1W1GA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1gA00
1SHCA 2H7EA 3ODWA 5FI1A 1FOEA 3A98B 3V5WA 2COFA 3KY9A 1TQZA 5C79A 2NMBA 1ISNA 4A6FB 3PEGA 3FEHA 2RGNB 3FM8C 2CY4A 2XQNM 1BTKA 2P0DA 2FJLA 2RUKB 4HHVA 3PVLA 4NSWA 2DTCA 2AEHA 2R09A 3KRXA 2DX5A 3ZDTA 1W1GA 2L1CA 3KZ1A 4IOYX 3ULCA 2QKMA 1MIZB 2COAA 2N0YA 3A8QA 3SUZA 2VKIA 3HW2B 4KHOA 3QWMA 1X86A 2CY5A 4KAXB 3RCPA 4GMVA 5J3TA 4CHMA 3WYFB 2OQBA 1UPRA 2ELBA 2YVCA 2LULA 4HAXB 5C6RA 1EGXA 2P0FA 3P7ZA 1P3RA 2K2JA 3PZDA 1ZC4B 1OQNA 1ZM0A 4K81A 3AU4A 1FHXA 2COCA 3PP2A 5D27A 3X23A 4TKNA 2UZRA 4C0AA 1V61A 3WA0A 2UVMA 1WJ1A 4D0NB 1M7RA 5DH9B 3DXDA 1EAZA 4HB2B 1PFJA 3FSSA 2DKPA 4TYZA 1I2HA 1V5UA 2DA0A 4YL8A 2YS1A 1ZC3B 2H7DA 4HDOA 4ZRJA 4MY6A 3AU5A 2LOZA 2Y8FA 4GXBA 2P0HA 1H10A 5LOPB 4F7GA 4EKUA 3ODXA 3OANA 1M7EA 3N7CA 1UNRA 4EMOA 1TXDA 2G35A 2J0KA 4Z2NA 2Z0OA 1RJ2A 5HE2A 4HAYB 5DI9B 4HDQA 2NZ8B 3VOQA 1X11A 3U8ZA 2EJ8A 4HAUB 3BJIA 4A6KA 1AQCA 2YSZA 1ZVRA 2GCLA 4KVGB 4WSFA 2KGXB 1MK9B 2K2UA 3M1IB 3QBVB 2IYBA 1BAKA 5C16A 2IFSA 5D3XA 1V88A 2LG1A 1LW3A 2D9YA 1FGZA 1NU2A 1W1DA 1V5PA 3NSUA 1U5EA 1WGUA 1ZSQA 3HQCA 1DYNA 1XR0B 2UZSA 1GC6A 1UEFA 5DHFB 4DXAB 2V76A 2HTHB 2L2IA 1GC7A 2R0DA 2D4QA 3KSYA 3ULBA 3CXBB 5HE3A 4BBKA 1WI1A 2D9WA 2KCJA 1U5FA 3VIAA 4HB0B 1EF1A 2ROZB 5JHGA 5HE0A 1XODA 2YS5A 1B55A 2AL6A 5KCVA 1QC6A 1U5GA 2ADZA 1RRPB 2I5FA 2D9XA 4NY0A 2P8VA 5CLQB 3ML4A 4DX8A 5FI0A 1Y19B 3D8DA 2PZ1A 4K17A 4PQ0A 3GYOA 1UNPA 1LB1A 4Y94A 1K5DB 1XD4A 1FHOA 1U29A 1IRSA 2I5CA 2D9VA 2OTXA 2Y8GA 1KI1B 3SNHA 1KZ7A 4DBBA 1DDVA 1W1HA 2K00A 3D8FA 5EFXA 3HK0A 1J19A 3GYPA 5CLLB 1XX0A 4WVFB 4Z2MB 1NTVA 2J0MA 3LJUX 2W2XC 2CAYA 1QQGA 1U2BA 3ODOA 4L6EA 2M14A 4A6HA 3SV1A 1MK7B 1XKEA 2Z0QA 2DFKA 3TO1A 4A6FA 1EVHA 2MDXA 1WJMA 1X05A 1WVHA 1KZGA 2D11A 2RNRB 3O96A 4GMXB 4K2PA 2VSZA 4GPTB 1DROA 2DHKA 3IVFA 1K5GB 1PLSA 2I1JA 4K2OA 2DHJA 2Z0PA 3A8PA 5J3QA 3CIKA 1TJ6A 2I1KA 2KUPA 2CRFA 2N23A 2QKLA 4GZUA 4HAVB 3ZVRA 1WG7A 2LYDA 4ZRIA 5C5BA 1N3HA 3MDBC 4YONA 4XWXA 1FGYA 5JLJB 3BINA 1U5DA 2YRYA 2W2WA 2MFQA 4F7HA 1Z87A 5KQ1A 2D9ZA 2GJYA 1P6SA 2ZPYA 2DN6A 2YT1A 4CYEA 2M38A 1FB8A 1BWNA 3D8EA 3KRWA 4HAWB 4HB4B 2YF0A 4IFSA 4MT7A 1MIXA 1GG3A 3PVWA 5D3VA 1WGQA 5GOWB 4EJNA 4F7UP 2LKOA 5L81A 2DHIA 4MK0A 3F5RA 3TCAA 2BCJA 4DX90 3PSCA 2MKRA 2MWNB 3TFMA 4CHJA 3F0WA 3DXEA 1J0WA 2YT0A 2EMTA 4KHBB 5C5BB 4KHAA 4B6HA 3DXCA 2JP2A 1MPHA 1XCGA 2Y7BA 2E2XA 3PVUA 3P6AA 4GN1A 1H4RA 1MKEA 1U27A 4ZRKA 2DYNA 2EMSA 1V89A 2EC1A 1BTNA 1X1GA 4H8SA 2YS3A 2ROVA 3TVVA 3G9WA 1UPQA 3QIJA 3AJ4A 2LOXA 2W2XD 1P5TA 1I7AA 2D2QA 4IAPA 4A5KA 2DYQA 5HE1A 2ELAA 5KQ4A 2Q13A 3UZTA 1Y5OA 3MPXA 1OMWA 1E5WA 3SYXA 2D10A 5D3WA 5JP4A 5DHAB 1FAOA 2DX1A 5JHHA 1Q67A 5DIFB 2VRWB 2CODA 1NTYA 2RLOA 5D3YA 3PG7A 4PNKA 1DBHA 4HAZB 4WJ7A 4HB3B 3TW1A 1DDWA 2DLWA 2J59M 5J3YA 1PMSA 2DKQA 1NI2A 1V5MA 2J0JA 4P7IA 5LONB 1SGHA 2RVBB 1DDMA 4HATB 2RSGA 1AWEA 3U7DA 2HE7A 1MAIA 3SO6A 3T06A 1OY2A 1UNQA 2X18A 2GS0A 1X1FA 2GCJA 1FHWA
chains in the Genus database with same CATH superfamily
1SHCA 2H7EA 3ODWA 5FI1A 1FOEA 3A98B 3V5WA 2GUMA 2COFA 3KY9A 1TQZA 5C79A 2NMBA 2Z14A 2Z59A 1ISNA 4A6FB 3PEGA 3FEHA 4OSNA 2RGNB 3FM8C 2CY4A 2XQNM 1BTKA 2P0DA 2FJLA 2RUKB 4HHVA 3PVLA 4NSWA 2DTCA 2Z13A 1T77A 2AEHA 2R09A 3KRXA 2DX5A 3ZDTA 1W1GA 2L1CA 3KZ1A 4IOYX 3ULCA 2QKMA 1MIZB 2RRFA 2COAA 2N0YA 3A8QA 3SUZA 2VKIA 3HW2B 4GNKB 4KHOA 3QWMA 1X86A 2CY5A 4KAXB 4QJ4B 3RCPA 4GMVA 5J3TA 4CHMA 3WYFB 2OQBA 1UPRA 2ELBA 2YVCA 2LULA 4HAXB 3A58A 5C6RA 1EGXA 2P0FA 1P3RA 3P7ZA 2K2JA 3PZDA 1ZC4B 1OQNA 1ZM0A 4K81A 3AU4A 1FHXA 2COCA 3PP2A 5D27A 3X23A 4TKNA 2UZRA 4C0AA 1V61A 4CSQA 3WA0A 2UVMA 1WJ1A 4D0NB 1M7RA 5DH9B 2Z4DA 3DXDA 1EAZA 3DCXA 4QJ5B 4HB2B 1PFJA 3FSSA 2DKPA 4TYZA 1I2HA 1V5UA 2DA0A 4YL8A 2YS1A 1ZC3B 2H7DA 4HDOA 4ZRJA 4MY6A 3AU5A 2LOZA 2Y8FA 4GXBA 2P0HA 4L1RA 2KR0A 1H10A 5LOPB 4F7GA 4EKUA 3ODXA 3OANA 1M7EA 3N7CA 1UNRA 4EMOA 1TXDA 2G35A 2J0KA 4Z2NA 2Z0OA 1RJ2A 5HE2A 4HAYB 5DI9B 4HDQA 2NZ8B 3VOQA 1X11A 3U8ZA 2EJ8A 4HAUB 3BJIA 4A6KA 4DIXA 1AQCA 2YSZA 1ZVRA 2GCLA 4KVGB 4WSFA 2KGXB 1MK9B 2K2UA 3M1IB 3QBVB 2IYBA 1BAKA 5C16A 2IFSA 5D3XA 1V88A 2LG1A 1LW3A 2D9YA 1FGZA 1NU2A 1W1DA 1V5PA 3NSUA 1U5EA 1WGUA 1ZSQA 3HQCA 3NWAA 1DYNA 5I2MA 1XR0B 2UZSA 1GC6A 5I2SA 1UEFA 5DHFB 4DXAB 2V76A 2HTHB 2L2IA 3FVCA 1GC7A 2R0DA 2D4QA 3KSYA 2KIEA 3ULBA 3CXBB 5HE3A 4BBKA 1WI1A 2D9WA 5M4YB 2KCJA 1U5FA 2K8EA 2FJUB 3VIAA 4HB0B 1EF1A 2ROZB 5JHGA 5HE0A 1XODA 2YS5A 1B55A 2AL6A 5KCVA 1QC6A 1U5GA 1MI1A 2KUQA 2ADZA 1RRPB 2I5FA 2D9XA 4NY0A 2P8VA 5CLQB 3ML4A 4DX8A 5FI0A 1Y19B 3D8DA 2PZ1A 4K17A 4PQ0A 2R2YA 3GYOA 1UNPA 1LB1A 4Y94A 1K5DB 1XD4A 1FHOA 1U29A 1IRSA 2I5CA 4D6WA 2D9VA 2OTXA 2Y8GA 5IRSA 1KI1B 3SNHA 1KZ7A 4DBBA 1DDVA 1W1HA 2K00A 3D8FA 5EFXA 3HK0A 1J19A 3GYPA 5CLLB 1XX0A 4WVFB 4Z2MB 1NTVA 2J0MA 3LJUX 2W2XC 2CAYA 1QQGA 1U2BA 3ODOA 4L6EA 2M14A 4A6HA 2K49A 3SV1A 1MK7B 1XKEA 2Z0QA 2DFKA 3TO1A 4A6FA 1EVHA 2MDXA 1WJMA 1X05A 1WVHA 1KZGA 3NW8A 2D11A 2RNRB 3O96A 4GMXB 2YT2A 4K2PA 2VSZA 4GPTB 1DROA 2DHKA 3IVFA 4QXAB 1K5GB 1PLSA 3U12A 2I1JA 4K2OA 2DHJA 2Z0PA 3A8PA 5J3QA 3CIKA 1TJ6A 2I1KA 2KUPA 2CRFA 2N23A 2QKLA 4GZUA 4HAVB 3ZVRA 5LG4B 1WG7A 3HIEA 2LYDA 4ZRIA 3B77A 4KHBA 5C5BA 1N3HA 3MDBC 4YONA 4XWXA 1FGYA 5JLJB 3BINA 1U5DA 2YRYA 2NBVA 2MFQA 2W2WA 4F7HA 1Z87A 5KQ1A 2D9ZA 2GJYA 1P6SA 2ZPYA 2DN6A 4GOUA 2YT1A 4CYEA 2M38A 1FB8A 1BWNA 3D8EA 3KRWA 4HAWB 4HB4B 2YF0A 4IFSA 4MT7A 1MIXA 1GG3A 3PVWA 5D3VA 1WGQA 5GOWB 4EJNA 4F7UP 3HSAA 2LKOA 5L81A 4QJ3B 2DHIA 4MK0A 3F5RA 3TCAA 2BCJA 4DX90 3PSCA 2MKRA 2MWNB 3TFMA 4CHJA 3F0WA 3DXEA 3NWDA 1J0WA 2YT0A 2EMTA 4KHBB 5C5BB 4KHAA 4B6HA 3DXCA 2JP2A 1MPHA 1XCGA 2Y7BA 2E2XA 3PVUA 3P6AA 4GN1A 1H4RA 1MKEA 1U27A 4ZRKA 2DYNA 2EMSA 1V89A 2EC1A 1BTNA 1X1GA 4H8SA 2YS3A 2ROVA 3TVVA 3OHMB 3G9WA 1UPQA 3QIJA 3AJ4A 2LOXA 2W2XD 1P5TA 1I7AA 2D2QA 4IAPA 4A5KA 2DYQA 5HE1A 2ELAA 5KQ4A 2Q13A 3UZTA 1Y5OA 3MPXA 1OMWA 1E5WA 3SYXA 2D10A 5D3WA 5JP4A 5DHAB 1FAOA 2DX1A 5JHHA 1Q67A 5DIFB 2VRWB 3NWFA 2KIGA 2CODA 1NTYA 2RLOA 5D3YA 3PG7A 4PNKA 1DBHA 4HAZB 4WJ7A 4HB3B 3TW1A 1DDWA 1ZYIA 2DLWA 2ZKMX 2J59M 5J3YA 1PMSA 2DKQA 1NI2A 1V5MA 2J0JA 4P7IA 4HSIA 5LONB 1SGHA 2RVBB 1DDMA 4HATB 2RSGA 1AWEA 3U7DA 2HE7A 1MAIA 3SO6A 3T06A 1OY2A 1UNQA 4OT1A 2X18A 2GS0A 1X1FA 2GCJA 1FHWA
chains in the Genus database with same CATH topology
1SHCA 2H7EA 3ODWA 5FI1A 1FOEA 3A98B 3V5WA 2COFA 3KY9A 1TQZA 5C79A 2NMBA 1ISNA 4A6FB 3PEGA 3FEHA 2RGNB 3FM8C 2CY4A 2XQNM 1BTKA 2P0DA 2FJLA 2RUKB 4HHVA 3PVLA 4NSWA 2DTCA 2AEHA 2R09A 3KRXA 2DX5A 3ZDTA 1W1GA 2L1CA 3KZ1A 4IOYX 3ULCA 2QKMA 1MIZB 2COAA 2N0YA 3A8QA 3SUZA 2VKIA 3HW2B 4KHOA 3QWMA 1X86A 2CY5A 4KAXB 3RCPA 4GMVA 5J3TA 4CHMA 3WYFB 2OQBA 1UPRA 2ELBA 2YVCA 2LULA 4HAXB 5C6RA 1EGXA 2P0FA 3P7ZA 1P3RA 2K2JA 3PZDA 1ZC4B 1OQNA 1ZM0A 4K81A 3AU4A 1FHXA 2COCA 3PP2A 5D27A 3X23A 4TKNA 2UZRA 4C0AA 1V61A 3WA0A 2UVMA 1WJ1A 4D0NB 1M7RA 5DH9B 3DXDA 1EAZA 4HB2B 1PFJA 3FSSA 2DKPA 4TYZA 1I2HA 1V5UA 2DA0A 4YL8A 2YS1A 1ZC3B 2H7DA 4HDOA 4ZRJA 4MY6A 3AU5A 2LOZA 2Y8FA 4GXBA 2P0HA 1H10A 5LOPB 4F7GA 4EKUA 3ODXA 3OANA 1M7EA 3N7CA 1UNRA 4EMOA 1TXDA 2G35A 2J0KA 4Z2NA 2Z0OA 1RJ2A 5HE2A 4HAYB 5DI9B 4HDQA 2NZ8B 3VOQA 1X11A 3U8ZA 2EJ8A 4HAUB 3BJIA 4A6KA 1AQCA 2YSZA 1ZVRA 2GCLA 4KVGB 4WSFA 2KGXB 1MK9B 2K2UA 3M1IB 3QBVB 2IYBA 1BAKA 5C16A 2IFSA 5D3XA 1V88A 2LG1A 1LW3A 2D9YA 1FGZA 1NU2A 1W1DA 1V5PA 3NSUA 1U5EA 1WGUA 1ZSQA 3HQCA 1DYNA 1XR0B 2UZSA 1GC6A 1UEFA 5DHFB 4DXAB 2V76A 2HTHB 2L2IA 1GC7A 2R0DA 2D4QA 3KSYA 3ULBA 3CXBB 5HE3A 4BBKA 1WI1A 2D9WA 2KCJA 1U5FA 3VIAA 4HB0B 1EF1A 2ROZB 5JHGA 5HE0A 1XODA 2YS5A 1B55A 2AL6A 5KCVA 1QC6A 1U5GA 2ADZA 1RRPB 2I5FA 2D9XA 4NY0A 2P8VA 5CLQB 3ML4A 4DX8A 5FI0A 1Y19B 3D8DA 2PZ1A 4K17A 4PQ0A 3GYOA 1UNPA 1LB1A 4Y94A 1K5DB 1XD4A 1FHOA 1U29A 1IRSA 2I5CA 2D9VA 2OTXA 2Y8GA 1KI1B 3SNHA 1KZ7A 4DBBA 1DDVA 1W1HA 2K00A 3D8FA 5EFXA 3HK0A 1J19A 3GYPA 5CLLB 1XX0A 4WVFB 4Z2MB 1NTVA 2J0MA 3LJUX 2W2XC 2CAYA 1QQGA 1U2BA 3ODOA 4L6EA 2M14A 4A6HA 3SV1A 1MK7B 1XKEA 2Z0QA 2DFKA 3TO1A 4A6FA 1EVHA 2MDXA 1WJMA 1X05A 1WVHA 1KZGA 2D11A 2RNRB 3O96A 4GMXB 4K2PA 2VSZA 4GPTB 1DROA 2DHKA 3IVFA 1K5GB 1PLSA 2I1JA 4K2OA 2DHJA 2Z0PA 3A8PA 5J3QA 3CIKA 1TJ6A 2I1KA 2KUPA 2CRFA 2N23A 2QKLA 4GZUA 4HAVB 3ZVRA 1WG7A 2LYDA 4ZRIA 5C5BA 1N3HA 3MDBC 4YONA 4XWXA 1FGYA 5JLJB 3BINA 1U5DA 2YRYA 2W2WA 2MFQA 4F7HA 1Z87A 5KQ1A 2D9ZA 2GJYA 1P6SA 2ZPYA 2DN6A 2YT1A 4CYEA 2M38A 1FB8A 1BWNA 3D8EA 3KRWA 4HAWB 4HB4B 2YF0A 4IFSA 4MT7A 1MIXA 1GG3A 3PVWA 5D3VA 1WGQA 5GOWB 4EJNA 4F7UP 2LKOA 5L81A 2DHIA 4MK0A 3F5RA 3TCAA 2BCJA 4DX90 3PSCA 2MKRA 2MWNB 3TFMA 4CHJA 3F0WA 3DXEA 1J0WA 2YT0A 2EMTA 4KHBB 5C5BB 4KHAA 4B6HA 3DXCA 2JP2A 1MPHA 1XCGA 2Y7BA 2E2XA 3PVUA 3P6AA 4GN1A 1H4RA 1MKEA 1U27A 4ZRKA 2DYNA 2EMSA 1V89A 2EC1A 1BTNA 1X1GA 4H8SA 2YS3A 2ROVA 3TVVA 3G9WA 1UPQA 3QIJA 3AJ4A 2LOXA 2W2XD 1P5TA 1I7AA 2D2QA 4IAPA 4A5KA 2DYQA 5HE1A 2ELAA 5KQ4A 2Q13A 3UZTA 1Y5OA 3MPXA 1OMWA 1E5WA 3SYXA 2D10A 5D3WA 5JP4A 5DHAB 1FAOA 2DX1A 5JHHA 1Q67A 5DIFB 2VRWB 2CODA 1NTYA 2RLOA 5D3YA 3PG7A 4PNKA 1DBHA 4HAZB 4WJ7A 4HB3B 3TW1A 1DDWA 2DLWA 2J59M 5J3YA 1PMSA 2DKQA 1NI2A 1V5MA 2J0JA 4P7IA 5LONB 1SGHA 2RVBB 1DDMA 4HATB 2RSGA 1AWEA 3U7DA 2HE7A 1MAIA 3SO6A 3T06A 1OY2A 1UNQA 2X18A 2GS0A 1X1FA 2GCJA 1FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHC A;  2H7E A;  3ODW A;  5FI1 A;  1FOE A;  3A98 B;  3V5W A;  2COF A;  3KY9 A;  1TQZ A;  5C79 A;  2NMB A;  1ISN A;  4A6F B;  3PEG A;  3FEH A;  2RGN B;  3FM8 C;  2CY4 A;  2XQN M;  1BTK A;  2P0D A;  2FJL A;  2RUK B;  4HHV A;  3PVL A;  4NSW A;  2DTC A;  2AEH A;  2R09 A;  3KRX A;  2DX5 A;  3ZDT A;  1W1G A;  2L1C A;  3KZ1 A;  4IOY X;  3ULC A;  2QKM A;  1MIZ B;  2COA A;  2N0Y A;  3A8Q A;  3SUZ A;  2VKI A;  3HW2 B;  4KHO A;  3QWM A;  1X86 A;  2CY5 A;  4KAX B;  3RCP A;  4GMV A;  5J3T A;  4CHM A;  3WYF B;  2OQB A;  1UPR A;  2ELB A;  2YVC A;  2LUL A;  4HAX B;  5C6R A;  1EGX A;  2P0F A;  3P7Z A;  1P3R A;  2K2J A;  3PZD A;  1ZC4 B;  1OQN A;  1ZM0 A;  4K81 A;  3AU4 A;  1FHX A;  2COC A;  3PP2 A;  5D27 A;  3X23 A;  4TKN A;  2UZR A;  4C0A A;  1V61 A;  3WA0 A;  2UVM A;  1WJ1 A;  4D0N B;  1M7R A;  5DH9 B;  3DXD A;  1EAZ A;  4HB2 B;  1PFJ A;  3FSS A;  2DKP A;  4TYZ A;  1I2H A;  1V5U A;  2DA0 A;  4YL8 A;  2YS1 A;  1ZC3 B;  2H7D A;  4HDO A;  4ZRJ A;  4MY6 A;  3AU5 A;  2LOZ A;  2Y8F A;  4GXB A;  2P0H A;  1H10 A;  5LOP B;  4F7G A;  4EKU A;  3ODX A;  3OAN A;  1M7E A;  3N7C A;  1UNR A;  4EMO A;  1TXD A;  2G35 A;  2J0K A;  4Z2N A;  2Z0O A;  1RJ2 A;  5HE2 A;  4HAY B;  5DI9 B;  4HDQ A;  2NZ8 B;  3VOQ A;  1X11 A;  3U8Z A;  2EJ8 A;  4HAU B;  3BJI A;  4A6K A;  1AQC A;  2YSZ A;  1ZVR A;  2GCL A;  4KVG B;  4WSF A;  2KGX B;  1MK9 B;  2K2U A;  3M1I B;  3QBV B;  2IYB A;  1BAK A;  5C16 A;  2IFS A;  5D3X A;  1V88 A;  2LG1 A;  1LW3 A;  2D9Y A;  1FGZ A;  1NU2 A;  1W1D A;  1V5P A;  3NSU A;  1U5E A;  1WGU A;  1ZSQ A;  3HQC A;  1DYN A;  1XR0 B;  2UZS A;  1GC6 A;  1UEF A;  5DHF B;  4DXA B;  2V76 A;  2HTH B;  2L2I A;  1GC7 A;  2R0D A;  2D4Q A;  3KSY A;  3ULB A;  3CXB B;  5HE3 A;  4BBK A;  1WI1 A;  2D9W A;  2KCJ A;  1U5F A;  3VIA A;  4HB0 B;  1EF1 A;  2ROZ B;  5JHG A;  5HE0 A;  1XOD A;  2YS5 A;  1B55 A;  2AL6 A;  5KCV A;  1QC6 A;  1U5G A;  2ADZ A;  1RRP B;  2I5F A;  2D9X A;  4NY0 A;  2P8V A;  5CLQ B;  3ML4 A;  4DX8 A;  5FI0 A;  1Y19 B;  3D8D A;  2PZ1 A;  4K17 A;  4PQ0 A;  3GYO A;  1UNP A;  1LB1 A;  4Y94 A;  1K5D B;  1XD4 A;  1FHO A;  1U29 A;  1IRS A;  2I5C A;  2D9V A;  2OTX A;  2Y8G A;  1KI1 B;  3SNH A;  1KZ7 A;  4DBB A;  1DDV A;  1W1H A;  2K00 A;  3D8F A;  5EFX A;  3HK0 A;  1J19 A;  3GYP A;  5CLL B;  1XX0 A;  4WVF B;  4Z2M B;  1NTV A;  2J0M A;  3LJU X;  2W2X C;  2CAY A;  1QQG A;  1U2B A;  3ODO A;  4L6E A;  2M14 A;  4A6H A;  3SV1 A;  1MK7 B;  1XKE A;  2Z0Q A;  2DFK A;  3TO1 A;  4A6F A;  1EVH A;  2MDX A;  1WJM A;  1X05 A;  1WVH A;  1KZG A;  2D11 A;  2RNR B;  3O96 A;  4GMX B;  4K2P A;  2VSZ A;  4GPT B;  1DRO A;  2DHK A;  3IVF A;  1K5G B;  1PLS A;  2I1J A;  4K2O A;  2DHJ A;  2Z0P A;  3A8P A;  5J3Q A;  3CIK A;  1TJ6 A;  2I1K A;  2KUP A;  2CRF A;  2N23 A;  2QKL A;  4GZU A;  4HAV B;  3ZVR A;  1WG7 A;  2LYD A;  4ZRI A;  5C5B A;  1N3H A;  3MDB C;  4YON A;  4XWX A;  1FGY A;  5JLJ B;  3BIN A;  1U5D A;  2YRY A;  2W2W A;  2MFQ A;  4F7H A;  1Z87 A;  5KQ1 A;  2D9Z A;  2GJY A;  1P6S A;  2ZPY A;  2DN6 A;  2YT1 A;  4CYE A;  2M38 A;  1FB8 A;  1BWN A;  3D8E A;  3KRW A;  4HAW B;  4HB4 B;  2YF0 A;  4IFS A;  4MT7 A;  1MIX A;  1GG3 A;  3PVW A;  5D3V A;  1WGQ A;  5GOW B;  4EJN A;  4F7U P;  2LKO A;  5L81 A;  2DHI A;  4MK0 A;  3F5R A;  3TCA A;  2BCJ A;  4DX9 0;  3PSC A;  2MKR A;  2MWN B;  3TFM A;  4CHJ A;  3F0W A;  3DXE A;  1J0W A;  2YT0 A;  2EMT A;  4KHB B;  5C5B B;  4KHA A;  4B6H A;  3DXC A;  2JP2 A;  1MPH A;  1XCG A;  2Y7B A;  2E2X A;  3PVU A;  3P6A A;  4GN1 A;  1H4R A;  1MKE A;  1U27 A;  4ZRK A;  2DYN A;  2EMS A;  1V89 A;  2EC1 A;  1BTN A;  1X1G A;  4H8S A;  2YS3 A;  2ROV A;  3TVV A;  3G9W A;  1UPQ A;  3QIJ A;  3AJ4 A;  2LOX A;  2W2X D;  1P5T A;  1I7A A;  2D2Q A;  4IAP A;  4A5K A;  2DYQ A;  5HE1 A;  2ELA A;  5KQ4 A;  2Q13 A;  3UZT A;  1Y5O A;  3MPX A;  1OMW A;  1E5W A;  3SYX A;  2D10 A;  5D3W A;  5JP4 A;  5DHA B;  1FAO A;  2DX1 A;  5JHH A;  1Q67 A;  5DIF B;  2VRW B;  2COD A;  1NTY A;  2RLO A;  5D3Y A;  3PG7 A;  4PNK A;  1DBH A;  4HAZ B;  4WJ7 A;  4HB3 B;  3TW1 A;  1DDW A;  2DLW A;  2J59 M;  5J3Y A;  1PMS A;  2DKQ A;  1NI2 A;  1V5M A;  2J0J A;  4P7I A;  5LON B;  1SGH A;  2RVB B;  1DDM A;  4HAT B;  2RSG A;  1AWE A;  3U7D A;  2HE7 A;  1MAI A;  3SO6 A;  3T06 A;  1OY2 A;  1UNQ A;  2X18 A;  2GS0 A;  1X1F A;  2GCJ A;  1FHW A; 
#chains in the Genus database with same CATH topology
 1SHC A;  2H7E A;  3ODW A;  5FI1 A;  1FOE A;  3A98 B;  3V5W A;  2GUM A;  2COF A;  3KY9 A;  1TQZ A;  5C79 A;  2NMB A;  2Z14 A;  2Z59 A;  1ISN A;  4A6F B;  3PEG A;  3FEH A;  4OSN A;  2RGN B;  3FM8 C;  2CY4 A;  2XQN M;  1BTK A;  2P0D A;  2FJL A;  2RUK B;  4HHV A;  3PVL A;  4NSW A;  2DTC A;  2Z13 A;  1T77 A;  2AEH A;  2R09 A;  3KRX A;  2DX5 A;  3ZDT A;  1W1G A;  2L1C A;  3KZ1 A;  4IOY X;  3ULC A;  2QKM A;  1MIZ B;  2RRF A;  2COA A;  2N0Y A;  3A8Q A;  3SUZ A;  2VKI A;  3HW2 B;  4GNK B;  4KHO A;  3QWM A;  1X86 A;  2CY5 A;  4KAX B;  4QJ4 B;  3RCP A;  4GMV A;  5J3T A;  4CHM A;  3WYF B;  2OQB A;  1UPR A;  2ELB A;  2YVC A;  2LUL A;  4HAX B;  3A58 A;  5C6R A;  1EGX A;  2P0F A;  1P3R A;  3P7Z A;  2K2J A;  3PZD A;  1ZC4 B;  1OQN A;  1ZM0 A;  4K81 A;  3AU4 A;  1FHX A;  2COC A;  3PP2 A;  5D27 A;  3X23 A;  4TKN A;  2UZR A;  4C0A A;  1V61 A;  4CSQ A;  3WA0 A;  2UVM A;  1WJ1 A;  4D0N B;  1M7R A;  5DH9 B;  2Z4D A;  3DXD A;  1EAZ A;  3DCX A;  4QJ5 B;  4HB2 B;  1PFJ A;  3FSS A;  2DKP A;  4TYZ A;  1I2H A;  1V5U A;  2DA0 A;  4YL8 A;  2YS1 A;  1ZC3 B;  2H7D A;  4HDO A;  4ZRJ A;  4MY6 A;  3AU5 A;  2LOZ A;  2Y8F A;  4GXB A;  2P0H A;  4L1R A;  2KR0 A;  1H10 A;  5LOP B;  4F7G A;  4EKU A;  3ODX A;  3OAN A;  1M7E A;  3N7C A;  1UNR A;  4EMO A;  1TXD A;  2G35 A;  2J0K A;  4Z2N A;  2Z0O A;  1RJ2 A;  5HE2 A;  4HAY B;  5DI9 B;  4HDQ A;  2NZ8 B;  3VOQ A;  1X11 A;  3U8Z A;  2EJ8 A;  4HAU B;  3BJI A;  4A6K A;  4DIX A;  1AQC A;  2YSZ A;  1ZVR A;  2GCL A;  4KVG B;  4WSF A;  2KGX B;  1MK9 B;  2K2U A;  3M1I B;  3QBV B;  2IYB A;  1BAK A;  5C16 A;  2IFS A;  5D3X A;  1V88 A;  2LG1 A;  1LW3 A;  2D9Y A;  1FGZ A;  1NU2 A;  1W1D A;  1V5P A;  3NSU A;  1U5E A;  1WGU A;  1ZSQ A;  3HQC A;  3NWA A;  1DYN A;  5I2M A;  1XR0 B;  2UZS A;  1GC6 A;  5I2S A;  1UEF A;  5DHF B;  4DXA B;  2V76 A;  2HTH B;  2L2I A;  3FVC A;  1GC7 A;  2R0D A;  2D4Q A;  3KSY A;  2KIE A;  3ULB A;  3CXB B;  5HE3 A;  4BBK A;  1WI1 A;  2D9W A;  5M4Y B;  2KCJ A;  1U5F A;  2K8E A;  2FJU B;  3VIA A;  4HB0 B;  1EF1 A;  2ROZ B;  5JHG A;  5HE0 A;  1XOD A;  2YS5 A;  1B55 A;  2AL6 A;  5KCV A;  1QC6 A;  1U5G A;  1MI1 A;  2KUQ A;  2ADZ A;  1RRP B;  2I5F A;  2D9X A;  4NY0 A;  2P8V A;  5CLQ B;  3ML4 A;  4DX8 A;  5FI0 A;  1Y19 B;  3D8D A;  2PZ1 A;  4K17 A;  4PQ0 A;  2R2Y A;  3GYO A;  1UNP A;  1LB1 A;  4Y94 A;  1K5D B;  1XD4 A;  1FHO A;  1U29 A;  1IRS A;  2I5C A;  4D6W A;  2D9V A;  2OTX A;  2Y8G A;  5IRS A;  1KI1 B;  3SNH A;  1KZ7 A;  4DBB A;  1DDV A;  1W1H A;  2K00 A;  3D8F A;  5EFX A;  3HK0 A;  1J19 A;  3GYP A;  5CLL B;  1XX0 A;  4WVF B;  4Z2M B;  1NTV A;  2J0M A;  3LJU X;  2W2X C;  2CAY A;  1QQG A;  1U2B A;  3ODO A;  4L6E A;  2M14 A;  4A6H A;  2K49 A;  3SV1 A;  1MK7 B;  1XKE A;  2Z0Q A;  2DFK A;  3TO1 A;  4A6F A;  1EVH A;  2MDX A;  1WJM A;  1X05 A;  1WVH A;  1KZG A;  3NW8 A;  2D11 A;  2RNR B;  3O96 A;  4GMX B;  2YT2 A;  4K2P A;  2VSZ A;  4GPT B;  1DRO A;  2DHK A;  3IVF A;  4QXA B;  1K5G B;  1PLS A;  3U12 A;  2I1J A;  4K2O A;  2DHJ A;  2Z0P A;  3A8P A;  5J3Q A;  3CIK A;  1TJ6 A;  2I1K A;  2KUP A;  2CRF A;  2N23 A;  2QKL A;  4GZU A;  4HAV B;  3ZVR A;  5LG4 B;  1WG7 A;  3HIE A;  2LYD A;  4ZRI A;  3B77 A;  4KHB A;  5C5B A;  1N3H A;  3MDB C;  4YON A;  4XWX A;  1FGY A;  5JLJ B;  3BIN A;  1U5D A;  2YRY A;  2NBV A;  2MFQ A;  2W2W A;  4F7H A;  1Z87 A;  5KQ1 A;  2D9Z A;  2GJY A;  1P6S A;  2ZPY A;  2DN6 A;  4GOU A;  2YT1 A;  4CYE A;  2M38 A;  1FB8 A;  1BWN A;  3D8E A;  3KRW A;  4HAW B;  4HB4 B;  2YF0 A;  4IFS A;  4MT7 A;  1MIX A;  1GG3 A;  3PVW A;  5D3V A;  1WGQ A;  5GOW B;  4EJN A;  4F7U P;  3HSA A;  2LKO A;  5L81 A;  4QJ3 B;  2DHI A;  4MK0 A;  3F5R A;  3TCA A;  2BCJ A;  4DX9 0;  3PSC A;  2MKR A;  2MWN B;  3TFM A;  4CHJ A;  3F0W A;  3DXE A;  3NWD A;  1J0W A;  2YT0 A;  2EMT A;  4KHB B;  5C5B B;  4KHA A;  4B6H A;  3DXC A;  2JP2 A;  1MPH A;  1XCG A;  2Y7B A;  2E2X A;  3PVU A;  3P6A A;  4GN1 A;  1H4R A;  1MKE A;  1U27 A;  4ZRK A;  2DYN A;  2EMS A;  1V89 A;  2EC1 A;  1BTN A;  1X1G A;  4H8S A;  2YS3 A;  2ROV A;  3TVV A;  3OHM B;  3G9W A;  1UPQ A;  3QIJ A;  3AJ4 A;  2LOX A;  2W2X D;  1P5T A;  1I7A A;  2D2Q A;  4IAP A;  4A5K A;  2DYQ A;  5HE1 A;  2ELA A;  5KQ4 A;  2Q13 A;  3UZT A;  1Y5O A;  3MPX A;  1OMW A;  1E5W A;  3SYX A;  2D10 A;  5D3W A;  5JP4 A;  5DHA B;  1FAO A;  2DX1 A;  5JHH A;  1Q67 A;  5DIF B;  2VRW B;  3NWF A;  2KIG A;  2COD A;  1NTY A;  2RLO A;  5D3Y A;  3PG7 A;  4PNK A;  1DBH A;  4HAZ B;  4WJ7 A;  4HB3 B;  3TW1 A;  1DDW A;  1ZYI A;  2DLW A;  2ZKM X;  2J59 M;  5J3Y A;  1PMS A;  2DKQ A;  1NI2 A;  1V5M A;  2J0J A;  4P7I A;  4HSI A;  5LON B;  1SGH A;  2RVB B;  1DDM A;  4HAT B;  2RSG A;  1AWE A;  3U7D A;  2HE7 A;  1MAI A;  3SO6 A;  3T06 A;  1OY2 A;  1UNQ A;  4OT1 A;  2X18 A;  2GS0 A;  1X1F A;  2GCJ A;  1FHW A; 
#chains in the Genus database with same CATH homology
 1SHC A;  2H7E A;  3ODW A;  5FI1 A;  1FOE A;  3A98 B;  3V5W A;  2COF A;  3KY9 A;  1TQZ A;  5C79 A;  2NMB A;  1ISN A;  4A6F B;  3PEG A;  3FEH A;  2RGN B;  3FM8 C;  2CY4 A;  2XQN M;  1BTK A;  2P0D A;  2FJL A;  2RUK B;  4HHV A;  3PVL A;  4NSW A;  2DTC A;  2AEH A;  2R09 A;  3KRX A;  2DX5 A;  3ZDT A;  1W1G A;  2L1C A;  3KZ1 A;  4IOY X;  3ULC A;  2QKM A;  1MIZ B;  2COA A;  2N0Y A;  3A8Q A;  3SUZ A;  2VKI A;  3HW2 B;  4KHO A;  3QWM A;  1X86 A;  2CY5 A;  4KAX B;  3RCP A;  4GMV A;  5J3T A;  4CHM A;  3WYF B;  2OQB A;  1UPR A;  2ELB A;  2YVC A;  2LUL A;  4HAX B;  5C6R A;  1EGX A;  2P0F A;  3P7Z A;  1P3R A;  2K2J A;  3PZD A;  1ZC4 B;  1OQN A;  1ZM0 A;  4K81 A;  3AU4 A;  1FHX A;  2COC A;  3PP2 A;  5D27 A;  3X23 A;  4TKN A;  2UZR A;  4C0A A;  1V61 A;  3WA0 A;  2UVM A;  1WJ1 A;  4D0N B;  1M7R A;  5DH9 B;  3DXD A;  1EAZ A;  4HB2 B;  1PFJ A;  3FSS A;  2DKP A;  4TYZ A;  1I2H A;  1V5U A;  2DA0 A;  4YL8 A;  2YS1 A;  1ZC3 B;  2H7D A;  4HDO A;  4ZRJ A;  4MY6 A;  3AU5 A;  2LOZ A;  2Y8F A;  4GXB A;  2P0H A;  1H10 A;  5LOP B;  4F7G A;  4EKU A;  3ODX A;  3OAN A;  1M7E A;  3N7C A;  1UNR A;  4EMO A;  1TXD A;  2G35 A;  2J0K A;  4Z2N A;  2Z0O A;  1RJ2 A;  5HE2 A;  4HAY B;  5DI9 B;  4HDQ A;  2NZ8 B;  3VOQ A;  1X11 A;  3U8Z A;  2EJ8 A;  4HAU B;  3BJI A;  4A6K A;  1AQC A;  2YSZ A;  1ZVR A;  2GCL A;  4KVG B;  4WSF A;  2KGX B;  1MK9 B;  2K2U A;  3M1I B;  3QBV B;  2IYB A;  1BAK A;  5C16 A;  2IFS A;  5D3X A;  1V88 A;  2LG1 A;  1LW3 A;  2D9Y A;  1FGZ A;  1NU2 A;  1W1D A;  1V5P A;  3NSU A;  1U5E A;  1WGU A;  1ZSQ A;  3HQC A;  1DYN A;  1XR0 B;  2UZS A;  1GC6 A;  1UEF A;  5DHF B;  4DXA B;  2V76 A;  2HTH B;  2L2I A;  1GC7 A;  2R0D A;  2D4Q A;  3KSY A;  3ULB A;  3CXB B;  5HE3 A;  4BBK A;  1WI1 A;  2D9W A;  2KCJ A;  1U5F A;  3VIA A;  4HB0 B;  1EF1 A;  2ROZ B;  5JHG A;  5HE0 A;  1XOD A;  2YS5 A;  1B55 A;  2AL6 A;  5KCV A;  1QC6 A;  1U5G A;  2ADZ A;  1RRP B;  2I5F A;  2D9X A;  4NY0 A;  2P8V A;  5CLQ B;  3ML4 A;  4DX8 A;  5FI0 A;  1Y19 B;  3D8D A;  2PZ1 A;  4K17 A;  4PQ0 A;  3GYO A;  1UNP A;  1LB1 A;  4Y94 A;  1K5D B;  1XD4 A;  1FHO A;  1U29 A;  1IRS A;  2I5C A;  2D9V A;  2OTX A;  2Y8G A;  1KI1 B;  3SNH A;  1KZ7 A;  4DBB A;  1DDV A;  1W1H A;  2K00 A;  3D8F A;  5EFX A;  3HK0 A;  1J19 A;  3GYP A;  5CLL B;  1XX0 A;  4WVF B;  4Z2M B;  1NTV A;  2J0M A;  3LJU X;  2W2X C;  2CAY A;  1QQG A;  1U2B A;  3ODO A;  4L6E A;  2M14 A;  4A6H A;  3SV1 A;  1MK7 B;  1XKE A;  2Z0Q A;  2DFK A;  3TO1 A;  4A6F A;  1EVH A;  2MDX A;  1WJM A;  1X05 A;  1WVH A;  1KZG A;  2D11 A;  2RNR B;  3O96 A;  4GMX B;  4K2P A;  2VSZ A;  4GPT B;  1DRO A;  2DHK A;  3IVF A;  1K5G B;  1PLS A;  2I1J A;  4K2O A;  2DHJ A;  2Z0P A;  3A8P A;  5J3Q A;  3CIK A;  1TJ6 A;  2I1K A;  2KUP A;  2CRF A;  2N23 A;  2QKL A;  4GZU A;  4HAV B;  3ZVR A;  1WG7 A;  2LYD A;  4ZRI A;  5C5B A;  1N3H A;  3MDB C;  4YON A;  4XWX A;  1FGY A;  5JLJ B;  3BIN A;  1U5D A;  2YRY A;  2W2W A;  2MFQ A;  4F7H A;  1Z87 A;  5KQ1 A;  2D9Z A;  2GJY A;  1P6S A;  2ZPY A;  2DN6 A;  2YT1 A;  4CYE A;  2M38 A;  1FB8 A;  1BWN A;  3D8E A;  3KRW A;  4HAW B;  4HB4 B;  2YF0 A;  4IFS A;  4MT7 A;  1MIX A;  1GG3 A;  3PVW A;  5D3V A;  1WGQ A;  5GOW B;  4EJN A;  4F7U P;  2LKO A;  5L81 A;  2DHI A;  4MK0 A;  3F5R A;  3TCA A;  2BCJ A;  4DX9 0;  3PSC A;  2MKR A;  2MWN B;  3TFM A;  4CHJ A;  3F0W A;  3DXE A;  1J0W A;  2YT0 A;  2EMT A;  4KHB B;  5C5B B;  4KHA A;  4B6H A;  3DXC A;  2JP2 A;  1MPH A;  1XCG A;  2Y7B A;  2E2X A;  3PVU A;  3P6A A;  4GN1 A;  1H4R A;  1MKE A;  1U27 A;  4ZRK A;  2DYN A;  2EMS A;  1V89 A;  2EC1 A;  1BTN A;  1X1G A;  4H8S A;  2YS3 A;  2ROV A;  3TVV A;  3G9W A;  1UPQ A;  3QIJ A;  3AJ4 A;  2LOX A;  2W2X D;  1P5T A;  1I7A A;  2D2Q A;  4IAP A;  4A5K A;  2DYQ A;  5HE1 A;  2ELA A;  5KQ4 A;  2Q13 A;  3UZT A;  1Y5O A;  3MPX A;  1OMW A;  1E5W A;  3SYX A;  2D10 A;  5D3W A;  5JP4 A;  5DHA B;  1FAO A;  2DX1 A;  5JHH A;  1Q67 A;  5DIF B;  2VRW B;  2COD A;  1NTY A;  2RLO A;  5D3Y A;  3PG7 A;  4PNK A;  1DBH A;  4HAZ B;  4WJ7 A;  4HB3 B;  3TW1 A;  1DDW A;  2DLW A;  2J59 M;  5J3Y A;  1PMS A;  2DKQ A;  1NI2 A;  1V5M A;  2J0J A;  4P7I A;  5LON B;  1SGH A;  2RVB B;  1DDM A;  4HAT B;  2RSG A;  1AWE A;  3U7D A;  2HE7 A;  1MAI A;  3SO6 A;  3T06 A;  1OY2 A;  1UNQ A;  2X18 A;  2GS0 A;  1X1F A;  2GCJ A;  1FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...