5KQ1A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
total genus 36
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq1A00
3HW2B 1UPRA 5LONB 5HE2A 2XQNM 4PQ0A 1MPHA 4HAVB 1J19A 1NU2A 4KHAA 3IVFA 2UVMA 2PZ1A 3A98B 4MT7A 2P8VA 2Y7BA 1KZGA 2DX1A 2I1KA 3DXDA 1H10A 1V61A 2RGNB 4A6KA 3D8FA 4Y94A 5D27A 4DX90 4F7UP 4ZRJA 4WJ7A 2YT0A 3HK0A 2K2JA 1U29A 5LOPB 3AJ4A 4TKNA 4EJNA 2KGXB 1WGQA 1WVHA 3GYPA 5DI9B 3VOQA 4ZRKA 1UNQA 1XCGA 1IRSA 3PSCA 2E2XA 4EKUA 2I1JA 1UNPA 2Z0QA 1MKEA 2NZ8B 2P0DA 2HE7A 4MK0A 5C5BB 3PVLA 4NSWA 3CXBB 5CLQB 2ROZB 5EFXA 2Y8GA 2K2UA 2MKRA 1PFJA 1SGHA 3ODXA 1U5FA 3P7ZA 1M7RA 2Q13A 1BTNA 3ZVRA 2MWNB 1FHWA 2GJYA 3M1IB 2L2IA 1XR0B 2MFQA 4A6HA 2UZRA 2D9ZA 3TFMA 4YL8A 1GC7A 1ISNA 2FJLA 3CIKA 5J3YA 3FSSA 4HAWB 1WJ1A 2GCLA 1MK7B 2N0YA 4WVFB 3KRXA 2DA0A 3TVVA 5FI0A 2QKLA 1I7AA 2D10A 2D11A 4KHOA 1LW3A 1XKEA 5L81A 3ODOA 4GZUA 1DDMA 3TO1A 3BINA 2LYDA 4HAYB 1MAIA 5D3WA 1ZC4B 2RNRB 3KZ1A 4GPTB 2HTHB 1TXDA 1ZSQA 5J3QA 1U2BA 1WJMA 1V89A 4F7HA 1NI2A 3FM8C 1FHOA 2OTXA 4HB3B 4GMXB 1H4RA 2EC1A 2R09A 1M7EA 1FB8A 3KY9A 1EAZA 1X86A 1V5UA 3QWMA 2D4QA 4NY0A 1V5MA 2G35A 1QC6A 3OANA 4BBKA 3F0WA 2D9YA 2D9XA 2DN6A 3DXEA 3PZDA 4IFSA 3UZTA 2Z0PA 5KQ1A 3A8PA 2YS3A 3MPXA 2DHIA 1X1FA 4HAXB 2JP2A 2EMTA 2DLWA 1V5PA 2J0KA 2V76A 2YVCA 3NSUA 3PEGA 2YF0A 2VRWB 3U8ZA 2OQBA 4HAZB 1UNRA 4IAPA 3O96A 1Y5OA 3DXCA 1PMSA 1FGYA 1BAKA 1W1HA 1PLSA 2DFKA 4P7IA 2YS5A 1RJ2A 1FHXA 3PG7A 2I5FA 2LG1A 4B6HA 1GG3A 2ZPYA 3F5RA 5DHAB 3BJIA 4GMVA 2CAYA 2Z0OA 5JP4A 1AWEA 1GC6A 3N7CA 2AEHA 2DKPA 1ZVRA 2YT1A 4PNKA 3SNHA 3RCPA 2IYBA 1P3RA 3VIAA 4K2PA 3LJUX 3ODWA 2MDXA 4CYEA 2M14A 1J0WA 1WG7A 3GYOA 4EMOA 5C6RA 2BCJA 5C79A 2W2WA 1TQZA 2J59M 2COCA 2ADZA 1EF1A 3D8DA 3KRWA 1XX0A 5CLLB 2DHJA 5KQ4A 4DX8A 4Z2NA 3P6AA 2LOXA 2M38A 4IOYX 3KSYA 3ML4A 3WA0A 2Y8FA 2DTCA 2W2XD 5JHGA 4MY6A 4KAXB 3SYXA 3FEHA 1EVHA 4CHJA 2R0DA 3AU5A 3TW1A 1SHCA 3QBVB 4K81A 1WGUA 4KVGB 2DHKA 4HDOA 1E5WA 1Y19B 1KZ7A 4CHMA 1U5GA 1UEFA 1OQNA 2VSZA 2DX5A 2W2XC 1KI1B 4DXAB 4D0NB 3V5WA 4A5KA 2GCJA 5KCVA 2YRYA 2DYQA 5DIFB 1RRPB 2VKIA 1Z87A 3QIJA 4YONA 1FOEA 1X11A 1XD4A 4K2OA 1OMWA 2NMBA 4KHBB 1AQCA 1ZC3B 2DKQA 2RUKB 4TYZA 3D8EA 2DYNA 1DYNA 1ZM0A 1X1GA 2EJ8A 3SUZA 3PP2A 4A6FA 2QKMA 2KCJA 1Q67A 2N23A 4HB0B 2RSGA 3ULCA 5HE1A 1DDVA 1K5GB 4HATB 2LKOA 1DROA 5DHFB 2LULA 2YSZA 1MK9B 1TJ6A 3TCAA 1U5EA 2I5CA 1BTKA 1K5DB 4K17A 4Z2MB 4HHVA 3AU4A 4HB2B 3X23A 5HE3A 5D3YA 5JLJB 2CODA 1B55A 1U27A 1U5DA 2COAA 3SO6A 2AL6A 3PVUA 4GXBA 1NTYA 2D2QA 1V88A 5JHHA 1FGZA 4HDQA 1FAOA 2K00A 2IFSA 4XWXA 5FI1A 2H7EA 1P5TA 1XODA 2ROVA 1EGXA 2RLOA 4F7GA 2CY5A 1MIXA 3SV1A 2P0HA 2ELAA 2UZSA 2H7DA 3U7DA 2ELBA 3ULBA 4DBBA 4WSFA 4H8SA 5C16A 1W1DA 1X05A 1W1GA 1P6SA 5D3XA 2KUPA 5HE0A 1DBHA 5J3TA 1OY2A 3WYFB 5C5BA 2L1CA 1N3HA 3ZDTA 2CY4A 4HB4B 2D9VA 2D9WA 4L6EA 1WI1A 5GOWB 3PVWA 2GS0A 1LB1A 3G9WA 2CRFA 2LOZA 1MIZB 1DDWA 2EMSA 1BWNA 2J0MA 2J0JA 5D3VA 1I2HA 5DH9B 4C0AA 2X18A 1QQGA 4HAUB 1NTVA 3T06A 3MDBC 2RVBB 2YS1A 4ZRIA 2P0FA 4GN1A 4A6FB 1UPQA 3A8QA 2COFA 3HQCA
chains in the Genus database with same CATH superfamily
3HW2B 1UPRA 5LONB 3OHMB 5HE2A 2XQNM 4PQ0A 1MPHA 4HAVB 1J19A 1NU2A 4KHAA 3IVFA 2UVMA 2PZ1A 3A98B 4MT7A 2P8VA 2Y7BA 1KZGA 1MI1A 2DX1A 2I1KA 3DXDA 1H10A 1V61A 2RGNB 4A6KA 2K8EA 3D8FA 4Y94A 5D27A 4DX90 4F7UP 4ZRJA 4WJ7A 3NWDA 2YT0A 3HK0A 2K2JA 1U29A 5LOPB 3AJ4A 4TKNA 4EJNA 2KGXB 1WGQA 1WVHA 3GYPA 5DI9B 3VOQA 4ZRKA 1UNQA 1XCGA 1IRSA 3PSCA 5I2MA 2E2XA 4EKUA 2I1JA 1UNPA 2Z0QA 1MKEA 2NZ8B 4HSIA 2P0DA 2HE7A 4MK0A 2FJUB 3PVLA 5C5BB 4NSWA 3CXBB 5CLQB 2ROZB 5EFXA 2Y8GA 2K2UA 2MKRA 1PFJA 1SGHA 3ODXA 1U5FA 1M7RA 3P7ZA 2Q13A 1BTNA 3ZVRA 2MWNB 1FHWA 2GJYA 4QXAB 3M1IB 2L2IA 2KUQA 1XR0B 2MFQA 4A6HA 2UZRA 3NWAA 2D9ZA 3TFMA 4YL8A 1GC7A 1ISNA 2FJLA 3CIKA 5J3YA 3FSSA 2Z14A 4HAWB 1WJ1A 2GCLA 1MK7B 2N0YA 4WVFB 4QJ3B 3KRXA 2DA0A 3TVVA 5FI0A 2QKLA 1I7AA 2D10A 2D11A 4KHOA 1LW3A 1XKEA 5L81A 3ODOA 4GZUA 2KIEA 1DDMA 3TO1A 3BINA 2LYDA 4HAYB 1MAIA 5D3WA 1ZC4B 2RNRB 3KZ1A 4GPTB 2HTHB 1TXDA 1ZSQA 5J3QA 1U2BA 1WJMA 1V89A 4F7HA 1NI2A 3FM8C 1FHOA 2OTXA 4HB3B 4GMXB 3NWFA 1H4RA 2EC1A 2R09A 1M7EA 1FB8A 3KY9A 5M4YB 1EAZA 1X86A 1V5UA 3QWMA 2D4QA 4NY0A 1V5MA 3NW8A 2G35A 1QC6A 2Z59A 3OANA 4BBKA 3F0WA 2D9YA 2D9XA 2DN6A 3DXEA 2Z4DA 3PZDA 4IFSA 3UZTA 2Z0PA 5KQ1A 3A8PA 2YS3A 4L1RA 3MPXA 2DHIA 1X1FA 4OT1A 4HAXB 2JP2A 2EMTA 2DLWA 1V5PA 2J0KA 2V76A 2YVCA 3NSUA 3PEGA 2YF0A 2VRWB 3U8ZA 2OQBA 4HAZB 1UNRA 4IAPA 2Z13A 1Y5OA 3DXCA 1PMSA 1FGYA 2K49A 1W1HA 3O96A 1BAKA 1PLSA 2DFKA 4P7IA 2YS5A 1RJ2A 1FHXA 3PG7A 2I5FA 2LG1A 4B6HA 1GG3A 3HSAA 2ZPYA 3F5RA 5DHAB 1ZYIA 3BJIA 4GMVA 2CAYA 2Z0OA 5JP4A 1AWEA 1GC6A 3N7CA 2AEHA 2DKPA 1ZVRA 2YT1A 2KR0A 4GOUA 4PNKA 3SNHA 3RCPA 2IYBA 1P3RA 3VIAA 4K2PA 3LJUX 3ODWA 2MDXA 2NBVA 4CYEA 2M14A 1J0WA 1WG7A 3GYOA 4EMOA 5C6RA 2BCJA 5C79A 2W2WA 1TQZA 2J59M 2COCA 2ADZA 5IRSA 1EF1A 3D8DA 3KRWA 1XX0A 5CLLB 2DHJA 5KQ4A 4DX8A 4Z2NA 3P6AA 2LOXA 2M38A 4IOYX 3KSYA 3ML4A 3WA0A 4QJ5B 2RRFA 2Y8FA 2DTCA 2W2XD 5LG4B 5JHGA 4MY6A 4KAXB 3SYXA 3FEHA 1EVHA 4CHJA 2R0DA 3AU5A 1T77A 2KIGA 3TW1A 1SHCA 3QBVB 4K81A 1WGUA 4KVGB 2DHKA 4HDOA 1E5WA 1Y19B 1KZ7A 4CSQA 1U5GA 4CHMA 1UEFA 1OQNA 2VSZA 2DX5A 2W2XC 1KI1B 4DXAB 4D0NB 3V5WA 3A58A 4A5KA 2GCJA 5KCVA 2YRYA 2DYQA 5DIFB 1RRPB 2VKIA 3DCXA 1Z87A 3QIJA 4YONA 1FOEA 1X11A 1XD4A 2YT2A 4K2OA 1OMWA 2NMBA 4KHBB 1AQCA 1ZC3B 2DKQA 2RUKB 4TYZA 3D8EA 3U12A 2DYNA 1DYNA 1ZM0A 1X1GA 2EJ8A 3SUZA 3PP2A 4A6FA 2QKMA 2KCJA 1Q67A 2N23A 4HB0B 2RSGA 3ULCA 4KHBA 5HE1A 1DDVA 1K5GB 4HATB 2LKOA 1DROA 5DHFB 4DIXA 2LULA 2YSZA 1MK9B 1TJ6A 2R2YA 3TCAA 1U5EA 2I5CA 1BTKA 1K5DB 4K17A 4Z2MB 4HHVA 3AU4A 4HB2B 3X23A 5HE3A 5D3YA 4OSNA 5JLJB 2CODA 1B55A 1U27A 1U5DA 2COAA 3SO6A 2AL6A 3PVUA 4GXBA 1NTYA 2D2QA 1V88A 5JHHA 1FGZA 4HDQA 1FAOA 2K00A 2IFSA 2ZKMX 4XWXA 5FI1A 2H7EA 1P5TA 1XODA 2ROVA 1EGXA 2RLOA 4F7GA 2CY5A 1MIXA 3SV1A 2P0HA 2ELAA 2UZSA 2H7DA 3U7DA 5I2SA 2ELBA 3ULBA 4DBBA 4WSFA 4H8SA 5C16A 1W1DA 1X05A 1W1GA 1P6SA 2GUMA 5D3XA 2KUPA 5HE0A 1DBHA 5J3TA 1OY2A 3WYFB 5C5BA 2L1CA 1N3HA 3ZDTA 2CY4A 4HB4B 2D9VA 2D9WA 4L6EA 1WI1A 5GOWB 4GNKB 3PVWA 2GS0A 1LB1A 3G9WA 2CRFA 2LOZA 1MIZB 1DDWA 2EMSA 1BWNA 2J0MA 2J0JA 5D3VA 1I2HA 5DH9B 3B77A 4C0AA 2X18A 1QQGA 4HAUB 3FVCA 1NTVA 4D6WA 3T06A 3MDBC 2RVBB 2YS1A 4ZRIA 3HIEA 2P0FA 4QJ4B 4GN1A 4A6FB 1UPQA 3A8QA 2COFA 3HQCA
chains in the Genus database with same CATH topology
3HW2B 1UPRA 5LONB 5HE2A 2XQNM 4PQ0A 1MPHA 4HAVB 1J19A 1NU2A 4KHAA 3IVFA 2UVMA 2PZ1A 3A98B 4MT7A 2P8VA 2Y7BA 1KZGA 2DX1A 2I1KA 3DXDA 1H10A 1V61A 2RGNB 4A6KA 3D8FA 4Y94A 5D27A 4DX90 4F7UP 4ZRJA 4WJ7A 2YT0A 3HK0A 2K2JA 1U29A 5LOPB 3AJ4A 4TKNA 4EJNA 2KGXB 1WGQA 1WVHA 3GYPA 5DI9B 3VOQA 4ZRKA 1UNQA 1XCGA 1IRSA 3PSCA 2E2XA 4EKUA 2I1JA 1UNPA 2Z0QA 1MKEA 2NZ8B 2P0DA 2HE7A 4MK0A 5C5BB 3PVLA 4NSWA 3CXBB 5CLQB 2ROZB 5EFXA 2Y8GA 2K2UA 2MKRA 1PFJA 1SGHA 3ODXA 1U5FA 3P7ZA 1M7RA 2Q13A 1BTNA 3ZVRA 2MWNB 1FHWA 2GJYA 3M1IB 2L2IA 1XR0B 2MFQA 4A6HA 2UZRA 2D9ZA 3TFMA 4YL8A 1GC7A 1ISNA 2FJLA 3CIKA 5J3YA 3FSSA 4HAWB 1WJ1A 2GCLA 1MK7B 2N0YA 4WVFB 3KRXA 2DA0A 3TVVA 5FI0A 2QKLA 1I7AA 2D10A 2D11A 4KHOA 1LW3A 1XKEA 5L81A 3ODOA 4GZUA 1DDMA 3TO1A 3BINA 2LYDA 4HAYB 1MAIA 5D3WA 1ZC4B 2RNRB 3KZ1A 4GPTB 2HTHB 1TXDA 1ZSQA 5J3QA 1U2BA 1WJMA 1V89A 4F7HA 1NI2A 3FM8C 1FHOA 2OTXA 4HB3B 4GMXB 1H4RA 2EC1A 2R09A 1M7EA 1FB8A 3KY9A 1EAZA 1X86A 1V5UA 3QWMA 2D4QA 4NY0A 1V5MA 2G35A 1QC6A 3OANA 4BBKA 3F0WA 2D9YA 2D9XA 2DN6A 3DXEA 3PZDA 4IFSA 3UZTA 2Z0PA 5KQ1A 3A8PA 2YS3A 3MPXA 2DHIA 1X1FA 4HAXB 2JP2A 2EMTA 2DLWA 1V5PA 2J0KA 2V76A 2YVCA 3NSUA 3PEGA 2YF0A 2VRWB 3U8ZA 2OQBA 4HAZB 1UNRA 4IAPA 3O96A 1Y5OA 3DXCA 1PMSA 1FGYA 1BAKA 1W1HA 1PLSA 2DFKA 4P7IA 2YS5A 1RJ2A 1FHXA 3PG7A 2I5FA 2LG1A 4B6HA 1GG3A 2ZPYA 3F5RA 5DHAB 3BJIA 4GMVA 2CAYA 2Z0OA 5JP4A 1AWEA 1GC6A 3N7CA 2AEHA 2DKPA 1ZVRA 2YT1A 4PNKA 3SNHA 3RCPA 2IYBA 1P3RA 3VIAA 4K2PA 3LJUX 3ODWA 2MDXA 4CYEA 2M14A 1J0WA 1WG7A 3GYOA 4EMOA 5C6RA 2BCJA 5C79A 2W2WA 1TQZA 2J59M 2COCA 2ADZA 1EF1A 3D8DA 3KRWA 1XX0A 5CLLB 2DHJA 5KQ4A 4DX8A 4Z2NA 3P6AA 2LOXA 2M38A 4IOYX 3KSYA 3ML4A 3WA0A 2Y8FA 2DTCA 2W2XD 5JHGA 4MY6A 4KAXB 3SYXA 3FEHA 1EVHA 4CHJA 2R0DA 3AU5A 3TW1A 1SHCA 3QBVB 4K81A 1WGUA 4KVGB 2DHKA 4HDOA 1E5WA 1Y19B 1KZ7A 4CHMA 1U5GA 1UEFA 1OQNA 2VSZA 2DX5A 2W2XC 1KI1B 4DXAB 4D0NB 3V5WA 4A5KA 2GCJA 5KCVA 2YRYA 2DYQA 5DIFB 1RRPB 2VKIA 1Z87A 3QIJA 4YONA 1FOEA 1X11A 1XD4A 4K2OA 1OMWA 2NMBA 4KHBB 1AQCA 1ZC3B 2DKQA 2RUKB 4TYZA 3D8EA 2DYNA 1DYNA 1ZM0A 1X1GA 2EJ8A 3SUZA 3PP2A 4A6FA 2QKMA 2KCJA 1Q67A 2N23A 4HB0B 2RSGA 3ULCA 5HE1A 1DDVA 1K5GB 4HATB 2LKOA 1DROA 5DHFB 2LULA 2YSZA 1MK9B 1TJ6A 3TCAA 1U5EA 2I5CA 1BTKA 1K5DB 4K17A 4Z2MB 4HHVA 3AU4A 4HB2B 3X23A 5HE3A 5D3YA 5JLJB 2CODA 1B55A 1U27A 1U5DA 2COAA 3SO6A 2AL6A 3PVUA 4GXBA 1NTYA 2D2QA 1V88A 5JHHA 1FGZA 4HDQA 1FAOA 2K00A 2IFSA 4XWXA 5FI1A 2H7EA 1P5TA 1XODA 2ROVA 1EGXA 2RLOA 4F7GA 2CY5A 1MIXA 3SV1A 2P0HA 2ELAA 2UZSA 2H7DA 3U7DA 2ELBA 3ULBA 4DBBA 4WSFA 4H8SA 5C16A 1W1DA 1X05A 1W1GA 1P6SA 5D3XA 2KUPA 5HE0A 1DBHA 5J3TA 1OY2A 3WYFB 5C5BA 2L1CA 1N3HA 3ZDTA 2CY4A 4HB4B 2D9VA 2D9WA 4L6EA 1WI1A 5GOWB 3PVWA 2GS0A 1LB1A 3G9WA 2CRFA 2LOZA 1MIZB 1DDWA 2EMSA 1BWNA 2J0MA 2J0JA 5D3VA 1I2HA 5DH9B 4C0AA 2X18A 1QQGA 4HAUB 1NTVA 3T06A 3MDBC 2RVBB 2YS1A 4ZRIA 2P0FA 4GN1A 4A6FB 1UPQA 3A8QA 2COFA 3HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW2 B;  1UPR A;  5LON B;  5HE2 A;  2XQN M;  4PQ0 A;  1MPH A;  4HAV B;  1J19 A;  1NU2 A;  4KHA A;  3IVF A;  2UVM A;  2PZ1 A;  3A98 B;  4MT7 A;  2P8V A;  2Y7B A;  1KZG A;  2DX1 A;  2I1K A;  3DXD A;  1H10 A;  1V61 A;  2RGN B;  4A6K A;  3D8F A;  4Y94 A;  5D27 A;  4DX9 0;  4F7U P;  4ZRJ A;  4WJ7 A;  2YT0 A;  3HK0 A;  2K2J A;  1U29 A;  5LOP B;  3AJ4 A;  4TKN A;  4EJN A;  2KGX B;  1WGQ A;  1WVH A;  3GYP A;  5DI9 B;  3VOQ A;  4ZRK A;  1UNQ A;  1XCG A;  1IRS A;  3PSC A;  2E2X A;  4EKU A;  2I1J A;  1UNP A;  2Z0Q A;  1MKE A;  2NZ8 B;  2P0D A;  2HE7 A;  4MK0 A;  5C5B B;  3PVL A;  4NSW A;  3CXB B;  5CLQ B;  2ROZ B;  5EFX A;  2Y8G A;  2K2U A;  2MKR A;  1PFJ A;  1SGH A;  3ODX A;  1U5F A;  3P7Z A;  1M7R A;  2Q13 A;  1BTN A;  3ZVR A;  2MWN B;  1FHW A;  2GJY A;  3M1I B;  2L2I A;  1XR0 B;  2MFQ A;  4A6H A;  2UZR A;  2D9Z A;  3TFM A;  4YL8 A;  1GC7 A;  1ISN A;  2FJL A;  3CIK A;  5J3Y A;  3FSS A;  4HAW B;  1WJ1 A;  2GCL A;  1MK7 B;  2N0Y A;  4WVF B;  3KRX A;  2DA0 A;  3TVV A;  5FI0 A;  2QKL A;  1I7A A;  2D10 A;  2D11 A;  4KHO A;  1LW3 A;  1XKE A;  5L81 A;  3ODO A;  4GZU A;  1DDM A;  3TO1 A;  3BIN A;  2LYD A;  4HAY B;  1MAI A;  5D3W A;  1ZC4 B;  2RNR B;  3KZ1 A;  4GPT B;  2HTH B;  1TXD A;  1ZSQ A;  5J3Q A;  1U2B A;  1WJM A;  1V89 A;  4F7H A;  1NI2 A;  3FM8 C;  1FHO A;  2OTX A;  4HB3 B;  4GMX B;  1H4R A;  2EC1 A;  2R09 A;  1M7E A;  1FB8 A;  3KY9 A;  1EAZ A;  1X86 A;  1V5U A;  3QWM A;  2D4Q A;  4NY0 A;  1V5M A;  2G35 A;  1QC6 A;  3OAN A;  4BBK A;  3F0W A;  2D9Y A;  2D9X A;  2DN6 A;  3DXE A;  3PZD A;  4IFS A;  3UZT A;  2Z0P A;  5KQ1 A;  3A8P A;  2YS3 A;  3MPX A;  2DHI A;  1X1F A;  4HAX B;  2JP2 A;  2EMT A;  2DLW A;  1V5P A;  2J0K A;  2V76 A;  2YVC A;  3NSU A;  3PEG A;  2YF0 A;  2VRW B;  3U8Z A;  2OQB A;  4HAZ B;  1UNR A;  4IAP A;  3O96 A;  1Y5O A;  3DXC A;  1PMS A;  1FGY A;  1BAK A;  1W1H A;  1PLS A;  2DFK A;  4P7I A;  2YS5 A;  1RJ2 A;  1FHX A;  3PG7 A;  2I5F A;  2LG1 A;  4B6H A;  1GG3 A;  2ZPY A;  3F5R A;  5DHA B;  3BJI A;  4GMV A;  2CAY A;  2Z0O A;  5JP4 A;  1AWE A;  1GC6 A;  3N7C A;  2AEH A;  2DKP A;  1ZVR A;  2YT1 A;  4PNK A;  3SNH A;  3RCP A;  2IYB A;  1P3R A;  3VIA A;  4K2P A;  3LJU X;  3ODW A;  2MDX A;  4CYE A;  2M14 A;  1J0W A;  1WG7 A;  3GYO A;  4EMO A;  5C6R A;  2BCJ A;  5C79 A;  2W2W A;  1TQZ A;  2J59 M;  2COC A;  2ADZ A;  1EF1 A;  3D8D A;  3KRW A;  1XX0 A;  5CLL B;  2DHJ A;  5KQ4 A;  4DX8 A;  4Z2N A;  3P6A A;  2LOX A;  2M38 A;  4IOY X;  3KSY A;  3ML4 A;  3WA0 A;  2Y8F A;  2DTC A;  2W2X D;  5JHG A;  4MY6 A;  4KAX B;  3SYX A;  3FEH A;  1EVH A;  4CHJ A;  2R0D A;  3AU5 A;  3TW1 A;  1SHC A;  3QBV B;  4K81 A;  1WGU A;  4KVG B;  2DHK A;  4HDO A;  1E5W A;  1Y19 B;  1KZ7 A;  4CHM A;  1U5G A;  1UEF A;  1OQN A;  2VSZ A;  2DX5 A;  2W2X C;  1KI1 B;  4DXA B;  4D0N B;  3V5W A;  4A5K A;  2GCJ A;  5KCV A;  2YRY A;  2DYQ A;  5DIF B;  1RRP B;  2VKI A;  1Z87 A;  3QIJ A;  4YON A;  1FOE A;  1X11 A;  1XD4 A;  4K2O A;  1OMW A;  2NMB A;  4KHB B;  1AQC A;  1ZC3 B;  2DKQ A;  2RUK B;  4TYZ A;  3D8E A;  2DYN A;  1DYN A;  1ZM0 A;  1X1G A;  2EJ8 A;  3SUZ A;  3PP2 A;  4A6F A;  2QKM A;  2KCJ A;  1Q67 A;  2N23 A;  4HB0 B;  2RSG A;  3ULC A;  5HE1 A;  1DDV A;  1K5G B;  4HAT B;  2LKO A;  1DRO A;  5DHF B;  2LUL A;  2YSZ A;  1MK9 B;  1TJ6 A;  3TCA A;  1U5E A;  2I5C A;  1BTK A;  1K5D B;  4K17 A;  4Z2M B;  4HHV A;  3AU4 A;  4HB2 B;  3X23 A;  5HE3 A;  5D3Y A;  5JLJ B;  2COD A;  1B55 A;  1U27 A;  1U5D A;  2COA A;  3SO6 A;  2AL6 A;  3PVU A;  4GXB A;  1NTY A;  2D2Q A;  1V88 A;  5JHH A;  1FGZ A;  4HDQ A;  1FAO A;  2K00 A;  2IFS A;  4XWX A;  5FI1 A;  2H7E A;  1P5T A;  1XOD A;  2ROV A;  1EGX A;  2RLO A;  4F7G A;  2CY5 A;  1MIX A;  3SV1 A;  2P0H A;  2ELA A;  2UZS A;  2H7D A;  3U7D A;  2ELB A;  3ULB A;  4DBB A;  4WSF A;  4H8S A;  5C16 A;  1W1D A;  1X05 A;  1W1G A;  1P6S A;  5D3X A;  2KUP A;  5HE0 A;  1DBH A;  5J3T A;  1OY2 A;  3WYF B;  5C5B A;  2L1C A;  1N3H A;  3ZDT A;  2CY4 A;  4HB4 B;  2D9V A;  2D9W A;  4L6E A;  1WI1 A;  5GOW B;  3PVW A;  2GS0 A;  1LB1 A;  3G9W A;  2CRF A;  2LOZ A;  1MIZ B;  1DDW A;  2EMS A;  1BWN A;  2J0M A;  2J0J A;  5D3V A;  1I2H A;  5DH9 B;  4C0A A;  2X18 A;  1QQG A;  4HAU B;  1NTV A;  3T06 A;  3MDB C;  2RVB B;  2YS1 A;  4ZRI A;  2P0F A;  4GN1 A;  4A6F B;  1UPQ A;  3A8Q A;  2COF A;  3HQC A; 
#chains in the Genus database with same CATH topology
 3HW2 B;  1UPR A;  5LON B;  3OHM B;  5HE2 A;  2XQN M;  4PQ0 A;  1MPH A;  4HAV B;  1J19 A;  1NU2 A;  4KHA A;  3IVF A;  2UVM A;  2PZ1 A;  3A98 B;  4MT7 A;  2P8V A;  2Y7B A;  1KZG A;  1MI1 A;  2DX1 A;  2I1K A;  3DXD A;  1H10 A;  1V61 A;  2RGN B;  4A6K A;  2K8E A;  3D8F A;  4Y94 A;  5D27 A;  4DX9 0;  4F7U P;  4ZRJ A;  4WJ7 A;  3NWD A;  2YT0 A;  3HK0 A;  2K2J A;  1U29 A;  5LOP B;  3AJ4 A;  4TKN A;  4EJN A;  2KGX B;  1WGQ A;  1WVH A;  3GYP A;  5DI9 B;  3VOQ A;  4ZRK A;  1UNQ A;  1XCG A;  1IRS A;  3PSC A;  5I2M A;  2E2X A;  4EKU A;  2I1J A;  1UNP A;  2Z0Q A;  1MKE A;  2NZ8 B;  4HSI A;  2P0D A;  2HE7 A;  4MK0 A;  2FJU B;  3PVL A;  5C5B B;  4NSW A;  3CXB B;  5CLQ B;  2ROZ B;  5EFX A;  2Y8G A;  2K2U A;  2MKR A;  1PFJ A;  1SGH A;  3ODX A;  1U5F A;  1M7R A;  3P7Z A;  2Q13 A;  1BTN A;  3ZVR A;  2MWN B;  1FHW A;  2GJY A;  4QXA B;  3M1I B;  2L2I A;  2KUQ A;  1XR0 B;  2MFQ A;  4A6H A;  2UZR A;  3NWA A;  2D9Z A;  3TFM A;  4YL8 A;  1GC7 A;  1ISN A;  2FJL A;  3CIK A;  5J3Y A;  3FSS A;  2Z14 A;  4HAW B;  1WJ1 A;  2GCL A;  1MK7 B;  2N0Y A;  4WVF B;  4QJ3 B;  3KRX A;  2DA0 A;  3TVV A;  5FI0 A;  2QKL A;  1I7A A;  2D10 A;  2D11 A;  4KHO A;  1LW3 A;  1XKE A;  5L81 A;  3ODO A;  4GZU A;  2KIE A;  1DDM A;  3TO1 A;  3BIN A;  2LYD A;  4HAY B;  1MAI A;  5D3W A;  1ZC4 B;  2RNR B;  3KZ1 A;  4GPT B;  2HTH B;  1TXD A;  1ZSQ A;  5J3Q A;  1U2B A;  1WJM A;  1V89 A;  4F7H A;  1NI2 A;  3FM8 C;  1FHO A;  2OTX A;  4HB3 B;  4GMX B;  3NWF A;  1H4R A;  2EC1 A;  2R09 A;  1M7E A;  1FB8 A;  3KY9 A;  5M4Y B;  1EAZ A;  1X86 A;  1V5U A;  3QWM A;  2D4Q A;  4NY0 A;  1V5M A;  3NW8 A;  2G35 A;  1QC6 A;  2Z59 A;  3OAN A;  4BBK A;  3F0W A;  2D9Y A;  2D9X A;  2DN6 A;  3DXE A;  2Z4D A;  3PZD A;  4IFS A;  3UZT A;  2Z0P A;  5KQ1 A;  3A8P A;  2YS3 A;  4L1R A;  3MPX A;  2DHI A;  1X1F A;  4OT1 A;  4HAX B;  2JP2 A;  2EMT A;  2DLW A;  1V5P A;  2J0K A;  2V76 A;  2YVC A;  3NSU A;  3PEG A;  2YF0 A;  2VRW B;  3U8Z A;  2OQB A;  4HAZ B;  1UNR A;  4IAP A;  2Z13 A;  1Y5O A;  3DXC A;  1PMS A;  1FGY A;  2K49 A;  1W1H A;  3O96 A;  1BAK A;  1PLS A;  2DFK A;  4P7I A;  2YS5 A;  1RJ2 A;  1FHX A;  3PG7 A;  2I5F A;  2LG1 A;  4B6H A;  1GG3 A;  3HSA A;  2ZPY A;  3F5R A;  5DHA B;  1ZYI A;  3BJI A;  4GMV A;  2CAY A;  2Z0O A;  5JP4 A;  1AWE A;  1GC6 A;  3N7C A;  2AEH A;  2DKP A;  1ZVR A;  2YT1 A;  2KR0 A;  4GOU A;  4PNK A;  3SNH A;  3RCP A;  2IYB A;  1P3R A;  3VIA A;  4K2P A;  3LJU X;  3ODW A;  2MDX A;  2NBV A;  4CYE A;  2M14 A;  1J0W A;  1WG7 A;  3GYO A;  4EMO A;  5C6R A;  2BCJ A;  5C79 A;  2W2W A;  1TQZ A;  2J59 M;  2COC A;  2ADZ A;  5IRS A;  1EF1 A;  3D8D A;  3KRW A;  1XX0 A;  5CLL B;  2DHJ A;  5KQ4 A;  4DX8 A;  4Z2N A;  3P6A A;  2LOX A;  2M38 A;  4IOY X;  3KSY A;  3ML4 A;  3WA0 A;  4QJ5 B;  2RRF A;  2Y8F A;  2DTC A;  2W2X D;  5LG4 B;  5JHG A;  4MY6 A;  4KAX B;  3SYX A;  3FEH A;  1EVH A;  4CHJ A;  2R0D A;  3AU5 A;  1T77 A;  2KIG A;  3TW1 A;  1SHC A;  3QBV B;  4K81 A;  1WGU A;  4KVG B;  2DHK A;  4HDO A;  1E5W A;  1Y19 B;  1KZ7 A;  4CSQ A;  1U5G A;  4CHM A;  1UEF A;  1OQN A;  2VSZ A;  2DX5 A;  2W2X C;  1KI1 B;  4DXA B;  4D0N B;  3V5W A;  3A58 A;  4A5K A;  2GCJ A;  5KCV A;  2YRY A;  2DYQ A;  5DIF B;  1RRP B;  2VKI A;  3DCX A;  1Z87 A;  3QIJ A;  4YON A;  1FOE A;  1X11 A;  1XD4 A;  2YT2 A;  4K2O A;  1OMW A;  2NMB A;  4KHB B;  1AQC A;  1ZC3 B;  2DKQ A;  2RUK B;  4TYZ A;  3D8E A;  3U12 A;  2DYN A;  1DYN A;  1ZM0 A;  1X1G A;  2EJ8 A;  3SUZ A;  3PP2 A;  4A6F A;  2QKM A;  2KCJ A;  1Q67 A;  2N23 A;  4HB0 B;  2RSG A;  3ULC A;  4KHB A;  5HE1 A;  1DDV A;  1K5G B;  4HAT B;  2LKO A;  1DRO A;  5DHF B;  4DIX A;  2LUL A;  2YSZ A;  1MK9 B;  1TJ6 A;  2R2Y A;  3TCA A;  1U5E A;  2I5C A;  1BTK A;  1K5D B;  4K17 A;  4Z2M B;  4HHV A;  3AU4 A;  4HB2 B;  3X23 A;  5HE3 A;  5D3Y A;  4OSN A;  5JLJ B;  2COD A;  1B55 A;  1U27 A;  1U5D A;  2COA A;  3SO6 A;  2AL6 A;  3PVU A;  4GXB A;  1NTY A;  2D2Q A;  1V88 A;  5JHH A;  1FGZ A;  4HDQ A;  1FAO A;  2K00 A;  2IFS A;  2ZKM X;  4XWX A;  5FI1 A;  2H7E A;  1P5T A;  1XOD A;  2ROV A;  1EGX A;  2RLO A;  4F7G A;  2CY5 A;  1MIX A;  3SV1 A;  2P0H A;  2ELA A;  2UZS A;  2H7D A;  3U7D A;  5I2S A;  2ELB A;  3ULB A;  4DBB A;  4WSF A;  4H8S A;  5C16 A;  1W1D A;  1X05 A;  1W1G A;  1P6S A;  2GUM A;  5D3X A;  2KUP A;  5HE0 A;  1DBH A;  5J3T A;  1OY2 A;  3WYF B;  5C5B A;  2L1C A;  1N3H A;  3ZDT A;  2CY4 A;  4HB4 B;  2D9V A;  2D9W A;  4L6E A;  1WI1 A;  5GOW B;  4GNK B;  3PVW A;  2GS0 A;  1LB1 A;  3G9W A;  2CRF A;  2LOZ A;  1MIZ B;  1DDW A;  2EMS A;  1BWN A;  2J0M A;  2J0J A;  5D3V A;  1I2H A;  5DH9 B;  3B77 A;  4C0A A;  2X18 A;  1QQG A;  4HAU B;  3FVC A;  1NTV A;  4D6W A;  3T06 A;  3MDB C;  2RVB B;  2YS1 A;  4ZRI A;  3HIE A;  2P0F A;  4QJ4 B;  4GN1 A;  4A6F B;  1UPQ A;  3A8Q A;  2COF A;  3HQC A; 
#chains in the Genus database with same CATH homology
 3HW2 B;  1UPR A;  5LON B;  5HE2 A;  2XQN M;  4PQ0 A;  1MPH A;  4HAV B;  1J19 A;  1NU2 A;  4KHA A;  3IVF A;  2UVM A;  2PZ1 A;  3A98 B;  4MT7 A;  2P8V A;  2Y7B A;  1KZG A;  2DX1 A;  2I1K A;  3DXD A;  1H10 A;  1V61 A;  2RGN B;  4A6K A;  3D8F A;  4Y94 A;  5D27 A;  4DX9 0;  4F7U P;  4ZRJ A;  4WJ7 A;  2YT0 A;  3HK0 A;  2K2J A;  1U29 A;  5LOP B;  3AJ4 A;  4TKN A;  4EJN A;  2KGX B;  1WGQ A;  1WVH A;  3GYP A;  5DI9 B;  3VOQ A;  4ZRK A;  1UNQ A;  1XCG A;  1IRS A;  3PSC A;  2E2X A;  4EKU A;  2I1J A;  1UNP A;  2Z0Q A;  1MKE A;  2NZ8 B;  2P0D A;  2HE7 A;  4MK0 A;  5C5B B;  3PVL A;  4NSW A;  3CXB B;  5CLQ B;  2ROZ B;  5EFX A;  2Y8G A;  2K2U A;  2MKR A;  1PFJ A;  1SGH A;  3ODX A;  1U5F A;  3P7Z A;  1M7R A;  2Q13 A;  1BTN A;  3ZVR A;  2MWN B;  1FHW A;  2GJY A;  3M1I B;  2L2I A;  1XR0 B;  2MFQ A;  4A6H A;  2UZR A;  2D9Z A;  3TFM A;  4YL8 A;  1GC7 A;  1ISN A;  2FJL A;  3CIK A;  5J3Y A;  3FSS A;  4HAW B;  1WJ1 A;  2GCL A;  1MK7 B;  2N0Y A;  4WVF B;  3KRX A;  2DA0 A;  3TVV A;  5FI0 A;  2QKL A;  1I7A A;  2D10 A;  2D11 A;  4KHO A;  1LW3 A;  1XKE A;  5L81 A;  3ODO A;  4GZU A;  1DDM A;  3TO1 A;  3BIN A;  2LYD A;  4HAY B;  1MAI A;  5D3W A;  1ZC4 B;  2RNR B;  3KZ1 A;  4GPT B;  2HTH B;  1TXD A;  1ZSQ A;  5J3Q A;  1U2B A;  1WJM A;  1V89 A;  4F7H A;  1NI2 A;  3FM8 C;  1FHO A;  2OTX A;  4HB3 B;  4GMX B;  1H4R A;  2EC1 A;  2R09 A;  1M7E A;  1FB8 A;  3KY9 A;  1EAZ A;  1X86 A;  1V5U A;  3QWM A;  2D4Q A;  4NY0 A;  1V5M A;  2G35 A;  1QC6 A;  3OAN A;  4BBK A;  3F0W A;  2D9Y A;  2D9X A;  2DN6 A;  3DXE A;  3PZD A;  4IFS A;  3UZT A;  2Z0P A;  5KQ1 A;  3A8P A;  2YS3 A;  3MPX A;  2DHI A;  1X1F A;  4HAX B;  2JP2 A;  2EMT A;  2DLW A;  1V5P A;  2J0K A;  2V76 A;  2YVC A;  3NSU A;  3PEG A;  2YF0 A;  2VRW B;  3U8Z A;  2OQB A;  4HAZ B;  1UNR A;  4IAP A;  3O96 A;  1Y5O A;  3DXC A;  1PMS A;  1FGY A;  1BAK A;  1W1H A;  1PLS A;  2DFK A;  4P7I A;  2YS5 A;  1RJ2 A;  1FHX A;  3PG7 A;  2I5F A;  2LG1 A;  4B6H A;  1GG3 A;  2ZPY A;  3F5R A;  5DHA B;  3BJI A;  4GMV A;  2CAY A;  2Z0O A;  5JP4 A;  1AWE A;  1GC6 A;  3N7C A;  2AEH A;  2DKP A;  1ZVR A;  2YT1 A;  4PNK A;  3SNH A;  3RCP A;  2IYB A;  1P3R A;  3VIA A;  4K2P A;  3LJU X;  3ODW A;  2MDX A;  4CYE A;  2M14 A;  1J0W A;  1WG7 A;  3GYO A;  4EMO A;  5C6R A;  2BCJ A;  5C79 A;  2W2W A;  1TQZ A;  2J59 M;  2COC A;  2ADZ A;  1EF1 A;  3D8D A;  3KRW A;  1XX0 A;  5CLL B;  2DHJ A;  5KQ4 A;  4DX8 A;  4Z2N A;  3P6A A;  2LOX A;  2M38 A;  4IOY X;  3KSY A;  3ML4 A;  3WA0 A;  2Y8F A;  2DTC A;  2W2X D;  5JHG A;  4MY6 A;  4KAX B;  3SYX A;  3FEH A;  1EVH A;  4CHJ A;  2R0D A;  3AU5 A;  3TW1 A;  1SHC A;  3QBV B;  4K81 A;  1WGU A;  4KVG B;  2DHK A;  4HDO A;  1E5W A;  1Y19 B;  1KZ7 A;  4CHM A;  1U5G A;  1UEF A;  1OQN A;  2VSZ A;  2DX5 A;  2W2X C;  1KI1 B;  4DXA B;  4D0N B;  3V5W A;  4A5K A;  2GCJ A;  5KCV A;  2YRY A;  2DYQ A;  5DIF B;  1RRP B;  2VKI A;  1Z87 A;  3QIJ A;  4YON A;  1FOE A;  1X11 A;  1XD4 A;  4K2O A;  1OMW A;  2NMB A;  4KHB B;  1AQC A;  1ZC3 B;  2DKQ A;  2RUK B;  4TYZ A;  3D8E A;  2DYN A;  1DYN A;  1ZM0 A;  1X1G A;  2EJ8 A;  3SUZ A;  3PP2 A;  4A6F A;  2QKM A;  2KCJ A;  1Q67 A;  2N23 A;  4HB0 B;  2RSG A;  3ULC A;  5HE1 A;  1DDV A;  1K5G B;  4HAT B;  2LKO A;  1DRO A;  5DHF B;  2LUL A;  2YSZ A;  1MK9 B;  1TJ6 A;  3TCA A;  1U5E A;  2I5C A;  1BTK A;  1K5D B;  4K17 A;  4Z2M B;  4HHV A;  3AU4 A;  4HB2 B;  3X23 A;  5HE3 A;  5D3Y A;  5JLJ B;  2COD A;  1B55 A;  1U27 A;  1U5D A;  2COA A;  3SO6 A;  2AL6 A;  3PVU A;  4GXB A;  1NTY A;  2D2Q A;  1V88 A;  5JHH A;  1FGZ A;  4HDQ A;  1FAO A;  2K00 A;  2IFS A;  4XWX A;  5FI1 A;  2H7E A;  1P5T A;  1XOD A;  2ROV A;  1EGX A;  2RLO A;  4F7G A;  2CY5 A;  1MIX A;  3SV1 A;  2P0H A;  2ELA A;  2UZS A;  2H7D A;  3U7D A;  2ELB A;  3ULB A;  4DBB A;  4WSF A;  4H8S A;  5C16 A;  1W1D A;  1X05 A;  1W1G A;  1P6S A;  5D3X A;  2KUP A;  5HE0 A;  1DBH A;  5J3T A;  1OY2 A;  3WYF B;  5C5B A;  2L1C A;  1N3H A;  3ZDT A;  2CY4 A;  4HB4 B;  2D9V A;  2D9W A;  4L6E A;  1WI1 A;  5GOW B;  3PVW A;  2GS0 A;  1LB1 A;  3G9W A;  2CRF A;  2LOZ A;  1MIZ B;  1DDW A;  2EMS A;  1BWN A;  2J0M A;  2J0J A;  5D3V A;  1I2H A;  5DH9 B;  4C0A A;  2X18 A;  1QQG A;  4HAU B;  1NTV A;  3T06 A;  3MDB C;  2RVB B;  2YS1 A;  4ZRI A;  2P0F A;  4GN1 A;  4A6F B;  1UPQ A;  3A8Q A;  2COF A;  3HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...