1W1GA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1gA00
2AL6A 1U5FA 4L6EA 1UPQA 2MDXA 1RJ2A 4P7IA 3VOQA 2D9YA 5KCVA 2QKLA 2YF0A 3D8DA 5HE1A 1XKEA 4F7UP 2NZ8B 3SNHA 2W2XC 1Z87A 3AJ4A 1M7EA 3U7DA 4GN1A 1KZGA 2P0FA 3D8EA 4ZRJA 5D3WA 5JHGA 2Y7BA 3A98B 1UPRA 3X23A 2ELAA 2KUPA 1FHXA 5J3QA 1DBHA 5JLJB 4PNKA 1ZSQA 2L2IA 1J19A 3TCAA 1UNQA 5LONB 4HDQA 5DIFB 2I1KA 3NSUA 1EAZA 1OMWA 2CAYA 2G35A 2COAA 5LOPB 3ODXA 5KQ1A 2COFA 5J3TA 1V89A 2CRFA 5HE3A 1LB1A 5CLLB 2CODA 1U29A 1BTKA 3A8QA 2HTHB 2Y8GA 3TW1A 1B55A 5FI1A 1UNRA 1WJ1A 4CHMA 2ZPYA 3P7ZA 4C0AA 3SYXA 3PEGA 5DH9B 2VRWB 4NY0A 4WJ7A 4K2PA 5DHFB 3V5WA 1PFJA 1U5EA 2UVMA 2Y8FA 2YT1A 4KAXB 4EMOA 4A6FA 2QKMA 1FHOA 1V5PA 1FGYA 3BINA 1XD4A 2JP2A 2EMTA 3HW2B 3WYFB 1XX0A 1NU2A 2VSZA 3OANA 4GXBA 1ZVRA 3KZ1A 2D4QA 5HE2A 2CY4A 2W2XD 1SGHA 1FGZA 4K2OA 3DXDA 2RSGA 2RVBB 3ZDTA 3U8ZA 1BTNA 5GOWB 5JP4A 4NSWA 1P3RA 3PVUA 1KZ7A 5C79A 2Z0QA 2UZRA 2V76A 2K00A 2RNRB 2HE7A 1DYNA 4ZRKA 1IRSA 1U2BA 3FEHA 2OTXA 3PP2A 3WA0A 1K5DB 2DYNA 3TVVA 2J0MA 3T06A 1Y5OA 1N3HA 2LG1A 2EMSA 3PSCA 1UNPA 4Y94A 4HAXB 3ULBA 4F7GA 5D3YA 1H10A 3D8FA 3PVLA 2COCA 3KRXA 3BJIA 1XCGA 3PG7A 2DX1A 3QWMA 1LW3A 1XODA 2DYQA 3ML4A 4TYZA 2YT0A 5JHHA 1WJMA 3N7CA 2M38A 2GCJA 4ZRIA 3F0WA 2FJLA 3P6AA 4YL8A 2DTCA 2DKPA 1ZC4B 4HAZB 1DDMA 2ADZA 3GYOA 1BAKA 3QIJA 2D2QA 1FOEA 5J3YA 4A6HA 3DXEA 1RRPB 3RCPA 1SHCA 1U27A 1ZC3B 2XQNM 3G9WA 4HAUB 1BWNA 1W1HA 5C5BB 1FHWA 4KHOA 2DA0A 2J0JA 2L1CA 3FM8C 2PZ1A 3TFMA 1M7RA 2YS3A 1V5MA 1W1DA 3TO1A 1Y19B 2Z0OA 1NI2A 1MIZB 4XWXA 2W2WA 1TQZA 3MPXA 4YONA 3SO6A 4CHJA 1U5GA 5HE0A 3SV1A 3MDBC 2GJYA 3A8PA 4TKNA 2I5CA 1NTVA 1QQGA 1NTYA 1MPHA 2D9VA 3KSYA 3ULCA 4GMXB 1WGQA 2YS1A 1AWEA 1DROA 1P6SA 2D10A 3VIAA 1ZM0A 2LULA 2GS0A 2MKRA 3CIKA 1WGUA 2E2XA 4HAYB 5D27A 2R09A 1E5WA 4HDOA 4MT7A 2LOXA 2D9WA 1DDVA 1MIXA 1DDWA 4MY6A 3PVWA 1MK9B 4IFSA 1OQNA 4EJNA 1I7AA 5L81A 2N0YA 1UEFA 2DHJA 1AQCA 5CLQB 2EC1A 4A5KA 3ZVRA 2GCLA 1OY2A 3KY9A 1EVHA 2H7DA 2YS5A 3UZTA 2YSZA 1Q67A 4HB4B 2YRYA 3PZDA 2DKQA 1KI1B 1FAOA 2UZSA 2P8VA 1WI1A 3LJUX 4DXAB 2OQBA 2I1JA 1WVHA 4HB3B 5FI0A 2VKIA 3AU4A 1FB8A 2H7EA 3SUZA 2J59M 2RUKB 1WG7A 4DX90 2EJ8A 2K2JA 4HAWB 4H8SA 4F7HA 4A6KA 4DBBA 4K81A 5D3XA 2ROZB 4EKUA 2ROVA 1EGXA 2I5FA 2D11A 1TJ6A 2M14A 2D9XA 1PMSA 1X05A 2MFQA 3HK0A 2DFKA 1MK7B 1MAIA 1PLSA 1GC6A 1GG3A 3FSSA 1XR0B 5C5BA 1J0WA 3GYPA 4HAVB 2DN6A 4HB2B 4WSFA 2LYDA 1I2HA 4Z2NA 2DHIA 4IOYX 1U5DA 2IYBA 2R0DA 3ODWA 4BBKA 4KVGB 4K17A 1P5TA 4HATB 2KGXB 4CYEA 2DHKA 4HB0B 1V88A 1QC6A 5DI9B 1GC7A 2KCJA 5KQ4A 1ISNA 4A6FB 4KHAA 5C16A 1MKEA 2CY5A 1X1FA 4GZUA 2ELBA 2DLWA 1V5UA 2Z0PA 1TXDA 3HQCA 3CXBB 1H4RA 2D9ZA 1EF1A 2K2UA 4MK0A 2BCJA 3M1IB 4DX8A 4GPTB 2YVCA 4Z2MB 2NMBA 2LKOA 3DXCA 4WVFB 3AU5A 2IFSA 2DX5A 3IVFA 2AEHA 3KRWA 2N23A 2RLOA 1W1GA 3ODOA 5C6RA 3F5RA 4GMVA 4D0NB 4B6HA 2P0HA 3QBVB 5DHAB 5EFXA 1V61A 1X86A 1K5GB 2RGNB 1X1GA 1X11A 2J0KA 4KHBB 4IAPA 2P0DA 3O96A 4PQ0A 2LOZA 2Q13A 5D3VA 2X18A 2MWNB 4HHVA
chains in the Genus database with same CATH superfamily
2AL6A 2GUMA 1U5FA 4L6EA 4OT1A 3HIEA 1UPQA 2MDXA 1RJ2A 4P7IA 3VOQA 2D9YA 5KCVA 2QKLA 2YF0A 3D8DA 5HE1A 1XKEA 4F7UP 2NZ8B 3SNHA 3NWAA 2W2XC 1Z87A 3AJ4A 1M7EA 3U7DA 4GN1A 1KZGA 2P0FA 3D8EA 4ZRJA 5I2SA 5D3WA 5JHGA 2Y7BA 3A98B 2FJUB 1MI1A 1UPRA 3X23A 1ZYIA 2ELAA 2KUPA 1FHXA 5J3QA 1DBHA 5JLJB 4PNKA 1ZSQA 2L2IA 1J19A 3TCAA 1UNQA 5LONB 4HDQA 5DIFB 2I1KA 3NSUA 1EAZA 1OMWA 2CAYA 2G35A 2COAA 5LOPB 3ODXA 5KQ1A 2COFA 5J3TA 1V89A 2CRFA 5HE3A 1LB1A 5CLLB 2CODA 1U29A 1BTKA 3A8QA 2HTHB 2Y8GA 3TW1A 1B55A 5FI1A 1UNRA 1WJ1A 4CHMA 2ZPYA 3P7ZA 4C0AA 3SYXA 3PEGA 5DH9B 2VRWB 4NY0A 2KR0A 4WJ7A 4K2PA 5DHFB 3V5WA 1PFJA 1U5EA 2UVMA 2Y8FA 2YT1A 4KAXB 4EMOA 4A6FA 2QKMA 1FHOA 1V5PA 1FGYA 3BINA 1XD4A 2JP2A 2EMTA 3HW2B 3WYFB 1XX0A 1NU2A 2VSZA 3OANA 4GXBA 1ZVRA 2KIGA 3KZ1A 4QJ4B 2D4QA 5HE2A 5I2MA 2CY4A 2W2XD 1SGHA 1FGZA 4K2OA 3DXDA 2RSGA 2RVBB 3ZDTA 3U8ZA 1BTNA 5GOWB 5JP4A 4GNKB 4NSWA 1P3RA 3PVUA 5M4YB 1KZ7A 5C79A 4KHBA 2Z0QA 2UZRA 2V76A 2K00A 2RNRB 2HE7A 1DYNA 4ZRKA 1IRSA 3DCXA 1U2BA 3FEHA 2OTXA 3HSAA 3PP2A 3WA0A 1K5DB 2DYNA 3TVVA 2J0MA 3T06A 1Y5OA 3B77A 1N3HA 2LG1A 2EMSA 3PSCA 1UNPA 4Y94A 4HAXB 3ULBA 4F7GA 5D3YA 1H10A 3D8FA 3PVLA 2COCA 3KRXA 3BJIA 1XCGA 3PG7A 2DX1A 3QWMA 1LW3A 1XODA 2DYQA 3ML4A 4TYZA 2NBVA 2YT0A 5JHHA 1WJMA 3N7CA 2M38A 2GCJA 4ZRIA 3F0WA 2FJLA 3P6AA 4YL8A 2DTCA 4QJ5B 2DKPA 1ZC4B 4HAZB 1DDMA 2ADZA 2K49A 3GYOA 1BAKA 3QIJA 3NWFA 2D2QA 1FOEA 5J3YA 4A6HA 3DXEA 1RRPB 3RCPA 4L1RA 1SHCA 1U27A 1ZC3B 2XQNM 3G9WA 4HAUB 1BWNA 1W1HA 3A58A 5C5BB 1FHWA 4KHOA 2DA0A 2J0JA 2L1CA 3FM8C 2PZ1A 3TFMA 1M7RA 2YS3A 1V5MA 1W1DA 3TO1A 1Y19B 5LG4B 2Z0OA 1NI2A 1MIZB 4XWXA 2W2WA 1TQZA 3FVCA 1T77A 3MPXA 4YONA 3SO6A 4CHJA 1U5GA 5HE0A 3SV1A 3MDBC 2GJYA 3A8PA 4GOUA 4TKNA 2I5CA 1NTVA 1QQGA 1NTYA 3U12A 1MPHA 2D9VA 3KSYA 3ULCA 4GMXB 2Z4DA 1WGQA 2YS1A 1AWEA 1DROA 1P6SA 2D10A 3VIAA 1ZM0A 2LULA 4OSNA 2GS0A 2MKRA 3CIKA 4DIXA 1WGUA 2E2XA 4HAYB 5D27A 2R09A 1E5WA 3NW8A 4HDOA 4MT7A 2LOXA 2D9WA 1DDVA 1MIXA 1DDWA 4MY6A 3OHMB 3PVWA 1MK9B 4IFSA 1OQNA 4EJNA 1I7AA 5L81A 2K8EA 2N0YA 1UEFA 2DHJA 1AQCA 5CLQB 2EC1A 4A5KA 3ZVRA 2GCLA 1OY2A 3KY9A 1EVHA 2H7DA 2YS5A 3UZTA 2YSZA 1Q67A 4HB4B 2YRYA 3PZDA 2DKQA 1KI1B 1FAOA 2UZSA 2P8VA 1WI1A 3LJUX 4DXAB 2OQBA 2I1JA 1WVHA 2KUQA 4HB3B 5FI0A 2Z59A 2VKIA 3AU4A 1FB8A 2H7EA 3SUZA 2J59M 2RUKB 1WG7A 4DX90 2EJ8A 2K2JA 4HAWB 4H8SA 4F7HA 4A6KA 4DBBA 4K81A 5D3XA 2ROZB 4EKUA 2ROVA 1EGXA 2I5FA 2D11A 1TJ6A 2M14A 2D9XA 1PMSA 5IRSA 1X05A 2MFQA 3HK0A 2DFKA 1MK7B 1MAIA 1PLSA 1GC6A 1GG3A 3FSSA 2RRFA 1XR0B 5C5BA 1J0WA 3GYPA 4HAVB 2DN6A 4HB2B 4WSFA 2LYDA 4HSIA 1I2HA 4Z2NA 2DHIA 4IOYX 1U5DA 2IYBA 2KIEA 2R0DA 3ODWA 4BBKA 4KVGB 4K17A 1P5TA 4HATB 2KGXB 4CYEA 2DHKA 4HB0B 1V88A 1QC6A 5DI9B 1GC7A 2KCJA 5KQ4A 1ISNA 2Z13A 2Z14A 4A6FB 4KHAA 5C16A 1MKEA 2CY5A 1X1FA 4GZUA 2ELBA 2DLWA 1V5UA 2Z0PA 1TXDA 3HQCA 3CXBB 1H4RA 2D9ZA 1EF1A 2K2UA 4MK0A 2BCJA 3M1IB 4DX8A 4GPTB 4CSQA 3NWDA 2YVCA 2ZKMX 4Z2MB 2NMBA 2YT2A 2LKOA 3DXCA 4WVFB 3AU5A 2IFSA 2DX5A 3IVFA 4D6WA 2AEHA 2N23A 2RLOA 3KRWA 1W1GA 3ODOA 5C6RA 3F5RA 4GMVA 4D0NB 2R2YA 4B6HA 2P0HA 3QBVB 5DHAB 5EFXA 1V61A 1X86A 1K5GB 2RGNB 1X1GA 1X11A 2J0KA 4KHBB 4IAPA 2P0DA 3O96A 4PQ0A 2LOZA 4QXAB 2Q13A 4QJ3B 5D3VA 2X18A 2MWNB 4HHVA
chains in the Genus database with same CATH topology
2AL6A 1U5FA 4L6EA 1UPQA 2MDXA 1RJ2A 4P7IA 3VOQA 2D9YA 5KCVA 2QKLA 2YF0A 3D8DA 5HE1A 1XKEA 4F7UP 2NZ8B 3SNHA 2W2XC 1Z87A 3AJ4A 1M7EA 3U7DA 4GN1A 1KZGA 2P0FA 3D8EA 4ZRJA 5D3WA 5JHGA 2Y7BA 3A98B 1UPRA 3X23A 2ELAA 2KUPA 1FHXA 5J3QA 1DBHA 5JLJB 4PNKA 1ZSQA 2L2IA 1J19A 3TCAA 1UNQA 5LONB 4HDQA 5DIFB 2I1KA 3NSUA 1EAZA 1OMWA 2CAYA 2G35A 2COAA 5LOPB 3ODXA 5KQ1A 2COFA 5J3TA 1V89A 2CRFA 5HE3A 1LB1A 5CLLB 2CODA 1U29A 1BTKA 3A8QA 2HTHB 2Y8GA 3TW1A 1B55A 5FI1A 1UNRA 1WJ1A 4CHMA 2ZPYA 3P7ZA 4C0AA 3SYXA 3PEGA 5DH9B 2VRWB 4NY0A 4WJ7A 4K2PA 5DHFB 3V5WA 1PFJA 1U5EA 2UVMA 2Y8FA 2YT1A 4KAXB 4EMOA 4A6FA 2QKMA 1FHOA 1V5PA 1FGYA 3BINA 1XD4A 2JP2A 2EMTA 3HW2B 3WYFB 1XX0A 1NU2A 2VSZA 3OANA 4GXBA 1ZVRA 3KZ1A 2D4QA 5HE2A 2CY4A 2W2XD 1SGHA 1FGZA 4K2OA 3DXDA 2RSGA 2RVBB 3ZDTA 3U8ZA 1BTNA 5GOWB 5JP4A 4NSWA 1P3RA 3PVUA 1KZ7A 5C79A 2Z0QA 2UZRA 2V76A 2K00A 2RNRB 2HE7A 1DYNA 4ZRKA 1IRSA 1U2BA 3FEHA 2OTXA 3PP2A 3WA0A 1K5DB 2DYNA 3TVVA 2J0MA 3T06A 1Y5OA 1N3HA 2LG1A 2EMSA 3PSCA 1UNPA 4Y94A 4HAXB 3ULBA 4F7GA 5D3YA 1H10A 3D8FA 3PVLA 2COCA 3KRXA 3BJIA 1XCGA 3PG7A 2DX1A 3QWMA 1LW3A 1XODA 2DYQA 3ML4A 4TYZA 2YT0A 5JHHA 1WJMA 3N7CA 2M38A 2GCJA 4ZRIA 3F0WA 2FJLA 3P6AA 4YL8A 2DTCA 2DKPA 1ZC4B 4HAZB 1DDMA 2ADZA 3GYOA 1BAKA 3QIJA 2D2QA 1FOEA 5J3YA 4A6HA 3DXEA 1RRPB 3RCPA 1SHCA 1U27A 1ZC3B 2XQNM 3G9WA 4HAUB 1BWNA 1W1HA 5C5BB 1FHWA 4KHOA 2DA0A 2J0JA 2L1CA 3FM8C 2PZ1A 3TFMA 1M7RA 2YS3A 1V5MA 1W1DA 3TO1A 1Y19B 2Z0OA 1NI2A 1MIZB 4XWXA 2W2WA 1TQZA 3MPXA 4YONA 3SO6A 4CHJA 1U5GA 5HE0A 3SV1A 3MDBC 2GJYA 3A8PA 4TKNA 2I5CA 1NTVA 1QQGA 1NTYA 1MPHA 2D9VA 3KSYA 3ULCA 4GMXB 1WGQA 2YS1A 1AWEA 1DROA 1P6SA 2D10A 3VIAA 1ZM0A 2LULA 2GS0A 2MKRA 3CIKA 1WGUA 2E2XA 4HAYB 5D27A 2R09A 1E5WA 4HDOA 4MT7A 2LOXA 2D9WA 1DDVA 1MIXA 1DDWA 4MY6A 3PVWA 1MK9B 4IFSA 1OQNA 4EJNA 1I7AA 5L81A 2N0YA 1UEFA 2DHJA 1AQCA 5CLQB 2EC1A 4A5KA 3ZVRA 2GCLA 1OY2A 3KY9A 1EVHA 2H7DA 2YS5A 3UZTA 2YSZA 1Q67A 4HB4B 2YRYA 3PZDA 2DKQA 1KI1B 1FAOA 2UZSA 2P8VA 1WI1A 3LJUX 4DXAB 2OQBA 2I1JA 1WVHA 4HB3B 5FI0A 2VKIA 3AU4A 1FB8A 2H7EA 3SUZA 2J59M 2RUKB 1WG7A 4DX90 2EJ8A 2K2JA 4HAWB 4H8SA 4F7HA 4A6KA 4DBBA 4K81A 5D3XA 2ROZB 4EKUA 2ROVA 1EGXA 2I5FA 2D11A 1TJ6A 2M14A 2D9XA 1PMSA 1X05A 2MFQA 3HK0A 2DFKA 1MK7B 1MAIA 1PLSA 1GC6A 1GG3A 3FSSA 1XR0B 5C5BA 1J0WA 3GYPA 4HAVB 2DN6A 4HB2B 4WSFA 2LYDA 1I2HA 4Z2NA 2DHIA 4IOYX 1U5DA 2IYBA 2R0DA 3ODWA 4BBKA 4KVGB 4K17A 1P5TA 4HATB 2KGXB 4CYEA 2DHKA 4HB0B 1V88A 1QC6A 5DI9B 1GC7A 2KCJA 5KQ4A 1ISNA 4A6FB 4KHAA 5C16A 1MKEA 2CY5A 1X1FA 4GZUA 2ELBA 2DLWA 1V5UA 2Z0PA 1TXDA 3HQCA 3CXBB 1H4RA 2D9ZA 1EF1A 2K2UA 4MK0A 2BCJA 3M1IB 4DX8A 4GPTB 2YVCA 4Z2MB 2NMBA 2LKOA 3DXCA 4WVFB 3AU5A 2IFSA 2DX5A 3IVFA 2AEHA 3KRWA 2N23A 2RLOA 1W1GA 3ODOA 5C6RA 3F5RA 4GMVA 4D0NB 4B6HA 2P0HA 3QBVB 5DHAB 5EFXA 1V61A 1X86A 1K5GB 2RGNB 1X1GA 1X11A 2J0KA 4KHBB 4IAPA 2P0DA 3O96A 4PQ0A 2LOZA 2Q13A 5D3VA 2X18A 2MWNB 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  1U5F A;  4L6E A;  1UPQ A;  2MDX A;  1RJ2 A;  4P7I A;  3VOQ A;  2D9Y A;  5KCV A;  2QKL A;  2YF0 A;  3D8D A;  5HE1 A;  1XKE A;  4F7U P;  2NZ8 B;  3SNH A;  2W2X C;  1Z87 A;  3AJ4 A;  1M7E A;  3U7D A;  4GN1 A;  1KZG A;  2P0F A;  3D8E A;  4ZRJ A;  5D3W A;  5JHG A;  2Y7B A;  3A98 B;  1UPR A;  3X23 A;  2ELA A;  2KUP A;  1FHX A;  5J3Q A;  1DBH A;  5JLJ B;  4PNK A;  1ZSQ A;  2L2I A;  1J19 A;  3TCA A;  1UNQ A;  5LON B;  4HDQ A;  5DIF B;  2I1K A;  3NSU A;  1EAZ A;  1OMW A;  2CAY A;  2G35 A;  2COA A;  5LOP B;  3ODX A;  5KQ1 A;  2COF A;  5J3T A;  1V89 A;  2CRF A;  5HE3 A;  1LB1 A;  5CLL B;  2COD A;  1U29 A;  1BTK A;  3A8Q A;  2HTH B;  2Y8G A;  3TW1 A;  1B55 A;  5FI1 A;  1UNR A;  1WJ1 A;  4CHM A;  2ZPY A;  3P7Z A;  4C0A A;  3SYX A;  3PEG A;  5DH9 B;  2VRW B;  4NY0 A;  4WJ7 A;  4K2P A;  5DHF B;  3V5W A;  1PFJ A;  1U5E A;  2UVM A;  2Y8F A;  2YT1 A;  4KAX B;  4EMO A;  4A6F A;  2QKM A;  1FHO A;  1V5P A;  1FGY A;  3BIN A;  1XD4 A;  2JP2 A;  2EMT A;  3HW2 B;  3WYF B;  1XX0 A;  1NU2 A;  2VSZ A;  3OAN A;  4GXB A;  1ZVR A;  3KZ1 A;  2D4Q A;  5HE2 A;  2CY4 A;  2W2X D;  1SGH A;  1FGZ A;  4K2O A;  3DXD A;  2RSG A;  2RVB B;  3ZDT A;  3U8Z A;  1BTN A;  5GOW B;  5JP4 A;  4NSW A;  1P3R A;  3PVU A;  1KZ7 A;  5C79 A;  2Z0Q A;  2UZR A;  2V76 A;  2K00 A;  2RNR B;  2HE7 A;  1DYN A;  4ZRK A;  1IRS A;  1U2B A;  3FEH A;  2OTX A;  3PP2 A;  3WA0 A;  1K5D B;  2DYN A;  3TVV A;  2J0M A;  3T06 A;  1Y5O A;  1N3H A;  2LG1 A;  2EMS A;  3PSC A;  1UNP A;  4Y94 A;  4HAX B;  3ULB A;  4F7G A;  5D3Y A;  1H10 A;  3D8F A;  3PVL A;  2COC A;  3KRX A;  3BJI A;  1XCG A;  3PG7 A;  2DX1 A;  3QWM A;  1LW3 A;  1XOD A;  2DYQ A;  3ML4 A;  4TYZ A;  2YT0 A;  5JHH A;  1WJM A;  3N7C A;  2M38 A;  2GCJ A;  4ZRI A;  3F0W A;  2FJL A;  3P6A A;  4YL8 A;  2DTC A;  2DKP A;  1ZC4 B;  4HAZ B;  1DDM A;  2ADZ A;  3GYO A;  1BAK A;  3QIJ A;  2D2Q A;  1FOE A;  5J3Y A;  4A6H A;  3DXE A;  1RRP B;  3RCP A;  1SHC A;  1U27 A;  1ZC3 B;  2XQN M;  3G9W A;  4HAU B;  1BWN A;  1W1H A;  5C5B B;  1FHW A;  4KHO A;  2DA0 A;  2J0J A;  2L1C A;  3FM8 C;  2PZ1 A;  3TFM A;  1M7R A;  2YS3 A;  1V5M A;  1W1D A;  3TO1 A;  1Y19 B;  2Z0O A;  1NI2 A;  1MIZ B;  4XWX A;  2W2W A;  1TQZ A;  3MPX A;  4YON A;  3SO6 A;  4CHJ A;  1U5G A;  5HE0 A;  3SV1 A;  3MDB C;  2GJY A;  3A8P A;  4TKN A;  2I5C A;  1NTV A;  1QQG A;  1NTY A;  1MPH A;  2D9V A;  3KSY A;  3ULC A;  4GMX B;  1WGQ A;  2YS1 A;  1AWE A;  1DRO A;  1P6S A;  2D10 A;  3VIA A;  1ZM0 A;  2LUL A;  2GS0 A;  2MKR A;  3CIK A;  1WGU A;  2E2X A;  4HAY B;  5D27 A;  2R09 A;  1E5W A;  4HDO A;  4MT7 A;  2LOX A;  2D9W A;  1DDV A;  1MIX A;  1DDW A;  4MY6 A;  3PVW A;  1MK9 B;  4IFS A;  1OQN A;  4EJN A;  1I7A A;  5L81 A;  2N0Y A;  1UEF A;  2DHJ A;  1AQC A;  5CLQ B;  2EC1 A;  4A5K A;  3ZVR A;  2GCL A;  1OY2 A;  3KY9 A;  1EVH A;  2H7D A;  2YS5 A;  3UZT A;  2YSZ A;  1Q67 A;  4HB4 B;  2YRY A;  3PZD A;  2DKQ A;  1KI1 B;  1FAO A;  2UZS A;  2P8V A;  1WI1 A;  3LJU X;  4DXA B;  2OQB A;  2I1J A;  1WVH A;  4HB3 B;  5FI0 A;  2VKI A;  3AU4 A;  1FB8 A;  2H7E A;  3SUZ A;  2J59 M;  2RUK B;  1WG7 A;  4DX9 0;  2EJ8 A;  2K2J A;  4HAW B;  4H8S A;  4F7H A;  4A6K A;  4DBB A;  4K81 A;  5D3X A;  2ROZ B;  4EKU A;  2ROV A;  1EGX A;  2I5F A;  2D11 A;  1TJ6 A;  2M14 A;  2D9X A;  1PMS A;  1X05 A;  2MFQ A;  3HK0 A;  2DFK A;  1MK7 B;  1MAI A;  1PLS A;  1GC6 A;  1GG3 A;  3FSS A;  1XR0 B;  5C5B A;  1J0W A;  3GYP A;  4HAV B;  2DN6 A;  4HB2 B;  4WSF A;  2LYD A;  1I2H A;  4Z2N A;  2DHI A;  4IOY X;  1U5D A;  2IYB A;  2R0D A;  3ODW A;  4BBK A;  4KVG B;  4K17 A;  1P5T A;  4HAT B;  2KGX B;  4CYE A;  2DHK A;  4HB0 B;  1V88 A;  1QC6 A;  5DI9 B;  1GC7 A;  2KCJ A;  5KQ4 A;  1ISN A;  4A6F B;  4KHA A;  5C16 A;  1MKE A;  2CY5 A;  1X1F A;  4GZU A;  2ELB A;  2DLW A;  1V5U A;  2Z0P A;  1TXD A;  3HQC A;  3CXB B;  1H4R A;  2D9Z A;  1EF1 A;  2K2U A;  4MK0 A;  2BCJ A;  3M1I B;  4DX8 A;  4GPT B;  2YVC A;  4Z2M B;  2NMB A;  2LKO A;  3DXC A;  4WVF B;  3AU5 A;  2IFS A;  2DX5 A;  3IVF A;  2AEH A;  3KRW A;  2N23 A;  2RLO A;  1W1G A;  3ODO A;  5C6R A;  3F5R A;  4GMV A;  4D0N B;  4B6H A;  2P0H A;  3QBV B;  5DHA B;  5EFX A;  1V61 A;  1X86 A;  1K5G B;  2RGN B;  1X1G A;  1X11 A;  2J0K A;  4KHB B;  4IAP A;  2P0D A;  3O96 A;  4PQ0 A;  2LOZ A;  2Q13 A;  5D3V A;  2X18 A;  2MWN B;  4HHV A; 
#chains in the Genus database with same CATH topology
 2AL6 A;  2GUM A;  1U5F A;  4L6E A;  4OT1 A;  3HIE A;  1UPQ A;  2MDX A;  1RJ2 A;  4P7I A;  3VOQ A;  2D9Y A;  5KCV A;  2QKL A;  2YF0 A;  3D8D A;  5HE1 A;  1XKE A;  4F7U P;  2NZ8 B;  3SNH A;  3NWA A;  2W2X C;  1Z87 A;  3AJ4 A;  1M7E A;  3U7D A;  4GN1 A;  1KZG A;  2P0F A;  3D8E A;  4ZRJ A;  5I2S A;  5D3W A;  5JHG A;  2Y7B A;  3A98 B;  2FJU B;  1MI1 A;  1UPR A;  3X23 A;  1ZYI A;  2ELA A;  2KUP A;  1FHX A;  5J3Q A;  1DBH A;  5JLJ B;  4PNK A;  1ZSQ A;  2L2I A;  1J19 A;  3TCA A;  1UNQ A;  5LON B;  4HDQ A;  5DIF B;  2I1K A;  3NSU A;  1EAZ A;  1OMW A;  2CAY A;  2G35 A;  2COA A;  5LOP B;  3ODX A;  5KQ1 A;  2COF A;  5J3T A;  1V89 A;  2CRF A;  5HE3 A;  1LB1 A;  5CLL B;  2COD A;  1U29 A;  1BTK A;  3A8Q A;  2HTH B;  2Y8G A;  3TW1 A;  1B55 A;  5FI1 A;  1UNR A;  1WJ1 A;  4CHM A;  2ZPY A;  3P7Z A;  4C0A A;  3SYX A;  3PEG A;  5DH9 B;  2VRW B;  4NY0 A;  2KR0 A;  4WJ7 A;  4K2P A;  5DHF B;  3V5W A;  1PFJ A;  1U5E A;  2UVM A;  2Y8F A;  2YT1 A;  4KAX B;  4EMO A;  4A6F A;  2QKM A;  1FHO A;  1V5P A;  1FGY A;  3BIN A;  1XD4 A;  2JP2 A;  2EMT A;  3HW2 B;  3WYF B;  1XX0 A;  1NU2 A;  2VSZ A;  3OAN A;  4GXB A;  1ZVR A;  2KIG A;  3KZ1 A;  4QJ4 B;  2D4Q A;  5HE2 A;  5I2M A;  2CY4 A;  2W2X D;  1SGH A;  1FGZ A;  4K2O A;  3DXD A;  2RSG A;  2RVB B;  3ZDT A;  3U8Z A;  1BTN A;  5GOW B;  5JP4 A;  4GNK B;  4NSW A;  1P3R A;  3PVU A;  5M4Y B;  1KZ7 A;  5C79 A;  4KHB A;  2Z0Q A;  2UZR A;  2V76 A;  2K00 A;  2RNR B;  2HE7 A;  1DYN A;  4ZRK A;  1IRS A;  3DCX A;  1U2B A;  3FEH A;  2OTX A;  3HSA A;  3PP2 A;  3WA0 A;  1K5D B;  2DYN A;  3TVV A;  2J0M A;  3T06 A;  1Y5O A;  3B77 A;  1N3H A;  2LG1 A;  2EMS A;  3PSC A;  1UNP A;  4Y94 A;  4HAX B;  3ULB A;  4F7G A;  5D3Y A;  1H10 A;  3D8F A;  3PVL A;  2COC A;  3KRX A;  3BJI A;  1XCG A;  3PG7 A;  2DX1 A;  3QWM A;  1LW3 A;  1XOD A;  2DYQ A;  3ML4 A;  4TYZ A;  2NBV A;  2YT0 A;  5JHH A;  1WJM A;  3N7C A;  2M38 A;  2GCJ A;  4ZRI A;  3F0W A;  2FJL A;  3P6A A;  4YL8 A;  2DTC A;  4QJ5 B;  2DKP A;  1ZC4 B;  4HAZ B;  1DDM A;  2ADZ A;  2K49 A;  3GYO A;  1BAK A;  3QIJ A;  3NWF A;  2D2Q A;  1FOE A;  5J3Y A;  4A6H A;  3DXE A;  1RRP B;  3RCP A;  4L1R A;  1SHC A;  1U27 A;  1ZC3 B;  2XQN M;  3G9W A;  4HAU B;  1BWN A;  1W1H A;  3A58 A;  5C5B B;  1FHW A;  4KHO A;  2DA0 A;  2J0J A;  2L1C A;  3FM8 C;  2PZ1 A;  3TFM A;  1M7R A;  2YS3 A;  1V5M A;  1W1D A;  3TO1 A;  1Y19 B;  5LG4 B;  2Z0O A;  1NI2 A;  1MIZ B;  4XWX A;  2W2W A;  1TQZ A;  3FVC A;  1T77 A;  3MPX A;  4YON A;  3SO6 A;  4CHJ A;  1U5G A;  5HE0 A;  3SV1 A;  3MDB C;  2GJY A;  3A8P A;  4GOU A;  4TKN A;  2I5C A;  1NTV A;  1QQG A;  1NTY A;  3U12 A;  1MPH A;  2D9V A;  3KSY A;  3ULC A;  4GMX B;  2Z4D A;  1WGQ A;  2YS1 A;  1AWE A;  1DRO A;  1P6S A;  2D10 A;  3VIA A;  1ZM0 A;  2LUL A;  4OSN A;  2GS0 A;  2MKR A;  3CIK A;  4DIX A;  1WGU A;  2E2X A;  4HAY B;  5D27 A;  2R09 A;  1E5W A;  3NW8 A;  4HDO A;  4MT7 A;  2LOX A;  2D9W A;  1DDV A;  1MIX A;  1DDW A;  4MY6 A;  3OHM B;  3PVW A;  1MK9 B;  4IFS A;  1OQN A;  4EJN A;  1I7A A;  5L81 A;  2K8E A;  2N0Y A;  1UEF A;  2DHJ A;  1AQC A;  5CLQ B;  2EC1 A;  4A5K A;  3ZVR A;  2GCL A;  1OY2 A;  3KY9 A;  1EVH A;  2H7D A;  2YS5 A;  3UZT A;  2YSZ A;  1Q67 A;  4HB4 B;  2YRY A;  3PZD A;  2DKQ A;  1KI1 B;  1FAO A;  2UZS A;  2P8V A;  1WI1 A;  3LJU X;  4DXA B;  2OQB A;  2I1J A;  1WVH A;  2KUQ A;  4HB3 B;  5FI0 A;  2Z59 A;  2VKI A;  3AU4 A;  1FB8 A;  2H7E A;  3SUZ A;  2J59 M;  2RUK B;  1WG7 A;  4DX9 0;  2EJ8 A;  2K2J A;  4HAW B;  4H8S A;  4F7H A;  4A6K A;  4DBB A;  4K81 A;  5D3X A;  2ROZ B;  4EKU A;  2ROV A;  1EGX A;  2I5F A;  2D11 A;  1TJ6 A;  2M14 A;  2D9X A;  1PMS A;  5IRS A;  1X05 A;  2MFQ A;  3HK0 A;  2DFK A;  1MK7 B;  1MAI A;  1PLS A;  1GC6 A;  1GG3 A;  3FSS A;  2RRF A;  1XR0 B;  5C5B A;  1J0W A;  3GYP A;  4HAV B;  2DN6 A;  4HB2 B;  4WSF A;  2LYD A;  4HSI A;  1I2H A;  4Z2N A;  2DHI A;  4IOY X;  1U5D A;  2IYB A;  2KIE A;  2R0D A;  3ODW A;  4BBK A;  4KVG B;  4K17 A;  1P5T A;  4HAT B;  2KGX B;  4CYE A;  2DHK A;  4HB0 B;  1V88 A;  1QC6 A;  5DI9 B;  1GC7 A;  2KCJ A;  5KQ4 A;  1ISN A;  2Z13 A;  2Z14 A;  4A6F B;  4KHA A;  5C16 A;  1MKE A;  2CY5 A;  1X1F A;  4GZU A;  2ELB A;  2DLW A;  1V5U A;  2Z0P A;  1TXD A;  3HQC A;  3CXB B;  1H4R A;  2D9Z A;  1EF1 A;  2K2U A;  4MK0 A;  2BCJ A;  3M1I B;  4DX8 A;  4GPT B;  4CSQ A;  3NWD A;  2YVC A;  2ZKM X;  4Z2M B;  2NMB A;  2YT2 A;  2LKO A;  3DXC A;  4WVF B;  3AU5 A;  2IFS A;  2DX5 A;  3IVF A;  4D6W A;  2AEH A;  2N23 A;  2RLO A;  3KRW A;  1W1G A;  3ODO A;  5C6R A;  3F5R A;  4GMV A;  4D0N B;  2R2Y A;  4B6H A;  2P0H A;  3QBV B;  5DHA B;  5EFX A;  1V61 A;  1X86 A;  1K5G B;  2RGN B;  1X1G A;  1X11 A;  2J0K A;  4KHB B;  4IAP A;  2P0D A;  3O96 A;  4PQ0 A;  2LOZ A;  4QXA B;  2Q13 A;  4QJ3 B;  5D3V A;  2X18 A;  2MWN B;  4HHV A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  1U5F A;  4L6E A;  1UPQ A;  2MDX A;  1RJ2 A;  4P7I A;  3VOQ A;  2D9Y A;  5KCV A;  2QKL A;  2YF0 A;  3D8D A;  5HE1 A;  1XKE A;  4F7U P;  2NZ8 B;  3SNH A;  2W2X C;  1Z87 A;  3AJ4 A;  1M7E A;  3U7D A;  4GN1 A;  1KZG A;  2P0F A;  3D8E A;  4ZRJ A;  5D3W A;  5JHG A;  2Y7B A;  3A98 B;  1UPR A;  3X23 A;  2ELA A;  2KUP A;  1FHX A;  5J3Q A;  1DBH A;  5JLJ B;  4PNK A;  1ZSQ A;  2L2I A;  1J19 A;  3TCA A;  1UNQ A;  5LON B;  4HDQ A;  5DIF B;  2I1K A;  3NSU A;  1EAZ A;  1OMW A;  2CAY A;  2G35 A;  2COA A;  5LOP B;  3ODX A;  5KQ1 A;  2COF A;  5J3T A;  1V89 A;  2CRF A;  5HE3 A;  1LB1 A;  5CLL B;  2COD A;  1U29 A;  1BTK A;  3A8Q A;  2HTH B;  2Y8G A;  3TW1 A;  1B55 A;  5FI1 A;  1UNR A;  1WJ1 A;  4CHM A;  2ZPY A;  3P7Z A;  4C0A A;  3SYX A;  3PEG A;  5DH9 B;  2VRW B;  4NY0 A;  4WJ7 A;  4K2P A;  5DHF B;  3V5W A;  1PFJ A;  1U5E A;  2UVM A;  2Y8F A;  2YT1 A;  4KAX B;  4EMO A;  4A6F A;  2QKM A;  1FHO A;  1V5P A;  1FGY A;  3BIN A;  1XD4 A;  2JP2 A;  2EMT A;  3HW2 B;  3WYF B;  1XX0 A;  1NU2 A;  2VSZ A;  3OAN A;  4GXB A;  1ZVR A;  3KZ1 A;  2D4Q A;  5HE2 A;  2CY4 A;  2W2X D;  1SGH A;  1FGZ A;  4K2O A;  3DXD A;  2RSG A;  2RVB B;  3ZDT A;  3U8Z A;  1BTN A;  5GOW B;  5JP4 A;  4NSW A;  1P3R A;  3PVU A;  1KZ7 A;  5C79 A;  2Z0Q A;  2UZR A;  2V76 A;  2K00 A;  2RNR B;  2HE7 A;  1DYN A;  4ZRK A;  1IRS A;  1U2B A;  3FEH A;  2OTX A;  3PP2 A;  3WA0 A;  1K5D B;  2DYN A;  3TVV A;  2J0M A;  3T06 A;  1Y5O A;  1N3H A;  2LG1 A;  2EMS A;  3PSC A;  1UNP A;  4Y94 A;  4HAX B;  3ULB A;  4F7G A;  5D3Y A;  1H10 A;  3D8F A;  3PVL A;  2COC A;  3KRX A;  3BJI A;  1XCG A;  3PG7 A;  2DX1 A;  3QWM A;  1LW3 A;  1XOD A;  2DYQ A;  3ML4 A;  4TYZ A;  2YT0 A;  5JHH A;  1WJM A;  3N7C A;  2M38 A;  2GCJ A;  4ZRI A;  3F0W A;  2FJL A;  3P6A A;  4YL8 A;  2DTC A;  2DKP A;  1ZC4 B;  4HAZ B;  1DDM A;  2ADZ A;  3GYO A;  1BAK A;  3QIJ A;  2D2Q A;  1FOE A;  5J3Y A;  4A6H A;  3DXE A;  1RRP B;  3RCP A;  1SHC A;  1U27 A;  1ZC3 B;  2XQN M;  3G9W A;  4HAU B;  1BWN A;  1W1H A;  5C5B B;  1FHW A;  4KHO A;  2DA0 A;  2J0J A;  2L1C A;  3FM8 C;  2PZ1 A;  3TFM A;  1M7R A;  2YS3 A;  1V5M A;  1W1D A;  3TO1 A;  1Y19 B;  2Z0O A;  1NI2 A;  1MIZ B;  4XWX A;  2W2W A;  1TQZ A;  3MPX A;  4YON A;  3SO6 A;  4CHJ A;  1U5G A;  5HE0 A;  3SV1 A;  3MDB C;  2GJY A;  3A8P A;  4TKN A;  2I5C A;  1NTV A;  1QQG A;  1NTY A;  1MPH A;  2D9V A;  3KSY A;  3ULC A;  4GMX B;  1WGQ A;  2YS1 A;  1AWE A;  1DRO A;  1P6S A;  2D10 A;  3VIA A;  1ZM0 A;  2LUL A;  2GS0 A;  2MKR A;  3CIK A;  1WGU A;  2E2X A;  4HAY B;  5D27 A;  2R09 A;  1E5W A;  4HDO A;  4MT7 A;  2LOX A;  2D9W A;  1DDV A;  1MIX A;  1DDW A;  4MY6 A;  3PVW A;  1MK9 B;  4IFS A;  1OQN A;  4EJN A;  1I7A A;  5L81 A;  2N0Y A;  1UEF A;  2DHJ A;  1AQC A;  5CLQ B;  2EC1 A;  4A5K A;  3ZVR A;  2GCL A;  1OY2 A;  3KY9 A;  1EVH A;  2H7D A;  2YS5 A;  3UZT A;  2YSZ A;  1Q67 A;  4HB4 B;  2YRY A;  3PZD A;  2DKQ A;  1KI1 B;  1FAO A;  2UZS A;  2P8V A;  1WI1 A;  3LJU X;  4DXA B;  2OQB A;  2I1J A;  1WVH A;  4HB3 B;  5FI0 A;  2VKI A;  3AU4 A;  1FB8 A;  2H7E A;  3SUZ A;  2J59 M;  2RUK B;  1WG7 A;  4DX9 0;  2EJ8 A;  2K2J A;  4HAW B;  4H8S A;  4F7H A;  4A6K A;  4DBB A;  4K81 A;  5D3X A;  2ROZ B;  4EKU A;  2ROV A;  1EGX A;  2I5F A;  2D11 A;  1TJ6 A;  2M14 A;  2D9X A;  1PMS A;  1X05 A;  2MFQ A;  3HK0 A;  2DFK A;  1MK7 B;  1MAI A;  1PLS A;  1GC6 A;  1GG3 A;  3FSS A;  1XR0 B;  5C5B A;  1J0W A;  3GYP A;  4HAV B;  2DN6 A;  4HB2 B;  4WSF A;  2LYD A;  1I2H A;  4Z2N A;  2DHI A;  4IOY X;  1U5D A;  2IYB A;  2R0D A;  3ODW A;  4BBK A;  4KVG B;  4K17 A;  1P5T A;  4HAT B;  2KGX B;  4CYE A;  2DHK A;  4HB0 B;  1V88 A;  1QC6 A;  5DI9 B;  1GC7 A;  2KCJ A;  5KQ4 A;  1ISN A;  4A6F B;  4KHA A;  5C16 A;  1MKE A;  2CY5 A;  1X1F A;  4GZU A;  2ELB A;  2DLW A;  1V5U A;  2Z0P A;  1TXD A;  3HQC A;  3CXB B;  1H4R A;  2D9Z A;  1EF1 A;  2K2U A;  4MK0 A;  2BCJ A;  3M1I B;  4DX8 A;  4GPT B;  2YVC A;  4Z2M B;  2NMB A;  2LKO A;  3DXC A;  4WVF B;  3AU5 A;  2IFS A;  2DX5 A;  3IVF A;  2AEH A;  3KRW A;  2N23 A;  2RLO A;  1W1G A;  3ODO A;  5C6R A;  3F5R A;  4GMV A;  4D0N B;  4B6H A;  2P0H A;  3QBV B;  5DHA B;  5EFX A;  1V61 A;  1X86 A;  1K5G B;  2RGN B;  1X1G A;  1X11 A;  2J0K A;  4KHB B;  4IAP A;  2P0D A;  3O96 A;  4PQ0 A;  2LOZ A;  2Q13 A;  5D3V A;  2X18 A;  2MWN B;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...