5KQ1A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
total genus 36
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq1A00
2DKQA 2D9XA 2P0FA 2D9YA 2DYQA 3KSYA 2Y8GA 1WVHA 5HE0A 5DHAB 1FOEA 2VRWB 3QWMA 5DH9B 1XKEA 2OQBA 5GOWB 4GZUA 5C16A 1DBHA 1KI1B 1PFJA 2RLOA 4TKNA 2Q13A 5C6RA 2KUPA 4GMXB 3HQCA 2L1CA 2P0HA 1AWEA 2K2JA 5D27A 1U27A 2M38A 3G9WA 2MDXA 1P5TA 3P6AA 1V89A 5D3YA 2R0DA 3O96A 2YT1A 4H8SA 5J3TA 1V5PA 2GS0A 1FB8A 2V76A 1BTNA 1U5FA 2DTCA 1DDWA 2D10A 4Y94A 1K5GB 5DIFB 2GJYA 1XODA 4ZRJA 2P0DA 3AJ4A 2LG1A 1V61A 2LOZA 4WJ7A 4HAWB 3DXDA 4CHMA 1MAIA 3A98B 3CXBB 1ZSQA 1X11A 4HB0B 2AEHA 3SV1A 4HATB 3PEGA 2DHJA 1TQZA 5C5BB 5JHGA 1ZVRA 2FJLA 2H7DA 1OQNA 3SYXA 1MIXA 4CYEA 2L2IA 2ROZB 2W2XD 4GPTB 4EMOA 1J19A 1LW3A 1BTKA 1I7AA 1V5MA 2N23A 4PQ0A 3BINA 2D2QA 1MK7B 3PZDA 2Z0QA 1J0WA 1LB1A 2DN6A 2W2WA 3P7ZA 4P7IA 4A6HA 1ZC3B 2COFA 1TXDA 1N3HA 3PVWA 2YRYA 4DBBA 5D3WA 1E5WA 1X86A 1DYNA 2P8VA 3ML4A 5C79A 4HHVA 3ODXA 4HDOA 3F5RA 3KRWA 4F7UP 3MPXA 1QC6A 2BCJA 1WGQA 3VOQA 2NMBA 1UNQA 2EMTA 2EJ8A 2D9WA 3ODOA 4KAXB 5FI1A 2D9VA 4Z2NA 4YONA 1NTYA 5HE1A 4D0NB 2UZRA 3AU4A 1P6SA 3KY9A 4IOYX 3F0WA 1GG3A 1WJMA 3QIJA 4MK0A 2NZ8B 5EFXA 4L6EA 2K00A 4TYZA 4ZRKA 4F7HA 2COAA 1W1DA 1GC7A 2E2XA 5CLQB 1OMWA 3D8EA 1NU2A 2MFQA 1M7RA 4DXAB 1UEFA 4WSFA 4HB2B 4MY6A 2D4QA 4XWXA 3AU5A 2CAYA 3NSUA 1X05A 1U5DA 2DHIA 2I1KA 3D8FA 2I1JA 1BWNA 2CRFA 5C5BA 4B6HA 2W2XC 1Z87A 3SO6A 2LULA 5DI9B 3ZDTA 2N0YA 1KZ7A 3VIAA 5J3QA 5DHFB 4C0AA 3TO1A 3PG7A 2I5CA 2KCJA 5HE2A 1DDMA 2J0MA 2YSZA 1P3RA 3TVVA 2M14A 4GMVA 2CODA 2YVCA 4KHBB 1ISNA 1EGXA 1ZM0A 4HAYB 3T06A 3QBVB 3KZ1A 3HW2B 2QKLA 3UZTA 3D8DA 1PMSA 1DDVA 3ODWA 2OTXA 3PP2A 2UVMA 1BAKA 2ZPYA 2J0KA 4IFSA 2LYDA 3ULCA 2RUKB 1QQGA 2YT0A 5KCVA 3A8QA 1H10A 4A6FA 1U5EA 1FGZA 3TCAA 4HAXB 2GCJA 3WYFB 2K2UA 3FEHA 2YS1A 4HAVB 1MIZB 4HAUB 1H4RA 5D3VA 4A6KA 3TFMA 4A5KA 3SNHA 1W1GA 2J0JA 4DX90 5L81A 4KVGB 3HK0A 1X1FA 1FAOA 4CHJA 2HE7A 4GN1A 1MK9B 4F7GA 1GC6A 1NTVA 1Q67A 3DXCA 3PVUA 3U7DA 2EMSA 3V5WA 2Y7BA 3MDBC 1WI1A 1SGHA 3PSCA 1FHOA 2G35A 1XCGA 3BJIA 1EAZA 1IRSA 4YL8A 4NSWA 1SHCA 2DX5A 2JP2A 1I2HA 2GCLA 2VKIA 2RNRB 2X18A 2DA0A 5J3YA 4HAZB 1K5DB 1U5GA 3ULBA 1WG7A 1FHXA 3FSSA 2IYBA 5CLLB 2RSGA 4K2OA 2COCA 2XQNM 1ZC4B 2J59M 2QKMA 3TW1A 4HB3B 2YS3A 4KHAA 3OANA 1FGYA 2YF0A 4MT7A 3GYOA 3GYPA 4A6FB 4PNKA 2DLWA 2R09A 1PLSA 5JLJB 4BBKA 3IVFA 3CIKA 1UNRA 3A8PA 2DFKA 2CY4A 4K2PA 3U8ZA 2ELAA 5LONB 2CY5A 2VSZA 1U2BA 4EKUA 1WGUA 1UNPA 4KHOA 3PVLA 4HDQA 1Y19B 4WVFB 5KQ4A 1V88A 1KZGA 2D9ZA 3DXEA 5HE3A 5LOPB 1NI2A 4IAPA 1WJ1A 2YS5A 2MKRA 1EVHA 3KRXA 1M7EA 2DYNA 5D3XA 1UPRA 4NY0A 4ZRIA 1RJ2A 2HTHB 4DX8A 2I5FA 2LKOA 2H7EA 2Z0PA 2DHKA 3ZVRA 2EC1A 1W1HA 3RCPA 2UZSA 5FI0A 1AQCA 2LOXA 4K17A 3M1IB 1DROA 1EF1A 5JP4A 2KGXB 3X23A 1XD4A 2RVBB 1Y5OA 2PZ1A 2MWNB 1RRPB 2DKPA 2Y8FA 3SUZA 1B55A 4Z2MB 2IFSA 3N7CA 1OY2A 1FHWA 3FM8C 4GXBA 1X1GA 3WA0A 2AL6A 3LJUX 1TJ6A 1UPQA 5KQ1A 2Z0OA 2D11A 1XR0B 4HB4B 5JHHA 4EJNA 2RGNB 2ROVA 2ELBA 2ADZA 1MPHA 1XX0A 1V5UA 1U29A 2DX1A 4K81A 1MKEA
chains in the Genus database with same CATH superfamily
2DKQA 2D9XA 2P0FA 2D9YA 2DYQA 3KSYA 5I2MA 2Y8GA 1WVHA 5HE0A 5DHAB 1FOEA 2VRWB 3QWMA 5DH9B 1XKEA 2OQBA 5GOWB 4GZUA 5C16A 1DBHA 1KI1B 1PFJA 2RLOA 4TKNA 2Q13A 5C6RA 2KUPA 4GMXB 3HQCA 2L1CA 2P0HA 3NWDA 1AWEA 2K2JA 5D27A 1U27A 2M38A 3G9WA 2MDXA 1P5TA 3P6AA 1V89A 5D3YA 2R0DA 3O96A 2YT1A 4H8SA 5J3TA 1V5PA 2GS0A 1FB8A 2V76A 1BTNA 3NWAA 1U5FA 2DTCA 1DDWA 2D10A 4Y94A 1K5GB 5DIFB 2GJYA 1XODA 4ZRJA 2P0DA 3AJ4A 2LG1A 4OSNA 1V61A 2LOZA 4WJ7A 4HAWB 3DXDA 4CHMA 1MAIA 3A98B 3CXBB 1ZSQA 1X11A 4HB0B 2AEHA 3SV1A 2K49A 4QXAB 4HATB 3PEGA 2DHJA 1TQZA 5C5BB 5JHGA 5IRSA 1ZVRA 2FJLA 2H7DA 1OQNA 3SYXA 1MIXA 4CYEA 2L2IA 2ROZB 2W2XD 4GPTB 4QJ4B 4EMOA 1J19A 1LW3A 1BTKA 1I7AA 1V5MA 2N23A 4PQ0A 3BINA 2D2QA 1MK7B 3PZDA 4KHBA 2Z0QA 1J0WA 1LB1A 2DN6A 2W2WA 2K8EA 3P7ZA 4P7IA 4A6HA 1ZC3B 2COFA 2GUMA 1TXDA 1N3HA 3PVWA 2YRYA 4HSIA 4DBBA 5D3WA 1E5WA 1X86A 1DYNA 2P8VA 4L1RA 3ML4A 5C79A 1T77A 4HHVA 3ODXA 4HDOA 3F5RA 3KRWA 4F7UP 3MPXA 1QC6A 2BCJA 1WGQA 3VOQA 2NMBA 1UNQA 2EMTA 2EJ8A 2D9WA 3ODOA 4KAXB 4OT1A 5FI1A 2D9VA 4Z2NA 4YONA 2Z14A 1NTYA 5HE1A 4D0NB 2UZRA 3AU4A 1P6SA 3KY9A 5M4YB 4IOYX 3F0WA 1GG3A 4GOUA 1WJMA 3QIJA 4MK0A 2NZ8B 5EFXA 4L6EA 2K00A 4TYZA 4ZRKA 4F7HA 2COAA 1W1DA 4CSQA 1GC7A 2E2XA 5CLQB 1OMWA 3D8EA 1NU2A 2MFQA 1M7RA 4DXAB 1UEFA 4WSFA 4HB2B 4MY6A 2D4QA 4XWXA 4QJ3B 3AU5A 2CAYA 3NSUA 1X05A 1U5DA 2DHIA 2I1KA 3D8FA 2I1JA 1BWNA 2CRFA 5C5BA 4B6HA 2R2YA 2W2XC 1Z87A 3SO6A 2LULA 5DI9B 3ZDTA 2N0YA 1KZ7A 3VIAA 5J3QA 5DHFB 4C0AA 3TO1A 3PG7A 2I5CA 2KCJA 2ZKMX 5HE2A 1DDMA 2J0MA 2YSZA 1P3RA 3TVVA 2M14A 4GMVA 2CODA 2YVCA 4KHBB 1ISNA 1EGXA 1ZM0A 4HAYB 3T06A 3QBVB 4GNKB 3KZ1A 3HW2B 2QKLA 3UZTA 3D8DA 1PMSA 1DDVA 3ODWA 2OTXA 3PP2A 2UVMA 1BAKA 2ZPYA 2J0KA 4IFSA 2LYDA 3ULCA 2RUKB 1QQGA 1MI1A 2YT2A 2YT0A 5KCVA 3A8QA 1H10A 4A6FA 1U5EA 1FGZA 3TCAA 4HAXB 2GCJA 3WYFB 2K2UA 3FEHA 2KIGA 2YS1A 4HAVB 2RRFA 1MIZB 4HAUB 1H4RA 5D3VA 4A6KA 3TFMA 4A5KA 3SNHA 1W1GA 2J0JA 4DX90 5L81A 4KVGB 3HK0A 1X1FA 1FAOA 4CHJA 2HE7A 4GN1A 1MK9B 4F7GA 1GC6A 1NTVA 1Q67A 2NBVA 3DXCA 3PVUA 3U7DA 2EMSA 3V5WA 2Y7BA 3MDBC 1WI1A 1SGHA 3PSCA 1FHOA 3HSAA 2G35A 4QJ5B 1ZYIA 1XCGA 3BJIA 1EAZA 1IRSA 4YL8A 4NSWA 1SHCA 3NW8A 2DX5A 2Z59A 2JP2A 1I2HA 2GCLA 2VKIA 2RNRB 2X18A 2DA0A 5J3YA 4HAZB 1K5DB 1U5GA 3ULBA 1WG7A 1FHXA 3FSSA 3HIEA 2IYBA 5CLLB 2RSGA 4K2OA 2COCA 2XQNM 1ZC4B 2J59M 2KIEA 2QKMA 4HB3B 2YS3A 3TW1A 4KHAA 3OANA 2FJUB 1FGYA 2YF0A 4MT7A 3GYOA 3GYPA 2Z4DA 4A6FB 4PNKA 2DLWA 2R09A 1PLSA 5JLJB 4BBKA 3IVFA 3CIKA 1UNRA 3A8PA 2DFKA 2CY4A 4K2PA 3DCXA 3U8ZA 2ELAA 5LONB 2CY5A 2VSZA 1U2BA 4EKUA 1WGUA 1UNPA 3A58A 4KHOA 3U12A 3PVLA 4HDQA 1Y19B 4WVFB 5KQ4A 1V88A 1KZGA 2D9ZA 3DXEA 3NWFA 5HE3A 3OHMB 5LOPB 1NI2A 4IAPA 1WJ1A 2YS5A 2MKRA 1EVHA 3KRXA 1M7EA 2DYNA 5D3XA 1UPRA 4NY0A 4ZRIA 1RJ2A 2HTHB 4DX8A 5I2SA 2I5FA 2LKOA 2H7EA 2Z0PA 2DHKA 3ZVRA 2EC1A 1W1HA 3RCPA 2UZSA 3FVCA 2KUQA 5FI0A 1AQCA 2LOXA 4K17A 3M1IB 1DROA 1EF1A 5JP4A 2KGXB 3X23A 1XD4A 2RVBB 4D6WA 1Y5OA 2PZ1A 5LG4B 2MWNB 1RRPB 2DKPA 2Y8FA 3SUZA 1B55A 4Z2MB 2IFSA 3N7CA 1OY2A 1FHWA 3FM8C 4GXBA 1X1GA 3WA0A 2AL6A 3LJUX 4DIXA 1TJ6A 1UPQA 5KQ1A 2Z0OA 2D11A 1XR0B 4HB4B 2Z13A 5JHHA 4EJNA 2RGNB 2ROVA 2ELBA 3B77A 2ADZA 1MPHA 2KR0A 1XX0A 1V5UA 1U29A 2DX1A 4K81A 1MKEA
chains in the Genus database with same CATH topology
2DKQA 2D9XA 2P0FA 2D9YA 2DYQA 3KSYA 2Y8GA 1WVHA 5HE0A 5DHAB 1FOEA 2VRWB 3QWMA 5DH9B 1XKEA 2OQBA 5GOWB 4GZUA 5C16A 1DBHA 1KI1B 1PFJA 2RLOA 4TKNA 2Q13A 5C6RA 2KUPA 4GMXB 3HQCA 2L1CA 2P0HA 1AWEA 2K2JA 5D27A 1U27A 2M38A 3G9WA 2MDXA 1P5TA 3P6AA 1V89A 5D3YA 2R0DA 3O96A 2YT1A 4H8SA 5J3TA 1V5PA 2GS0A 1FB8A 2V76A 1BTNA 1U5FA 2DTCA 1DDWA 2D10A 4Y94A 1K5GB 5DIFB 2GJYA 1XODA 4ZRJA 2P0DA 3AJ4A 2LG1A 1V61A 2LOZA 4WJ7A 4HAWB 3DXDA 4CHMA 1MAIA 3A98B 3CXBB 1ZSQA 1X11A 4HB0B 2AEHA 3SV1A 4HATB 3PEGA 2DHJA 1TQZA 5C5BB 5JHGA 1ZVRA 2FJLA 2H7DA 1OQNA 3SYXA 1MIXA 4CYEA 2L2IA 2ROZB 2W2XD 4GPTB 4EMOA 1J19A 1LW3A 1BTKA 1I7AA 1V5MA 2N23A 4PQ0A 3BINA 2D2QA 1MK7B 3PZDA 2Z0QA 1J0WA 1LB1A 2DN6A 2W2WA 3P7ZA 4P7IA 4A6HA 1ZC3B 2COFA 1TXDA 1N3HA 3PVWA 2YRYA 4DBBA 5D3WA 1E5WA 1X86A 1DYNA 2P8VA 3ML4A 5C79A 4HHVA 3ODXA 4HDOA 3F5RA 3KRWA 4F7UP 3MPXA 1QC6A 2BCJA 1WGQA 3VOQA 2NMBA 1UNQA 2EMTA 2EJ8A 2D9WA 3ODOA 4KAXB 5FI1A 2D9VA 4Z2NA 4YONA 1NTYA 5HE1A 4D0NB 2UZRA 3AU4A 1P6SA 3KY9A 4IOYX 3F0WA 1GG3A 1WJMA 3QIJA 4MK0A 2NZ8B 5EFXA 4L6EA 2K00A 4TYZA 4ZRKA 4F7HA 2COAA 1W1DA 1GC7A 2E2XA 5CLQB 1OMWA 3D8EA 1NU2A 2MFQA 1M7RA 4DXAB 1UEFA 4WSFA 4HB2B 4MY6A 2D4QA 4XWXA 3AU5A 2CAYA 3NSUA 1X05A 1U5DA 2DHIA 2I1KA 3D8FA 2I1JA 1BWNA 2CRFA 5C5BA 4B6HA 2W2XC 1Z87A 3SO6A 2LULA 5DI9B 3ZDTA 2N0YA 1KZ7A 3VIAA 5J3QA 5DHFB 4C0AA 3TO1A 3PG7A 2I5CA 2KCJA 5HE2A 1DDMA 2J0MA 2YSZA 1P3RA 3TVVA 2M14A 4GMVA 2CODA 2YVCA 4KHBB 1ISNA 1EGXA 1ZM0A 4HAYB 3T06A 3QBVB 3KZ1A 3HW2B 2QKLA 3UZTA 3D8DA 1PMSA 1DDVA 3ODWA 2OTXA 3PP2A 2UVMA 1BAKA 2ZPYA 2J0KA 4IFSA 2LYDA 3ULCA 2RUKB 1QQGA 2YT0A 5KCVA 3A8QA 1H10A 4A6FA 1U5EA 1FGZA 3TCAA 4HAXB 2GCJA 3WYFB 2K2UA 3FEHA 2YS1A 4HAVB 1MIZB 4HAUB 1H4RA 5D3VA 4A6KA 3TFMA 4A5KA 3SNHA 1W1GA 2J0JA 4DX90 5L81A 4KVGB 3HK0A 1X1FA 1FAOA 4CHJA 2HE7A 4GN1A 1MK9B 4F7GA 1GC6A 1NTVA 1Q67A 3DXCA 3PVUA 3U7DA 2EMSA 3V5WA 2Y7BA 3MDBC 1WI1A 1SGHA 3PSCA 1FHOA 2G35A 1XCGA 3BJIA 1EAZA 1IRSA 4YL8A 4NSWA 1SHCA 2DX5A 2JP2A 1I2HA 2GCLA 2VKIA 2RNRB 2X18A 2DA0A 5J3YA 4HAZB 1K5DB 1U5GA 3ULBA 1WG7A 1FHXA 3FSSA 2IYBA 5CLLB 2RSGA 4K2OA 2COCA 2XQNM 1ZC4B 2J59M 2QKMA 3TW1A 4HB3B 2YS3A 4KHAA 3OANA 1FGYA 2YF0A 4MT7A 3GYOA 3GYPA 4A6FB 4PNKA 2DLWA 2R09A 1PLSA 5JLJB 4BBKA 3IVFA 3CIKA 1UNRA 3A8PA 2DFKA 2CY4A 4K2PA 3U8ZA 2ELAA 5LONB 2CY5A 2VSZA 1U2BA 4EKUA 1WGUA 1UNPA 4KHOA 3PVLA 4HDQA 1Y19B 4WVFB 5KQ4A 1V88A 1KZGA 2D9ZA 3DXEA 5HE3A 5LOPB 1NI2A 4IAPA 1WJ1A 2YS5A 2MKRA 1EVHA 3KRXA 1M7EA 2DYNA 5D3XA 1UPRA 4NY0A 4ZRIA 1RJ2A 2HTHB 4DX8A 2I5FA 2LKOA 2H7EA 2Z0PA 2DHKA 3ZVRA 2EC1A 1W1HA 3RCPA 2UZSA 5FI0A 1AQCA 2LOXA 4K17A 3M1IB 1DROA 1EF1A 5JP4A 2KGXB 3X23A 1XD4A 2RVBB 1Y5OA 2PZ1A 2MWNB 1RRPB 2DKPA 2Y8FA 3SUZA 1B55A 4Z2MB 2IFSA 3N7CA 1OY2A 1FHWA 3FM8C 4GXBA 1X1GA 3WA0A 2AL6A 3LJUX 1TJ6A 1UPQA 5KQ1A 2Z0OA 2D11A 1XR0B 4HB4B 5JHHA 4EJNA 2RGNB 2ROVA 2ELBA 2ADZA 1MPHA 1XX0A 1V5UA 1U29A 2DX1A 4K81A 1MKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKQ A;  2D9X A;  2P0F A;  2D9Y A;  2DYQ A;  3KSY A;  2Y8G A;  1WVH A;  5HE0 A;  5DHA B;  1FOE A;  2VRW B;  3QWM A;  5DH9 B;  1XKE A;  2OQB A;  5GOW B;  4GZU A;  5C16 A;  1DBH A;  1KI1 B;  1PFJ A;  2RLO A;  4TKN A;  2Q13 A;  5C6R A;  2KUP A;  4GMX B;  3HQC A;  2L1C A;  2P0H A;  1AWE A;  2K2J A;  5D27 A;  1U27 A;  2M38 A;  3G9W A;  2MDX A;  1P5T A;  3P6A A;  1V89 A;  5D3Y A;  2R0D A;  3O96 A;  2YT1 A;  4H8S A;  5J3T A;  1V5P A;  2GS0 A;  1FB8 A;  2V76 A;  1BTN A;  1U5F A;  2DTC A;  1DDW A;  2D10 A;  4Y94 A;  1K5G B;  5DIF B;  2GJY A;  1XOD A;  4ZRJ A;  2P0D A;  3AJ4 A;  2LG1 A;  1V61 A;  2LOZ A;  4WJ7 A;  4HAW B;  3DXD A;  4CHM A;  1MAI A;  3A98 B;  3CXB B;  1ZSQ A;  1X11 A;  4HB0 B;  2AEH A;  3SV1 A;  4HAT B;  3PEG A;  2DHJ A;  1TQZ A;  5C5B B;  5JHG A;  1ZVR A;  2FJL A;  2H7D A;  1OQN A;  3SYX A;  1MIX A;  4CYE A;  2L2I A;  2ROZ B;  2W2X D;  4GPT B;  4EMO A;  1J19 A;  1LW3 A;  1BTK A;  1I7A A;  1V5M A;  2N23 A;  4PQ0 A;  3BIN A;  2D2Q A;  1MK7 B;  3PZD A;  2Z0Q A;  1J0W A;  1LB1 A;  2DN6 A;  2W2W A;  3P7Z A;  4P7I A;  4A6H A;  1ZC3 B;  2COF A;  1TXD A;  1N3H A;  3PVW A;  2YRY A;  4DBB A;  5D3W A;  1E5W A;  1X86 A;  1DYN A;  2P8V A;  3ML4 A;  5C79 A;  4HHV A;  3ODX A;  4HDO A;  3F5R A;  3KRW A;  4F7U P;  3MPX A;  1QC6 A;  2BCJ A;  1WGQ A;  3VOQ A;  2NMB A;  1UNQ A;  2EMT A;  2EJ8 A;  2D9W A;  3ODO A;  4KAX B;  5FI1 A;  2D9V A;  4Z2N A;  4YON A;  1NTY A;  5HE1 A;  4D0N B;  2UZR A;  3AU4 A;  1P6S A;  3KY9 A;  4IOY X;  3F0W A;  1GG3 A;  1WJM A;  3QIJ A;  4MK0 A;  2NZ8 B;  5EFX A;  4L6E A;  2K00 A;  4TYZ A;  4ZRK A;  4F7H A;  2COA A;  1W1D A;  1GC7 A;  2E2X A;  5CLQ B;  1OMW A;  3D8E A;  1NU2 A;  2MFQ A;  1M7R A;  4DXA B;  1UEF A;  4WSF A;  4HB2 B;  4MY6 A;  2D4Q A;  4XWX A;  3AU5 A;  2CAY A;  3NSU A;  1X05 A;  1U5D A;  2DHI A;  2I1K A;  3D8F A;  2I1J A;  1BWN A;  2CRF A;  5C5B A;  4B6H A;  2W2X C;  1Z87 A;  3SO6 A;  2LUL A;  5DI9 B;  3ZDT A;  2N0Y A;  1KZ7 A;  3VIA A;  5J3Q A;  5DHF B;  4C0A A;  3TO1 A;  3PG7 A;  2I5C A;  2KCJ A;  5HE2 A;  1DDM A;  2J0M A;  2YSZ A;  1P3R A;  3TVV A;  2M14 A;  4GMV A;  2COD A;  2YVC A;  4KHB B;  1ISN A;  1EGX A;  1ZM0 A;  4HAY B;  3T06 A;  3QBV B;  3KZ1 A;  3HW2 B;  2QKL A;  3UZT A;  3D8D A;  1PMS A;  1DDV A;  3ODW A;  2OTX A;  3PP2 A;  2UVM A;  1BAK A;  2ZPY A;  2J0K A;  4IFS A;  2LYD A;  3ULC A;  2RUK B;  1QQG A;  2YT0 A;  5KCV A;  3A8Q A;  1H10 A;  4A6F A;  1U5E A;  1FGZ A;  3TCA A;  4HAX B;  2GCJ A;  3WYF B;  2K2U A;  3FEH A;  2YS1 A;  4HAV B;  1MIZ B;  4HAU B;  1H4R A;  5D3V A;  4A6K A;  3TFM A;  4A5K A;  3SNH A;  1W1G A;  2J0J A;  4DX9 0;  5L81 A;  4KVG B;  3HK0 A;  1X1F A;  1FAO A;  4CHJ A;  2HE7 A;  4GN1 A;  1MK9 B;  4F7G A;  1GC6 A;  1NTV A;  1Q67 A;  3DXC A;  3PVU A;  3U7D A;  2EMS A;  3V5W A;  2Y7B A;  3MDB C;  1WI1 A;  1SGH A;  3PSC A;  1FHO A;  2G35 A;  1XCG A;  3BJI A;  1EAZ A;  1IRS A;  4YL8 A;  4NSW A;  1SHC A;  2DX5 A;  2JP2 A;  1I2H A;  2GCL A;  2VKI A;  2RNR B;  2X18 A;  2DA0 A;  5J3Y A;  4HAZ B;  1K5D B;  1U5G A;  3ULB A;  1WG7 A;  1FHX A;  3FSS A;  2IYB A;  5CLL B;  2RSG A;  4K2O A;  2COC A;  2XQN M;  1ZC4 B;  2J59 M;  2QKM A;  3TW1 A;  4HB3 B;  2YS3 A;  4KHA A;  3OAN A;  1FGY A;  2YF0 A;  4MT7 A;  3GYO A;  3GYP A;  4A6F B;  4PNK A;  2DLW A;  2R09 A;  1PLS A;  5JLJ B;  4BBK A;  3IVF A;  3CIK A;  1UNR A;  3A8P A;  2DFK A;  2CY4 A;  4K2P A;  3U8Z A;  2ELA A;  5LON B;  2CY5 A;  2VSZ A;  1U2B A;  4EKU A;  1WGU A;  1UNP A;  4KHO A;  3PVL A;  4HDQ A;  1Y19 B;  4WVF B;  5KQ4 A;  1V88 A;  1KZG A;  2D9Z A;  3DXE A;  5HE3 A;  5LOP B;  1NI2 A;  4IAP A;  1WJ1 A;  2YS5 A;  2MKR A;  1EVH A;  3KRX A;  1M7E A;  2DYN A;  5D3X A;  1UPR A;  4NY0 A;  4ZRI A;  1RJ2 A;  2HTH B;  4DX8 A;  2I5F A;  2LKO A;  2H7E A;  2Z0P A;  2DHK A;  3ZVR A;  2EC1 A;  1W1H A;  3RCP A;  2UZS A;  5FI0 A;  1AQC A;  2LOX A;  4K17 A;  3M1I B;  1DRO A;  1EF1 A;  5JP4 A;  2KGX B;  3X23 A;  1XD4 A;  2RVB B;  1Y5O A;  2PZ1 A;  2MWN B;  1RRP B;  2DKP A;  2Y8F A;  3SUZ A;  1B55 A;  4Z2M B;  2IFS A;  3N7C A;  1OY2 A;  1FHW A;  3FM8 C;  4GXB A;  1X1G A;  3WA0 A;  2AL6 A;  3LJU X;  1TJ6 A;  1UPQ A;  5KQ1 A;  2Z0O A;  2D11 A;  1XR0 B;  4HB4 B;  5JHH A;  4EJN A;  2RGN B;  2ROV A;  2ELB A;  2ADZ A;  1MPH A;  1XX0 A;  1V5U A;  1U29 A;  2DX1 A;  4K81 A;  1MKE A; 
#chains in the Genus database with same CATH topology
 2DKQ A;  2D9X A;  2P0F A;  2D9Y A;  2DYQ A;  3KSY A;  5I2M A;  2Y8G A;  1WVH A;  5HE0 A;  5DHA B;  1FOE A;  2VRW B;  3QWM A;  5DH9 B;  1XKE A;  2OQB A;  5GOW B;  4GZU A;  5C16 A;  1DBH A;  1KI1 B;  1PFJ A;  2RLO A;  4TKN A;  2Q13 A;  5C6R A;  2KUP A;  4GMX B;  3HQC A;  2L1C A;  2P0H A;  3NWD A;  1AWE A;  2K2J A;  5D27 A;  1U27 A;  2M38 A;  3G9W A;  2MDX A;  1P5T A;  3P6A A;  1V89 A;  5D3Y A;  2R0D A;  3O96 A;  2YT1 A;  4H8S A;  5J3T A;  1V5P A;  2GS0 A;  1FB8 A;  2V76 A;  1BTN A;  3NWA A;  1U5F A;  2DTC A;  1DDW A;  2D10 A;  4Y94 A;  1K5G B;  5DIF B;  2GJY A;  1XOD A;  4ZRJ A;  2P0D A;  3AJ4 A;  2LG1 A;  4OSN A;  1V61 A;  2LOZ A;  4WJ7 A;  4HAW B;  3DXD A;  4CHM A;  1MAI A;  3A98 B;  3CXB B;  1ZSQ A;  1X11 A;  4HB0 B;  2AEH A;  3SV1 A;  2K49 A;  4QXA B;  4HAT B;  3PEG A;  2DHJ A;  1TQZ A;  5C5B B;  5JHG A;  5IRS A;  1ZVR A;  2FJL A;  2H7D A;  1OQN A;  3SYX A;  1MIX A;  4CYE A;  2L2I A;  2ROZ B;  2W2X D;  4GPT B;  4QJ4 B;  4EMO A;  1J19 A;  1LW3 A;  1BTK A;  1I7A A;  1V5M A;  2N23 A;  4PQ0 A;  3BIN A;  2D2Q A;  1MK7 B;  3PZD A;  4KHB A;  2Z0Q A;  1J0W A;  1LB1 A;  2DN6 A;  2W2W A;  2K8E A;  3P7Z A;  4P7I A;  4A6H A;  1ZC3 B;  2COF A;  2GUM A;  1TXD A;  1N3H A;  3PVW A;  2YRY A;  4HSI A;  4DBB A;  5D3W A;  1E5W A;  1X86 A;  1DYN A;  2P8V A;  4L1R A;  3ML4 A;  5C79 A;  1T77 A;  4HHV A;  3ODX A;  4HDO A;  3F5R A;  3KRW A;  4F7U P;  3MPX A;  1QC6 A;  2BCJ A;  1WGQ A;  3VOQ A;  2NMB A;  1UNQ A;  2EMT A;  2EJ8 A;  2D9W A;  3ODO A;  4KAX B;  4OT1 A;  5FI1 A;  2D9V A;  4Z2N A;  4YON A;  2Z14 A;  1NTY A;  5HE1 A;  4D0N B;  2UZR A;  3AU4 A;  1P6S A;  3KY9 A;  5M4Y B;  4IOY X;  3F0W A;  1GG3 A;  4GOU A;  1WJM A;  3QIJ A;  4MK0 A;  2NZ8 B;  5EFX A;  4L6E A;  2K00 A;  4TYZ A;  4ZRK A;  4F7H A;  2COA A;  1W1D A;  4CSQ A;  1GC7 A;  2E2X A;  5CLQ B;  1OMW A;  3D8E A;  1NU2 A;  2MFQ A;  1M7R A;  4DXA B;  1UEF A;  4WSF A;  4HB2 B;  4MY6 A;  2D4Q A;  4XWX A;  4QJ3 B;  3AU5 A;  2CAY A;  3NSU A;  1X05 A;  1U5D A;  2DHI A;  2I1K A;  3D8F A;  2I1J A;  1BWN A;  2CRF A;  5C5B A;  4B6H A;  2R2Y A;  2W2X C;  1Z87 A;  3SO6 A;  2LUL A;  5DI9 B;  3ZDT A;  2N0Y A;  1KZ7 A;  3VIA A;  5J3Q A;  5DHF B;  4C0A A;  3TO1 A;  3PG7 A;  2I5C A;  2KCJ A;  2ZKM X;  5HE2 A;  1DDM A;  2J0M A;  2YSZ A;  1P3R A;  3TVV A;  2M14 A;  4GMV A;  2COD A;  2YVC A;  4KHB B;  1ISN A;  1EGX A;  1ZM0 A;  4HAY B;  3T06 A;  3QBV B;  4GNK B;  3KZ1 A;  3HW2 B;  2QKL A;  3UZT A;  3D8D A;  1PMS A;  1DDV A;  3ODW A;  2OTX A;  3PP2 A;  2UVM A;  1BAK A;  2ZPY A;  2J0K A;  4IFS A;  2LYD A;  3ULC A;  2RUK B;  1QQG A;  1MI1 A;  2YT2 A;  2YT0 A;  5KCV A;  3A8Q A;  1H10 A;  4A6F A;  1U5E A;  1FGZ A;  3TCA A;  4HAX B;  2GCJ A;  3WYF B;  2K2U A;  3FEH A;  2KIG A;  2YS1 A;  4HAV B;  2RRF A;  1MIZ B;  4HAU B;  1H4R A;  5D3V A;  4A6K A;  3TFM A;  4A5K A;  3SNH A;  1W1G A;  2J0J A;  4DX9 0;  5L81 A;  4KVG B;  3HK0 A;  1X1F A;  1FAO A;  4CHJ A;  2HE7 A;  4GN1 A;  1MK9 B;  4F7G A;  1GC6 A;  1NTV A;  1Q67 A;  2NBV A;  3DXC A;  3PVU A;  3U7D A;  2EMS A;  3V5W A;  2Y7B A;  3MDB C;  1WI1 A;  1SGH A;  3PSC A;  1FHO A;  3HSA A;  2G35 A;  4QJ5 B;  1ZYI A;  1XCG A;  3BJI A;  1EAZ A;  1IRS A;  4YL8 A;  4NSW A;  1SHC A;  3NW8 A;  2DX5 A;  2Z59 A;  2JP2 A;  1I2H A;  2GCL A;  2VKI A;  2RNR B;  2X18 A;  2DA0 A;  5J3Y A;  4HAZ B;  1K5D B;  1U5G A;  3ULB A;  1WG7 A;  1FHX A;  3FSS A;  3HIE A;  2IYB A;  5CLL B;  2RSG A;  4K2O A;  2COC A;  2XQN M;  1ZC4 B;  2J59 M;  2KIE A;  2QKM A;  4HB3 B;  2YS3 A;  3TW1 A;  4KHA A;  3OAN A;  2FJU B;  1FGY A;  2YF0 A;  4MT7 A;  3GYO A;  3GYP A;  2Z4D A;  4A6F B;  4PNK A;  2DLW A;  2R09 A;  1PLS A;  5JLJ B;  4BBK A;  3IVF A;  3CIK A;  1UNR A;  3A8P A;  2DFK A;  2CY4 A;  4K2P A;  3DCX A;  3U8Z A;  2ELA A;  5LON B;  2CY5 A;  2VSZ A;  1U2B A;  4EKU A;  1WGU A;  1UNP A;  3A58 A;  4KHO A;  3U12 A;  3PVL A;  4HDQ A;  1Y19 B;  4WVF B;  5KQ4 A;  1V88 A;  1KZG A;  2D9Z A;  3DXE A;  3NWF A;  5HE3 A;  3OHM B;  5LOP B;  1NI2 A;  4IAP A;  1WJ1 A;  2YS5 A;  2MKR A;  1EVH A;  3KRX A;  1M7E A;  2DYN A;  5D3X A;  1UPR A;  4NY0 A;  4ZRI A;  1RJ2 A;  2HTH B;  4DX8 A;  5I2S A;  2I5F A;  2LKO A;  2H7E A;  2Z0P A;  2DHK A;  3ZVR A;  2EC1 A;  1W1H A;  3RCP A;  2UZS A;  3FVC A;  2KUQ A;  5FI0 A;  1AQC A;  2LOX A;  4K17 A;  3M1I B;  1DRO A;  1EF1 A;  5JP4 A;  2KGX B;  3X23 A;  1XD4 A;  2RVB B;  4D6W A;  1Y5O A;  2PZ1 A;  5LG4 B;  2MWN B;  1RRP B;  2DKP A;  2Y8F A;  3SUZ A;  1B55 A;  4Z2M B;  2IFS A;  3N7C A;  1OY2 A;  1FHW A;  3FM8 C;  4GXB A;  1X1G A;  3WA0 A;  2AL6 A;  3LJU X;  4DIX A;  1TJ6 A;  1UPQ A;  5KQ1 A;  2Z0O A;  2D11 A;  1XR0 B;  4HB4 B;  2Z13 A;  5JHH A;  4EJN A;  2RGN B;  2ROV A;  2ELB A;  3B77 A;  2ADZ A;  1MPH A;  2KR0 A;  1XX0 A;  1V5U A;  1U29 A;  2DX1 A;  4K81 A;  1MKE A; 
#chains in the Genus database with same CATH homology
 2DKQ A;  2D9X A;  2P0F A;  2D9Y A;  2DYQ A;  3KSY A;  2Y8G A;  1WVH A;  5HE0 A;  5DHA B;  1FOE A;  2VRW B;  3QWM A;  5DH9 B;  1XKE A;  2OQB A;  5GOW B;  4GZU A;  5C16 A;  1DBH A;  1KI1 B;  1PFJ A;  2RLO A;  4TKN A;  2Q13 A;  5C6R A;  2KUP A;  4GMX B;  3HQC A;  2L1C A;  2P0H A;  1AWE A;  2K2J A;  5D27 A;  1U27 A;  2M38 A;  3G9W A;  2MDX A;  1P5T A;  3P6A A;  1V89 A;  5D3Y A;  2R0D A;  3O96 A;  2YT1 A;  4H8S A;  5J3T A;  1V5P A;  2GS0 A;  1FB8 A;  2V76 A;  1BTN A;  1U5F A;  2DTC A;  1DDW A;  2D10 A;  4Y94 A;  1K5G B;  5DIF B;  2GJY A;  1XOD A;  4ZRJ A;  2P0D A;  3AJ4 A;  2LG1 A;  1V61 A;  2LOZ A;  4WJ7 A;  4HAW B;  3DXD A;  4CHM A;  1MAI A;  3A98 B;  3CXB B;  1ZSQ A;  1X11 A;  4HB0 B;  2AEH A;  3SV1 A;  4HAT B;  3PEG A;  2DHJ A;  1TQZ A;  5C5B B;  5JHG A;  1ZVR A;  2FJL A;  2H7D A;  1OQN A;  3SYX A;  1MIX A;  4CYE A;  2L2I A;  2ROZ B;  2W2X D;  4GPT B;  4EMO A;  1J19 A;  1LW3 A;  1BTK A;  1I7A A;  1V5M A;  2N23 A;  4PQ0 A;  3BIN A;  2D2Q A;  1MK7 B;  3PZD A;  2Z0Q A;  1J0W A;  1LB1 A;  2DN6 A;  2W2W A;  3P7Z A;  4P7I A;  4A6H A;  1ZC3 B;  2COF A;  1TXD A;  1N3H A;  3PVW A;  2YRY A;  4DBB A;  5D3W A;  1E5W A;  1X86 A;  1DYN A;  2P8V A;  3ML4 A;  5C79 A;  4HHV A;  3ODX A;  4HDO A;  3F5R A;  3KRW A;  4F7U P;  3MPX A;  1QC6 A;  2BCJ A;  1WGQ A;  3VOQ A;  2NMB A;  1UNQ A;  2EMT A;  2EJ8 A;  2D9W A;  3ODO A;  4KAX B;  5FI1 A;  2D9V A;  4Z2N A;  4YON A;  1NTY A;  5HE1 A;  4D0N B;  2UZR A;  3AU4 A;  1P6S A;  3KY9 A;  4IOY X;  3F0W A;  1GG3 A;  1WJM A;  3QIJ A;  4MK0 A;  2NZ8 B;  5EFX A;  4L6E A;  2K00 A;  4TYZ A;  4ZRK A;  4F7H A;  2COA A;  1W1D A;  1GC7 A;  2E2X A;  5CLQ B;  1OMW A;  3D8E A;  1NU2 A;  2MFQ A;  1M7R A;  4DXA B;  1UEF A;  4WSF A;  4HB2 B;  4MY6 A;  2D4Q A;  4XWX A;  3AU5 A;  2CAY A;  3NSU A;  1X05 A;  1U5D A;  2DHI A;  2I1K A;  3D8F A;  2I1J A;  1BWN A;  2CRF A;  5C5B A;  4B6H A;  2W2X C;  1Z87 A;  3SO6 A;  2LUL A;  5DI9 B;  3ZDT A;  2N0Y A;  1KZ7 A;  3VIA A;  5J3Q A;  5DHF B;  4C0A A;  3TO1 A;  3PG7 A;  2I5C A;  2KCJ A;  5HE2 A;  1DDM A;  2J0M A;  2YSZ A;  1P3R A;  3TVV A;  2M14 A;  4GMV A;  2COD A;  2YVC A;  4KHB B;  1ISN A;  1EGX A;  1ZM0 A;  4HAY B;  3T06 A;  3QBV B;  3KZ1 A;  3HW2 B;  2QKL A;  3UZT A;  3D8D A;  1PMS A;  1DDV A;  3ODW A;  2OTX A;  3PP2 A;  2UVM A;  1BAK A;  2ZPY A;  2J0K A;  4IFS A;  2LYD A;  3ULC A;  2RUK B;  1QQG A;  2YT0 A;  5KCV A;  3A8Q A;  1H10 A;  4A6F A;  1U5E A;  1FGZ A;  3TCA A;  4HAX B;  2GCJ A;  3WYF B;  2K2U A;  3FEH A;  2YS1 A;  4HAV B;  1MIZ B;  4HAU B;  1H4R A;  5D3V A;  4A6K A;  3TFM A;  4A5K A;  3SNH A;  1W1G A;  2J0J A;  4DX9 0;  5L81 A;  4KVG B;  3HK0 A;  1X1F A;  1FAO A;  4CHJ A;  2HE7 A;  4GN1 A;  1MK9 B;  4F7G A;  1GC6 A;  1NTV A;  1Q67 A;  3DXC A;  3PVU A;  3U7D A;  2EMS A;  3V5W A;  2Y7B A;  3MDB C;  1WI1 A;  1SGH A;  3PSC A;  1FHO A;  2G35 A;  1XCG A;  3BJI A;  1EAZ A;  1IRS A;  4YL8 A;  4NSW A;  1SHC A;  2DX5 A;  2JP2 A;  1I2H A;  2GCL A;  2VKI A;  2RNR B;  2X18 A;  2DA0 A;  5J3Y A;  4HAZ B;  1K5D B;  1U5G A;  3ULB A;  1WG7 A;  1FHX A;  3FSS A;  2IYB A;  5CLL B;  2RSG A;  4K2O A;  2COC A;  2XQN M;  1ZC4 B;  2J59 M;  2QKM A;  3TW1 A;  4HB3 B;  2YS3 A;  4KHA A;  3OAN A;  1FGY A;  2YF0 A;  4MT7 A;  3GYO A;  3GYP A;  4A6F B;  4PNK A;  2DLW A;  2R09 A;  1PLS A;  5JLJ B;  4BBK A;  3IVF A;  3CIK A;  1UNR A;  3A8P A;  2DFK A;  2CY4 A;  4K2P A;  3U8Z A;  2ELA A;  5LON B;  2CY5 A;  2VSZ A;  1U2B A;  4EKU A;  1WGU A;  1UNP A;  4KHO A;  3PVL A;  4HDQ A;  1Y19 B;  4WVF B;  5KQ4 A;  1V88 A;  1KZG A;  2D9Z A;  3DXE A;  5HE3 A;  5LOP B;  1NI2 A;  4IAP A;  1WJ1 A;  2YS5 A;  2MKR A;  1EVH A;  3KRX A;  1M7E A;  2DYN A;  5D3X A;  1UPR A;  4NY0 A;  4ZRI A;  1RJ2 A;  2HTH B;  4DX8 A;  2I5F A;  2LKO A;  2H7E A;  2Z0P A;  2DHK A;  3ZVR A;  2EC1 A;  1W1H A;  3RCP A;  2UZS A;  5FI0 A;  1AQC A;  2LOX A;  4K17 A;  3M1I B;  1DRO A;  1EF1 A;  5JP4 A;  2KGX B;  3X23 A;  1XD4 A;  2RVB B;  1Y5O A;  2PZ1 A;  2MWN B;  1RRP B;  2DKP A;  2Y8F A;  3SUZ A;  1B55 A;  4Z2M B;  2IFS A;  3N7C A;  1OY2 A;  1FHW A;  3FM8 C;  4GXB A;  1X1G A;  3WA0 A;  2AL6 A;  3LJU X;  1TJ6 A;  1UPQ A;  5KQ1 A;  2Z0O A;  2D11 A;  1XR0 B;  4HB4 B;  5JHH A;  4EJN A;  2RGN B;  2ROV A;  2ELB A;  2ADZ A;  1MPH A;  1XX0 A;  1V5U A;  1U29 A;  2DX1 A;  4K81 A;  1MKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...