1W1GA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1gA00
2I5FA 2DYQA 4EKUA 4HDQA 1Q67A 3AU4A 1PMSA 4F7HA 4MT7A 2YS5A 3A8PA 2P0DA 3SUZA 3CXBB 4PNKA 1ZVRA 3DXDA 1V61A 1BTNA 2COAA 2CY5A 4HAYB 1DYNA 2D9WA 4WJ7A 4K2PA 5FI0A 4CHMA 4GPTB 5LOPB 2AEHA 1ISNA 3SO6A 4ZRIA 2NMBA 1GC7A 2V76A 5HE2A 1DBHA 1KZGA 3O96A 3X23A 1ZM0A 2YT1A 2M38A 2P8VA 1U5FA 2DX5A 3AJ4A 1NTYA 1W1DA 3WA0A 1V89A 3P7ZA 2DHJA 2YVCA 2COFA 2Y8FA 4DXAB 4H8SA 1FHXA 3A8QA 4Z2NA 2D9VA 3PVWA 4P7IA 2YS3A 3TO1A 1ZSQA 2L1CA 2RGNB 2Y8GA 4HB0B 4K17A 1QQGA 3HW2B 2VSZA 1Y19B 2LULA 3KSYA 5C79A 3MDBC 2J0JA 4HDOA 2LOZA 4HHVA 4KHBB 1B55A 4HAVB 4K81A 4GXBA 2AL6A 4F7GA 4MK0A 2COCA 2G35A 1UPQA 4KHOA 2YSZA 1J0WA 1LB1A 5D3VA 1EVHA 3D8EA 1RRPB 2DTCA 4Z2MB 5C16A 1U29A 2DN6A 4NSWA 1XKEA 2GJYA 4HAXB 1MK9B 2Z0OA 3D8DA 2MWNB 5JHHA 5JP4A 1M7RA 1OQNA 2YS1A 2JP2A 3LJUX 3OANA 2ROVA 5J3YA 3QIJA 2RSGA 4B6HA 3PG7A 1DROA 1Z87A 4A6KA 1XCGA 2Q13A 2ZPYA 1U5EA 1EGXA 5DI9B 4HAWB 3HQCA 2K2UA 3MPXA 1FB8A 2HE7A 2DHIA 2NZ8B 3GYPA 4A6FA 1LW3A 1MKEA 2X18A 2IFSA 2M14A 2RUKB 4GN1A 5DH9B 2EC1A 1M7EA 3KRWA 5D27A 3ODXA 3ULBA 2DA0A 4K2OA 1NU2A 2OTXA 2DHKA 5KQ4A 2CAYA 2RVBB 1AWEA 2UZRA 3T06A 4WVFB 4CYEA 1XR0B 2LYDA 2I1KA 3BINA 1TJ6A 3SNHA 1W1GA 2K00A 2GS0A 2D9XA 4DX90 1SHCA 1XX0A 3KY9A 1FGYA 1NTVA 4EJNA 2GCLA 4KHAA 1MAIA 2YT0A 1TXDA 3ZDTA 2KGXB 2DFKA 2PZ1A 5L81A 1TQZA 1UEFA 2DYNA 5C6RA 4ZRJA 4WSFA 2FJLA 1X1FA 2CRFA 1NI2A 4KAXB 1ZC4B 2W2XC 1GG3A 1BAKA 1P5TA 3TW1A 1IRSA 4HAZB 4A6FB 4L6EA 2MKRA 1BTKA 2Z0PA 2UZSA 3UZTA 5GOWB 1AQCA 2I5CA 1WJMA 3N7CA 1WG7A 4IOYX 3FM8C 1OY2A 1H10A 1X11A 1V5PA 5EFXA 1X86A 2EMSA 4HB3B 5DHAB 3RCPA 1V88A 2RLOA 5J3QA 5JHGA 3P6AA 5D3WA 2Z0QA 3ZVRA 3D8FA 1KZ7A 2H7EA 1MIZB 3PEGA 1EAZA 2KCJA 1BWNA 1P6SA 5JLJB 5KCVA 3U8ZA 3PVUA 1ZC3B 4C0AA 5C5BA 2ROZB 3BJIA 4IFSA 2D2QA 1SGHA 3F0WA 4HATB 4TKNA 2DLWA 3SYXA 2P0FA 3PVLA 4HB4B 2ADZA 1FOEA 3F5RA 3HK0A 2J59M 2HTHB 1FAOA 1UNQA 1WGUA 2LKOA 2OQBA 2Y7BA 1RJ2A 2RNRB 3ODWA 2EJ8A 2MDXA 4HAUB 5LONB 3WYFB 4EMOA 2ELBA 2LOXA 2QKMA 4GMXB 5CLLB 4NY0A 4DBBA 1XODA 1GC6A 1MIXA 2MFQA 4GMVA 5DIFB 1WI1A 3FEHA 5HE3A 4Y94A 4YL8A 2L2IA 3PSCA 4IAPA 2EMTA 2GCJA 5CLQB 4BBKA 4TYZA 2J0KA 5C5BB 2N0YA 1I2HA 1WJ1A 1FHOA 3NSUA 5DHFB 1FHWA 2YF0A 3TCAA 1J19A 2D9YA 2P0HA 4D0NB 4HB2B 1MK7B 3KRXA 2J0MA 2CODA 3M1IB 3A98B 2D4QA 3FSSA 1PLSA 3GYOA 3QBVB 1FGZA 1U5DA 3ML4A 1QC6A 2D11A 2ELAA 4MY6A 1V5MA 4DX8A 1X05A 1X1GA 5HE1A 4ZRKA 1U27A 4A6HA 1DDMA 2W2XD 2E2XA 2K2JA 5D3YA 2N23A 3SV1A 1P3RA 2QKLA 3CIKA 2VKIA 1Y5OA 2KUPA 3DXEA 2D9ZA 3IVFA 1EF1A 2UVMA 3V5WA 1UPRA 1H4RA 5KQ1A 1WGQA 1PFJA 2I1JA 3G9WA 3VIAA 3U7DA 2DKQA 3PZDA 4A5KA 1MPHA 1UNPA 1WVHA 3TFMA 3QWMA 1K5DB 2H7DA 2D10A 1I7AA 5FI1A 4KVGB 2YRYA 5HE0A 3ODOA 4CHJA 1K5GB 2XQNM 1DDVA 2DX1A 1OMWA 1XD4A 4PQ0A 1N3HA 1U5GA 3DXCA 1E5WA 5J3TA 3TVVA 2BCJA 5D3XA 3AU5A 4GZUA 1DDWA 4YONA 1KI1B 3ULCA 2R0DA 2VRWB 1U2BA 4XWXA 2CY4A 3PP2A 2LG1A 2R09A 1V5UA 2IYBA 2DKPA 3VOQA 3KZ1A 1W1HA 4F7UP 1UNRA 2W2WA
chains in the Genus database with same CATH superfamily
2I5FA 2DYQA 4EKUA 4HDQA 1Q67A 3AU4A 2Z59A 1PMSA 4F7HA 4MT7A 2YS5A 3A8PA 2P0DA 3SUZA 3CXBB 4PNKA 1ZVRA 3DXDA 5M4YB 1V61A 1BTNA 2COAA 2CY5A 4HAYB 1DYNA 2D9WA 4WJ7A 4K2PA 5FI0A 4CHMA 4GPTB 5LOPB 2AEHA 1ISNA 2KUQA 3SO6A 4ZRIA 2NMBA 1GC7A 2V76A 5HE2A 1DBHA 1KZGA 3O96A 3X23A 1ZM0A 2YT1A 2M38A 2P8VA 1U5FA 2DX5A 2RRFA 2K49A 3AJ4A 1NTYA 1W1DA 3WA0A 1V89A 3P7ZA 2DHJA 2YVCA 2COFA 2Y8FA 4DXAB 4H8SA 1FHXA 3A8QA 4Z2NA 2D9VA 3PVWA 4P7IA 2YS3A 3TO1A 1ZSQA 2KR0A 2L1CA 2KIEA 2RGNB 2Y8GA 5I2MA 4HB0B 4K17A 1QQGA 3HW2B 2VSZA 1Y19B 2LULA 3KSYA 5C79A 3MDBC 1MI1A 2J0JA 4HDOA 2LOZA 4HHVA 4KHBB 1B55A 4HAVB 4K81A 4GXBA 2AL6A 4F7GA 4MK0A 2COCA 2G35A 1UPQA 4KHOA 2YSZA 1J0WA 1LB1A 5D3VA 1EVHA 3D8EA 1RRPB 2DTCA 4Z2MB 5C16A 1U29A 2DN6A 4NSWA 1XKEA 2GJYA 4HAXB 1MK9B 2Z0OA 3D8DA 2MWNB 5JHHA 5JP4A 1M7RA 1OQNA 2YS1A 2JP2A 3LJUX 3OANA 2ROVA 5J3YA 3QIJA 2RSGA 4B6HA 3PG7A 1DROA 1Z87A 4A6KA 1XCGA 2Q13A 2ZPYA 1U5EA 1EGXA 2Z4DA 5DI9B 4HAWB 3HQCA 2K2UA 3MPXA 1FB8A 2HE7A 2DHIA 2NZ8B 3GYPA 4A6FA 1LW3A 1MKEA 2X18A 2IFSA 2M14A 2RUKB 2Z13A 4GN1A 5DH9B 2EC1A 1M7EA 2ZKMX 3KRWA 5D27A 3ODXA 4CSQA 3ULBA 2DA0A 4K2OA 1NU2A 2OTXA 2DHKA 5KQ4A 1T77A 2CAYA 2RVBB 1AWEA 2UZRA 3T06A 4WVFB 4CYEA 1XR0B 2LYDA 2I1KA 3BINA 1TJ6A 3SNHA 1W1GA 2K00A 2GS0A 2D9XA 4DX90 1SHCA 2YT2A 1XX0A 3KY9A 1FGYA 1NTVA 4EJNA 2GCLA 4KHAA 1MAIA 2YT0A 1TXDA 3ZDTA 2KGXB 2GUMA 2DFKA 2PZ1A 5L81A 1TQZA 1UEFA 2DYNA 5C6RA 4ZRJA 4WSFA 2FJLA 1X1FA 2CRFA 3OHMB 1NI2A 4KAXB 1ZC4B 2W2XC 1GG3A 3HIEA 4DIXA 1BAKA 4QJ4B 1P5TA 3TW1A 1IRSA 4HAZB 4A6FB 4L6EA 2MKRA 2Z14A 1BTKA 2Z0PA 2UZSA 3U12A 2R2YA 3UZTA 5GOWB 1AQCA 2I5CA 1WJMA 1WG7A 3N7CA 4IOYX 3FM8C 1OY2A 1H10A 1X11A 1V5PA 5EFXA 1X86A 2EMSA 4HB3B 5DHAB 3RCPA 1V88A 2RLOA 4GOUA 3FVCA 5J3QA 5JHGA 3P6AA 5D3WA 2Z0QA 3ZVRA 3D8FA 1KZ7A 2H7EA 1ZYIA 1MIZB 3PEGA 1EAZA 2KCJA 1BWNA 1P6SA 5JLJB 5KCVA 3U8ZA 4L1RA 3PVUA 1ZC3B 4C0AA 5C5BA 2ROZB 3BJIA 4IFSA 5IRSA 2NBVA 2D2QA 1SGHA 3F0WA 4HATB 4TKNA 2DLWA 3SYXA 2P0FA 3PVLA 4HB4B 2ADZA 1FOEA 3HK0A 3F5RA 2J59M 2HTHB 1FAOA 1UNQA 4GNKB 1WGUA 2LKOA 4QJ5B 2OQBA 2Y7BA 1RJ2A 2RNRB 3ODWA 2EJ8A 2MDXA 4HAUB 5LONB 3WYFB 4EMOA 2ELBA 2KIGA 2LOXA 2QKMA 4GMXB 5CLLB 4NY0A 4DBBA 1XODA 1GC6A 1MIXA 2MFQA 4GMVA 5DIFB 1WI1A 3FEHA 5HE3A 4Y94A 4YL8A 2L2IA 3PSCA 4IAPA 2EMTA 5LG4B 2GCJA 5CLQB 4BBKA 4TYZA 3NWFA 4KHBA 2J0KA 4QJ3B 5C5BB 4OSNA 3B77A 2N0YA 1I2HA 1WJ1A 1FHOA 3NSUA 5DHFB 1FHWA 2YF0A 3TCAA 4HSIA 1J19A 2D9YA 2P0HA 4D0NB 4HB2B 1MK7B 3KRXA 2J0MA 2CODA 3M1IB 3A98B 2D4QA 3FSSA 1PLSA 3GYOA 3QBVB 1FGZA 1U5DA 3ML4A 1QC6A 2D11A 3NWAA 2ELAA 4MY6A 1V5MA 4DX8A 4D6WA 1X05A 1X1GA 5HE1A 3NWDA 4OT1A 4ZRKA 1U27A 3NW8A 4A6HA 1DDMA 2W2XD 2E2XA 2K2JA 5D3YA 2N23A 3SV1A 3DCXA 1P3RA 2QKLA 3CIKA 2VKIA 1Y5OA 2KUPA 3DXEA 2D9ZA 3IVFA 1EF1A 2UVMA 3V5WA 1UPRA 1H4RA 5KQ1A 1WGQA 1PFJA 2I1JA 3G9WA 3VIAA 3HSAA 3U7DA 2DKQA 3PZDA 4A5KA 1MPHA 1UNPA 1WVHA 3TFMA 3QWMA 1K5DB 2H7DA 2D10A 1I7AA 5FI1A 4KVGB 2YRYA 5HE0A 3ODOA 3A58A 4CHJA 1K5GB 2XQNM 1DDVA 2DX1A 1OMWA 1XD4A 4PQ0A 1N3HA 1U5GA 3DXCA 1E5WA 5J3TA 2FJUB 4QXAB 3TVVA 2BCJA 5D3XA 5I2SA 2K8EA 3AU5A 4GZUA 1DDWA 4YONA 1KI1B 3ULCA 2R0DA 2VRWB 1U2BA 4XWXA 2CY4A 3PP2A 2LG1A 2R09A 1V5UA 2IYBA 2DKPA 3VOQA 3KZ1A 1W1HA 4F7UP 1UNRA 2W2WA
chains in the Genus database with same CATH topology
2I5FA 2DYQA 4EKUA 4HDQA 1Q67A 3AU4A 1PMSA 4F7HA 4MT7A 2YS5A 3A8PA 2P0DA 3SUZA 3CXBB 4PNKA 1ZVRA 3DXDA 1V61A 1BTNA 2COAA 2CY5A 4HAYB 1DYNA 2D9WA 4WJ7A 4K2PA 5FI0A 4CHMA 4GPTB 5LOPB 2AEHA 1ISNA 3SO6A 4ZRIA 2NMBA 1GC7A 2V76A 5HE2A 1DBHA 1KZGA 3O96A 3X23A 1ZM0A 2YT1A 2M38A 2P8VA 1U5FA 2DX5A 3AJ4A 1NTYA 1W1DA 3WA0A 1V89A 3P7ZA 2DHJA 2YVCA 2COFA 2Y8FA 4DXAB 4H8SA 1FHXA 3A8QA 4Z2NA 2D9VA 3PVWA 4P7IA 2YS3A 3TO1A 1ZSQA 2L1CA 2RGNB 2Y8GA 4HB0B 4K17A 1QQGA 3HW2B 2VSZA 1Y19B 2LULA 3KSYA 5C79A 3MDBC 2J0JA 4HDOA 2LOZA 4HHVA 4KHBB 1B55A 4HAVB 4K81A 4GXBA 2AL6A 4F7GA 4MK0A 2COCA 2G35A 1UPQA 4KHOA 2YSZA 1J0WA 1LB1A 5D3VA 1EVHA 3D8EA 1RRPB 2DTCA 4Z2MB 5C16A 1U29A 2DN6A 4NSWA 1XKEA 2GJYA 4HAXB 1MK9B 2Z0OA 3D8DA 2MWNB 5JHHA 5JP4A 1M7RA 1OQNA 2YS1A 2JP2A 3LJUX 3OANA 2ROVA 5J3YA 3QIJA 2RSGA 4B6HA 3PG7A 1DROA 1Z87A 4A6KA 1XCGA 2Q13A 2ZPYA 1U5EA 1EGXA 5DI9B 4HAWB 3HQCA 2K2UA 3MPXA 1FB8A 2HE7A 2DHIA 2NZ8B 3GYPA 4A6FA 1LW3A 1MKEA 2X18A 2IFSA 2M14A 2RUKB 4GN1A 5DH9B 2EC1A 1M7EA 3KRWA 5D27A 3ODXA 3ULBA 2DA0A 4K2OA 1NU2A 2OTXA 2DHKA 5KQ4A 2CAYA 2RVBB 1AWEA 2UZRA 3T06A 4WVFB 4CYEA 1XR0B 2LYDA 2I1KA 3BINA 1TJ6A 3SNHA 1W1GA 2K00A 2GS0A 2D9XA 4DX90 1SHCA 1XX0A 3KY9A 1FGYA 1NTVA 4EJNA 2GCLA 4KHAA 1MAIA 2YT0A 1TXDA 3ZDTA 2KGXB 2DFKA 2PZ1A 5L81A 1TQZA 1UEFA 2DYNA 5C6RA 4ZRJA 4WSFA 2FJLA 1X1FA 2CRFA 1NI2A 4KAXB 1ZC4B 2W2XC 1GG3A 1BAKA 1P5TA 3TW1A 1IRSA 4HAZB 4A6FB 4L6EA 2MKRA 1BTKA 2Z0PA 2UZSA 3UZTA 5GOWB 1AQCA 2I5CA 1WJMA 3N7CA 1WG7A 4IOYX 3FM8C 1OY2A 1H10A 1X11A 1V5PA 5EFXA 1X86A 2EMSA 4HB3B 5DHAB 3RCPA 1V88A 2RLOA 5J3QA 5JHGA 3P6AA 5D3WA 2Z0QA 3ZVRA 3D8FA 1KZ7A 2H7EA 1MIZB 3PEGA 1EAZA 2KCJA 1BWNA 1P6SA 5JLJB 5KCVA 3U8ZA 3PVUA 1ZC3B 4C0AA 5C5BA 2ROZB 3BJIA 4IFSA 2D2QA 1SGHA 3F0WA 4HATB 4TKNA 2DLWA 3SYXA 2P0FA 3PVLA 4HB4B 2ADZA 1FOEA 3F5RA 3HK0A 2J59M 2HTHB 1FAOA 1UNQA 1WGUA 2LKOA 2OQBA 2Y7BA 1RJ2A 2RNRB 3ODWA 2EJ8A 2MDXA 4HAUB 5LONB 3WYFB 4EMOA 2ELBA 2LOXA 2QKMA 4GMXB 5CLLB 4NY0A 4DBBA 1XODA 1GC6A 1MIXA 2MFQA 4GMVA 5DIFB 1WI1A 3FEHA 5HE3A 4Y94A 4YL8A 2L2IA 3PSCA 4IAPA 2EMTA 2GCJA 5CLQB 4BBKA 4TYZA 2J0KA 5C5BB 2N0YA 1I2HA 1WJ1A 1FHOA 3NSUA 5DHFB 1FHWA 2YF0A 3TCAA 1J19A 2D9YA 2P0HA 4D0NB 4HB2B 1MK7B 3KRXA 2J0MA 2CODA 3M1IB 3A98B 2D4QA 3FSSA 1PLSA 3GYOA 3QBVB 1FGZA 1U5DA 3ML4A 1QC6A 2D11A 2ELAA 4MY6A 1V5MA 4DX8A 1X05A 1X1GA 5HE1A 4ZRKA 1U27A 4A6HA 1DDMA 2W2XD 2E2XA 2K2JA 5D3YA 2N23A 3SV1A 1P3RA 2QKLA 3CIKA 2VKIA 1Y5OA 2KUPA 3DXEA 2D9ZA 3IVFA 1EF1A 2UVMA 3V5WA 1UPRA 1H4RA 5KQ1A 1WGQA 1PFJA 2I1JA 3G9WA 3VIAA 3U7DA 2DKQA 3PZDA 4A5KA 1MPHA 1UNPA 1WVHA 3TFMA 3QWMA 1K5DB 2H7DA 2D10A 1I7AA 5FI1A 4KVGB 2YRYA 5HE0A 3ODOA 4CHJA 1K5GB 2XQNM 1DDVA 2DX1A 1OMWA 1XD4A 4PQ0A 1N3HA 1U5GA 3DXCA 1E5WA 5J3TA 3TVVA 2BCJA 5D3XA 3AU5A 4GZUA 1DDWA 4YONA 1KI1B 3ULCA 2R0DA 2VRWB 1U2BA 4XWXA 2CY4A 3PP2A 2LG1A 2R09A 1V5UA 2IYBA 2DKPA 3VOQA 3KZ1A 1W1HA 4F7UP 1UNRA 2W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  2DYQ A;  4EKU A;  4HDQ A;  1Q67 A;  3AU4 A;  1PMS A;  4F7H A;  4MT7 A;  2YS5 A;  3A8P A;  2P0D A;  3SUZ A;  3CXB B;  4PNK A;  1ZVR A;  3DXD A;  1V61 A;  1BTN A;  2COA A;  2CY5 A;  4HAY B;  1DYN A;  2D9W A;  4WJ7 A;  4K2P A;  5FI0 A;  4CHM A;  4GPT B;  5LOP B;  2AEH A;  1ISN A;  3SO6 A;  4ZRI A;  2NMB A;  1GC7 A;  2V76 A;  5HE2 A;  1DBH A;  1KZG A;  3O96 A;  3X23 A;  1ZM0 A;  2YT1 A;  2M38 A;  2P8V A;  1U5F A;  2DX5 A;  3AJ4 A;  1NTY A;  1W1D A;  3WA0 A;  1V89 A;  3P7Z A;  2DHJ A;  2YVC A;  2COF A;  2Y8F A;  4DXA B;  4H8S A;  1FHX A;  3A8Q A;  4Z2N A;  2D9V A;  3PVW A;  4P7I A;  2YS3 A;  3TO1 A;  1ZSQ A;  2L1C A;  2RGN B;  2Y8G A;  4HB0 B;  4K17 A;  1QQG A;  3HW2 B;  2VSZ A;  1Y19 B;  2LUL A;  3KSY A;  5C79 A;  3MDB C;  2J0J A;  4HDO A;  2LOZ A;  4HHV A;  4KHB B;  1B55 A;  4HAV B;  4K81 A;  4GXB A;  2AL6 A;  4F7G A;  4MK0 A;  2COC A;  2G35 A;  1UPQ A;  4KHO A;  2YSZ A;  1J0W A;  1LB1 A;  5D3V A;  1EVH A;  3D8E A;  1RRP B;  2DTC A;  4Z2M B;  5C16 A;  1U29 A;  2DN6 A;  4NSW A;  1XKE A;  2GJY A;  4HAX B;  1MK9 B;  2Z0O A;  3D8D A;  2MWN B;  5JHH A;  5JP4 A;  1M7R A;  1OQN A;  2YS1 A;  2JP2 A;  3LJU X;  3OAN A;  2ROV A;  5J3Y A;  3QIJ A;  2RSG A;  4B6H A;  3PG7 A;  1DRO A;  1Z87 A;  4A6K A;  1XCG A;  2Q13 A;  2ZPY A;  1U5E A;  1EGX A;  5DI9 B;  4HAW B;  3HQC A;  2K2U A;  3MPX A;  1FB8 A;  2HE7 A;  2DHI A;  2NZ8 B;  3GYP A;  4A6F A;  1LW3 A;  1MKE A;  2X18 A;  2IFS A;  2M14 A;  2RUK B;  4GN1 A;  5DH9 B;  2EC1 A;  1M7E A;  3KRW A;  5D27 A;  3ODX A;  3ULB A;  2DA0 A;  4K2O A;  1NU2 A;  2OTX A;  2DHK A;  5KQ4 A;  2CAY A;  2RVB B;  1AWE A;  2UZR A;  3T06 A;  4WVF B;  4CYE A;  1XR0 B;  2LYD A;  2I1K A;  3BIN A;  1TJ6 A;  3SNH A;  1W1G A;  2K00 A;  2GS0 A;  2D9X A;  4DX9 0;  1SHC A;  1XX0 A;  3KY9 A;  1FGY A;  1NTV A;  4EJN A;  2GCL A;  4KHA A;  1MAI A;  2YT0 A;  1TXD A;  3ZDT A;  2KGX B;  2DFK A;  2PZ1 A;  5L81 A;  1TQZ A;  1UEF A;  2DYN A;  5C6R A;  4ZRJ A;  4WSF A;  2FJL A;  1X1F A;  2CRF A;  1NI2 A;  4KAX B;  1ZC4 B;  2W2X C;  1GG3 A;  1BAK A;  1P5T A;  3TW1 A;  1IRS A;  4HAZ B;  4A6F B;  4L6E A;  2MKR A;  1BTK A;  2Z0P A;  2UZS A;  3UZT A;  5GOW B;  1AQC A;  2I5C A;  1WJM A;  3N7C A;  1WG7 A;  4IOY X;  3FM8 C;  1OY2 A;  1H10 A;  1X11 A;  1V5P A;  5EFX A;  1X86 A;  2EMS A;  4HB3 B;  5DHA B;  3RCP A;  1V88 A;  2RLO A;  5J3Q A;  5JHG A;  3P6A A;  5D3W A;  2Z0Q A;  3ZVR A;  3D8F A;  1KZ7 A;  2H7E A;  1MIZ B;  3PEG A;  1EAZ A;  2KCJ A;  1BWN A;  1P6S A;  5JLJ B;  5KCV A;  3U8Z A;  3PVU A;  1ZC3 B;  4C0A A;  5C5B A;  2ROZ B;  3BJI A;  4IFS A;  2D2Q A;  1SGH A;  3F0W A;  4HAT B;  4TKN A;  2DLW A;  3SYX A;  2P0F A;  3PVL A;  4HB4 B;  2ADZ A;  1FOE A;  3F5R A;  3HK0 A;  2J59 M;  2HTH B;  1FAO A;  1UNQ A;  1WGU A;  2LKO A;  2OQB A;  2Y7B A;  1RJ2 A;  2RNR B;  3ODW A;  2EJ8 A;  2MDX A;  4HAU B;  5LON B;  3WYF B;  4EMO A;  2ELB A;  2LOX A;  2QKM A;  4GMX B;  5CLL B;  4NY0 A;  4DBB A;  1XOD A;  1GC6 A;  1MIX A;  2MFQ A;  4GMV A;  5DIF B;  1WI1 A;  3FEH A;  5HE3 A;  4Y94 A;  4YL8 A;  2L2I A;  3PSC A;  4IAP A;  2EMT A;  2GCJ A;  5CLQ B;  4BBK A;  4TYZ A;  2J0K A;  5C5B B;  2N0Y A;  1I2H A;  1WJ1 A;  1FHO A;  3NSU A;  5DHF B;  1FHW A;  2YF0 A;  3TCA A;  1J19 A;  2D9Y A;  2P0H A;  4D0N B;  4HB2 B;  1MK7 B;  3KRX A;  2J0M A;  2COD A;  3M1I B;  3A98 B;  2D4Q A;  3FSS A;  1PLS A;  3GYO A;  3QBV B;  1FGZ A;  1U5D A;  3ML4 A;  1QC6 A;  2D11 A;  2ELA A;  4MY6 A;  1V5M A;  4DX8 A;  1X05 A;  1X1G A;  5HE1 A;  4ZRK A;  1U27 A;  4A6H A;  1DDM A;  2W2X D;  2E2X A;  2K2J A;  5D3Y A;  2N23 A;  3SV1 A;  1P3R A;  2QKL A;  3CIK A;  2VKI A;  1Y5O A;  2KUP A;  3DXE A;  2D9Z A;  3IVF A;  1EF1 A;  2UVM A;  3V5W A;  1UPR A;  1H4R A;  5KQ1 A;  1WGQ A;  1PFJ A;  2I1J A;  3G9W A;  3VIA A;  3U7D A;  2DKQ A;  3PZD A;  4A5K A;  1MPH A;  1UNP A;  1WVH A;  3TFM A;  3QWM A;  1K5D B;  2H7D A;  2D10 A;  1I7A A;  5FI1 A;  4KVG B;  2YRY A;  5HE0 A;  3ODO A;  4CHJ A;  1K5G B;  2XQN M;  1DDV A;  2DX1 A;  1OMW A;  1XD4 A;  4PQ0 A;  1N3H A;  1U5G A;  3DXC A;  1E5W A;  5J3T A;  3TVV A;  2BCJ A;  5D3X A;  3AU5 A;  4GZU A;  1DDW A;  4YON A;  1KI1 B;  3ULC A;  2R0D A;  2VRW B;  1U2B A;  4XWX A;  2CY4 A;  3PP2 A;  2LG1 A;  2R09 A;  1V5U A;  2IYB A;  2DKP A;  3VOQ A;  3KZ1 A;  1W1H A;  4F7U P;  1UNR A;  2W2W A; 
#chains in the Genus database with same CATH topology
 2I5F A;  2DYQ A;  4EKU A;  4HDQ A;  1Q67 A;  3AU4 A;  2Z59 A;  1PMS A;  4F7H A;  4MT7 A;  2YS5 A;  3A8P A;  2P0D A;  3SUZ A;  3CXB B;  4PNK A;  1ZVR A;  3DXD A;  5M4Y B;  1V61 A;  1BTN A;  2COA A;  2CY5 A;  4HAY B;  1DYN A;  2D9W A;  4WJ7 A;  4K2P A;  5FI0 A;  4CHM A;  4GPT B;  5LOP B;  2AEH A;  1ISN A;  2KUQ A;  3SO6 A;  4ZRI A;  2NMB A;  1GC7 A;  2V76 A;  5HE2 A;  1DBH A;  1KZG A;  3O96 A;  3X23 A;  1ZM0 A;  2YT1 A;  2M38 A;  2P8V A;  1U5F A;  2DX5 A;  2RRF A;  2K49 A;  3AJ4 A;  1NTY A;  1W1D A;  3WA0 A;  1V89 A;  3P7Z A;  2DHJ A;  2YVC A;  2COF A;  2Y8F A;  4DXA B;  4H8S A;  1FHX A;  3A8Q A;  4Z2N A;  2D9V A;  3PVW A;  4P7I A;  2YS3 A;  3TO1 A;  1ZSQ A;  2KR0 A;  2L1C A;  2KIE A;  2RGN B;  2Y8G A;  5I2M A;  4HB0 B;  4K17 A;  1QQG A;  3HW2 B;  2VSZ A;  1Y19 B;  2LUL A;  3KSY A;  5C79 A;  3MDB C;  1MI1 A;  2J0J A;  4HDO A;  2LOZ A;  4HHV A;  4KHB B;  1B55 A;  4HAV B;  4K81 A;  4GXB A;  2AL6 A;  4F7G A;  4MK0 A;  2COC A;  2G35 A;  1UPQ A;  4KHO A;  2YSZ A;  1J0W A;  1LB1 A;  5D3V A;  1EVH A;  3D8E A;  1RRP B;  2DTC A;  4Z2M B;  5C16 A;  1U29 A;  2DN6 A;  4NSW A;  1XKE A;  2GJY A;  4HAX B;  1MK9 B;  2Z0O A;  3D8D A;  2MWN B;  5JHH A;  5JP4 A;  1M7R A;  1OQN A;  2YS1 A;  2JP2 A;  3LJU X;  3OAN A;  2ROV A;  5J3Y A;  3QIJ A;  2RSG A;  4B6H A;  3PG7 A;  1DRO A;  1Z87 A;  4A6K A;  1XCG A;  2Q13 A;  2ZPY A;  1U5E A;  1EGX A;  2Z4D A;  5DI9 B;  4HAW B;  3HQC A;  2K2U A;  3MPX A;  1FB8 A;  2HE7 A;  2DHI A;  2NZ8 B;  3GYP A;  4A6F A;  1LW3 A;  1MKE A;  2X18 A;  2IFS A;  2M14 A;  2RUK B;  2Z13 A;  4GN1 A;  5DH9 B;  2EC1 A;  1M7E A;  2ZKM X;  3KRW A;  5D27 A;  3ODX A;  4CSQ A;  3ULB A;  2DA0 A;  4K2O A;  1NU2 A;  2OTX A;  2DHK A;  5KQ4 A;  1T77 A;  2CAY A;  2RVB B;  1AWE A;  2UZR A;  3T06 A;  4WVF B;  4CYE A;  1XR0 B;  2LYD A;  2I1K A;  3BIN A;  1TJ6 A;  3SNH A;  1W1G A;  2K00 A;  2GS0 A;  2D9X A;  4DX9 0;  1SHC A;  2YT2 A;  1XX0 A;  3KY9 A;  1FGY A;  1NTV A;  4EJN A;  2GCL A;  4KHA A;  1MAI A;  2YT0 A;  1TXD A;  3ZDT A;  2KGX B;  2GUM A;  2DFK A;  2PZ1 A;  5L81 A;  1TQZ A;  1UEF A;  2DYN A;  5C6R A;  4ZRJ A;  4WSF A;  2FJL A;  1X1F A;  2CRF A;  3OHM B;  1NI2 A;  4KAX B;  1ZC4 B;  2W2X C;  1GG3 A;  3HIE A;  4DIX A;  1BAK A;  4QJ4 B;  1P5T A;  3TW1 A;  1IRS A;  4HAZ B;  4A6F B;  4L6E A;  2MKR A;  2Z14 A;  1BTK A;  2Z0P A;  2UZS A;  3U12 A;  2R2Y A;  3UZT A;  5GOW B;  1AQC A;  2I5C A;  1WJM A;  1WG7 A;  3N7C A;  4IOY X;  3FM8 C;  1OY2 A;  1H10 A;  1X11 A;  1V5P A;  5EFX A;  1X86 A;  2EMS A;  4HB3 B;  5DHA B;  3RCP A;  1V88 A;  2RLO A;  4GOU A;  3FVC A;  5J3Q A;  5JHG A;  3P6A A;  5D3W A;  2Z0Q A;  3ZVR A;  3D8F A;  1KZ7 A;  2H7E A;  1ZYI A;  1MIZ B;  3PEG A;  1EAZ A;  2KCJ A;  1BWN A;  1P6S A;  5JLJ B;  5KCV A;  3U8Z A;  4L1R A;  3PVU A;  1ZC3 B;  4C0A A;  5C5B A;  2ROZ B;  3BJI A;  4IFS A;  5IRS A;  2NBV A;  2D2Q A;  1SGH A;  3F0W A;  4HAT B;  4TKN A;  2DLW A;  3SYX A;  2P0F A;  3PVL A;  4HB4 B;  2ADZ A;  1FOE A;  3HK0 A;  3F5R A;  2J59 M;  2HTH B;  1FAO A;  1UNQ A;  4GNK B;  1WGU A;  2LKO A;  4QJ5 B;  2OQB A;  2Y7B A;  1RJ2 A;  2RNR B;  3ODW A;  2EJ8 A;  2MDX A;  4HAU B;  5LON B;  3WYF B;  4EMO A;  2ELB A;  2KIG A;  2LOX A;  2QKM A;  4GMX B;  5CLL B;  4NY0 A;  4DBB A;  1XOD A;  1GC6 A;  1MIX A;  2MFQ A;  4GMV A;  5DIF B;  1WI1 A;  3FEH A;  5HE3 A;  4Y94 A;  4YL8 A;  2L2I A;  3PSC A;  4IAP A;  2EMT A;  5LG4 B;  2GCJ A;  5CLQ B;  4BBK A;  4TYZ A;  3NWF A;  4KHB A;  2J0K A;  4QJ3 B;  5C5B B;  4OSN A;  3B77 A;  2N0Y A;  1I2H A;  1WJ1 A;  1FHO A;  3NSU A;  5DHF B;  1FHW A;  2YF0 A;  3TCA A;  4HSI A;  1J19 A;  2D9Y A;  2P0H A;  4D0N B;  4HB2 B;  1MK7 B;  3KRX A;  2J0M A;  2COD A;  3M1I B;  3A98 B;  2D4Q A;  3FSS A;  1PLS A;  3GYO A;  3QBV B;  1FGZ A;  1U5D A;  3ML4 A;  1QC6 A;  2D11 A;  3NWA A;  2ELA A;  4MY6 A;  1V5M A;  4DX8 A;  4D6W A;  1X05 A;  1X1G A;  5HE1 A;  3NWD A;  4OT1 A;  4ZRK A;  1U27 A;  3NW8 A;  4A6H A;  1DDM A;  2W2X D;  2E2X A;  2K2J A;  5D3Y A;  2N23 A;  3SV1 A;  3DCX A;  1P3R A;  2QKL A;  3CIK A;  2VKI A;  1Y5O A;  2KUP A;  3DXE A;  2D9Z A;  3IVF A;  1EF1 A;  2UVM A;  3V5W A;  1UPR A;  1H4R A;  5KQ1 A;  1WGQ A;  1PFJ A;  2I1J A;  3G9W A;  3VIA A;  3HSA A;  3U7D A;  2DKQ A;  3PZD A;  4A5K A;  1MPH A;  1UNP A;  1WVH A;  3TFM A;  3QWM A;  1K5D B;  2H7D A;  2D10 A;  1I7A A;  5FI1 A;  4KVG B;  2YRY A;  5HE0 A;  3ODO A;  3A58 A;  4CHJ A;  1K5G B;  2XQN M;  1DDV A;  2DX1 A;  1OMW A;  1XD4 A;  4PQ0 A;  1N3H A;  1U5G A;  3DXC A;  1E5W A;  5J3T A;  2FJU B;  4QXA B;  3TVV A;  2BCJ A;  5D3X A;  5I2S A;  2K8E A;  3AU5 A;  4GZU A;  1DDW A;  4YON A;  1KI1 B;  3ULC A;  2R0D A;  2VRW B;  1U2B A;  4XWX A;  2CY4 A;  3PP2 A;  2LG1 A;  2R09 A;  1V5U A;  2IYB A;  2DKP A;  3VOQ A;  3KZ1 A;  1W1H A;  4F7U P;  1UNR A;  2W2W A; 
#chains in the Genus database with same CATH homology
 2I5F A;  2DYQ A;  4EKU A;  4HDQ A;  1Q67 A;  3AU4 A;  1PMS A;  4F7H A;  4MT7 A;  2YS5 A;  3A8P A;  2P0D A;  3SUZ A;  3CXB B;  4PNK A;  1ZVR A;  3DXD A;  1V61 A;  1BTN A;  2COA A;  2CY5 A;  4HAY B;  1DYN A;  2D9W A;  4WJ7 A;  4K2P A;  5FI0 A;  4CHM A;  4GPT B;  5LOP B;  2AEH A;  1ISN A;  3SO6 A;  4ZRI A;  2NMB A;  1GC7 A;  2V76 A;  5HE2 A;  1DBH A;  1KZG A;  3O96 A;  3X23 A;  1ZM0 A;  2YT1 A;  2M38 A;  2P8V A;  1U5F A;  2DX5 A;  3AJ4 A;  1NTY A;  1W1D A;  3WA0 A;  1V89 A;  3P7Z A;  2DHJ A;  2YVC A;  2COF A;  2Y8F A;  4DXA B;  4H8S A;  1FHX A;  3A8Q A;  4Z2N A;  2D9V A;  3PVW A;  4P7I A;  2YS3 A;  3TO1 A;  1ZSQ A;  2L1C A;  2RGN B;  2Y8G A;  4HB0 B;  4K17 A;  1QQG A;  3HW2 B;  2VSZ A;  1Y19 B;  2LUL A;  3KSY A;  5C79 A;  3MDB C;  2J0J A;  4HDO A;  2LOZ A;  4HHV A;  4KHB B;  1B55 A;  4HAV B;  4K81 A;  4GXB A;  2AL6 A;  4F7G A;  4MK0 A;  2COC A;  2G35 A;  1UPQ A;  4KHO A;  2YSZ A;  1J0W A;  1LB1 A;  5D3V A;  1EVH A;  3D8E A;  1RRP B;  2DTC A;  4Z2M B;  5C16 A;  1U29 A;  2DN6 A;  4NSW A;  1XKE A;  2GJY A;  4HAX B;  1MK9 B;  2Z0O A;  3D8D A;  2MWN B;  5JHH A;  5JP4 A;  1M7R A;  1OQN A;  2YS1 A;  2JP2 A;  3LJU X;  3OAN A;  2ROV A;  5J3Y A;  3QIJ A;  2RSG A;  4B6H A;  3PG7 A;  1DRO A;  1Z87 A;  4A6K A;  1XCG A;  2Q13 A;  2ZPY A;  1U5E A;  1EGX A;  5DI9 B;  4HAW B;  3HQC A;  2K2U A;  3MPX A;  1FB8 A;  2HE7 A;  2DHI A;  2NZ8 B;  3GYP A;  4A6F A;  1LW3 A;  1MKE A;  2X18 A;  2IFS A;  2M14 A;  2RUK B;  4GN1 A;  5DH9 B;  2EC1 A;  1M7E A;  3KRW A;  5D27 A;  3ODX A;  3ULB A;  2DA0 A;  4K2O A;  1NU2 A;  2OTX A;  2DHK A;  5KQ4 A;  2CAY A;  2RVB B;  1AWE A;  2UZR A;  3T06 A;  4WVF B;  4CYE A;  1XR0 B;  2LYD A;  2I1K A;  3BIN A;  1TJ6 A;  3SNH A;  1W1G A;  2K00 A;  2GS0 A;  2D9X A;  4DX9 0;  1SHC A;  1XX0 A;  3KY9 A;  1FGY A;  1NTV A;  4EJN A;  2GCL A;  4KHA A;  1MAI A;  2YT0 A;  1TXD A;  3ZDT A;  2KGX B;  2DFK A;  2PZ1 A;  5L81 A;  1TQZ A;  1UEF A;  2DYN A;  5C6R A;  4ZRJ A;  4WSF A;  2FJL A;  1X1F A;  2CRF A;  1NI2 A;  4KAX B;  1ZC4 B;  2W2X C;  1GG3 A;  1BAK A;  1P5T A;  3TW1 A;  1IRS A;  4HAZ B;  4A6F B;  4L6E A;  2MKR A;  1BTK A;  2Z0P A;  2UZS A;  3UZT A;  5GOW B;  1AQC A;  2I5C A;  1WJM A;  3N7C A;  1WG7 A;  4IOY X;  3FM8 C;  1OY2 A;  1H10 A;  1X11 A;  1V5P A;  5EFX A;  1X86 A;  2EMS A;  4HB3 B;  5DHA B;  3RCP A;  1V88 A;  2RLO A;  5J3Q A;  5JHG A;  3P6A A;  5D3W A;  2Z0Q A;  3ZVR A;  3D8F A;  1KZ7 A;  2H7E A;  1MIZ B;  3PEG A;  1EAZ A;  2KCJ A;  1BWN A;  1P6S A;  5JLJ B;  5KCV A;  3U8Z A;  3PVU A;  1ZC3 B;  4C0A A;  5C5B A;  2ROZ B;  3BJI A;  4IFS A;  2D2Q A;  1SGH A;  3F0W A;  4HAT B;  4TKN A;  2DLW A;  3SYX A;  2P0F A;  3PVL A;  4HB4 B;  2ADZ A;  1FOE A;  3F5R A;  3HK0 A;  2J59 M;  2HTH B;  1FAO A;  1UNQ A;  1WGU A;  2LKO A;  2OQB A;  2Y7B A;  1RJ2 A;  2RNR B;  3ODW A;  2EJ8 A;  2MDX A;  4HAU B;  5LON B;  3WYF B;  4EMO A;  2ELB A;  2LOX A;  2QKM A;  4GMX B;  5CLL B;  4NY0 A;  4DBB A;  1XOD A;  1GC6 A;  1MIX A;  2MFQ A;  4GMV A;  5DIF B;  1WI1 A;  3FEH A;  5HE3 A;  4Y94 A;  4YL8 A;  2L2I A;  3PSC A;  4IAP A;  2EMT A;  2GCJ A;  5CLQ B;  4BBK A;  4TYZ A;  2J0K A;  5C5B B;  2N0Y A;  1I2H A;  1WJ1 A;  1FHO A;  3NSU A;  5DHF B;  1FHW A;  2YF0 A;  3TCA A;  1J19 A;  2D9Y A;  2P0H A;  4D0N B;  4HB2 B;  1MK7 B;  3KRX A;  2J0M A;  2COD A;  3M1I B;  3A98 B;  2D4Q A;  3FSS A;  1PLS A;  3GYO A;  3QBV B;  1FGZ A;  1U5D A;  3ML4 A;  1QC6 A;  2D11 A;  2ELA A;  4MY6 A;  1V5M A;  4DX8 A;  1X05 A;  1X1G A;  5HE1 A;  4ZRK A;  1U27 A;  4A6H A;  1DDM A;  2W2X D;  2E2X A;  2K2J A;  5D3Y A;  2N23 A;  3SV1 A;  1P3R A;  2QKL A;  3CIK A;  2VKI A;  1Y5O A;  2KUP A;  3DXE A;  2D9Z A;  3IVF A;  1EF1 A;  2UVM A;  3V5W A;  1UPR A;  1H4R A;  5KQ1 A;  1WGQ A;  1PFJ A;  2I1J A;  3G9W A;  3VIA A;  3U7D A;  2DKQ A;  3PZD A;  4A5K A;  1MPH A;  1UNP A;  1WVH A;  3TFM A;  3QWM A;  1K5D B;  2H7D A;  2D10 A;  1I7A A;  5FI1 A;  4KVG B;  2YRY A;  5HE0 A;  3ODO A;  4CHJ A;  1K5G B;  2XQN M;  1DDV A;  2DX1 A;  1OMW A;  1XD4 A;  4PQ0 A;  1N3H A;  1U5G A;  3DXC A;  1E5W A;  5J3T A;  3TVV A;  2BCJ A;  5D3X A;  3AU5 A;  4GZU A;  1DDW A;  4YON A;  1KI1 B;  3ULC A;  2R0D A;  2VRW B;  1U2B A;  4XWX A;  2CY4 A;  3PP2 A;  2LG1 A;  2R09 A;  1V5U A;  2IYB A;  2DKP A;  3VOQ A;  3KZ1 A;  1W1H A;  4F7U P;  1UNR A;  2W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...