5KQ1A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 36
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq1A00
2P0DA 3PSCA 3T06A 5DHFB 2COFA 3CXBB 1EGXA 2I1KA 3GYOA 2MFQA 3ML4A 4TKNA 3P7ZA 1PMSA 5DI9B 2DHKA 4F7GA 5JHHA 4HB2B 4GN1A 1ZVRA 1IRSA 2P0HA 1W1GA 3WA0A 2J0JA 3QWMA 1ZSQA 4HAXB 4WVFB 1MK9B 2GCLA 5J3YA 4GMVA 2YS5A 3ULCA 2MWNB 1MPHA 3KY9A 1QC6A 4WJ7A 5CLQB 4HHVA 1RJ2A 4YL8A 2DTCA 2LOZA 2LYDA 3PZDA 1WGUA 2AL6A 1I7AA 1H4RA 2RSGA 1DROA 5KQ4A 3AU5A 2YS1A 1FB8A 1U5GA 2D4QA 1W1HA 1NTVA 2DHJA 4DX8A 1X86A 2RVBB 4CHJA 4MT7A 1TJ6A 5LONB 2JP2A 2YSZA 3MDBC 1X11A 2I5CA 1U2BA 3BINA 2Z0QA 1ZM0A 5GOWB 3BJIA 2ELAA 2IYBA 2PZ1A 1J19A 3O96A 1AQCA 1Y5OA 2VRWB 3MPXA 5J3TA 2I5FA 3KRWA 3DXDA 2D9ZA 2Z0PA 2J0KA 1ZC4B 4Y94A 4ZRIA 4KAXB 1DDVA 2CAYA 2DYNA 1ZC3B 5L81A 2IFSA 3D8EA 3NSUA 4F7HA 5JP4A 3LJUX 4K81A 3TO1A 3TVVA 4IOYX 3ZVRA 4CHMA 2G35A 2DKQA 1N3HA 3FEHA 4KHBB 2GS0A 5HE1A 4CYEA 5J3QA 1U5EA 4NY0A 3FM8C 1PLSA 1X1FA 4DX90 2LKOA 5D3YA 3HK0A 5EFXA 3KRXA 5D27A 2BCJA 1H10A 1BTKA 3PVWA 2CODA 3SUZA 4HB3B 1UNRA 1EF1A 3FSSA 3N7CA 2CRFA 2VSZA 5CLLB 5JLJB 4P7IA 1EVHA 3ODXA 3AJ4A 4EJNA 1U5FA 5JHGA 2Y8GA 1AWEA 1NI2A 1K5DB 4K2OA 1LB1A 1SHCA 4HB0B 1UNPA 3KZ1A 3M1IB 1QQGA 3P6AA 4HDOA 1TQZA 1UPRA 5C6RA 4PNKA 1P6SA 2EMTA 4HDQA 3UZTA 1BAKA 4KHOA 1XODA 4GMXB 2GJYA 2MKRA 4BBKA 2L1CA 3SYXA 2EC1A 2E2XA 4NSWA 3D8FA 2W2XC 4C0AA 2CY4A 2DFKA 3SNHA 2Q13A 1GC6A 1FHWA 1MKEA 3PP2A 1NU2A 1FGYA 1V5PA 4YONA 1SGHA 5FI0A 1WVHA 1DYNA 2XQNM 2W2WA 2J59M 1X1GA 2DX5A 1M7EA 2UVMA 3U7DA 2OQBA 4K2PA 1MIXA 3ODOA 4ZRJA 3IVFA 1I2HA 1Y19B 4B6HA 3RCPA 2KUPA 4WSFA 1FOEA 2W2XD 1U29A 2AEHA 5C16A 2R09A 2CY5A 4Z2NA 1NTYA 5D3VA 1MK7B 1WI1A 4HAVB 1E5WA 1X05A 3GYPA 2DLWA 3SV1A 4XWXA 2YS3A 4IAPA 2RUKB 3ODWA 1WJ1A 4PQ0A 1FHXA 3X23A 3WYFB 4HAZB 2ELBA 1Z87A 2Y8FA 2EJ8A 1W1DA 2DA0A 3CIKA 3HQCA 2I1JA 2Y7BA 1V61A 1V5UA 5DHAB 4A5KA 4EMOA 2COAA 1P3RA 3VIAA 1V5MA 5KCVA 4L6EA 3G9WA 2K2JA 3PG7A 2EMSA 5DIFB 2YRYA 1XD4A 1FHOA 3ZDTA 5DH9B 1UEFA 2RGNB 2DKPA 2Z0OA 5C79A 4MK0A 1EAZA 1KZGA 1WG7A 2K00A 2ADZA 2P8VA 1XKEA 1OY2A 1Q67A 5FI1A 1DBHA 1GG3A 4DBBA 4HB4B 4A6HA 4A6FA 2YVCA 3PVUA 2DHIA 4GZUA 5C5BA 1FAOA 1WGQA 2UZRA 3QIJA 2M38A 1XCGA 4F7UP 5HE2A 1RRPB 1XX0A 3VOQA 2ROVA 5KQ1A 2P0FA 4DXAB 1OMWA 4D0NB 1WJMA 3OANA 3HW2B 1J0WA 1M7RA 2KCJA 1GC7A 3D8DA 4IFSA 4EKUA 2COCA 2ROZB 2NZ8B 2HTHB 3A8PA 4HAWB 2X18A 3F5RA 2NMBA 2H7EA 2RNRB 2FJLA 1K5GB 2L2IA 1UNQA 1DDWA 2D9XA 1MAIA 3DXCA 5HE0A 3TCAA 2KGXB 4KHAA 1LW3A 1U5DA 2V76A 1MIZB 1U27A 2MDXA 2N23A 3TFMA 4HAUB 2K2UA 4HATB 5HE3A 1V89A 3V5WA 2GCJA 2DYQA 2M14A 1BWNA 2LULA 2D10A 1TXDA 2VKIA 2LOXA 1XR0B 2HE7A 3SO6A 4GPTB 1PFJA 1KZ7A 2LG1A 4Z2MB 2D2QA 2D11A 1ISNA 4MY6A 1UPQA 1OQNA 2N0YA 2D9VA 3F0WA 2QKMA 1BTNA 3KSYA 2UZSA 2QKLA 4TYZA 1B55A 4A6KA 2H7DA 2OTXA 2D9WA 4H8SA 5D3WA 1P5TA 3AU4A 5D3XA 2DX1A 4ZRKA 2RLOA 2YT0A 3TW1A 3A8QA 3DXEA 3PEGA 3QBVB 2YF0A 2D9YA 5LOPB 1V88A 2ZPYA 4KVGB 4A6FB 2J0MA 2DN6A 5C5BB 3A98B 3PVLA 3U8ZA 3ULBA 4K17A 1KI1B 2R0DA 4GXBA 2YT1A 1DDMA 4HAYB 1FGZA
chains in the Genus database with same CATH superfamily
2P0DA 3PSCA 3T06A 5DHFB 2YT2A 2COFA 3CXBB 1EGXA 2I1KA 3FVCA 3GYOA 2MFQA 3ML4A 4TKNA 3P7ZA 1PMSA 5DI9B 2DHKA 4F7GA 5JHHA 4HB2B 4GN1A 1ZVRA 1IRSA 2P0HA 1W1GA 3WA0A 2J0JA 3QWMA 1ZSQA 4HAXB 4WVFB 1MK9B 2GCLA 5J3YA 4GMVA 2YS5A 3ULCA 2MWNB 1MPHA 3KY9A 1QC6A 4WJ7A 5CLQB 4HHVA 1RJ2A 4YL8A 2DTCA 2LOZA 2LYDA 3U12A 3PZDA 1WGUA 2AL6A 1I7AA 1H4RA 2RSGA 1DROA 5KQ4A 3AU5A 2YS1A 1FB8A 1U5GA 2D4QA 1W1HA 1NTVA 2DHJA 4DX8A 1X86A 2RVBB 4CHJA 4MT7A 1TJ6A 5LONB 2JP2A 2YSZA 3MDBC 1X11A 2I5CA 1U2BA 3BINA 2Z0QA 1ZM0A 5GOWB 3BJIA 2ELAA 2IYBA 2PZ1A 1J19A 3O96A 5I2SA 1AQCA 1Y5OA 3HSAA 2VRWB 3MPXA 5J3TA 2I5FA 2ZKMX 3KRWA 3DXDA 2D9ZA 2Z0PA 2J0KA 1ZC4B 4Y94A 4ZRIA 4KAXB 1DDVA 2CAYA 2DYNA 1ZC3B 5L81A 2IFSA 2Z4DA 3D8EA 4OSNA 3NSUA 4F7HA 5JP4A 3LJUX 4K81A 3TO1A 3TVVA 4IOYX 3ZVRA 3A58A 4CHMA 2G35A 2DKQA 3B77A 1N3HA 3FEHA 4KHBB 2GS0A 5HE1A 4CYEA 5J3QA 1U5EA 4NY0A 3FM8C 1PLSA 1X1FA 4DX90 2LKOA 5D3YA 3HK0A 4KHBA 3KRXA 5EFXA 5D27A 2BCJA 1H10A 1BTKA 3PVWA 2CODA 3SUZA 4HB3B 1UNRA 4DIXA 1EF1A 3FSSA 3N7CA 2CRFA 2VSZA 5CLLB 3DCXA 5JLJB 4P7IA 1EVHA 3ODXA 3AJ4A 4EJNA 1U5FA 5JHGA 2Y8GA 1AWEA 1NI2A 1K5DB 4K2OA 1LB1A 1SHCA 2R2YA 4HB0B 1T77A 1UNPA 3KZ1A 4QJ5B 3M1IB 1QQGA 3P6AA 4HDOA 1TQZA 1UPRA 5C6RA 4PNKA 1P6SA 2Z59A 2EMTA 4HDQA 3UZTA 1BAKA 4KHOA 1XODA 4GMXB 2GJYA 2MKRA 4BBKA 2L1CA 3SYXA 2EC1A 2E2XA 4NSWA 4QJ3B 3D8FA 2W2XC 4C0AA 2CY4A 2DFKA 3SNHA 2Q13A 1GC6A 1FHWA 1MKEA 3PP2A 3NW8A 1NU2A 1FGYA 1V5PA 4YONA 1SGHA 4L1RA 5FI0A 1WVHA 4QXAB 1DYNA 1ZYIA 2XQNM 2W2WA 2J59M 1X1GA 2DX5A 1M7EA 2UVMA 3U7DA 2OQBA 4K2PA 1MIXA 3ODOA 4ZRJA 4HSIA 3IVFA 1I2HA 1Y19B 4B6HA 3RCPA 2KUPA 4OT1A 4WSFA 1FOEA 2W2XD 1U29A 2AEHA 5C16A 2R09A 2CY5A 4Z2NA 1NTYA 5D3VA 1MK7B 1WI1A 4HAVB 1E5WA 1X05A 3GYPA 2DLWA 3SV1A 4XWXA 2YS3A 4IAPA 2RUKB 2KUQA 3ODWA 1WJ1A 4PQ0A 4CSQA 2KIGA 1FHXA 3X23A 3WYFB 4D6WA 4HAZB 2ELBA 1Z87A 2Y8FA 2EJ8A 1W1DA 2DA0A 3CIKA 3HQCA 2I1JA 2Y7BA 1V61A 1V5UA 5DHAB 4A5KA 2NBVA 4EMOA 2COAA 1P3RA 3VIAA 1V5MA 5KCVA 4L6EA 3G9WA 2K2JA 3PG7A 2EMSA 5DIFB 2YRYA 1XD4A 3HIEA 1FHOA 3ZDTA 5DH9B 1UEFA 2RGNB 2DKPA 2Z13A 2Z0OA 5C79A 4MK0A 1EAZA 1KZGA 1WG7A 2K00A 2ADZA 2P8VA 1XKEA 1OY2A 5LG4B 1Q67A 5FI1A 1DBHA 1GG3A 4DBBA 4HB4B 4A6HA 4GOUA 4A6FA 2YVCA 3PVUA 2DHIA 4GZUA 5C5BA 1FAOA 1WGQA 2UZRA 3QIJA 2M38A 1XCGA 4F7UP 5HE2A 1RRPB 1XX0A 2K49A 3VOQA 2ROVA 5KQ1A 2P0FA 4DXAB 1OMWA 4D0NB 1WJMA 3OANA 3HW2B 1J0WA 1M7RA 2KCJA 1GC7A 3D8DA 4IFSA 4EKUA 2COCA 2ROZB 2NZ8B 2HTHB 3A8PA 4HAWB 2Z14A 2X18A 3F5RA 2NMBA 2H7EA 2RNRB 2FJLA 1K5GB 2L2IA 1UNQA 1DDWA 2D9XA 1MAIA 3DXCA 5HE0A 3TCAA 5M4YB 4QJ4B 2KGXB 4KHAA 1LW3A 1U5DA 2V76A 1MIZB 1U27A 2MDXA 2N23A 3TFMA 4HAUB 2K2UA 4HATB 5HE3A 1V89A 3V5WA 2GCJA 2DYQA 2M14A 2FJUB 1MI1A 1BWNA 2LULA 2D10A 1TXDA 2VKIA 2LOXA 1XR0B 2HE7A 3SO6A 4GPTB 3NWDA 1PFJA 5IRSA 1KZ7A 2LG1A 4Z2MB 2D2QA 2D11A 1ISNA 4MY6A 1UPQA 1OQNA 2N0YA 2D9VA 3F0WA 2QKMA 1BTNA 3KSYA 2UZSA 2QKLA 4TYZA 1B55A 3NWFA 4A6KA 2H7DA 2KIEA 2OTXA 3OHMB 2D9WA 4H8SA 5D3WA 1P5TA 3AU4A 5D3XA 2DX1A 4ZRKA 2RLOA 2YT0A 3TW1A 3A8QA 3DXEA 3PEGA 3QBVB 5I2MA 2KR0A 2RRFA 2YF0A 2D9YA 5LOPB 1V88A 2ZPYA 4KVGB 4A6FB 2J0MA 2K8EA 2DN6A 2GUMA 3NWAA 5C5BB 4GNKB 3A98B 3PVLA 3U8ZA 3ULBA 4K17A 1KI1B 2R0DA 4GXBA 2YT1A 1DDMA 4HAYB 1FGZA
chains in the Genus database with same CATH topology
2P0DA 3PSCA 3T06A 5DHFB 2COFA 3CXBB 1EGXA 2I1KA 3GYOA 2MFQA 3ML4A 4TKNA 3P7ZA 1PMSA 5DI9B 2DHKA 4F7GA 5JHHA 4HB2B 4GN1A 1ZVRA 1IRSA 2P0HA 1W1GA 3WA0A 2J0JA 3QWMA 1ZSQA 4HAXB 4WVFB 1MK9B 2GCLA 5J3YA 4GMVA 2YS5A 3ULCA 2MWNB 1MPHA 3KY9A 1QC6A 4WJ7A 5CLQB 4HHVA 1RJ2A 4YL8A 2DTCA 2LOZA 2LYDA 3PZDA 1WGUA 2AL6A 1I7AA 1H4RA 2RSGA 1DROA 5KQ4A 3AU5A 2YS1A 1FB8A 1U5GA 2D4QA 1W1HA 1NTVA 2DHJA 4DX8A 1X86A 2RVBB 4CHJA 4MT7A 1TJ6A 5LONB 2JP2A 2YSZA 3MDBC 1X11A 2I5CA 1U2BA 3BINA 2Z0QA 1ZM0A 5GOWB 3BJIA 2ELAA 2IYBA 2PZ1A 1J19A 3O96A 1AQCA 1Y5OA 2VRWB 3MPXA 5J3TA 2I5FA 3KRWA 3DXDA 2D9ZA 2Z0PA 2J0KA 1ZC4B 4Y94A 4ZRIA 4KAXB 1DDVA 2CAYA 2DYNA 1ZC3B 5L81A 2IFSA 3D8EA 3NSUA 4F7HA 5JP4A 3LJUX 4K81A 3TO1A 3TVVA 4IOYX 3ZVRA 4CHMA 2G35A 2DKQA 1N3HA 3FEHA 4KHBB 2GS0A 5HE1A 4CYEA 5J3QA 1U5EA 4NY0A 3FM8C 1PLSA 1X1FA 4DX90 2LKOA 5D3YA 3HK0A 5EFXA 3KRXA 5D27A 2BCJA 1H10A 1BTKA 3PVWA 2CODA 3SUZA 4HB3B 1UNRA 1EF1A 3FSSA 3N7CA 2CRFA 2VSZA 5CLLB 5JLJB 4P7IA 1EVHA 3ODXA 3AJ4A 4EJNA 1U5FA 5JHGA 2Y8GA 1AWEA 1NI2A 1K5DB 4K2OA 1LB1A 1SHCA 4HB0B 1UNPA 3KZ1A 3M1IB 1QQGA 3P6AA 4HDOA 1TQZA 1UPRA 5C6RA 4PNKA 1P6SA 2EMTA 4HDQA 3UZTA 1BAKA 4KHOA 1XODA 4GMXB 2GJYA 2MKRA 4BBKA 2L1CA 3SYXA 2EC1A 2E2XA 4NSWA 3D8FA 2W2XC 4C0AA 2CY4A 2DFKA 3SNHA 2Q13A 1GC6A 1FHWA 1MKEA 3PP2A 1NU2A 1FGYA 1V5PA 4YONA 1SGHA 5FI0A 1WVHA 1DYNA 2XQNM 2W2WA 2J59M 1X1GA 2DX5A 1M7EA 2UVMA 3U7DA 2OQBA 4K2PA 1MIXA 3ODOA 4ZRJA 3IVFA 1I2HA 1Y19B 4B6HA 3RCPA 2KUPA 4WSFA 1FOEA 2W2XD 1U29A 2AEHA 5C16A 2R09A 2CY5A 4Z2NA 1NTYA 5D3VA 1MK7B 1WI1A 4HAVB 1E5WA 1X05A 3GYPA 2DLWA 3SV1A 4XWXA 2YS3A 4IAPA 2RUKB 3ODWA 1WJ1A 4PQ0A 1FHXA 3X23A 3WYFB 4HAZB 2ELBA 1Z87A 2Y8FA 2EJ8A 1W1DA 2DA0A 3CIKA 3HQCA 2I1JA 2Y7BA 1V61A 1V5UA 5DHAB 4A5KA 4EMOA 2COAA 1P3RA 3VIAA 1V5MA 5KCVA 4L6EA 3G9WA 2K2JA 3PG7A 2EMSA 5DIFB 2YRYA 1XD4A 1FHOA 3ZDTA 5DH9B 1UEFA 2RGNB 2DKPA 2Z0OA 5C79A 4MK0A 1EAZA 1KZGA 1WG7A 2K00A 2ADZA 2P8VA 1XKEA 1OY2A 1Q67A 5FI1A 1DBHA 1GG3A 4DBBA 4HB4B 4A6HA 4A6FA 2YVCA 3PVUA 2DHIA 4GZUA 5C5BA 1FAOA 1WGQA 2UZRA 3QIJA 2M38A 1XCGA 4F7UP 5HE2A 1RRPB 1XX0A 3VOQA 2ROVA 5KQ1A 2P0FA 4DXAB 1OMWA 4D0NB 1WJMA 3OANA 3HW2B 1J0WA 1M7RA 2KCJA 1GC7A 3D8DA 4IFSA 4EKUA 2COCA 2ROZB 2NZ8B 2HTHB 3A8PA 4HAWB 2X18A 3F5RA 2NMBA 2H7EA 2RNRB 2FJLA 1K5GB 2L2IA 1UNQA 1DDWA 2D9XA 1MAIA 3DXCA 5HE0A 3TCAA 2KGXB 4KHAA 1LW3A 1U5DA 2V76A 1MIZB 1U27A 2MDXA 2N23A 3TFMA 4HAUB 2K2UA 4HATB 5HE3A 1V89A 3V5WA 2GCJA 2DYQA 2M14A 1BWNA 2LULA 2D10A 1TXDA 2VKIA 2LOXA 1XR0B 2HE7A 3SO6A 4GPTB 1PFJA 1KZ7A 2LG1A 4Z2MB 2D2QA 2D11A 1ISNA 4MY6A 1UPQA 1OQNA 2N0YA 2D9VA 3F0WA 2QKMA 1BTNA 3KSYA 2UZSA 2QKLA 4TYZA 1B55A 4A6KA 2H7DA 2OTXA 2D9WA 4H8SA 5D3WA 1P5TA 3AU4A 5D3XA 2DX1A 4ZRKA 2RLOA 2YT0A 3TW1A 3A8QA 3DXEA 3PEGA 3QBVB 2YF0A 2D9YA 5LOPB 1V88A 2ZPYA 4KVGB 4A6FB 2J0MA 2DN6A 5C5BB 3A98B 3PVLA 3U8ZA 3ULBA 4K17A 1KI1B 2R0DA 4GXBA 2YT1A 1DDMA 4HAYB 1FGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0D A;  3PSC A;  3T06 A;  5DHF B;  2COF A;  3CXB B;  1EGX A;  2I1K A;  3GYO A;  2MFQ A;  3ML4 A;  4TKN A;  3P7Z A;  1PMS A;  5DI9 B;  2DHK A;  4F7G A;  5JHH A;  4HB2 B;  4GN1 A;  1ZVR A;  1IRS A;  2P0H A;  1W1G A;  3WA0 A;  2J0J A;  3QWM A;  1ZSQ A;  4HAX B;  4WVF B;  1MK9 B;  2GCL A;  5J3Y A;  4GMV A;  2YS5 A;  3ULC A;  2MWN B;  1MPH A;  3KY9 A;  1QC6 A;  4WJ7 A;  5CLQ B;  4HHV A;  1RJ2 A;  4YL8 A;  2DTC A;  2LOZ A;  2LYD A;  3PZD A;  1WGU A;  2AL6 A;  1I7A A;  1H4R A;  2RSG A;  1DRO A;  5KQ4 A;  3AU5 A;  2YS1 A;  1FB8 A;  1U5G A;  2D4Q A;  1W1H A;  1NTV A;  2DHJ A;  4DX8 A;  1X86 A;  2RVB B;  4CHJ A;  4MT7 A;  1TJ6 A;  5LON B;  2JP2 A;  2YSZ A;  3MDB C;  1X11 A;  2I5C A;  1U2B A;  3BIN A;  2Z0Q A;  1ZM0 A;  5GOW B;  3BJI A;  2ELA A;  2IYB A;  2PZ1 A;  1J19 A;  3O96 A;  1AQC A;  1Y5O A;  2VRW B;  3MPX A;  5J3T A;  2I5F A;  3KRW A;  3DXD A;  2D9Z A;  2Z0P A;  2J0K A;  1ZC4 B;  4Y94 A;  4ZRI A;  4KAX B;  1DDV A;  2CAY A;  2DYN A;  1ZC3 B;  5L81 A;  2IFS A;  3D8E A;  3NSU A;  4F7H A;  5JP4 A;  3LJU X;  4K81 A;  3TO1 A;  3TVV A;  4IOY X;  3ZVR A;  4CHM A;  2G35 A;  2DKQ A;  1N3H A;  3FEH A;  4KHB B;  2GS0 A;  5HE1 A;  4CYE A;  5J3Q A;  1U5E A;  4NY0 A;  3FM8 C;  1PLS A;  1X1F A;  4DX9 0;  2LKO A;  5D3Y A;  3HK0 A;  5EFX A;  3KRX A;  5D27 A;  2BCJ A;  1H10 A;  1BTK A;  3PVW A;  2COD A;  3SUZ A;  4HB3 B;  1UNR A;  1EF1 A;  3FSS A;  3N7C A;  2CRF A;  2VSZ A;  5CLL B;  5JLJ B;  4P7I A;  1EVH A;  3ODX A;  3AJ4 A;  4EJN A;  1U5F A;  5JHG A;  2Y8G A;  1AWE A;  1NI2 A;  1K5D B;  4K2O A;  1LB1 A;  1SHC A;  4HB0 B;  1UNP A;  3KZ1 A;  3M1I B;  1QQG A;  3P6A A;  4HDO A;  1TQZ A;  1UPR A;  5C6R A;  4PNK A;  1P6S A;  2EMT A;  4HDQ A;  3UZT A;  1BAK A;  4KHO A;  1XOD A;  4GMX B;  2GJY A;  2MKR A;  4BBK A;  2L1C A;  3SYX A;  2EC1 A;  2E2X A;  4NSW A;  3D8F A;  2W2X C;  4C0A A;  2CY4 A;  2DFK A;  3SNH A;  2Q13 A;  1GC6 A;  1FHW A;  1MKE A;  3PP2 A;  1NU2 A;  1FGY A;  1V5P A;  4YON A;  1SGH A;  5FI0 A;  1WVH A;  1DYN A;  2XQN M;  2W2W A;  2J59 M;  1X1G A;  2DX5 A;  1M7E A;  2UVM A;  3U7D A;  2OQB A;  4K2P A;  1MIX A;  3ODO A;  4ZRJ A;  3IVF A;  1I2H A;  1Y19 B;  4B6H A;  3RCP A;  2KUP A;  4WSF A;  1FOE A;  2W2X D;  1U29 A;  2AEH A;  5C16 A;  2R09 A;  2CY5 A;  4Z2N A;  1NTY A;  5D3V A;  1MK7 B;  1WI1 A;  4HAV B;  1E5W A;  1X05 A;  3GYP A;  2DLW A;  3SV1 A;  4XWX A;  2YS3 A;  4IAP A;  2RUK B;  3ODW A;  1WJ1 A;  4PQ0 A;  1FHX A;  3X23 A;  3WYF B;  4HAZ B;  2ELB A;  1Z87 A;  2Y8F A;  2EJ8 A;  1W1D A;  2DA0 A;  3CIK A;  3HQC A;  2I1J A;  2Y7B A;  1V61 A;  1V5U A;  5DHA B;  4A5K A;  4EMO A;  2COA A;  1P3R A;  3VIA A;  1V5M A;  5KCV A;  4L6E A;  3G9W A;  2K2J A;  3PG7 A;  2EMS A;  5DIF B;  2YRY A;  1XD4 A;  1FHO A;  3ZDT A;  5DH9 B;  1UEF A;  2RGN B;  2DKP A;  2Z0O A;  5C79 A;  4MK0 A;  1EAZ A;  1KZG A;  1WG7 A;  2K00 A;  2ADZ A;  2P8V A;  1XKE A;  1OY2 A;  1Q67 A;  5FI1 A;  1DBH A;  1GG3 A;  4DBB A;  4HB4 B;  4A6H A;  4A6F A;  2YVC A;  3PVU A;  2DHI A;  4GZU A;  5C5B A;  1FAO A;  1WGQ A;  2UZR A;  3QIJ A;  2M38 A;  1XCG A;  4F7U P;  5HE2 A;  1RRP B;  1XX0 A;  3VOQ A;  2ROV A;  5KQ1 A;  2P0F A;  4DXA B;  1OMW A;  4D0N B;  1WJM A;  3OAN A;  3HW2 B;  1J0W A;  1M7R A;  2KCJ A;  1GC7 A;  3D8D A;  4IFS A;  4EKU A;  2COC A;  2ROZ B;  2NZ8 B;  2HTH B;  3A8P A;  4HAW B;  2X18 A;  3F5R A;  2NMB A;  2H7E A;  2RNR B;  2FJL A;  1K5G B;  2L2I A;  1UNQ A;  1DDW A;  2D9X A;  1MAI A;  3DXC A;  5HE0 A;  3TCA A;  2KGX B;  4KHA A;  1LW3 A;  1U5D A;  2V76 A;  1MIZ B;  1U27 A;  2MDX A;  2N23 A;  3TFM A;  4HAU B;  2K2U A;  4HAT B;  5HE3 A;  1V89 A;  3V5W A;  2GCJ A;  2DYQ A;  2M14 A;  1BWN A;  2LUL A;  2D10 A;  1TXD A;  2VKI A;  2LOX A;  1XR0 B;  2HE7 A;  3SO6 A;  4GPT B;  1PFJ A;  1KZ7 A;  2LG1 A;  4Z2M B;  2D2Q A;  2D11 A;  1ISN A;  4MY6 A;  1UPQ A;  1OQN A;  2N0Y A;  2D9V A;  3F0W A;  2QKM A;  1BTN A;  3KSY A;  2UZS A;  2QKL A;  4TYZ A;  1B55 A;  4A6K A;  2H7D A;  2OTX A;  2D9W A;  4H8S A;  5D3W A;  1P5T A;  3AU4 A;  5D3X A;  2DX1 A;  4ZRK A;  2RLO A;  2YT0 A;  3TW1 A;  3A8Q A;  3DXE A;  3PEG A;  3QBV B;  2YF0 A;  2D9Y A;  5LOP B;  1V88 A;  2ZPY A;  4KVG B;  4A6F B;  2J0M A;  2DN6 A;  5C5B B;  3A98 B;  3PVL A;  3U8Z A;  3ULB A;  4K17 A;  1KI1 B;  2R0D A;  4GXB A;  2YT1 A;  1DDM A;  4HAY B;  1FGZ A; 
#chains in the Genus database with same CATH topology
 2P0D A;  3PSC A;  3T06 A;  5DHF B;  2YT2 A;  2COF A;  3CXB B;  1EGX A;  2I1K A;  3FVC A;  3GYO A;  2MFQ A;  3ML4 A;  4TKN A;  3P7Z A;  1PMS A;  5DI9 B;  2DHK A;  4F7G A;  5JHH A;  4HB2 B;  4GN1 A;  1ZVR A;  1IRS A;  2P0H A;  1W1G A;  3WA0 A;  2J0J A;  3QWM A;  1ZSQ A;  4HAX B;  4WVF B;  1MK9 B;  2GCL A;  5J3Y A;  4GMV A;  2YS5 A;  3ULC A;  2MWN B;  1MPH A;  3KY9 A;  1QC6 A;  4WJ7 A;  5CLQ B;  4HHV A;  1RJ2 A;  4YL8 A;  2DTC A;  2LOZ A;  2LYD A;  3U12 A;  3PZD A;  1WGU A;  2AL6 A;  1I7A A;  1H4R A;  2RSG A;  1DRO A;  5KQ4 A;  3AU5 A;  2YS1 A;  1FB8 A;  1U5G A;  2D4Q A;  1W1H A;  1NTV A;  2DHJ A;  4DX8 A;  1X86 A;  2RVB B;  4CHJ A;  4MT7 A;  1TJ6 A;  5LON B;  2JP2 A;  2YSZ A;  3MDB C;  1X11 A;  2I5C A;  1U2B A;  3BIN A;  2Z0Q A;  1ZM0 A;  5GOW B;  3BJI A;  2ELA A;  2IYB A;  2PZ1 A;  1J19 A;  3O96 A;  5I2S A;  1AQC A;  1Y5O A;  3HSA A;  2VRW B;  3MPX A;  5J3T A;  2I5F A;  2ZKM X;  3KRW A;  3DXD A;  2D9Z A;  2Z0P A;  2J0K A;  1ZC4 B;  4Y94 A;  4ZRI A;  4KAX B;  1DDV A;  2CAY A;  2DYN A;  1ZC3 B;  5L81 A;  2IFS A;  2Z4D A;  3D8E A;  4OSN A;  3NSU A;  4F7H A;  5JP4 A;  3LJU X;  4K81 A;  3TO1 A;  3TVV A;  4IOY X;  3ZVR A;  3A58 A;  4CHM A;  2G35 A;  2DKQ A;  3B77 A;  1N3H A;  3FEH A;  4KHB B;  2GS0 A;  5HE1 A;  4CYE A;  5J3Q A;  1U5E A;  4NY0 A;  3FM8 C;  1PLS A;  1X1F A;  4DX9 0;  2LKO A;  5D3Y A;  3HK0 A;  4KHB A;  3KRX A;  5EFX A;  5D27 A;  2BCJ A;  1H10 A;  1BTK A;  3PVW A;  2COD A;  3SUZ A;  4HB3 B;  1UNR A;  4DIX A;  1EF1 A;  3FSS A;  3N7C A;  2CRF A;  2VSZ A;  5CLL B;  3DCX A;  5JLJ B;  4P7I A;  1EVH A;  3ODX A;  3AJ4 A;  4EJN A;  1U5F A;  5JHG A;  2Y8G A;  1AWE A;  1NI2 A;  1K5D B;  4K2O A;  1LB1 A;  1SHC A;  2R2Y A;  4HB0 B;  1T77 A;  1UNP A;  3KZ1 A;  4QJ5 B;  3M1I B;  1QQG A;  3P6A A;  4HDO A;  1TQZ A;  1UPR A;  5C6R A;  4PNK A;  1P6S A;  2Z59 A;  2EMT A;  4HDQ A;  3UZT A;  1BAK A;  4KHO A;  1XOD A;  4GMX B;  2GJY A;  2MKR A;  4BBK A;  2L1C A;  3SYX A;  2EC1 A;  2E2X A;  4NSW A;  4QJ3 B;  3D8F A;  2W2X C;  4C0A A;  2CY4 A;  2DFK A;  3SNH A;  2Q13 A;  1GC6 A;  1FHW A;  1MKE A;  3PP2 A;  3NW8 A;  1NU2 A;  1FGY A;  1V5P A;  4YON A;  1SGH A;  4L1R A;  5FI0 A;  1WVH A;  4QXA B;  1DYN A;  1ZYI A;  2XQN M;  2W2W A;  2J59 M;  1X1G A;  2DX5 A;  1M7E A;  2UVM A;  3U7D A;  2OQB A;  4K2P A;  1MIX A;  3ODO A;  4ZRJ A;  4HSI A;  3IVF A;  1I2H A;  1Y19 B;  4B6H A;  3RCP A;  2KUP A;  4OT1 A;  4WSF A;  1FOE A;  2W2X D;  1U29 A;  2AEH A;  5C16 A;  2R09 A;  2CY5 A;  4Z2N A;  1NTY A;  5D3V A;  1MK7 B;  1WI1 A;  4HAV B;  1E5W A;  1X05 A;  3GYP A;  2DLW A;  3SV1 A;  4XWX A;  2YS3 A;  4IAP A;  2RUK B;  2KUQ A;  3ODW A;  1WJ1 A;  4PQ0 A;  4CSQ A;  2KIG A;  1FHX A;  3X23 A;  3WYF B;  4D6W A;  4HAZ B;  2ELB A;  1Z87 A;  2Y8F A;  2EJ8 A;  1W1D A;  2DA0 A;  3CIK A;  3HQC A;  2I1J A;  2Y7B A;  1V61 A;  1V5U A;  5DHA B;  4A5K A;  2NBV A;  4EMO A;  2COA A;  1P3R A;  3VIA A;  1V5M A;  5KCV A;  4L6E A;  3G9W A;  2K2J A;  3PG7 A;  2EMS A;  5DIF B;  2YRY A;  1XD4 A;  3HIE A;  1FHO A;  3ZDT A;  5DH9 B;  1UEF A;  2RGN B;  2DKP A;  2Z13 A;  2Z0O A;  5C79 A;  4MK0 A;  1EAZ A;  1KZG A;  1WG7 A;  2K00 A;  2ADZ A;  2P8V A;  1XKE A;  1OY2 A;  5LG4 B;  1Q67 A;  5FI1 A;  1DBH A;  1GG3 A;  4DBB A;  4HB4 B;  4A6H A;  4GOU A;  4A6F A;  2YVC A;  3PVU A;  2DHI A;  4GZU A;  5C5B A;  1FAO A;  1WGQ A;  2UZR A;  3QIJ A;  2M38 A;  1XCG A;  4F7U P;  5HE2 A;  1RRP B;  1XX0 A;  2K49 A;  3VOQ A;  2ROV A;  5KQ1 A;  2P0F A;  4DXA B;  1OMW A;  4D0N B;  1WJM A;  3OAN A;  3HW2 B;  1J0W A;  1M7R A;  2KCJ A;  1GC7 A;  3D8D A;  4IFS A;  4EKU A;  2COC A;  2ROZ B;  2NZ8 B;  2HTH B;  3A8P A;  4HAW B;  2Z14 A;  2X18 A;  3F5R A;  2NMB A;  2H7E A;  2RNR B;  2FJL A;  1K5G B;  2L2I A;  1UNQ A;  1DDW A;  2D9X A;  1MAI A;  3DXC A;  5HE0 A;  3TCA A;  5M4Y B;  4QJ4 B;  2KGX B;  4KHA A;  1LW3 A;  1U5D A;  2V76 A;  1MIZ B;  1U27 A;  2MDX A;  2N23 A;  3TFM A;  4HAU B;  2K2U A;  4HAT B;  5HE3 A;  1V89 A;  3V5W A;  2GCJ A;  2DYQ A;  2M14 A;  2FJU B;  1MI1 A;  1BWN A;  2LUL A;  2D10 A;  1TXD A;  2VKI A;  2LOX A;  1XR0 B;  2HE7 A;  3SO6 A;  4GPT B;  3NWD A;  1PFJ A;  5IRS A;  1KZ7 A;  2LG1 A;  4Z2M B;  2D2Q A;  2D11 A;  1ISN A;  4MY6 A;  1UPQ A;  1OQN A;  2N0Y A;  2D9V A;  3F0W A;  2QKM A;  1BTN A;  3KSY A;  2UZS A;  2QKL A;  4TYZ A;  1B55 A;  3NWF A;  4A6K A;  2H7D A;  2KIE A;  2OTX A;  3OHM B;  2D9W A;  4H8S A;  5D3W A;  1P5T A;  3AU4 A;  5D3X A;  2DX1 A;  4ZRK A;  2RLO A;  2YT0 A;  3TW1 A;  3A8Q A;  3DXE A;  3PEG A;  3QBV B;  5I2M A;  2KR0 A;  2RRF A;  2YF0 A;  2D9Y A;  5LOP B;  1V88 A;  2ZPY A;  4KVG B;  4A6F B;  2J0M A;  2K8E A;  2DN6 A;  2GUM A;  3NWA A;  5C5B B;  4GNK B;  3A98 B;  3PVL A;  3U8Z A;  3ULB A;  4K17 A;  1KI1 B;  2R0D A;  4GXB A;  2YT1 A;  1DDM A;  4HAY B;  1FGZ A; 
#chains in the Genus database with same CATH homology
 2P0D A;  3PSC A;  3T06 A;  5DHF B;  2COF A;  3CXB B;  1EGX A;  2I1K A;  3GYO A;  2MFQ A;  3ML4 A;  4TKN A;  3P7Z A;  1PMS A;  5DI9 B;  2DHK A;  4F7G A;  5JHH A;  4HB2 B;  4GN1 A;  1ZVR A;  1IRS A;  2P0H A;  1W1G A;  3WA0 A;  2J0J A;  3QWM A;  1ZSQ A;  4HAX B;  4WVF B;  1MK9 B;  2GCL A;  5J3Y A;  4GMV A;  2YS5 A;  3ULC A;  2MWN B;  1MPH A;  3KY9 A;  1QC6 A;  4WJ7 A;  5CLQ B;  4HHV A;  1RJ2 A;  4YL8 A;  2DTC A;  2LOZ A;  2LYD A;  3PZD A;  1WGU A;  2AL6 A;  1I7A A;  1H4R A;  2RSG A;  1DRO A;  5KQ4 A;  3AU5 A;  2YS1 A;  1FB8 A;  1U5G A;  2D4Q A;  1W1H A;  1NTV A;  2DHJ A;  4DX8 A;  1X86 A;  2RVB B;  4CHJ A;  4MT7 A;  1TJ6 A;  5LON B;  2JP2 A;  2YSZ A;  3MDB C;  1X11 A;  2I5C A;  1U2B A;  3BIN A;  2Z0Q A;  1ZM0 A;  5GOW B;  3BJI A;  2ELA A;  2IYB A;  2PZ1 A;  1J19 A;  3O96 A;  1AQC A;  1Y5O A;  2VRW B;  3MPX A;  5J3T A;  2I5F A;  3KRW A;  3DXD A;  2D9Z A;  2Z0P A;  2J0K A;  1ZC4 B;  4Y94 A;  4ZRI A;  4KAX B;  1DDV A;  2CAY A;  2DYN A;  1ZC3 B;  5L81 A;  2IFS A;  3D8E A;  3NSU A;  4F7H A;  5JP4 A;  3LJU X;  4K81 A;  3TO1 A;  3TVV A;  4IOY X;  3ZVR A;  4CHM A;  2G35 A;  2DKQ A;  1N3H A;  3FEH A;  4KHB B;  2GS0 A;  5HE1 A;  4CYE A;  5J3Q A;  1U5E A;  4NY0 A;  3FM8 C;  1PLS A;  1X1F A;  4DX9 0;  2LKO A;  5D3Y A;  3HK0 A;  5EFX A;  3KRX A;  5D27 A;  2BCJ A;  1H10 A;  1BTK A;  3PVW A;  2COD A;  3SUZ A;  4HB3 B;  1UNR A;  1EF1 A;  3FSS A;  3N7C A;  2CRF A;  2VSZ A;  5CLL B;  5JLJ B;  4P7I A;  1EVH A;  3ODX A;  3AJ4 A;  4EJN A;  1U5F A;  5JHG A;  2Y8G A;  1AWE A;  1NI2 A;  1K5D B;  4K2O A;  1LB1 A;  1SHC A;  4HB0 B;  1UNP A;  3KZ1 A;  3M1I B;  1QQG A;  3P6A A;  4HDO A;  1TQZ A;  1UPR A;  5C6R A;  4PNK A;  1P6S A;  2EMT A;  4HDQ A;  3UZT A;  1BAK A;  4KHO A;  1XOD A;  4GMX B;  2GJY A;  2MKR A;  4BBK A;  2L1C A;  3SYX A;  2EC1 A;  2E2X A;  4NSW A;  3D8F A;  2W2X C;  4C0A A;  2CY4 A;  2DFK A;  3SNH A;  2Q13 A;  1GC6 A;  1FHW A;  1MKE A;  3PP2 A;  1NU2 A;  1FGY A;  1V5P A;  4YON A;  1SGH A;  5FI0 A;  1WVH A;  1DYN A;  2XQN M;  2W2W A;  2J59 M;  1X1G A;  2DX5 A;  1M7E A;  2UVM A;  3U7D A;  2OQB A;  4K2P A;  1MIX A;  3ODO A;  4ZRJ A;  3IVF A;  1I2H A;  1Y19 B;  4B6H A;  3RCP A;  2KUP A;  4WSF A;  1FOE A;  2W2X D;  1U29 A;  2AEH A;  5C16 A;  2R09 A;  2CY5 A;  4Z2N A;  1NTY A;  5D3V A;  1MK7 B;  1WI1 A;  4HAV B;  1E5W A;  1X05 A;  3GYP A;  2DLW A;  3SV1 A;  4XWX A;  2YS3 A;  4IAP A;  2RUK B;  3ODW A;  1WJ1 A;  4PQ0 A;  1FHX A;  3X23 A;  3WYF B;  4HAZ B;  2ELB A;  1Z87 A;  2Y8F A;  2EJ8 A;  1W1D A;  2DA0 A;  3CIK A;  3HQC A;  2I1J A;  2Y7B A;  1V61 A;  1V5U A;  5DHA B;  4A5K A;  4EMO A;  2COA A;  1P3R A;  3VIA A;  1V5M A;  5KCV A;  4L6E A;  3G9W A;  2K2J A;  3PG7 A;  2EMS A;  5DIF B;  2YRY A;  1XD4 A;  1FHO A;  3ZDT A;  5DH9 B;  1UEF A;  2RGN B;  2DKP A;  2Z0O A;  5C79 A;  4MK0 A;  1EAZ A;  1KZG A;  1WG7 A;  2K00 A;  2ADZ A;  2P8V A;  1XKE A;  1OY2 A;  1Q67 A;  5FI1 A;  1DBH A;  1GG3 A;  4DBB A;  4HB4 B;  4A6H A;  4A6F A;  2YVC A;  3PVU A;  2DHI A;  4GZU A;  5C5B A;  1FAO A;  1WGQ A;  2UZR A;  3QIJ A;  2M38 A;  1XCG A;  4F7U P;  5HE2 A;  1RRP B;  1XX0 A;  3VOQ A;  2ROV A;  5KQ1 A;  2P0F A;  4DXA B;  1OMW A;  4D0N B;  1WJM A;  3OAN A;  3HW2 B;  1J0W A;  1M7R A;  2KCJ A;  1GC7 A;  3D8D A;  4IFS A;  4EKU A;  2COC A;  2ROZ B;  2NZ8 B;  2HTH B;  3A8P A;  4HAW B;  2X18 A;  3F5R A;  2NMB A;  2H7E A;  2RNR B;  2FJL A;  1K5G B;  2L2I A;  1UNQ A;  1DDW A;  2D9X A;  1MAI A;  3DXC A;  5HE0 A;  3TCA A;  2KGX B;  4KHA A;  1LW3 A;  1U5D A;  2V76 A;  1MIZ B;  1U27 A;  2MDX A;  2N23 A;  3TFM A;  4HAU B;  2K2U A;  4HAT B;  5HE3 A;  1V89 A;  3V5W A;  2GCJ A;  2DYQ A;  2M14 A;  1BWN A;  2LUL A;  2D10 A;  1TXD A;  2VKI A;  2LOX A;  1XR0 B;  2HE7 A;  3SO6 A;  4GPT B;  1PFJ A;  1KZ7 A;  2LG1 A;  4Z2M B;  2D2Q A;  2D11 A;  1ISN A;  4MY6 A;  1UPQ A;  1OQN A;  2N0Y A;  2D9V A;  3F0W A;  2QKM A;  1BTN A;  3KSY A;  2UZS A;  2QKL A;  4TYZ A;  1B55 A;  4A6K A;  2H7D A;  2OTX A;  2D9W A;  4H8S A;  5D3W A;  1P5T A;  3AU4 A;  5D3X A;  2DX1 A;  4ZRK A;  2RLO A;  2YT0 A;  3TW1 A;  3A8Q A;  3DXE A;  3PEG A;  3QBV B;  2YF0 A;  2D9Y A;  5LOP B;  1V88 A;  2ZPY A;  4KVG B;  4A6F B;  2J0M A;  2DN6 A;  5C5B B;  3A98 B;  3PVL A;  3U8Z A;  3ULB A;  4K17 A;  1KI1 B;  2R0D A;  4GXB A;  2YT1 A;  1DDM A;  4HAY B;  1FGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...