 3IVFA 1DBHA 1U5FA 1BTNA 3PEGA 2EC1A 4KAXB 4TYZA 2L2IA 2H7DA 1ZC3B 3SV1A 1X86A 2MKRA 5DHFB 4D0NB 5C5BB 3ODOA 2H7EA 2V76A 3BJIA 1PLSA 1AQCA 2W2XC 5JHGA 4ZRKA 1I7AA 4L6EA 2NZ8B 5D27A 2YT0A 1M7EA 1EGXA 4B6HA 5D3WA 3KY9A 4IAPA 3TW1A 4H8SA 2D2QA 4K2PA 3TFMA 3VOQA 5JP4A 2LOZA 1X1FA 1U5DA 5DHAB 3ML4A 2RNRB 2LULA 3F5RA 5L81A 2DHKA 2G35A 5KCVA 2K2JA 3F0WA 1NU2A 2CY4A 1QC6A 1ZC4B 5HE2A 3WA0A 1WVHA 1DROA 5CLQB 1P3RA 2Q13A 1TXDA 4CHJA 4DX8A 1XKEA 1BTKA 5EFXA 1U2BA 2K2UA 2MDXA 2DLWA 4KHBB 1W1GA 2DYNA 1DDWA 2VKIA 4DXAB 4NY0A 3PZDA 2COAA 3DXCA 2D9WA 1FGYA 1W1HA 2D9YA 3T06A 1U27A 1MK9B 1FGZA 1ZSQA 3MPXA 4CYEA 2GCJA 1NTVA 3WYFB 3FEHA 1DYNA 1M7RA 4GMVA 5GOWB 5J3TA 1AWEA 1U29A 3TO1A 3HK0A 2AEHA 2YVCA 4F7HA 1IRSA 1PMSA 2D9VA 2K00A 2MWNB 3ZDTA 3PVUA 5C5BA 4WSFA 3QIJA 3KRWA 5C16A 1UNQA 3P7ZA 3CXBB 3HQCA 2UZRA 5LOPB 2Z0PA 2BCJA 2PZ1A 1LW3A 5FI1A 2P0DA 2KGXB 4Z2MB 3ULCA 2AL6A 1WGQA 2VSZA 1SGHA 2IYBA 1RJ2A 2N0YA 3A98B 2GCLA 1DDVA 1J19A 2D9XA 2IFSA 4CHMA 3PG7A 1FOEA 1EVHA 1PFJA 4C0AA 4MT7A 1Y19B 2DA0A 4YONA 4MY6A 4A6FA 2CAYA 1MIZB 4PNKA 2X18A 2Z0OA 4HAVB 1BAKA 1TJ6A 2RSGA 4HB0B 3P6AA 3M1IB 4A5KA 2NMBA 1ZM0A 2YS3A 1EF1A 5D3VA 3ODXA 5CLLB 1I2HA 1X11A 2KUPA 4HATB 1H10A 4EKUA 2Y8GA 2I5CA 3PSCA 2W2WA 2Y7BA 1UPRA 4EMOA 1FB8A 1P6SA 3D8DA 2GJYA 5JLJB 2DN6A 2EMTA 4MK0A 1ZVRA 1X05A 2J59M 3SO6A 4KHAA 1KI1B 3FM8C 2D4QA 4A6FB 1TQZA 1KZGA 1Q67A 4K17A 4HHVA 1OQNA 1NI2A 1WGUA 1XX0A 1WG7A 3PP2A 2W2XD 3KSYA 2DHIA 2N23A 1FAOA 4ZRIA 3GYPA 2RLOA 3AU4A 1N3HA 1WI1A 2XQNM 4BBKA 2R09A 4GXBA 2HTHB 3MDBC 3NSUA 3HW2B 1V89A 3SNHA 2CODA 3TVVA 4HDQA 3VIAA 5HE0A 3QBVB 3A8QA 1V5PA 1WJMA 3DXDA 3N7CA 5KQ4A 2CRFA 5J3QA 1GG3A 1V88A 1Y5OA 2VRWB 2CY5A 1MAIA 2J0KA 3BINA 3CIKA 4IFSA 5LONB 2I1KA 2J0MA 2DFKA 4DX90 3KZ1A 1XODA 2YF0A 1FHOA 5HE3A 1RRPB 2E2XA 1W1DA 5DI9B 5J3YA 4EJNA 5D3YA 3TCAA 2LG1A 2DKQA 2COCA 2J0JA 2MFQA 3DXEA 4YL8A 2ROZB 1UNPA 2P0HA 1KZ7A 1OY2A 2Z0QA 1V5MA 4HAZB 2ELBA 2EMSA 1XD4A 2UVMA 1FHWA 1MPHA 2OQBA 5JHHA 1QQGA 2EJ8A 1X1GA 4WVFB 1P5TA 4GPTB 5D3XA 1UPQA 2GS0A 2YT1A 4HB2B 3QWMA 3D8EA 2KCJA 2HE7A 4IOYX 2I5FA 5DIFB 4HAUB 1FHXA 4HAWB 1U5EA 2UZSA 4KHOA 1MKEA 1K5GB 2DX1A 2QKLA 2FJLA 4DBBA 4HAYB 2QKMA 1XR0B 1UEFA 2I1JA 4Y94A 3G9WA 1V61A 1XCGA 3SYXA 3O96A 2OTXA 2ZPYA 3UZTA 1B55A 3PVWA 4ZRJA 4F7UP 2JP2A 1BWNA 2ADZA 3U7DA 1EAZA 2ROVA 2P0FA 4KVGB 4HDOA 4XWXA 3U8ZA 4PQ0A 2YS1A 3AJ4A 4Z2NA 2DTCA 3A8PA 3PVLA 1E5WA 4HAXB 3D8FA 2RGNB 2D10A 4P7IA 3GYOA 4HB4B 1DDMA 1GC7A 1MK7B 2D11A 2Y8FA 2D9ZA 1GC6A 1WJ1A 1U5GA 2RUKB 5KQ1A 2LOXA 5HE1A 2YS5A 2DHJA 2RVBB 4GMXB 1Z87A 1MIXA 2M14A 4F7GA 2LKOA 1OMWA 5DH9B 3X23A 4WJ7A 3RCPA 2YSZA 1ISNA 4K2OA 3ULBA 3SUZA 2L1CA 4A6HA 3ZVRA 1LB1A 3FSSA 4TKNA 1NTYA 2P8VA 1V5UA 4NSWA
chains in the Genus database with same CATH superfamily
2COFA 2DKPA 5FI0A 3ODWA 3V5WA 1UNRA 2LYDA 4A6KA 3KRXA 2M38A 3OANA 2ELAA 2DYQA 3AU5A 4GN1A 3LJUX 1H4RA 1J0WA 1K5DB 4GZUA 2DX5A 2YRYA 4HB3B 1SHCA 5C6RA 2R0DA 4K81A 5C79A 3IVFA 1DBHA 1U5FA 1BTNA 3PEGA 4HSIA 5I2MA 2EC1A 4KAXB 4QXAB 4TYZA 2L2IA 2H7DA 1ZC3B 3SV1A 1X86A 2MKRA 5DHFB 3A58A 4D0NB 5C5BB 3ODOA 2H7EA 2V76A 3BJIA 1PLSA 1AQCA 2W2XC 5JHGA 4ZRKA 1I7AA 4L6EA 2NZ8B 5D27A 2YT0A 3NWAA 1M7EA 1EGXA 4B6HA 5D3WA 3KY9A 4IAPA 3TW1A 3NWFA 4H8SA 2D2QA 4K2PA 3TFMA 3VOQA 5JP4A 2LOZA 1X1FA 2YT2A 1U5DA 5DHAB 4OSNA 5I2SA 3ML4A 2RNRB 2LULA 3F5RA 5L81A 2DHKA 2G35A 3NWDA 5KCVA 2K2JA 3F0WA 1T77A 1NU2A 2CY4A 1QC6A 1ZC4B 5HE2A 3WA0A 1WVHA 2K8EA 1DROA 5CLQB 1P3RA 2Q13A 1TXDA 2FJUB 4CHJA 5M4YB 4DX8A 1XKEA 1BTKA 5EFXA 1U2BA 2K2UA 2MDXA 2DLWA 4KHBB 1W1GA 2DYNA 4DIXA 1DDWA 2VKIA 4DXAB 2Z13A 1ZYIA 4NY0A 3PZDA 2COAA 3DXCA 2D9WA 1FGYA 1W1HA 2D9YA 3T06A 1U27A 1MK9B 1FGZA 1ZSQA 3MPXA 4CYEA 2GCJA 1NTVA 3WYFB 3FEHA 1DYNA 1M7RA 4GMVA 5GOWB 5J3TA 1AWEA 1U29A 4KHBA 3TO1A 3HK0A 2AEHA 2YVCA 4F7HA 1IRSA 1PMSA 2D9VA 2K00A 2MWNB 3ZDTA 3PVUA 5C5BA 4WSFA 3QIJA 3KRWA 5C16A 1UNQA 3NW8A 3P7ZA 3CXBB 3HQCA 2UZRA 5LOPB 2Z0PA 2BCJA 2PZ1A 1LW3A 5FI1A 2P0DA 2KGXB 4Z2MB 3ULCA 2AL6A 1WGQA 2VSZA 1SGHA 2IYBA 1RJ2A 2N0YA 3A98B 2GCLA 1DDVA 1J19A 2D9XA 2IFSA 4CHMA 3PG7A 4L1RA 1FOEA 1EVHA 1PFJA 4C0AA 4MT7A 3FVCA 1Y19B 2KR0A 2DA0A 4YONA 4MY6A 3OHMB 4A6FA 2CAYA 1MIZB 2Z59A 4PNKA 2X18A 2Z0OA 4HAVB 1BAKA 1TJ6A 2RSGA 4HB0B 3P6AA 3M1IB 4A5KA 2NMBA 1ZM0A 2YS3A 1EF1A 5D3VA 3ODXA 3HSAA 5CLLB 1I2HA 1X11A 2KUPA 4HATB 1H10A 4EKUA 2Y8GA 2I5CA 3PSCA 2W2WA 2Y7BA 1UPRA 4EMOA 1FB8A 1P6SA 3D8DA 2GJYA 5JLJB 2DN6A 2EMTA 2K49A 4MK0A 1ZVRA 3HIEA 1X05A 2J59M 3SO6A 4KHAA 1KI1B 3FM8C 2D4QA 4A6FB 1TQZA 1KZGA 1Q67A 3U12A 4K17A 4HHVA 1OQNA 1NI2A 1WGUA 1XX0A 1WG7A 3PP2A 1MI1A 2W2XD 4QJ3B 3KSYA 2DHIA 2N23A 1FAOA 4ZRIA 3GYPA 2RLOA 3AU4A 1N3HA 1WI1A 2XQNM 4BBKA 2R09A 4GXBA 2HTHB 4QJ5B 3MDBC 3NSUA 3HW2B 1V89A 3SNHA 2CODA 3TVVA 2ZKMX 4HDQA 3VIAA 5HE0A 3QBVB 3A8QA 1V5PA 1WJMA 3DXDA 3N7CA 5KQ4A 2CRFA 5J3QA 1GG3A 4GNKB 1V88A 1Y5OA 2VRWB 2CY5A 1MAIA 2J0KA 3BINA 3CIKA 4IFSA 5LONB 2I1KA 2J0MA 2DFKA 4DX90 3KZ1A 1XODA 5LG4B 2YF0A 4QJ4B 1FHOA 5HE3A 5IRSA 1RRPB 2E2XA 2NBVA 1W1DA 5DI9B 5J3YA 4EJNA 5D3YA 3TCAA 2LG1A 2DKQA 2COCA 2J0JA 2MFQA 3DXEA 4YL8A 2ROZB 2Z4DA 3DCXA 1UNPA 2P0HA 4D6WA 1KZ7A 1OY2A 2Z0QA 1V5MA 4HAZB 2ELBA 2EMSA 1XD4A 4OT1A 3B77A 2UVMA 1FHWA 1MPHA 2OQBA 5JHHA 1QQGA 2EJ8A 1X1GA 4WVFB 1P5TA 4GPTB 5D3XA 2KUQA 1UPQA 2GS0A 2RRFA 2YT1A 4HB2B 3QWMA 3D8EA 2KCJA 2HE7A 4IOYX 2R2YA 2I5FA 4CSQA 5DIFB 4HAUB 1FHXA 4HAWB 1U5EA 2UZSA 4KHOA 1MKEA 1K5GB 2DX1A 2QKLA 2FJLA 4DBBA 4HAYB 2QKMA 1XR0B 1UEFA 2I1JA 4Y94A 3G9WA 1V61A 1XCGA 3SYXA 3O96A 2OTXA 2ZPYA 3UZTA 1B55A 3PVWA 4ZRJA 4F7UP 2JP2A 1BWNA 2ADZA 3U7DA 1EAZA 2ROVA 2P0FA 2GUMA 4KVGB 4HDOA 4XWXA 3U8ZA 4PQ0A 2YS1A 3AJ4A 4Z2NA 2DTCA 4GOUA 3A8PA 3PVLA 1E5WA 4HAXB 3D8FA 2RGNB 2D10A 4P7IA 3GYOA 4HB4B 1DDMA 1GC7A 1MK7B 2D11A 2Y8FA 2D9ZA 1GC6A 1WJ1A 1U5GA 2RUKB 5KQ1A 2LOXA 5HE1A 2YS5A 2DHJA 2RVBB 4GMXB 1Z87A 1MIXA 2M14A 2Z14A 4F7GA 2LKOA 1OMWA 5DH9B 2KIEA 3X23A 4WJ7A 3RCPA 2YSZA 1ISNA 4K2OA 3ULBA 3SUZA 2L1CA 4A6HA 3ZVRA 1LB1A 3FSSA 4TKNA 1NTYA 2P8VA 1V5UA 4NSWA 2KIGA
chains in the Genus database with same CATH topology
2COFA 2DKPA 5FI0A 3ODWA 3V5WA 1UNRA 2LYDA 4A6KA 3KRXA 2M38A 3OANA 2ELAA 2DYQA 3AU5A 4GN1A 3LJUX 1H4RA 1J0WA 1K5DB 4GZUA 2DX5A 2YRYA 4HB3B 1SHCA 5C6RA 2R0DA 4K81A 5C79A 3IVFA 1DBHA 1U5FA 1BTNA 3PEGA 2EC1A 4KAXB 4TYZA 2L2IA 2H7DA 1ZC3B 3SV1A 1X86A 2MKRA 5DHFB 4D0NB 5C5BB 3ODOA 2H7EA 2V76A 3BJIA 1PLSA 1AQCA 2W2XC 5JHGA 4ZRKA 1I7AA 4L6EA 2NZ8B 5D27A 2YT0A 1M7EA 1EGXA 4B6HA 5D3WA 3KY9A 4IAPA 3TW1A 4H8SA 2D2QA 4K2PA 3TFMA 3VOQA 5JP4A 2LOZA 1X1FA 1U5DA 5DHAB 3ML4A 2RNRB 2LULA 3F5RA 5L81A 2DHKA 2G35A 5KCVA 2K2JA 3F0WA 1NU2A 2CY4A 1QC6A 1ZC4B 5HE2A 3WA0A 1WVHA 1DROA 5CLQB 1P3RA 2Q13A 1TXDA 4CHJA 4DX8A 1XKEA 1BTKA 5EFXA 1U2BA 2K2UA 2MDXA 2DLWA 4KHBB 1W1GA 2DYNA 1DDWA 2VKIA 4DXAB 4NY0A 3PZDA 2COAA 3DXCA 2D9WA 1FGYA 1W1HA 2D9YA 3T06A 1U27A 1MK9B 1FGZA 1ZSQA 3MPXA 4CYEA 2GCJA 1NTVA 3WYFB 3FEHA 1DYNA 1M7RA 4GMVA 5GOWB 5J3TA 1AWEA 1U29A 3TO1A 3HK0A 2AEHA 2YVCA 4F7HA 1IRSA 1PMSA 2D9VA 2K00A 2MWNB 3ZDTA 3PVUA 5C5BA 4WSFA 3QIJA 3KRWA 5C16A 1UNQA 3P7ZA 3CXBB 3HQCA 2UZRA 5LOPB 2Z0PA 2BCJA 2PZ1A 1LW3A 5FI1A 2P0DA 2KGXB 4Z2MB 3ULCA 2AL6A 1WGQA 2VSZA 1SGHA 2IYBA 1RJ2A 2N0YA 3A98B 2GCLA 1DDVA 1J19A 2D9XA 2IFSA 4CHMA 3PG7A 1FOEA 1EVHA 1PFJA 4C0AA 4MT7A 1Y19B 2DA0A 4YONA 4MY6A 4A6FA 2CAYA 1MIZB 4PNKA 2X18A 2Z0OA 4HAVB 1BAKA 1TJ6A 2RSGA 4HB0B 3P6AA 3M1IB 4A5KA 2NMBA 1ZM0A 2YS3A 1EF1A 5D3VA 3ODXA 5CLLB 1I2HA 1X11A 2KUPA 4HATB 1H10A 4EKUA 2Y8GA 2I5CA 3PSCA 2W2WA 2Y7BA 1UPRA 4EMOA 1FB8A 1P6SA 3D8DA 2GJYA 5JLJB 2DN6A 2EMTA 4MK0A 1ZVRA 1X05A 2J59M 3SO6A 4KHAA 1KI1B 3FM8C 2D4QA 4A6FB 1TQZA 1KZGA 1Q67A 4K17A 4HHVA 1OQNA 1NI2A 1WGUA 1XX0A 1WG7A 3PP2A 2W2XD 3KSYA 2DHIA 2N23A 1FAOA 4ZRIA 3GYPA 2RLOA 3AU4A 1N3HA 1WI1A 2XQNM 4BBKA 2R09A 4GXBA 2HTHB 3MDBC 3NSUA 3HW2B 1V89A 3SNHA 2CODA 3TVVA 4HDQA 3VIAA 5HE0A 3QBVB 3A8QA 1V5PA 1WJMA 3DXDA 3N7CA 5KQ4A 2CRFA 5J3QA 1GG3A 1V88A 1Y5OA 2VRWB 2CY5A 1MAIA 2J0KA 3BINA 3CIKA 4IFSA 5LONB 2I1KA 2J0MA 2DFKA 4DX90 3KZ1A 1XODA 2YF0A 1FHOA 5HE3A 1RRPB 2E2XA 1W1DA 5DI9B 5J3YA 4EJNA 5D3YA 3TCAA 2LG1A 2DKQA 2COCA 2J0JA 2MFQA 3DXEA 4YL8A 2ROZB 1UNPA 2P0HA 1KZ7A 1OY2A 2Z0QA 1V5MA 4HAZB 2ELBA 2EMSA 1XD4A 2UVMA 1FHWA 1MPHA 2OQBA 5JHHA 1QQGA 2EJ8A 1X1GA 4WVFB 1P5TA 4GPTB 5D3XA 1UPQA 2GS0A 2YT1A 4HB2B 3QWMA 3D8EA 2KCJA 2HE7A 4IOYX 2I5FA 5DIFB 4HAUB 1FHXA 4HAWB 1U5EA 2UZSA 4KHOA 1MKEA 1K5GB 2DX1A 2QKLA 2FJLA 4DBBA 4HAYB 2QKMA 1XR0B 1UEFA 2I1JA 4Y94A 3G9WA 1V61A 1XCGA 3SYXA 3O96A 2OTXA 2ZPYA 3UZTA 1B55A 3PVWA 4ZRJA 4F7UP 2JP2A 1BWNA 2ADZA 3U7DA 1EAZA 2ROVA 2P0FA 4KVGB 4HDOA 4XWXA 3U8ZA 4PQ0A 2YS1A 3AJ4A 4Z2NA 2DTCA 3A8PA 3PVLA 1E5WA 4HAXB 3D8FA 2RGNB 2D10A 4P7IA 3GYOA 4HB4B 1DDMA 1GC7A 1MK7B 2D11A 2Y8FA 2D9ZA 1GC6A 1WJ1A 1U5GA 2RUKB 5KQ1A 2LOXA 5HE1A 2YS5A 2DHJA 2RVBB 4GMXB 1Z87A 1MIXA 2M14A 4F7GA 2LKOA 1OMWA 5DH9B 3X23A 4WJ7A 3RCPA 2YSZA 1ISNA 4K2OA 3ULBA 3SUZA 2L1CA 4A6HA 3ZVRA 1LB1A 3FSSA 4TKNA 1NTYA 2P8VA 1V5UA 4NSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  2DKP A;  5FI0 A;  3ODW A;  3V5W A;  1UNR A;  2LYD A;  4A6K A;  3KRX A;  2M38 A;  3OAN A;  2ELA A;  2DYQ A;  3AU5 A;  4GN1 A;  3LJU X;  1H4R A;  1J0W A;  1K5D B;  4GZU A;  2DX5 A;  2YRY A;  4HB3 B;  1SHC A;  5C6R A;  2R0D A;  4K81 A;  5C79 A;  3IVF A;  1DBH A;  1U5F A;  1BTN A;  3PEG A;  2EC1 A;  4KAX B;  4TYZ A;  2L2I A;  2H7D A;  1ZC3 B;  3SV1 A;  1X86 A;  2MKR A;  5DHF B;  4D0N B;  5C5B B;  3ODO A;  2H7E A;  2V76 A;  3BJI A;  1PLS A;  1AQC A;  2W2X C;  5JHG A;  4ZRK A;  1I7A A;  4L6E A;  2NZ8 B;  5D27 A;  2YT0 A;  1M7E A;  1EGX A;  4B6H A;  5D3W A;  3KY9 A;  4IAP A;  3TW1 A;  4H8S A;  2D2Q A;  4K2P A;  3TFM A;  3VOQ A;  5JP4 A;  2LOZ A;  1X1F A;  1U5D A;  5DHA B;  3ML4 A;  2RNR B;  2LUL A;  3F5R A;  5L81 A;  2DHK A;  2G35 A;  5KCV A;  2K2J A;  3F0W A;  1NU2 A;  2CY4 A;  1QC6 A;  1ZC4 B;  5HE2 A;  3WA0 A;  1WVH A;  1DRO A;  5CLQ B;  1P3R A;  2Q13 A;  1TXD A;  4CHJ A;  4DX8 A;  1XKE A;  1BTK A;  5EFX A;  1U2B A;  2K2U A;  2MDX A;  2DLW A;  4KHB B;  1W1G A;  2DYN A;  1DDW A;  2VKI A;  4DXA B;  4NY0 A;  3PZD A;  2COA A;  3DXC A;  2D9W A;  1FGY A;  1W1H A;  2D9Y A;  3T06 A;  1U27 A;  1MK9 B;  1FGZ A;  1ZSQ A;  3MPX A;  4CYE A;  2GCJ A;  1NTV A;  3WYF B;  3FEH A;  1DYN A;  1M7R A;  4GMV A;  5GOW B;  5J3T A;  1AWE A;  1U29 A;  3TO1 A;  3HK0 A;  2AEH A;  2YVC A;  4F7H A;  1IRS A;  1PMS A;  2D9V A;  2K00 A;  2MWN B;  3ZDT A;  3PVU A;  5C5B A;  4WSF A;  3QIJ A;  3KRW A;  5C16 A;  1UNQ A;  3P7Z A;  3CXB B;  3HQC A;  2UZR A;  5LOP B;  2Z0P A;  2BCJ A;  2PZ1 A;  1LW3 A;  5FI1 A;  2P0D A;  2KGX B;  4Z2M B;  3ULC A;  2AL6 A;  1WGQ A;  2VSZ A;  1SGH A;  2IYB A;  1RJ2 A;  2N0Y A;  3A98 B;  2GCL A;  1DDV A;  1J19 A;  2D9X A;  2IFS A;  4CHM A;  3PG7 A;  1FOE A;  1EVH A;  1PFJ A;  4C0A A;  4MT7 A;  1Y19 B;  2DA0 A;  4YON A;  4MY6 A;  4A6F A;  2CAY A;  1MIZ B;  4PNK A;  2X18 A;  2Z0O A;  4HAV B;  1BAK A;  1TJ6 A;  2RSG A;  4HB0 B;  3P6A A;  3M1I B;  4A5K A;  2NMB A;  1ZM0 A;  2YS3 A;  1EF1 A;  5D3V A;  3ODX A;  5CLL B;  1I2H A;  1X11 A;  2KUP A;  4HAT B;  1H10 A;  4EKU A;  2Y8G A;  2I5C A;  3PSC A;  2W2W A;  2Y7B A;  1UPR A;  4EMO A;  1FB8 A;  1P6S A;  3D8D A;  2GJY A;  5JLJ B;  2DN6 A;  2EMT A;  4MK0 A;  1ZVR A;  1X05 A;  2J59 M;  3SO6 A;  4KHA A;  1KI1 B;  3FM8 C;  2D4Q A;  4A6F B;  1TQZ A;  1KZG A;  1Q67 A;  4K17 A;  4HHV A;  1OQN A;  1NI2 A;  1WGU A;  1XX0 A;  1WG7 A;  3PP2 A;  2W2X D;  3KSY A;  2DHI A;  2N23 A;  1FAO A;  4ZRI A;  3GYP A;  2RLO A;  3AU4 A;  1N3H A;  1WI1 A;  2XQN M;  4BBK A;  2R09 A;  4GXB A;  2HTH B;  3MDB C;  3NSU A;  3HW2 B;  1V89 A;  3SNH A;  2COD A;  3TVV A;  4HDQ A;  3VIA A;  5HE0 A;  3QBV B;  3A8Q A;  1V5P A;  1WJM A;  3DXD A;  3N7C A;  5KQ4 A;  2CRF A;  5J3Q A;  1GG3 A;  1V88 A;  1Y5O A;  2VRW B;  2CY5 A;  1MAI A;  2J0K A;  3BIN A;  3CIK A;  4IFS A;  5LON B;  2I1K A;  2J0M A;  2DFK A;  4DX9 0;  3KZ1 A;  1XOD A;  2YF0 A;  1FHO A;  5HE3 A;  1RRP B;  2E2X A;  1W1D A;  5DI9 B;  5J3Y A;  4EJN A;  5D3Y A;  3TCA A;  2LG1 A;  2DKQ A;  2COC A;  2J0J A;  2MFQ A;  3DXE A;  4YL8 A;  2ROZ B;  1UNP A;  2P0H A;  1KZ7 A;  1OY2 A;  2Z0Q A;  1V5M A;  4HAZ B;  2ELB A;  2EMS A;  1XD4 A;  2UVM A;  1FHW A;  1MPH A;  2OQB A;  5JHH A;  1QQG A;  2EJ8 A;  1X1G A;  4WVF B;  1P5T A;  4GPT B;  5D3X A;  1UPQ A;  2GS0 A;  2YT1 A;  4HB2 B;  3QWM A;  3D8E A;  2KCJ A;  2HE7 A;  4IOY X;  2I5F A;  5DIF B;  4HAU B;  1FHX A;  4HAW B;  1U5E A;  2UZS A;  4KHO A;  1MKE A;  1K5G B;  2DX1 A;  2QKL A;  2FJL A;  4DBB A;  4HAY B;  2QKM A;  1XR0 B;  1UEF A;  2I1J A;  4Y94 A;  3G9W A;  1V61 A;  1XCG A;  3SYX A;  3O96 A;  2OTX A;  2ZPY A;  3UZT A;  1B55 A;  3PVW A;  4ZRJ A;  4F7U P;  2JP2 A;  1BWN A;  2ADZ A;  3U7D A;  1EAZ A;  2ROV A;  2P0F A;  4KVG B;  4HDO A;  4XWX A;  3U8Z A;  4PQ0 A;  2YS1 A;  3AJ4 A;  4Z2N A;  2DTC A;  3A8P A;  3PVL A;  1E5W A;  4HAX B;  3D8F A;  2RGN B;  2D10 A;  4P7I A;  3GYO A;  4HB4 B;  1DDM A;  1GC7 A;  1MK7 B;  2D11 A;  2Y8F A;  2D9Z A;  1GC6 A;  1WJ1 A;  1U5G A;  2RUK B;  5KQ1 A;  2LOX A;  5HE1 A;  2YS5 A;  2DHJ A;  2RVB B;  4GMX B;  1Z87 A;  1MIX A;  2M14 A;  4F7G A;  2LKO A;  1OMW A;  5DH9 B;  3X23 A;  4WJ7 A;  3RCP A;  2YSZ A;  1ISN A;  4K2O A;  3ULB A;  3SUZ A;  2L1C A;  4A6H A;  3ZVR A;  1LB1 A;  3FSS A;  4TKN A;  1NTY A;  2P8V A;  1V5U A;  4NSW A; 
#chains in the Genus database with same CATH topology
 2COF A;  2DKP A;  5FI0 A;  3ODW A;  3V5W A;  1UNR A;  2LYD A;  4A6K A;  3KRX A;  2M38 A;  3OAN A;  2ELA A;  2DYQ A;  3AU5 A;  4GN1 A;  3LJU X;  1H4R A;  1J0W A;  1K5D B;  4GZU A;  2DX5 A;  2YRY A;  4HB3 B;  1SHC A;  5C6R A;  2R0D A;  4K81 A;  5C79 A;  3IVF A;  1DBH A;  1U5F A;  1BTN A;  3PEG A;  4HSI A;  5I2M A;  2EC1 A;  4KAX B;  4QXA B;  4TYZ A;  2L2I A;  2H7D A;  1ZC3 B;  3SV1 A;  1X86 A;  2MKR A;  5DHF B;  3A58 A;  4D0N B;  5C5B B;  3ODO A;  2H7E A;  2V76 A;  3BJI A;  1PLS A;  1AQC A;  2W2X C;  5JHG A;  4ZRK A;  1I7A A;  4L6E A;  2NZ8 B;  5D27 A;  2YT0 A;  3NWA A;  1M7E A;  1EGX A;  4B6H A;  5D3W A;  3KY9 A;  4IAP A;  3TW1 A;  3NWF A;  4H8S A;  2D2Q A;  4K2P A;  3TFM A;  3VOQ A;  5JP4 A;  2LOZ A;  1X1F A;  2YT2 A;  1U5D A;  5DHA B;  4OSN A;  5I2S A;  3ML4 A;  2RNR B;  2LUL A;  3F5R A;  5L81 A;  2DHK A;  2G35 A;  3NWD A;  5KCV A;  2K2J A;  3F0W A;  1T77 A;  1NU2 A;  2CY4 A;  1QC6 A;  1ZC4 B;  5HE2 A;  3WA0 A;  1WVH A;  2K8E A;  1DRO A;  5CLQ B;  1P3R A;  2Q13 A;  1TXD A;  2FJU B;  4CHJ A;  5M4Y B;  4DX8 A;  1XKE A;  1BTK A;  5EFX A;  1U2B A;  2K2U A;  2MDX A;  2DLW A;  4KHB B;  1W1G A;  2DYN A;  4DIX A;  1DDW A;  2VKI A;  4DXA B;  2Z13 A;  1ZYI A;  4NY0 A;  3PZD A;  2COA A;  3DXC A;  2D9W A;  1FGY A;  1W1H A;  2D9Y A;  3T06 A;  1U27 A;  1MK9 B;  1FGZ A;  1ZSQ A;  3MPX A;  4CYE A;  2GCJ A;  1NTV A;  3WYF B;  3FEH A;  1DYN A;  1M7R A;  4GMV A;  5GOW B;  5J3T A;  1AWE A;  1U29 A;  4KHB A;  3TO1 A;  3HK0 A;  2AEH A;  2YVC A;  4F7H A;  1IRS A;  1PMS A;  2D9V A;  2K00 A;  2MWN B;  3ZDT A;  3PVU A;  5C5B A;  4WSF A;  3QIJ A;  3KRW A;  5C16 A;  1UNQ A;  3NW8 A;  3P7Z A;  3CXB B;  3HQC A;  2UZR A;  5LOP B;  2Z0P A;  2BCJ A;  2PZ1 A;  1LW3 A;  5FI1 A;  2P0D A;  2KGX B;  4Z2M B;  3ULC A;  2AL6 A;  1WGQ A;  2VSZ A;  1SGH A;  2IYB A;  1RJ2 A;  2N0Y A;  3A98 B;  2GCL A;  1DDV A;  1J19 A;  2D9X A;  2IFS A;  4CHM A;  3PG7 A;  4L1R A;  1FOE A;  1EVH A;  1PFJ A;  4C0A A;  4MT7 A;  3FVC A;  1Y19 B;  2KR0 A;  2DA0 A;  4YON A;  4MY6 A;  3OHM B;  4A6F A;  2CAY A;  1MIZ B;  2Z59 A;  4PNK A;  2X18 A;  2Z0O A;  4HAV B;  1BAK A;  1TJ6 A;  2RSG A;  4HB0 B;  3P6A A;  3M1I B;  4A5K A;  2NMB A;  1ZM0 A;  2YS3 A;  1EF1 A;  5D3V A;  3ODX A;  3HSA A;  5CLL B;  1I2H A;  1X11 A;  2KUP A;  4HAT B;  1H10 A;  4EKU A;  2Y8G A;  2I5C A;  3PSC A;  2W2W A;  2Y7B A;  1UPR A;  4EMO A;  1FB8 A;  1P6S A;  3D8D A;  2GJY A;  5JLJ B;  2DN6 A;  2EMT A;  2K49 A;  4MK0 A;  1ZVR A;  3HIE A;  1X05 A;  2J59 M;  3SO6 A;  4KHA A;  1KI1 B;  3FM8 C;  2D4Q A;  4A6F B;  1TQZ A;  1KZG A;  1Q67 A;  3U12 A;  4K17 A;  4HHV A;  1OQN A;  1NI2 A;  1WGU A;  1XX0 A;  1WG7 A;  3PP2 A;  1MI1 A;  2W2X D;  4QJ3 B;  3KSY A;  2DHI A;  2N23 A;  1FAO A;  4ZRI A;  3GYP A;  2RLO A;  3AU4 A;  1N3H A;  1WI1 A;  2XQN M;  4BBK A;  2R09 A;  4GXB A;  2HTH B;  4QJ5 B;  3MDB C;  3NSU A;  3HW2 B;  1V89 A;  3SNH A;  2COD A;  3TVV A;  2ZKM X;  4HDQ A;  3VIA A;  5HE0 A;  3QBV B;  3A8Q A;  1V5P A;  1WJM A;  3DXD A;  3N7C A;  5KQ4 A;  2CRF A;  5J3Q A;  1GG3 A;  4GNK B;  1V88 A;  1Y5O A;  2VRW B;  2CY5 A;  1MAI A;  2J0K A;  3BIN A;  3CIK A;  4IFS A;  5LON B;  2I1K A;  2J0M A;  2DFK A;  4DX9 0;  3KZ1 A;  1XOD A;  5LG4 B;  2YF0 A;  4QJ4 B;  1FHO A;  5HE3 A;  5IRS A;  1RRP B;  2E2X A;  2NBV A;  1W1D A;  5DI9 B;  5J3Y A;  4EJN A;  5D3Y A;  3TCA A;  2LG1 A;  2DKQ A;  2COC A;  2J0J A;  2MFQ A;  3DXE A;  4YL8 A;  2ROZ B;  2Z4D A;  3DCX A;  1UNP A;  2P0H A;  4D6W A;  1KZ7 A;  1OY2 A;  2Z0Q A;  1V5M A;  4HAZ B;  2ELB A;  2EMS A;  1XD4 A;  4OT1 A;  3B77 A;  2UVM A;  1FHW A;  1MPH A;  2OQB A;  5JHH A;  1QQG A;  2EJ8 A;  1X1G A;  4WVF B;  1P5T A;  4GPT B;  5D3X A;  2KUQ A;  1UPQ A;  2GS0 A;  2RRF A;  2YT1 A;  4HB2 B;  3QWM A;  3D8E A;  2KCJ A;  2HE7 A;  4IOY X;  2R2Y A;  2I5F A;  4CSQ A;  5DIF B;  4HAU B;  1FHX A;  4HAW B;  1U5E A;  2UZS A;  4KHO A;  1MKE A;  1K5G B;  2DX1 A;  2QKL A;  2FJL A;  4DBB A;  4HAY B;  2QKM A;  1XR0 B;  1UEF A;  2I1J A;  4Y94 A;  3G9W A;  1V61 A;  1XCG A;  3SYX A;  3O96 A;  2OTX A;  2ZPY A;  3UZT A;  1B55 A;  3PVW A;  4ZRJ A;  4F7U P;  2JP2 A;  1BWN A;  2ADZ A;  3U7D A;  1EAZ A;  2ROV A;  2P0F A;  2GUM A;  4KVG B;  4HDO A;  4XWX A;  3U8Z A;  4PQ0 A;  2YS1 A;  3AJ4 A;  4Z2N A;  2DTC A;  4GOU A;  3A8P A;  3PVL A;  1E5W A;  4HAX B;  3D8F A;  2RGN B;  2D10 A;  4P7I A;  3GYO A;  4HB4 B;  1DDM A;  1GC7 A;  1MK7 B;  2D11 A;  2Y8F A;  2D9Z A;  1GC6 A;  1WJ1 A;  1U5G A;  2RUK B;  5KQ1 A;  2LOX A;  5HE1 A;  2YS5 A;  2DHJ A;  2RVB B;  4GMX B;  1Z87 A;  1MIX A;  2M14 A;  2Z14 A;  4F7G A;  2LKO A;  1OMW A;  5DH9 B;  2KIE A;  3X23 A;  4WJ7 A;  3RCP A;  2YSZ A;  1ISN A;  4K2O A;  3ULB A;  3SUZ A;  2L1C A;  4A6H A;  3ZVR A;  1LB1 A;  3FSS A;  4TKN A;  1NTY A;  2P8V A;  1V5U A;  4NSW A;  2KIG A; 
#chains in the Genus database with same CATH homology
 2COF A;  2DKP A;  5FI0 A;  3ODW A;  3V5W A;  1UNR A;  2LYD A;  4A6K A;  3KRX A;  2M38 A;  3OAN A;  2ELA A;  2DYQ A;  3AU5 A;  4GN1 A;  3LJU X;  1H4R A;  1J0W A;  1K5D B;  4GZU A;  2DX5 A;  2YRY A;  4HB3 B;  1SHC A;  5C6R A;  2R0D A;  4K81 A;  5C79 A;  3IVF A;  1DBH A;  1U5F A;  1BTN A;  3PEG A;  2EC1 A;  4KAX B;  4TYZ A;  2L2I A;  2H7D A;  1ZC3 B;  3SV1 A;  1X86 A;  2MKR A;  5DHF B;  4D0N B;  5C5B B;  3ODO A;  2H7E A;  2V76 A;  3BJI A;  1PLS A;  1AQC A;  2W2X C;  5JHG A;  4ZRK A;  1I7A A;  4L6E A;  2NZ8 B;  5D27 A;  2YT0 A;  1M7E A;  1EGX A;  4B6H A;  5D3W A;  3KY9 A;  4IAP A;  3TW1 A;  4H8S A;  2D2Q A;  4K2P A;  3TFM A;  3VOQ A;  5JP4 A;  2LOZ A;  1X1F A;  1U5D A;  5DHA B;  3ML4 A;  2RNR B;  2LUL A;  3F5R A;  5L81 A;  2DHK A;  2G35 A;  5KCV A;  2K2J A;  3F0W A;  1NU2 A;  2CY4 A;  1QC6 A;  1ZC4 B;  5HE2 A;  3WA0 A;  1WVH A;  1DRO A;  5CLQ B;  1P3R A;  2Q13 A;  1TXD A;  4CHJ A;  4DX8 A;  1XKE A;  1BTK A;  5EFX A;  1U2B A;  2K2U A;  2MDX A;  2DLW A;  4KHB B;  1W1G A;  2DYN A;  1DDW A;  2VKI A;  4DXA B;  4NY0 A;  3PZD A;  2COA A;  3DXC A;  2D9W A;  1FGY A;  1W1H A;  2D9Y A;  3T06 A;  1U27 A;  1MK9 B;  1FGZ A;  1ZSQ A;  3MPX A;  4CYE A;  2GCJ A;  1NTV A;  3WYF B;  3FEH A;  1DYN A;  1M7R A;  4GMV A;  5GOW B;  5J3T A;  1AWE A;  1U29 A;  3TO1 A;  3HK0 A;  2AEH A;  2YVC A;  4F7H A;  1IRS A;  1PMS A;  2D9V A;  2K00 A;  2MWN B;  3ZDT A;  3PVU A;  5C5B A;  4WSF A;  3QIJ A;  3KRW A;  5C16 A;  1UNQ A;  3P7Z A;  3CXB B;  3HQC A;  2UZR A;  5LOP B;  2Z0P A;  2BCJ A;  2PZ1 A;  1LW3 A;  5FI1 A;  2P0D A;  2KGX B;  4Z2M B;  3ULC A;  2AL6 A;  1WGQ A;  2VSZ A;  1SGH A;  2IYB A;  1RJ2 A;  2N0Y A;  3A98 B;  2GCL A;  1DDV A;  1J19 A;  2D9X A;  2IFS A;  4CHM A;  3PG7 A;  1FOE A;  1EVH A;  1PFJ A;  4C0A A;  4MT7 A;  1Y19 B;  2DA0 A;  4YON A;  4MY6 A;  4A6F A;  2CAY A;  1MIZ B;  4PNK A;  2X18 A;  2Z0O A;  4HAV B;  1BAK A;  1TJ6 A;  2RSG A;  4HB0 B;  3P6A A;  3M1I B;  4A5K A;  2NMB A;  1ZM0 A;  2YS3 A;  1EF1 A;  5D3V A;  3ODX A;  5CLL B;  1I2H A;  1X11 A;  2KUP A;  4HAT B;  1H10 A;  4EKU A;  2Y8G A;  2I5C A;  3PSC A;  2W2W A;  2Y7B A;  1UPR A;  4EMO A;  1FB8 A;  1P6S A;  3D8D A;  2GJY A;  5JLJ B;  2DN6 A;  2EMT A;  4MK0 A;  1ZVR A;  1X05 A;  2J59 M;  3SO6 A;  4KHA A;  1KI1 B;  3FM8 C;  2D4Q A;  4A6F B;  1TQZ A;  1KZG A;  1Q67 A;  4K17 A;  4HHV A;  1OQN A;  1NI2 A;  1WGU A;  1XX0 A;  1WG7 A;  3PP2 A;  2W2X D;  3KSY A;  2DHI A;  2N23 A;  1FAO A;  4ZRI A;  3GYP A;  2RLO A;  3AU4 A;  1N3H A;  1WI1 A;  2XQN M;  4BBK A;  2R09 A;  4GXB A;  2HTH B;  3MDB C;  3NSU A;  3HW2 B;  1V89 A;  3SNH A;  2COD A;  3TVV A;  4HDQ A;  3VIA A;  5HE0 A;  3QBV B;  3A8Q A;  1V5P A;  1WJM A;  3DXD A;  3N7C A;  5KQ4 A;  2CRF A;  5J3Q A;  1GG3 A;  1V88 A;  1Y5O A;  2VRW B;  2CY5 A;  1MAI A;  2J0K A;  3BIN A;  3CIK A;  4IFS A;  5LON B;  2I1K A;  2J0M A;  2DFK A;  4DX9 0;  3KZ1 A;  1XOD A;  2YF0 A;  1FHO A;  5HE3 A;  1RRP B;  2E2X A;  1W1D A;  5DI9 B;  5J3Y A;  4EJN A;  5D3Y A;  3TCA A;  2LG1 A;  2DKQ A;  2COC A;  2J0J A;  2MFQ A;  3DXE A;  4YL8 A;  2ROZ B;  1UNP A;  2P0H A;  1KZ7 A;  1OY2 A;  2Z0Q A;  1V5M A;  4HAZ B;  2ELB A;  2EMS A;  1XD4 A;  2UVM A;  1FHW A;  1MPH A;  2OQB A;  5JHH A;  1QQG A;  2EJ8 A;  1X1G A;  4WVF B;  1P5T A;  4GPT B;  5D3X A;  1UPQ A;  2GS0 A;  2YT1 A;  4HB2 B;  3QWM A;  3D8E A;  2KCJ A;  2HE7 A;  4IOY X;  2I5F A;  5DIF B;  4HAU B;  1FHX A;  4HAW B;  1U5E A;  2UZS A;  4KHO A;  1MKE A;  1K5G B;  2DX1 A;  2QKL A;  2FJL A;  4DBB A;  4HAY B;  2QKM A;  1XR0 B;  1UEF A;  2I1J A;  4Y94 A;  3G9W A;  1V61 A;  1XCG A;  3SYX A;  3O96 A;  2OTX A;  2ZPY A;  3UZT A;  1B55 A;  3PVW A;  4ZRJ A;  4F7U P;  2JP2 A;  1BWN A;  2ADZ A;  3U7D A;  1EAZ A;  2ROV A;  2P0F A;  4KVG B;  4HDO A;  4XWX A;  3U8Z A;  4PQ0 A;  2YS1 A;  3AJ4 A;  4Z2N A;  2DTC A;  3A8P A;  3PVL A;  1E5W A;  4HAX B;  3D8F A;  2RGN B;  2D10 A;  4P7I A;  3GYO A;  4HB4 B;  1DDM A;  1GC7 A;  1MK7 B;  2D11 A;  2Y8F A;  2D9Z A;  1GC6 A;  1WJ1 A;  1U5G A;  2RUK B;  5KQ1 A;  2LOX A;  5HE1 A;  2YS5 A;  2DHJ A;  2RVB B;  4GMX B;  1Z87 A;  1MIX A;  2M14 A;  4F7G A;  2LKO A;  1OMW A;  5DH9 B;  3X23 A;  4WJ7 A;  3RCP A;  2YSZ A;  1ISN A;  4K2O A;  3ULB A;  3SUZ A;  2L1C A;  4A6H A;  3ZVR A;  1LB1 A;  3FSS A;  4TKN A;  1NTY A;  2P8V A;  1V5U A;  4NSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...