1W1GA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 40
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1gA00
2LOZA 2D9YA 3A8PA 2COFA 2LKOA 2YS1A 3TO1A 5D3YA 1NTVA 4IOYX 2M38A 5DI9B 3D8FA 4NY0A 4HDQA 3AJ4A 2W2XC 2EC1A 3TVVA 3UZTA 1U5EA 1J0WA 4Y94A 4F7GA 1U27A 4DBBA 1Y5OA 1GC7A 1BTKA 5DHAB 4B6HA 4HB2B 2K2JA 1ZSQA 1X05A 2IFSA 2COAA 2OQBA 1RJ2A 2NZ8B 2J0KA 4F7UP 1PLSA 2I1KA 1WVHA 4HAXB 1FOEA 1UPQA 1XX0A 3D8EA 5CLQB 1TXDA 4GN1A 5GOWB 1UPRA 1X86A 2RNRB 4MT7A 2ROVA 5KQ1A 2D2QA 4KHOA 2RLOA 3PVLA 5D3XA 1KZGA 2ROZB 2VSZA 3DXEA 4TYZA 5HE1A 3HQCA 2UZSA 1WGUA 2HE7A 1Q67A 1NI2A 2M14A 4HAYB 1GC6A 3PP2A 1RRPB 5J3YA 1MAIA 2V76A 1DYNA 5L81A 2YT1A 5HE0A 1FHOA 1EGXA 3RCPA 1PMSA 2CRFA 1OY2A 1I2HA 2KGXB 1TJ6A 1XODA 3FSSA 3BINA 1U5FA 2DX5A 2MWNB 4Z2MB 4WJ7A 1MIXA 4GZUA 5KQ4A 4BBKA 3ZVRA 4WVFB 4IFSA 1ISNA 2DHKA 1WI1A 1KI1B 5DH9B 4A6HA 1NTYA 3FEHA 4HB0B 2VRWB 1QC6A 1WGQA 2N0YA 3NSUA 1ZVRA 2AEHA 2LG1A 1MPHA 3P7ZA 2J59M 1FGYA 4GMXB 3ODWA 2Z0QA 2LOXA 2RUKB 3WA0A 1M7RA 1V88A 3TFMA 1SHCA 3KRWA 3KRXA 3QBVB 4H8SA 5EFXA 1V5PA 4YL8A 1I7AA 2DHJA 4A6KA 2EJ8A 5J3TA 3G9WA 2JP2A 3SUZA 3MDBC 4ZRKA 3F5RA 3IVFA 1U5DA 2D9WA 4ZRIA 1EAZA 4CHJA 1XD4A 4HAUB 3T06A 4WSFA 2R0DA 4CHMA 1P5TA 1MK9B 2YS5A 3ODOA 4DX90 4HAWB 1EVHA 2DN6A 2YVCA 1EF1A 4PQ0A 3PVWA 1AWEA 1H10A 1UEFA 5D3VA 2Y7BA 5DHFB 2OTXA 1V5UA 4XWXA 1LB1A 2VKIA 3KSYA 1W1GA 1WJ1A 1BTNA 2RGNB 5D27A 2DKQA 2EMSA 2COCA 3V5WA 2YF0A 4HB3B 1WJMA 3PG7A 2RVBB 3OANA 4DX8A 5LONB 2Y8FA 1OQNA 2G35A 1V89A 1B55A 3ML4A 4KHBB 1DDVA 4A5KA 4KAXB 1X1GA 3A98B 3KZ1A 3ULCA 5C79A 1FGZA 1DROA 2D4QA 3PZDA 2K2UA 2DFKA 4GXBA 2I1JA 2P8VA 2PZ1A 4CYEA 2H7EA 2DX1A 4F7HA 2N23A 1ZC4B 1K5GB 1W1DA 2P0FA 2YSZA 1NU2A 3P6AA 2XQNM 5CLLB 3LJUX 5D3WA 1AQCA 2D11A 4HATB 4HAZB 1V61A 4K2OA 1P3RA 1U5GA 2FJLA 1FHWA 3HK0A 1WG7A 1FAOA 2P0DA 1E5WA 5C5BB 3X23A 3ODXA 1UNPA 3AU5A 1UNRA 2LULA 1M7EA 5C6RA 1BAKA 2LYDA 2NMBA 2IYBA 1Y19B 4EKUA 4EJNA 2W2XD 3QIJA 3FM8C 3U7DA 2DKPA 3GYOA 1QQGA 2W2WA 1U29A 2D9VA 4TKNA 4MY6A 1BWNA 3CIKA 1GG3A 1PFJA 3AU4A 2Z0OA 4HHVA 2KUPA 1ZC3B 3PSCA 2R09A 1MK7B 2Z0PA 1W1HA 2DA0A 2RSGA 4ZRJA 1IRSA 1K5DB 3MPXA 2ELBA 4Z2NA 2DLWA 1U2BA 3ULBA 5C16A 2D10A 1SGHA 2I5CA 1DBHA 4HDOA 3PEGA 1XR0B 2AL6A 4D0NB 2K00A 3QWMA 5DIFB 4DXAB 5LOPB 2Q13A 1DDMA 2E2XA 1FB8A 2QKMA 2MDXA 2J0JA 5HE3A 2CY5A 1N3HA 3D8DA 2CAYA 3TW1A 2I5FA 2D9ZA 5HE2A 2UVMA 2BCJA 5JHGA 2P0HA 2YRYA 4K17A 3CXBB 5C5BA 4PNKA 1ZM0A 4NSWA 3SV1A 3BJIA 1XKEA 4K81A 4HB4B 2ZPYA 3VOQA 3F0WA 3DXCA 1UNQA 2DYNA 1J19A 2GCJA 2QKLA 2DTCA 3O96A 1DDWA 2KCJA 3SO6A 3HW2B 3N7CA 2J0MA 3SNHA 4P7IA 3A8QA 3DXDA 1H4RA 4EMOA 4KHAA 2GS0A 1MKEA 4C0AA 2D9XA 2L1CA 4L6EA 4K2PA 1OMWA 1V5MA 3ZDTA 2L2IA 4GPTB 4HAVB 2DYQA 5JP4A 3M1IB 2EMTA 3KY9A 5FI0A 1LW3A 2X18A 2Y8GA 3GYPA 3SYXA 2DHIA 5FI1A 2GJYA 1TQZA 2ELAA 4YONA 4KVGB 1P6SA 4MK0A 5JHHA 2UZRA 3TCAA 3VIAA 2CY4A 2CODA 2YT0A 2HTHB 5JLJB 2YS3A 2ADZA 5J3QA 1FHXA 1MIZB 1Z87A 3PVUA 4GMVA 4IAPA 1X11A 2MKRA 4A6FB 3WYFB 2MFQA 1KZ7A 1XCGA 1X1FA 2GCLA 5KCVA 3U8ZA 2H7DA 4A6FA
chains in the Genus database with same CATH superfamily
2LOZA 2D9YA 3A8PA 2COFA 2LKOA 2YS1A 3TO1A 5D3YA 1NTVA 4IOYX 2M38A 5DI9B 3D8FA 4NY0A 4HDQA 3AJ4A 2FJUB 2W2XC 2EC1A 3TVVA 3UZTA 1U5EA 1J0WA 3DCXA 4Y94A 4F7GA 1U27A 4DBBA 1Y5OA 1GC7A 1BTKA 5DHAB 4B6HA 4HB2B 2K2JA 1ZSQA 1X05A 2Z13A 4L1RA 2IFSA 2COAA 2OQBA 1RJ2A 2NZ8B 2J0KA 4F7UP 1PLSA 2I1KA 1WVHA 4HAXB 1FOEA 1UPQA 1XX0A 3D8EA 4D6WA 5CLQB 1TXDA 4GN1A 5GOWB 1UPRA 1X86A 2RNRB 4MT7A 2ROVA 5KQ1A 2D2QA 4KHOA 2RLOA 3PVLA 5D3XA 1KZGA 2ROZB 2VSZA 3DXEA 4TYZA 5HE1A 3HQCA 2UZSA 1WGUA 2HE7A 1Q67A 1NI2A 2M14A 4HAYB 1GC6A 3PP2A 1RRPB 5J3YA 1MAIA 2V76A 1DYNA 5L81A 2YT1A 2NBVA 5HE0A 1FHOA 1EGXA 3RCPA 2Z14A 1PMSA 2CRFA 1OY2A 1I2HA 2KGXB 1TJ6A 1XODA 3FSSA 3BINA 1U5FA 2DX5A 2MWNB 4Z2MB 4WJ7A 1MIXA 4GZUA 2GUMA 5KQ4A 4BBKA 3ZVRA 4WVFB 4IFSA 1ISNA 2DHKA 1ZYIA 1WI1A 1KI1B 5DH9B 4A6HA 1NTYA 3FEHA 4HB0B 2VRWB 1QC6A 1WGQA 2N0YA 3NSUA 1ZVRA 2AEHA 2LG1A 1MPHA 4QJ4B 3P7ZA 5I2SA 2J59M 1FGYA 4GMXB 3ODWA 2Z0QA 2LOXA 2RUKB 3WA0A 1M7RA 1V88A 3TFMA 1SHCA 3KRWA 3KRXA 3QBVB 4H8SA 5EFXA 1V5PA 4YL8A 1I7AA 2DHJA 4A6KA 2EJ8A 5J3TA 3G9WA 2JP2A 3SUZA 3MDBC 4ZRKA 3F5RA 3IVFA 1U5DA 2D9WA 4ZRIA 1EAZA 4CHJA 1XD4A 4HAUB 3T06A 4WSFA 2YT2A 2R0DA 4CHMA 1P5TA 1MK9B 2YS5A 3ODOA 4DX90 4HAWB 1EVHA 2DN6A 3B77A 2YVCA 3A58A 1EF1A 4PQ0A 3PVWA 1AWEA 1H10A 3FVCA 2K8EA 1UEFA 5D3VA 2Y7BA 5DHFB 2OTXA 1V5UA 4XWXA 1LB1A 2VKIA 3KSYA 1W1GA 1WJ1A 1BTNA 4HSIA 2RGNB 5D27A 2DKQA 1MI1A 2EMSA 5IRSA 2COCA 3V5WA 2YF0A 4HB3B 1WJMA 3PG7A 2RVBB 3OANA 4DX8A 5LONB 2Y8FA 1OQNA 2G35A 3NWDA 1V89A 1B55A 3ML4A 4KHBB 1DDVA 4A5KA 4KAXB 1X1GA 3A98B 4GOUA 3KZ1A 3ULCA 4OSNA 5C79A 1FGZA 1DROA 2D4QA 3PZDA 2K2UA 2DFKA 4GXBA 2R2YA 2I1JA 2P8VA 2PZ1A 4CYEA 2H7EA 2DX1A 4F7HA 2N23A 1ZC4B 1K5GB 1W1DA 2P0FA 2YSZA 1T77A 3U12A 1NU2A 3P6AA 2XQNM 5CLLB 3LJUX 5D3WA 1AQCA 2D11A 4HATB 4HAZB 4QJ5B 1V61A 4K2OA 1P3RA 1U5GA 2FJLA 1FHWA 3HK0A 1WG7A 1FAOA 2RRFA 2P0DA 1E5WA 5C5BB 3X23A 3ODXA 4GNKB 1UNPA 3AU5A 1UNRA 2LULA 4CSQA 1M7EA 5C6RA 1BAKA 2LYDA 2NMBA 2IYBA 1Y19B 4EKUA 2Z59A 4EJNA 2W2XD 3QIJA 3FM8C 5LG4B 3U7DA 5I2MA 2DKPA 3GYOA 2Z4DA 1QQGA 2W2WA 1U29A 2D9VA 4TKNA 4MY6A 1BWNA 3CIKA 1GG3A 1PFJA 3AU4A 3NWFA 2Z0OA 4HHVA 2KUPA 1ZC3B 3PSCA 2R09A 1MK7B 2Z0PA 1W1HA 2DA0A 4QXAB 2RSGA 4ZRJA 1IRSA 1K5DB 3MPXA 2ELBA 4Z2NA 2DLWA 1U2BA 2KIEA 3ULBA 5C16A 2D10A 2KUQA 1SGHA 2I5CA 1DBHA 4HDOA 3PEGA 2KR0A 1XR0B 2AL6A 4D0NB 2K00A 3QWMA 5DIFB 4DXAB 5LOPB 2Q13A 1DDMA 2E2XA 1FB8A 2QKMA 3OHMB 2MDXA 2J0JA 5HE3A 2CY5A 1N3HA 3D8DA 2CAYA 3TW1A 2I5FA 3HSAA 2D9ZA 5HE2A 3NW8A 2UVMA 2BCJA 5JHGA 2P0HA 2YRYA 4K17A 3CXBB 2KIGA 5C5BA 4PNKA 1ZM0A 4NSWA 3SV1A 2K49A 3BJIA 1XKEA 4K81A 4HB4B 2ZPYA 3VOQA 3F0WA 3DXCA 1UNQA 2DYNA 4DIXA 1J19A 2GCJA 2QKLA 2DTCA 3NWAA 3O96A 1DDWA 2KCJA 3SO6A 3HW2B 3N7CA 2J0MA 3SNHA 4P7IA 3A8QA 3DXDA 1H4RA 4EMOA 4KHAA 2GS0A 1MKEA 4C0AA 2D9XA 2L1CA 4L6EA 4K2PA 1OMWA 1V5MA 2ZKMX 3ZDTA 2L2IA 4GPTB 4HAVB 2DYQA 5JP4A 3M1IB 2EMTA 3KY9A 5FI0A 1LW3A 2X18A 2Y8GA 4QJ3B 3GYPA 3SYXA 2DHIA 5FI1A 3HIEA 2GJYA 1TQZA 2ELAA 4YONA 4KVGB 1P6SA 4MK0A 5JHHA 2UZRA 3TCAA 3VIAA 2CY4A 2CODA 5M4YB 2YT0A 2HTHB 5JLJB 2YS3A 2ADZA 5J3QA 1FHXA 1MIZB 1Z87A 3PVUA 4GMVA 4IAPA 1X11A 2MKRA 4A6FB 4OT1A 2MFQA 3WYFB 1KZ7A 1XCGA 1X1FA 2GCLA 5KCVA 3U8ZA 4KHBA 2H7DA 4A6FA
chains in the Genus database with same CATH topology
2LOZA 2D9YA 3A8PA 2COFA 2LKOA 2YS1A 3TO1A 5D3YA 1NTVA 4IOYX 2M38A 5DI9B 3D8FA 4NY0A 4HDQA 3AJ4A 2W2XC 2EC1A 3TVVA 3UZTA 1U5EA 1J0WA 4Y94A 4F7GA 1U27A 4DBBA 1Y5OA 1GC7A 1BTKA 5DHAB 4B6HA 4HB2B 2K2JA 1ZSQA 1X05A 2IFSA 2COAA 2OQBA 1RJ2A 2NZ8B 2J0KA 4F7UP 1PLSA 2I1KA 1WVHA 4HAXB 1FOEA 1UPQA 1XX0A 3D8EA 5CLQB 1TXDA 4GN1A 5GOWB 1UPRA 1X86A 2RNRB 4MT7A 2ROVA 5KQ1A 2D2QA 4KHOA 2RLOA 3PVLA 5D3XA 1KZGA 2ROZB 2VSZA 3DXEA 4TYZA 5HE1A 3HQCA 2UZSA 1WGUA 2HE7A 1Q67A 1NI2A 2M14A 4HAYB 1GC6A 3PP2A 1RRPB 5J3YA 1MAIA 2V76A 1DYNA 5L81A 2YT1A 5HE0A 1FHOA 1EGXA 3RCPA 1PMSA 2CRFA 1OY2A 1I2HA 2KGXB 1TJ6A 1XODA 3FSSA 3BINA 1U5FA 2DX5A 2MWNB 4Z2MB 4WJ7A 1MIXA 4GZUA 5KQ4A 4BBKA 3ZVRA 4WVFB 4IFSA 1ISNA 2DHKA 1WI1A 1KI1B 5DH9B 4A6HA 1NTYA 3FEHA 4HB0B 2VRWB 1QC6A 1WGQA 2N0YA 3NSUA 1ZVRA 2AEHA 2LG1A 1MPHA 3P7ZA 2J59M 1FGYA 4GMXB 3ODWA 2Z0QA 2LOXA 2RUKB 3WA0A 1M7RA 1V88A 3TFMA 1SHCA 3KRWA 3KRXA 3QBVB 4H8SA 5EFXA 1V5PA 4YL8A 1I7AA 2DHJA 4A6KA 2EJ8A 5J3TA 3G9WA 2JP2A 3SUZA 3MDBC 4ZRKA 3F5RA 3IVFA 1U5DA 2D9WA 4ZRIA 1EAZA 4CHJA 1XD4A 4HAUB 3T06A 4WSFA 2R0DA 4CHMA 1P5TA 1MK9B 2YS5A 3ODOA 4DX90 4HAWB 1EVHA 2DN6A 2YVCA 1EF1A 4PQ0A 3PVWA 1AWEA 1H10A 1UEFA 5D3VA 2Y7BA 5DHFB 2OTXA 1V5UA 4XWXA 1LB1A 2VKIA 3KSYA 1W1GA 1WJ1A 1BTNA 2RGNB 5D27A 2DKQA 2EMSA 2COCA 3V5WA 2YF0A 4HB3B 1WJMA 3PG7A 2RVBB 3OANA 4DX8A 5LONB 2Y8FA 1OQNA 2G35A 1V89A 1B55A 3ML4A 4KHBB 1DDVA 4A5KA 4KAXB 1X1GA 3A98B 3KZ1A 3ULCA 5C79A 1FGZA 1DROA 2D4QA 3PZDA 2K2UA 2DFKA 4GXBA 2I1JA 2P8VA 2PZ1A 4CYEA 2H7EA 2DX1A 4F7HA 2N23A 1ZC4B 1K5GB 1W1DA 2P0FA 2YSZA 1NU2A 3P6AA 2XQNM 5CLLB 3LJUX 5D3WA 1AQCA 2D11A 4HATB 4HAZB 1V61A 4K2OA 1P3RA 1U5GA 2FJLA 1FHWA 3HK0A 1WG7A 1FAOA 2P0DA 1E5WA 5C5BB 3X23A 3ODXA 1UNPA 3AU5A 1UNRA 2LULA 1M7EA 5C6RA 1BAKA 2LYDA 2NMBA 2IYBA 1Y19B 4EKUA 4EJNA 2W2XD 3QIJA 3FM8C 3U7DA 2DKPA 3GYOA 1QQGA 2W2WA 1U29A 2D9VA 4TKNA 4MY6A 1BWNA 3CIKA 1GG3A 1PFJA 3AU4A 2Z0OA 4HHVA 2KUPA 1ZC3B 3PSCA 2R09A 1MK7B 2Z0PA 1W1HA 2DA0A 2RSGA 4ZRJA 1IRSA 1K5DB 3MPXA 2ELBA 4Z2NA 2DLWA 1U2BA 3ULBA 5C16A 2D10A 1SGHA 2I5CA 1DBHA 4HDOA 3PEGA 1XR0B 2AL6A 4D0NB 2K00A 3QWMA 5DIFB 4DXAB 5LOPB 2Q13A 1DDMA 2E2XA 1FB8A 2QKMA 2MDXA 2J0JA 5HE3A 2CY5A 1N3HA 3D8DA 2CAYA 3TW1A 2I5FA 2D9ZA 5HE2A 2UVMA 2BCJA 5JHGA 2P0HA 2YRYA 4K17A 3CXBB 5C5BA 4PNKA 1ZM0A 4NSWA 3SV1A 3BJIA 1XKEA 4K81A 4HB4B 2ZPYA 3VOQA 3F0WA 3DXCA 1UNQA 2DYNA 1J19A 2GCJA 2QKLA 2DTCA 3O96A 1DDWA 2KCJA 3SO6A 3HW2B 3N7CA 2J0MA 3SNHA 4P7IA 3A8QA 3DXDA 1H4RA 4EMOA 4KHAA 2GS0A 1MKEA 4C0AA 2D9XA 2L1CA 4L6EA 4K2PA 1OMWA 1V5MA 3ZDTA 2L2IA 4GPTB 4HAVB 2DYQA 5JP4A 3M1IB 2EMTA 3KY9A 5FI0A 1LW3A 2X18A 2Y8GA 3GYPA 3SYXA 2DHIA 5FI1A 2GJYA 1TQZA 2ELAA 4YONA 4KVGB 1P6SA 4MK0A 5JHHA 2UZRA 3TCAA 3VIAA 2CY4A 2CODA 2YT0A 2HTHB 5JLJB 2YS3A 2ADZA 5J3QA 1FHXA 1MIZB 1Z87A 3PVUA 4GMVA 4IAPA 1X11A 2MKRA 4A6FB 3WYFB 2MFQA 1KZ7A 1XCGA 1X1FA 2GCLA 5KCVA 3U8ZA 2H7DA 4A6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOZ A;  2D9Y A;  3A8P A;  2COF A;  2LKO A;  2YS1 A;  3TO1 A;  5D3Y A;  1NTV A;  4IOY X;  2M38 A;  5DI9 B;  3D8F A;  4NY0 A;  4HDQ A;  3AJ4 A;  2W2X C;  2EC1 A;  3TVV A;  3UZT A;  1U5E A;  1J0W A;  4Y94 A;  4F7G A;  1U27 A;  4DBB A;  1Y5O A;  1GC7 A;  1BTK A;  5DHA B;  4B6H A;  4HB2 B;  2K2J A;  1ZSQ A;  1X05 A;  2IFS A;  2COA A;  2OQB A;  1RJ2 A;  2NZ8 B;  2J0K A;  4F7U P;  1PLS A;  2I1K A;  1WVH A;  4HAX B;  1FOE A;  1UPQ A;  1XX0 A;  3D8E A;  5CLQ B;  1TXD A;  4GN1 A;  5GOW B;  1UPR A;  1X86 A;  2RNR B;  4MT7 A;  2ROV A;  5KQ1 A;  2D2Q A;  4KHO A;  2RLO A;  3PVL A;  5D3X A;  1KZG A;  2ROZ B;  2VSZ A;  3DXE A;  4TYZ A;  5HE1 A;  3HQC A;  2UZS A;  1WGU A;  2HE7 A;  1Q67 A;  1NI2 A;  2M14 A;  4HAY B;  1GC6 A;  3PP2 A;  1RRP B;  5J3Y A;  1MAI A;  2V76 A;  1DYN A;  5L81 A;  2YT1 A;  5HE0 A;  1FHO A;  1EGX A;  3RCP A;  1PMS A;  2CRF A;  1OY2 A;  1I2H A;  2KGX B;  1TJ6 A;  1XOD A;  3FSS A;  3BIN A;  1U5F A;  2DX5 A;  2MWN B;  4Z2M B;  4WJ7 A;  1MIX A;  4GZU A;  5KQ4 A;  4BBK A;  3ZVR A;  4WVF B;  4IFS A;  1ISN A;  2DHK A;  1WI1 A;  1KI1 B;  5DH9 B;  4A6H A;  1NTY A;  3FEH A;  4HB0 B;  2VRW B;  1QC6 A;  1WGQ A;  2N0Y A;  3NSU A;  1ZVR A;  2AEH A;  2LG1 A;  1MPH A;  3P7Z A;  2J59 M;  1FGY A;  4GMX B;  3ODW A;  2Z0Q A;  2LOX A;  2RUK B;  3WA0 A;  1M7R A;  1V88 A;  3TFM A;  1SHC A;  3KRW A;  3KRX A;  3QBV B;  4H8S A;  5EFX A;  1V5P A;  4YL8 A;  1I7A A;  2DHJ A;  4A6K A;  2EJ8 A;  5J3T A;  3G9W A;  2JP2 A;  3SUZ A;  3MDB C;  4ZRK A;  3F5R A;  3IVF A;  1U5D A;  2D9W A;  4ZRI A;  1EAZ A;  4CHJ A;  1XD4 A;  4HAU B;  3T06 A;  4WSF A;  2R0D A;  4CHM A;  1P5T A;  1MK9 B;  2YS5 A;  3ODO A;  4DX9 0;  4HAW B;  1EVH A;  2DN6 A;  2YVC A;  1EF1 A;  4PQ0 A;  3PVW A;  1AWE A;  1H10 A;  1UEF A;  5D3V A;  2Y7B A;  5DHF B;  2OTX A;  1V5U A;  4XWX A;  1LB1 A;  2VKI A;  3KSY A;  1W1G A;  1WJ1 A;  1BTN A;  2RGN B;  5D27 A;  2DKQ A;  2EMS A;  2COC A;  3V5W A;  2YF0 A;  4HB3 B;  1WJM A;  3PG7 A;  2RVB B;  3OAN A;  4DX8 A;  5LON B;  2Y8F A;  1OQN A;  2G35 A;  1V89 A;  1B55 A;  3ML4 A;  4KHB B;  1DDV A;  4A5K A;  4KAX B;  1X1G A;  3A98 B;  3KZ1 A;  3ULC A;  5C79 A;  1FGZ A;  1DRO A;  2D4Q A;  3PZD A;  2K2U A;  2DFK A;  4GXB A;  2I1J A;  2P8V A;  2PZ1 A;  4CYE A;  2H7E A;  2DX1 A;  4F7H A;  2N23 A;  1ZC4 B;  1K5G B;  1W1D A;  2P0F A;  2YSZ A;  1NU2 A;  3P6A A;  2XQN M;  5CLL B;  3LJU X;  5D3W A;  1AQC A;  2D11 A;  4HAT B;  4HAZ B;  1V61 A;  4K2O A;  1P3R A;  1U5G A;  2FJL A;  1FHW A;  3HK0 A;  1WG7 A;  1FAO A;  2P0D A;  1E5W A;  5C5B B;  3X23 A;  3ODX A;  1UNP A;  3AU5 A;  1UNR A;  2LUL A;  1M7E A;  5C6R A;  1BAK A;  2LYD A;  2NMB A;  2IYB A;  1Y19 B;  4EKU A;  4EJN A;  2W2X D;  3QIJ A;  3FM8 C;  3U7D A;  2DKP A;  3GYO A;  1QQG A;  2W2W A;  1U29 A;  2D9V A;  4TKN A;  4MY6 A;  1BWN A;  3CIK A;  1GG3 A;  1PFJ A;  3AU4 A;  2Z0O A;  4HHV A;  2KUP A;  1ZC3 B;  3PSC A;  2R09 A;  1MK7 B;  2Z0P A;  1W1H A;  2DA0 A;  2RSG A;  4ZRJ A;  1IRS A;  1K5D B;  3MPX A;  2ELB A;  4Z2N A;  2DLW A;  1U2B A;  3ULB A;  5C16 A;  2D10 A;  1SGH A;  2I5C A;  1DBH A;  4HDO A;  3PEG A;  1XR0 B;  2AL6 A;  4D0N B;  2K00 A;  3QWM A;  5DIF B;  4DXA B;  5LOP B;  2Q13 A;  1DDM A;  2E2X A;  1FB8 A;  2QKM A;  2MDX A;  2J0J A;  5HE3 A;  2CY5 A;  1N3H A;  3D8D A;  2CAY A;  3TW1 A;  2I5F A;  2D9Z A;  5HE2 A;  2UVM A;  2BCJ A;  5JHG A;  2P0H A;  2YRY A;  4K17 A;  3CXB B;  5C5B A;  4PNK A;  1ZM0 A;  4NSW A;  3SV1 A;  3BJI A;  1XKE A;  4K81 A;  4HB4 B;  2ZPY A;  3VOQ A;  3F0W A;  3DXC A;  1UNQ A;  2DYN A;  1J19 A;  2GCJ A;  2QKL A;  2DTC A;  3O96 A;  1DDW A;  2KCJ A;  3SO6 A;  3HW2 B;  3N7C A;  2J0M A;  3SNH A;  4P7I A;  3A8Q A;  3DXD A;  1H4R A;  4EMO A;  4KHA A;  2GS0 A;  1MKE A;  4C0A A;  2D9X A;  2L1C A;  4L6E A;  4K2P A;  1OMW A;  1V5M A;  3ZDT A;  2L2I A;  4GPT B;  4HAV B;  2DYQ A;  5JP4 A;  3M1I B;  2EMT A;  3KY9 A;  5FI0 A;  1LW3 A;  2X18 A;  2Y8G A;  3GYP A;  3SYX A;  2DHI A;  5FI1 A;  2GJY A;  1TQZ A;  2ELA A;  4YON A;  4KVG B;  1P6S A;  4MK0 A;  5JHH A;  2UZR A;  3TCA A;  3VIA A;  2CY4 A;  2COD A;  2YT0 A;  2HTH B;  5JLJ B;  2YS3 A;  2ADZ A;  5J3Q A;  1FHX A;  1MIZ B;  1Z87 A;  3PVU A;  4GMV A;  4IAP A;  1X11 A;  2MKR A;  4A6F B;  3WYF B;  2MFQ A;  1KZ7 A;  1XCG A;  1X1F A;  2GCL A;  5KCV A;  3U8Z A;  2H7D A;  4A6F A; 
#chains in the Genus database with same CATH topology
 2LOZ A;  2D9Y A;  3A8P A;  2COF A;  2LKO A;  2YS1 A;  3TO1 A;  5D3Y A;  1NTV A;  4IOY X;  2M38 A;  5DI9 B;  3D8F A;  4NY0 A;  4HDQ A;  3AJ4 A;  2FJU B;  2W2X C;  2EC1 A;  3TVV A;  3UZT A;  1U5E A;  1J0W A;  3DCX A;  4Y94 A;  4F7G A;  1U27 A;  4DBB A;  1Y5O A;  1GC7 A;  1BTK A;  5DHA B;  4B6H A;  4HB2 B;  2K2J A;  1ZSQ A;  1X05 A;  2Z13 A;  4L1R A;  2IFS A;  2COA A;  2OQB A;  1RJ2 A;  2NZ8 B;  2J0K A;  4F7U P;  1PLS A;  2I1K A;  1WVH A;  4HAX B;  1FOE A;  1UPQ A;  1XX0 A;  3D8E A;  4D6W A;  5CLQ B;  1TXD A;  4GN1 A;  5GOW B;  1UPR A;  1X86 A;  2RNR B;  4MT7 A;  2ROV A;  5KQ1 A;  2D2Q A;  4KHO A;  2RLO A;  3PVL A;  5D3X A;  1KZG A;  2ROZ B;  2VSZ A;  3DXE A;  4TYZ A;  5HE1 A;  3HQC A;  2UZS A;  1WGU A;  2HE7 A;  1Q67 A;  1NI2 A;  2M14 A;  4HAY B;  1GC6 A;  3PP2 A;  1RRP B;  5J3Y A;  1MAI A;  2V76 A;  1DYN A;  5L81 A;  2YT1 A;  2NBV A;  5HE0 A;  1FHO A;  1EGX A;  3RCP A;  2Z14 A;  1PMS A;  2CRF A;  1OY2 A;  1I2H A;  2KGX B;  1TJ6 A;  1XOD A;  3FSS A;  3BIN A;  1U5F A;  2DX5 A;  2MWN B;  4Z2M B;  4WJ7 A;  1MIX A;  4GZU A;  2GUM A;  5KQ4 A;  4BBK A;  3ZVR A;  4WVF B;  4IFS A;  1ISN A;  2DHK A;  1ZYI A;  1WI1 A;  1KI1 B;  5DH9 B;  4A6H A;  1NTY A;  3FEH A;  4HB0 B;  2VRW B;  1QC6 A;  1WGQ A;  2N0Y A;  3NSU A;  1ZVR A;  2AEH A;  2LG1 A;  1MPH A;  4QJ4 B;  3P7Z A;  5I2S A;  2J59 M;  1FGY A;  4GMX B;  3ODW A;  2Z0Q A;  2LOX A;  2RUK B;  3WA0 A;  1M7R A;  1V88 A;  3TFM A;  1SHC A;  3KRW A;  3KRX A;  3QBV B;  4H8S A;  5EFX A;  1V5P A;  4YL8 A;  1I7A A;  2DHJ A;  4A6K A;  2EJ8 A;  5J3T A;  3G9W A;  2JP2 A;  3SUZ A;  3MDB C;  4ZRK A;  3F5R A;  3IVF A;  1U5D A;  2D9W A;  4ZRI A;  1EAZ A;  4CHJ A;  1XD4 A;  4HAU B;  3T06 A;  4WSF A;  2YT2 A;  2R0D A;  4CHM A;  1P5T A;  1MK9 B;  2YS5 A;  3ODO A;  4DX9 0;  4HAW B;  1EVH A;  2DN6 A;  3B77 A;  2YVC A;  3A58 A;  1EF1 A;  4PQ0 A;  3PVW A;  1AWE A;  1H10 A;  3FVC A;  2K8E A;  1UEF A;  5D3V A;  2Y7B A;  5DHF B;  2OTX A;  1V5U A;  4XWX A;  1LB1 A;  2VKI A;  3KSY A;  1W1G A;  1WJ1 A;  1BTN A;  4HSI A;  2RGN B;  5D27 A;  2DKQ A;  1MI1 A;  2EMS A;  5IRS A;  2COC A;  3V5W A;  2YF0 A;  4HB3 B;  1WJM A;  3PG7 A;  2RVB B;  3OAN A;  4DX8 A;  5LON B;  2Y8F A;  1OQN A;  2G35 A;  3NWD A;  1V89 A;  1B55 A;  3ML4 A;  4KHB B;  1DDV A;  4A5K A;  4KAX B;  1X1G A;  3A98 B;  4GOU A;  3KZ1 A;  3ULC A;  4OSN A;  5C79 A;  1FGZ A;  1DRO A;  2D4Q A;  3PZD A;  2K2U A;  2DFK A;  4GXB A;  2R2Y A;  2I1J A;  2P8V A;  2PZ1 A;  4CYE A;  2H7E A;  2DX1 A;  4F7H A;  2N23 A;  1ZC4 B;  1K5G B;  1W1D A;  2P0F A;  2YSZ A;  1T77 A;  3U12 A;  1NU2 A;  3P6A A;  2XQN M;  5CLL B;  3LJU X;  5D3W A;  1AQC A;  2D11 A;  4HAT B;  4HAZ B;  4QJ5 B;  1V61 A;  4K2O A;  1P3R A;  1U5G A;  2FJL A;  1FHW A;  3HK0 A;  1WG7 A;  1FAO A;  2RRF A;  2P0D A;  1E5W A;  5C5B B;  3X23 A;  3ODX A;  4GNK B;  1UNP A;  3AU5 A;  1UNR A;  2LUL A;  4CSQ A;  1M7E A;  5C6R A;  1BAK A;  2LYD A;  2NMB A;  2IYB A;  1Y19 B;  4EKU A;  2Z59 A;  4EJN A;  2W2X D;  3QIJ A;  3FM8 C;  5LG4 B;  3U7D A;  5I2M A;  2DKP A;  3GYO A;  2Z4D A;  1QQG A;  2W2W A;  1U29 A;  2D9V A;  4TKN A;  4MY6 A;  1BWN A;  3CIK A;  1GG3 A;  1PFJ A;  3AU4 A;  3NWF A;  2Z0O A;  4HHV A;  2KUP A;  1ZC3 B;  3PSC A;  2R09 A;  1MK7 B;  2Z0P A;  1W1H A;  2DA0 A;  4QXA B;  2RSG A;  4ZRJ A;  1IRS A;  1K5D B;  3MPX A;  2ELB A;  4Z2N A;  2DLW A;  1U2B A;  2KIE A;  3ULB A;  5C16 A;  2D10 A;  2KUQ A;  1SGH A;  2I5C A;  1DBH A;  4HDO A;  3PEG A;  2KR0 A;  1XR0 B;  2AL6 A;  4D0N B;  2K00 A;  3QWM A;  5DIF B;  4DXA B;  5LOP B;  2Q13 A;  1DDM A;  2E2X A;  1FB8 A;  2QKM A;  3OHM B;  2MDX A;  2J0J A;  5HE3 A;  2CY5 A;  1N3H A;  3D8D A;  2CAY A;  3TW1 A;  2I5F A;  3HSA A;  2D9Z A;  5HE2 A;  3NW8 A;  2UVM A;  2BCJ A;  5JHG A;  2P0H A;  2YRY A;  4K17 A;  3CXB B;  2KIG A;  5C5B A;  4PNK A;  1ZM0 A;  4NSW A;  3SV1 A;  2K49 A;  3BJI A;  1XKE A;  4K81 A;  4HB4 B;  2ZPY A;  3VOQ A;  3F0W A;  3DXC A;  1UNQ A;  2DYN A;  4DIX A;  1J19 A;  2GCJ A;  2QKL A;  2DTC A;  3NWA A;  3O96 A;  1DDW A;  2KCJ A;  3SO6 A;  3HW2 B;  3N7C A;  2J0M A;  3SNH A;  4P7I A;  3A8Q A;  3DXD A;  1H4R A;  4EMO A;  4KHA A;  2GS0 A;  1MKE A;  4C0A A;  2D9X A;  2L1C A;  4L6E A;  4K2P A;  1OMW A;  1V5M A;  2ZKM X;  3ZDT A;  2L2I A;  4GPT B;  4HAV B;  2DYQ A;  5JP4 A;  3M1I B;  2EMT A;  3KY9 A;  5FI0 A;  1LW3 A;  2X18 A;  2Y8G A;  4QJ3 B;  3GYP A;  3SYX A;  2DHI A;  5FI1 A;  3HIE A;  2GJY A;  1TQZ A;  2ELA A;  4YON A;  4KVG B;  1P6S A;  4MK0 A;  5JHH A;  2UZR A;  3TCA A;  3VIA A;  2CY4 A;  2COD A;  5M4Y B;  2YT0 A;  2HTH B;  5JLJ B;  2YS3 A;  2ADZ A;  5J3Q A;  1FHX A;  1MIZ B;  1Z87 A;  3PVU A;  4GMV A;  4IAP A;  1X11 A;  2MKR A;  4A6F B;  4OT1 A;  2MFQ A;  3WYF B;  1KZ7 A;  1XCG A;  1X1F A;  2GCL A;  5KCV A;  3U8Z A;  4KHB A;  2H7D A;  4A6F A; 
#chains in the Genus database with same CATH homology
 2LOZ A;  2D9Y A;  3A8P A;  2COF A;  2LKO A;  2YS1 A;  3TO1 A;  5D3Y A;  1NTV A;  4IOY X;  2M38 A;  5DI9 B;  3D8F A;  4NY0 A;  4HDQ A;  3AJ4 A;  2W2X C;  2EC1 A;  3TVV A;  3UZT A;  1U5E A;  1J0W A;  4Y94 A;  4F7G A;  1U27 A;  4DBB A;  1Y5O A;  1GC7 A;  1BTK A;  5DHA B;  4B6H A;  4HB2 B;  2K2J A;  1ZSQ A;  1X05 A;  2IFS A;  2COA A;  2OQB A;  1RJ2 A;  2NZ8 B;  2J0K A;  4F7U P;  1PLS A;  2I1K A;  1WVH A;  4HAX B;  1FOE A;  1UPQ A;  1XX0 A;  3D8E A;  5CLQ B;  1TXD A;  4GN1 A;  5GOW B;  1UPR A;  1X86 A;  2RNR B;  4MT7 A;  2ROV A;  5KQ1 A;  2D2Q A;  4KHO A;  2RLO A;  3PVL A;  5D3X A;  1KZG A;  2ROZ B;  2VSZ A;  3DXE A;  4TYZ A;  5HE1 A;  3HQC A;  2UZS A;  1WGU A;  2HE7 A;  1Q67 A;  1NI2 A;  2M14 A;  4HAY B;  1GC6 A;  3PP2 A;  1RRP B;  5J3Y A;  1MAI A;  2V76 A;  1DYN A;  5L81 A;  2YT1 A;  5HE0 A;  1FHO A;  1EGX A;  3RCP A;  1PMS A;  2CRF A;  1OY2 A;  1I2H A;  2KGX B;  1TJ6 A;  1XOD A;  3FSS A;  3BIN A;  1U5F A;  2DX5 A;  2MWN B;  4Z2M B;  4WJ7 A;  1MIX A;  4GZU A;  5KQ4 A;  4BBK A;  3ZVR A;  4WVF B;  4IFS A;  1ISN A;  2DHK A;  1WI1 A;  1KI1 B;  5DH9 B;  4A6H A;  1NTY A;  3FEH A;  4HB0 B;  2VRW B;  1QC6 A;  1WGQ A;  2N0Y A;  3NSU A;  1ZVR A;  2AEH A;  2LG1 A;  1MPH A;  3P7Z A;  2J59 M;  1FGY A;  4GMX B;  3ODW A;  2Z0Q A;  2LOX A;  2RUK B;  3WA0 A;  1M7R A;  1V88 A;  3TFM A;  1SHC A;  3KRW A;  3KRX A;  3QBV B;  4H8S A;  5EFX A;  1V5P A;  4YL8 A;  1I7A A;  2DHJ A;  4A6K A;  2EJ8 A;  5J3T A;  3G9W A;  2JP2 A;  3SUZ A;  3MDB C;  4ZRK A;  3F5R A;  3IVF A;  1U5D A;  2D9W A;  4ZRI A;  1EAZ A;  4CHJ A;  1XD4 A;  4HAU B;  3T06 A;  4WSF A;  2R0D A;  4CHM A;  1P5T A;  1MK9 B;  2YS5 A;  3ODO A;  4DX9 0;  4HAW B;  1EVH A;  2DN6 A;  2YVC A;  1EF1 A;  4PQ0 A;  3PVW A;  1AWE A;  1H10 A;  1UEF A;  5D3V A;  2Y7B A;  5DHF B;  2OTX A;  1V5U A;  4XWX A;  1LB1 A;  2VKI A;  3KSY A;  1W1G A;  1WJ1 A;  1BTN A;  2RGN B;  5D27 A;  2DKQ A;  2EMS A;  2COC A;  3V5W A;  2YF0 A;  4HB3 B;  1WJM A;  3PG7 A;  2RVB B;  3OAN A;  4DX8 A;  5LON B;  2Y8F A;  1OQN A;  2G35 A;  1V89 A;  1B55 A;  3ML4 A;  4KHB B;  1DDV A;  4A5K A;  4KAX B;  1X1G A;  3A98 B;  3KZ1 A;  3ULC A;  5C79 A;  1FGZ A;  1DRO A;  2D4Q A;  3PZD A;  2K2U A;  2DFK A;  4GXB A;  2I1J A;  2P8V A;  2PZ1 A;  4CYE A;  2H7E A;  2DX1 A;  4F7H A;  2N23 A;  1ZC4 B;  1K5G B;  1W1D A;  2P0F A;  2YSZ A;  1NU2 A;  3P6A A;  2XQN M;  5CLL B;  3LJU X;  5D3W A;  1AQC A;  2D11 A;  4HAT B;  4HAZ B;  1V61 A;  4K2O A;  1P3R A;  1U5G A;  2FJL A;  1FHW A;  3HK0 A;  1WG7 A;  1FAO A;  2P0D A;  1E5W A;  5C5B B;  3X23 A;  3ODX A;  1UNP A;  3AU5 A;  1UNR A;  2LUL A;  1M7E A;  5C6R A;  1BAK A;  2LYD A;  2NMB A;  2IYB A;  1Y19 B;  4EKU A;  4EJN A;  2W2X D;  3QIJ A;  3FM8 C;  3U7D A;  2DKP A;  3GYO A;  1QQG A;  2W2W A;  1U29 A;  2D9V A;  4TKN A;  4MY6 A;  1BWN A;  3CIK A;  1GG3 A;  1PFJ A;  3AU4 A;  2Z0O A;  4HHV A;  2KUP A;  1ZC3 B;  3PSC A;  2R09 A;  1MK7 B;  2Z0P A;  1W1H A;  2DA0 A;  2RSG A;  4ZRJ A;  1IRS A;  1K5D B;  3MPX A;  2ELB A;  4Z2N A;  2DLW A;  1U2B A;  3ULB A;  5C16 A;  2D10 A;  1SGH A;  2I5C A;  1DBH A;  4HDO A;  3PEG A;  1XR0 B;  2AL6 A;  4D0N B;  2K00 A;  3QWM A;  5DIF B;  4DXA B;  5LOP B;  2Q13 A;  1DDM A;  2E2X A;  1FB8 A;  2QKM A;  2MDX A;  2J0J A;  5HE3 A;  2CY5 A;  1N3H A;  3D8D A;  2CAY A;  3TW1 A;  2I5F A;  2D9Z A;  5HE2 A;  2UVM A;  2BCJ A;  5JHG A;  2P0H A;  2YRY A;  4K17 A;  3CXB B;  5C5B A;  4PNK A;  1ZM0 A;  4NSW A;  3SV1 A;  3BJI A;  1XKE A;  4K81 A;  4HB4 B;  2ZPY A;  3VOQ A;  3F0W A;  3DXC A;  1UNQ A;  2DYN A;  1J19 A;  2GCJ A;  2QKL A;  2DTC A;  3O96 A;  1DDW A;  2KCJ A;  3SO6 A;  3HW2 B;  3N7C A;  2J0M A;  3SNH A;  4P7I A;  3A8Q A;  3DXD A;  1H4R A;  4EMO A;  4KHA A;  2GS0 A;  1MKE A;  4C0A A;  2D9X A;  2L1C A;  4L6E A;  4K2P A;  1OMW A;  1V5M A;  3ZDT A;  2L2I A;  4GPT B;  4HAV B;  2DYQ A;  5JP4 A;  3M1I B;  2EMT A;  3KY9 A;  5FI0 A;  1LW3 A;  2X18 A;  2Y8G A;  3GYP A;  3SYX A;  2DHI A;  5FI1 A;  2GJY A;  1TQZ A;  2ELA A;  4YON A;  4KVG B;  1P6S A;  4MK0 A;  5JHH A;  2UZR A;  3TCA A;  3VIA A;  2CY4 A;  2COD A;  2YT0 A;  2HTH B;  5JLJ B;  2YS3 A;  2ADZ A;  5J3Q A;  1FHX A;  1MIZ B;  1Z87 A;  3PVU A;  4GMV A;  4IAP A;  1X11 A;  2MKR A;  4A6F B;  3WYF B;  2MFQ A;  1KZ7 A;  1XCG A;  1X1F A;  2GCL A;  5KCV A;  3U8Z A;  2H7D A;  4A6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...