1W1GA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 40
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1gA00
5D3XA 3V5WA 2LG1A 4GPTB 5C6RA 3CIKA 1U29A 4K17A 2CAYA 1ZM0A 4WVFB 2D2QA 3DXCA 1U27A 5D27A 2DX1A 4EMOA 2I5CA 3SYXA 1XX0A 1EAZA 3KRXA 1QQGA 2EC1A 3GYPA 3P7ZA 4PNKA 2J59M 3P6AA 4WJ7A 3TFMA 2K2JA 4PQ0A 2COCA 1FHWA 3PVLA 4HB3B 4A6FB 2LOZA 1FGYA 3U7DA 1DDMA 2P0FA 5DH9B 2PZ1A 5CLQB 1WI1A 1ZSQA 4GXBA 3AJ4A 3TCAA 5LOPB 3AU5A 3O96A 2GJYA 5HE3A 2J0JA 2IYBA 1FGZA 4ZRJA 5J3TA 1ZC4B 2P0DA 1UPQA 3QBVB 4HAXB 1K5DB 3ODWA 1W1HA 3QWMA 3N7CA 1Q67A 2DYNA 3FEHA 2G35A 1AWEA 3KZ1A 2IFSA 1P3RA 1NU2A 4Z2NA 4A6HA 1TJ6A 2COFA 5EFXA 4KVGB 1ISNA 1DDWA 1X86A 2Y8FA 1LW3A 2D10A 1EF1A 1KZ7A 1XR0B 3KRWA 2YT0A 3MPXA 2Y8GA 3PZDA 1KI1B 2YS5A 4B6HA 4KHOA 3CXBB 4YL8A 3PG7A 4KAXB 4DBBA 5JHHA 2DLWA 4GZUA 4HB0B 1W1GA 2CY4A 5L81A 4A6KA 2RLOA 1PFJA 3HQCA 1WVHA 2I5FA 2LOXA 5JLJB 1EVHA 3GYOA 2YS1A 3TO1A 1BTNA 1BWNA 2GCLA 3TVVA 3D8DA 2DN6A 3IVFA 1EGXA 1MPHA 2AL6A 1UNQA 2DKPA 2L1CA 3FSSA 5C79A 2CODA 1FHXA 5HE1A 4F7HA 5J3QA 4HAYB 2Q13A 2Z0QA 1U2BA 2UVMA 2YSZA 1GC6A 2M14A 4IAPA 1K5GB 2V76A 4KHBB 2MKRA 4DX8A 1XODA 1ZVRA 2Z0OA 1WGQA 2MFQA 4IOYX 1U5EA 3LJUX 1TQZA 3D8EA 2I1JA 4K81A 4ZRIA 1Y19B 2JP2A 3BJIA 2EJ8A 3X23A 2RUKB 3VIAA 3F0WA 1MIZB 2K2UA 1H10A 3T06A 3PP2A 4IFSA 2D9XA 3PSCA 3ZDTA 1PMSA 2J0KA 2YT1A 2D9WA 3FM8C 4NY0A 2ELBA 3A8PA 4NSWA 5KCVA 2D9YA 4GN1A 1V88A 4MY6A 5D3WA 1M7RA 1UNPA 1NI2A 5C5BA 4HAUB 2RSGA 3ODOA 2CRFA 3WYFB 3OANA 3RCPA 5GOWB 3HW2B 3AU4A 1MK9B 2GCJA 3PEGA 2N0YA 3F5RA 3WA0A 1I2HA 1NTVA 3DXDA 2P8VA 1BAKA 1MK7B 2KCJA 3A98B 2W2XD 1BTKA 1GG3A 1B55A 2OQBA 4HB4B 2HTHB 1V5UA 2COAA 4A6FA 2K00A 2Y7BA 4HDQA 4A5KA 2ADZA 2RGNB 4ZRKA 2VRWB 4KHAA 2D4QA 4CYEA 4BBKA 2DHIA 5KQ1A 1P5TA 1Z87A 2OTXA 2ZPYA 2I1KA 2YVCA 1U5FA 1I7AA 2Z0PA 2LULA 2ELAA 2DKQA 1UEFA 4H8SA 1Y5OA 1RJ2A 1J19A 4K2PA 5CLLB 3U8ZA 1MKEA 4WSFA 4HB2B 3A8QA 3G9WA 1UNRA 5D3VA 3HK0A 4Z2MB 3SNHA 5DHFB 3SUZA 2LYDA 1FHOA 2MDXA 4MT7A 4L6EA 1V61A 4MK0A 2CY5A 2DA0A 3QIJA 1WG7A 3TW1A 2EMSA 4Y94A 1QC6A 3D8FA 2DX5A 2DFKA 2ROZB 2YS3A 5DHAB 1OQNA 5HE2A 2AEHA 2RVBB 3ML4A 2FJLA 4TYZA 2R0DA 2XQNM 2H7DA 1LB1A 2VKIA 2EMTA 4XWXA 4YONA 1KZGA 4HDOA 4DXAB 3SV1A 3NSUA 2UZSA 4GMVA 2X18A 5LONB 4HHVA 2L2IA 5C5BB 1NTYA 1MAIA 1MIXA 2W2XC 2YRYA 3ODXA 2RNRB 3M1IB 2BCJA 4HAWB 1X05A 1WJMA 1ZC3B 4K2OA 5JHGA 1FAOA 1V5PA 1U5DA 5C16A 4EKUA 1IRSA 5FI0A 1V89A 2QKLA 2YF0A 2LKOA 3ULBA 2D11A 1V5MA 4D0NB 1SHCA 1OY2A 3ZVRA 2NZ8B 4P7IA 1DDVA 1P6SA 4C0AA 4GMXB 4HATB 2DHKA 4EJNA 3ULCA 1M7EA 1DBHA 5J3YA 2DHJA 2D9VA 3KSYA 4HAZB 2GS0A 5DIFB 1H4RA 2D9ZA 3MDBC 3BINA 1X1GA 1X11A 4CHMA 1FB8A 1N3HA 2DYQA 3PVUA 1FOEA 3VOQA 4TKNA 3PVWA 1AQCA 1XCGA 5HE0A 2P0HA 3SO6A 5KQ4A 1RRPB 2N23A 1W1DA 2E2XA 4HAVB 2H7EA 1OMWA 1E5WA 2QKMA 4F7UP 1SGHA 5DI9B 1WGUA 3UZTA 1GC7A 2UZRA 5D3YA 1XD4A 3DXEA 5JP4A 1UPRA 2M38A 2VSZA 2R09A 1TXDA 2DTCA 2MWNB 1U5GA 1J0WA 2KUPA 2HE7A 5FI1A 4DX90 3KY9A 4CHJA 1DYNA 2KGXB 1X1FA 2W2WA 2NMBA 1DROA 1WJ1A 2J0MA 1PLSA 1XKEA 4F7GA 2ROVA
chains in the Genus database with same CATH superfamily
5D3XA 3V5WA 2LG1A 4QJ5B 4GPTB 4DIXA 5C6RA 4QJ3B 3CIKA 1U29A 4K17A 2CAYA 2KIEA 1ZM0A 4WVFB 2D2QA 3DXCA 1U27A 5D27A 2DX1A 4EMOA 2I5CA 3SYXA 1XX0A 1EAZA 3KRXA 1QQGA 2EC1A 3GYPA 3P7ZA 4PNKA 2J59M 3P6AA 4WJ7A 3TFMA 2K2JA 4PQ0A 2COCA 1FHWA 3PVLA 4HB3B 4A6FB 2LOZA 1FGYA 3U7DA 1DDMA 2P0FA 5DH9B 2PZ1A 5CLQB 1WI1A 1ZSQA 4GXBA 3AJ4A 3NW8A 3TCAA 5LOPB 3AU5A 3O96A 2GJYA 5HE3A 2YT2A 2J0JA 2IYBA 1FGZA 4ZRJA 5J3TA 1ZC4B 2P0DA 1UPQA 3QBVB 4HAXB 1K5DB 3ODWA 1W1HA 3QWMA 3N7CA 1Q67A 2DYNA 3FEHA 2G35A 1AWEA 3KZ1A 2IFSA 1P3RA 1NU2A 4Z2NA 4A6HA 1TJ6A 2COFA 5EFXA 4KVGB 1ISNA 1DDWA 1X86A 2Y8FA 1LW3A 2D10A 1EF1A 1KZ7A 1XR0B 3KRWA 3NWAA 2YT0A 3MPXA 2Y8GA 3PZDA 1KI1B 2YS5A 4B6HA 4KHOA 3CXBB 4YL8A 4CSQA 3PG7A 4KAXB 4DBBA 5JHHA 2DLWA 4GZUA 4HB0B 1W1GA 2CY4A 5L81A 4A6KA 1MI1A 2RLOA 1PFJA 3HQCA 1WVHA 2I5FA 2LOXA 5JLJB 1EVHA 3GYOA 2YS1A 5I2MA 3TO1A 1BTNA 4KHBA 1BWNA 2GCLA 3TVVA 3D8DA 2DN6A 3IVFA 1EGXA 1MPHA 2AL6A 2Z14A 1UNQA 2DKPA 2L1CA 3FSSA 5C79A 2CODA 1FHXA 5HE1A 4F7HA 5J3QA 4HAYB 2Q13A 2Z0QA 1U2BA 2UVMA 2YSZA 1GC6A 2M14A 4IAPA 1K5GB 2V76A 4KHBB 2MKRA 3HIEA 4DX8A 1XODA 1ZVRA 2Z0OA 2K8EA 1WGQA 2MFQA 3LJUX 1U5EA 4IOYX 1TQZA 3D8EA 2I1JA 4K81A 2Z13A 4ZRIA 1Y19B 2JP2A 3BJIA 4D6WA 2EJ8A 3X23A 2KIGA 2RUKB 3VIAA 3F0WA 1MIZB 2FJUB 2K2UA 1H10A 3T06A 3PP2A 4IFSA 2D9XA 3PSCA 4GOUA 3ZDTA 3HSAA 1PMSA 2J0KA 4HSIA 2YT1A 2D9WA 3FM8C 2RRFA 4NY0A 2ELBA 3A8PA 4NSWA 5KCVA 2D9YA 4GN1A 1V88A 4MY6A 5D3WA 1M7RA 1UNPA 1NI2A 5C5BA 4HAUB 2RSGA 3ODOA 2CRFA 3WYFB 3OANA 3RCPA 5GOWB 3HW2B 3AU4A 1MK9B 2GCJA 3PEGA 2N0YA 3F5RA 3WA0A 1I2HA 1NTVA 3DXDA 2P8VA 1BAKA 1MK7B 2KCJA 3A98B 5LG4B 2W2XD 1BTKA 1GG3A 1B55A 3DCXA 2OQBA 4HB4B 2HTHB 1V5UA 2COAA 4A6FA 2K00A 2Y7BA 4HDQA 4A5KA 2ADZA 2RGNB 4ZRKA 2VRWB 5IRSA 4KHAA 2NBVA 2D4QA 4CYEA 4BBKA 2DHIA 5KQ1A 1P5TA 1Z87A 2OTXA 2ZPYA 2I1KA 2GUMA 2YVCA 1U5FA 1I7AA 4OT1A 2Z0PA 2LULA 2ELAA 3A58A 2DKQA 1UEFA 4H8SA 1Y5OA 3OHMB 1RJ2A 1J19A 4K2PA 5CLLB 3U8ZA 1MKEA 4WSFA 4HB2B 3A8QA 3G9WA 1UNRA 2R2YA 5D3VA 3HK0A 4Z2MB 3SNHA 5DHFB 3SUZA 4OSNA 2LYDA 5M4YB 1FHOA 2MDXA 4MT7A 2Z4DA 2ZKMX 4L6EA 1V61A 4MK0A 2CY5A 2DA0A 3QIJA 3NWDA 1WG7A 3TW1A 2EMSA 4Y94A 1QC6A 3D8FA 2DX5A 2DFKA 2ROZB 1ZYIA 2YS3A 5DHAB 1OQNA 5HE2A 4QJ4B 2AEHA 2RVBB 3ML4A 2FJLA 2K49A 4TYZA 2R0DA 2XQNM 2H7DA 1LB1A 2VKIA 2EMTA 4XWXA 4YONA 1KZGA 4HDOA 4DXAB 1T77A 3SV1A 3NSUA 2UZSA 4GMVA 2X18A 5LONB 4HHVA 2L2IA 5C5BB 1NTYA 4L1RA 1MAIA 1MIXA 2W2XC 2YRYA 3ODXA 2RNRB 3M1IB 2BCJA 4HAWB 1X05A 1WJMA 1ZC3B 4K2OA 5JHGA 1FAOA 1V5PA 1U5DA 5C16A 4EKUA 1IRSA 5FI0A 1V89A 2QKLA 2YF0A 2LKOA 3ULBA 2D11A 1V5MA 4D0NB 1SHCA 1OY2A 4QXAB 3ZVRA 2NZ8B 4P7IA 1DDVA 1P6SA 4C0AA 4GMXB 4HATB 3U12A 2DHKA 4EJNA 2KR0A 3ULCA 1M7EA 1DBHA 5J3YA 2DHJA 2D9VA 3KSYA 4HAZB 2GS0A 5DIFB 1H4RA 2D9ZA 3MDBC 3BINA 1X1GA 1X11A 4CHMA 1FB8A 1N3HA 2DYQA 3PVUA 1FOEA 3VOQA 2Z59A 4TKNA 3PVWA 1AQCA 1XCGA 5HE0A 2P0HA 3SO6A 5KQ4A 1RRPB 2N23A 1W1DA 2E2XA 4HAVB 2KUQA 4GNKB 2H7EA 1OMWA 1E5WA 2QKMA 4F7UP 1SGHA 5DI9B 1WGUA 3UZTA 3B77A 1GC7A 2UZRA 5D3YA 1XD4A 3DXEA 5JP4A 1UPRA 2M38A 2VSZA 2R09A 1TXDA 2DTCA 2MWNB 1U5GA 1J0WA 2KUPA 2HE7A 5FI1A 4DX90 3KY9A 4CHJA 1DYNA 2KGXB 1X1FA 2W2WA 2NMBA 1DROA 3FVCA 1WJ1A 3NWFA 2J0MA 5I2SA 1PLSA 1XKEA 4F7GA 2ROVA
chains in the Genus database with same CATH topology
5D3XA 3V5WA 2LG1A 4GPTB 5C6RA 3CIKA 1U29A 4K17A 2CAYA 1ZM0A 4WVFB 2D2QA 3DXCA 1U27A 5D27A 2DX1A 4EMOA 2I5CA 3SYXA 1XX0A 1EAZA 3KRXA 1QQGA 2EC1A 3GYPA 3P7ZA 4PNKA 2J59M 3P6AA 4WJ7A 3TFMA 2K2JA 4PQ0A 2COCA 1FHWA 3PVLA 4HB3B 4A6FB 2LOZA 1FGYA 3U7DA 1DDMA 2P0FA 5DH9B 2PZ1A 5CLQB 1WI1A 1ZSQA 4GXBA 3AJ4A 3TCAA 5LOPB 3AU5A 3O96A 2GJYA 5HE3A 2J0JA 2IYBA 1FGZA 4ZRJA 5J3TA 1ZC4B 2P0DA 1UPQA 3QBVB 4HAXB 1K5DB 3ODWA 1W1HA 3QWMA 3N7CA 1Q67A 2DYNA 3FEHA 2G35A 1AWEA 3KZ1A 2IFSA 1P3RA 1NU2A 4Z2NA 4A6HA 1TJ6A 2COFA 5EFXA 4KVGB 1ISNA 1DDWA 1X86A 2Y8FA 1LW3A 2D10A 1EF1A 1KZ7A 1XR0B 3KRWA 2YT0A 3MPXA 2Y8GA 3PZDA 1KI1B 2YS5A 4B6HA 4KHOA 3CXBB 4YL8A 3PG7A 4KAXB 4DBBA 5JHHA 2DLWA 4GZUA 4HB0B 1W1GA 2CY4A 5L81A 4A6KA 2RLOA 1PFJA 3HQCA 1WVHA 2I5FA 2LOXA 5JLJB 1EVHA 3GYOA 2YS1A 3TO1A 1BTNA 1BWNA 2GCLA 3TVVA 3D8DA 2DN6A 3IVFA 1EGXA 1MPHA 2AL6A 1UNQA 2DKPA 2L1CA 3FSSA 5C79A 2CODA 1FHXA 5HE1A 4F7HA 5J3QA 4HAYB 2Q13A 2Z0QA 1U2BA 2UVMA 2YSZA 1GC6A 2M14A 4IAPA 1K5GB 2V76A 4KHBB 2MKRA 4DX8A 1XODA 1ZVRA 2Z0OA 1WGQA 2MFQA 4IOYX 1U5EA 3LJUX 1TQZA 3D8EA 2I1JA 4K81A 4ZRIA 1Y19B 2JP2A 3BJIA 2EJ8A 3X23A 2RUKB 3VIAA 3F0WA 1MIZB 2K2UA 1H10A 3T06A 3PP2A 4IFSA 2D9XA 3PSCA 3ZDTA 1PMSA 2J0KA 2YT1A 2D9WA 3FM8C 4NY0A 2ELBA 3A8PA 4NSWA 5KCVA 2D9YA 4GN1A 1V88A 4MY6A 5D3WA 1M7RA 1UNPA 1NI2A 5C5BA 4HAUB 2RSGA 3ODOA 2CRFA 3WYFB 3OANA 3RCPA 5GOWB 3HW2B 3AU4A 1MK9B 2GCJA 3PEGA 2N0YA 3F5RA 3WA0A 1I2HA 1NTVA 3DXDA 2P8VA 1BAKA 1MK7B 2KCJA 3A98B 2W2XD 1BTKA 1GG3A 1B55A 2OQBA 4HB4B 2HTHB 1V5UA 2COAA 4A6FA 2K00A 2Y7BA 4HDQA 4A5KA 2ADZA 2RGNB 4ZRKA 2VRWB 4KHAA 2D4QA 4CYEA 4BBKA 2DHIA 5KQ1A 1P5TA 1Z87A 2OTXA 2ZPYA 2I1KA 2YVCA 1U5FA 1I7AA 2Z0PA 2LULA 2ELAA 2DKQA 1UEFA 4H8SA 1Y5OA 1RJ2A 1J19A 4K2PA 5CLLB 3U8ZA 1MKEA 4WSFA 4HB2B 3A8QA 3G9WA 1UNRA 5D3VA 3HK0A 4Z2MB 3SNHA 5DHFB 3SUZA 2LYDA 1FHOA 2MDXA 4MT7A 4L6EA 1V61A 4MK0A 2CY5A 2DA0A 3QIJA 1WG7A 3TW1A 2EMSA 4Y94A 1QC6A 3D8FA 2DX5A 2DFKA 2ROZB 2YS3A 5DHAB 1OQNA 5HE2A 2AEHA 2RVBB 3ML4A 2FJLA 4TYZA 2R0DA 2XQNM 2H7DA 1LB1A 2VKIA 2EMTA 4XWXA 4YONA 1KZGA 4HDOA 4DXAB 3SV1A 3NSUA 2UZSA 4GMVA 2X18A 5LONB 4HHVA 2L2IA 5C5BB 1NTYA 1MAIA 1MIXA 2W2XC 2YRYA 3ODXA 2RNRB 3M1IB 2BCJA 4HAWB 1X05A 1WJMA 1ZC3B 4K2OA 5JHGA 1FAOA 1V5PA 1U5DA 5C16A 4EKUA 1IRSA 5FI0A 1V89A 2QKLA 2YF0A 2LKOA 3ULBA 2D11A 1V5MA 4D0NB 1SHCA 1OY2A 3ZVRA 2NZ8B 4P7IA 1DDVA 1P6SA 4C0AA 4GMXB 4HATB 2DHKA 4EJNA 3ULCA 1M7EA 1DBHA 5J3YA 2DHJA 2D9VA 3KSYA 4HAZB 2GS0A 5DIFB 1H4RA 2D9ZA 3MDBC 3BINA 1X1GA 1X11A 4CHMA 1FB8A 1N3HA 2DYQA 3PVUA 1FOEA 3VOQA 4TKNA 3PVWA 1AQCA 1XCGA 5HE0A 2P0HA 3SO6A 5KQ4A 1RRPB 2N23A 1W1DA 2E2XA 4HAVB 2H7EA 1OMWA 1E5WA 2QKMA 4F7UP 1SGHA 5DI9B 1WGUA 3UZTA 1GC7A 2UZRA 5D3YA 1XD4A 3DXEA 5JP4A 1UPRA 2M38A 2VSZA 2R09A 1TXDA 2DTCA 2MWNB 1U5GA 1J0WA 2KUPA 2HE7A 5FI1A 4DX90 3KY9A 4CHJA 1DYNA 2KGXB 1X1FA 2W2WA 2NMBA 1DROA 1WJ1A 2J0MA 1PLSA 1XKEA 4F7GA 2ROVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3X A;  3V5W A;  2LG1 A;  4GPT B;  5C6R A;  3CIK A;  1U29 A;  4K17 A;  2CAY A;  1ZM0 A;  4WVF B;  2D2Q A;  3DXC A;  1U27 A;  5D27 A;  2DX1 A;  4EMO A;  2I5C A;  3SYX A;  1XX0 A;  1EAZ A;  3KRX A;  1QQG A;  2EC1 A;  3GYP A;  3P7Z A;  4PNK A;  2J59 M;  3P6A A;  4WJ7 A;  3TFM A;  2K2J A;  4PQ0 A;  2COC A;  1FHW A;  3PVL A;  4HB3 B;  4A6F B;  2LOZ A;  1FGY A;  3U7D A;  1DDM A;  2P0F A;  5DH9 B;  2PZ1 A;  5CLQ B;  1WI1 A;  1ZSQ A;  4GXB A;  3AJ4 A;  3TCA A;  5LOP B;  3AU5 A;  3O96 A;  2GJY A;  5HE3 A;  2J0J A;  2IYB A;  1FGZ A;  4ZRJ A;  5J3T A;  1ZC4 B;  2P0D A;  1UPQ A;  3QBV B;  4HAX B;  1K5D B;  3ODW A;  1W1H A;  3QWM A;  3N7C A;  1Q67 A;  2DYN A;  3FEH A;  2G35 A;  1AWE A;  3KZ1 A;  2IFS A;  1P3R A;  1NU2 A;  4Z2N A;  4A6H A;  1TJ6 A;  2COF A;  5EFX A;  4KVG B;  1ISN A;  1DDW A;  1X86 A;  2Y8F A;  1LW3 A;  2D10 A;  1EF1 A;  1KZ7 A;  1XR0 B;  3KRW A;  2YT0 A;  3MPX A;  2Y8G A;  3PZD A;  1KI1 B;  2YS5 A;  4B6H A;  4KHO A;  3CXB B;  4YL8 A;  3PG7 A;  4KAX B;  4DBB A;  5JHH A;  2DLW A;  4GZU A;  4HB0 B;  1W1G A;  2CY4 A;  5L81 A;  4A6K A;  2RLO A;  1PFJ A;  3HQC A;  1WVH A;  2I5F A;  2LOX A;  5JLJ B;  1EVH A;  3GYO A;  2YS1 A;  3TO1 A;  1BTN A;  1BWN A;  2GCL A;  3TVV A;  3D8D A;  2DN6 A;  3IVF A;  1EGX A;  1MPH A;  2AL6 A;  1UNQ A;  2DKP A;  2L1C A;  3FSS A;  5C79 A;  2COD A;  1FHX A;  5HE1 A;  4F7H A;  5J3Q A;  4HAY B;  2Q13 A;  2Z0Q A;  1U2B A;  2UVM A;  2YSZ A;  1GC6 A;  2M14 A;  4IAP A;  1K5G B;  2V76 A;  4KHB B;  2MKR A;  4DX8 A;  1XOD A;  1ZVR A;  2Z0O A;  1WGQ A;  2MFQ A;  4IOY X;  1U5E A;  3LJU X;  1TQZ A;  3D8E A;  2I1J A;  4K81 A;  4ZRI A;  1Y19 B;  2JP2 A;  3BJI A;  2EJ8 A;  3X23 A;  2RUK B;  3VIA A;  3F0W A;  1MIZ B;  2K2U A;  1H10 A;  3T06 A;  3PP2 A;  4IFS A;  2D9X A;  3PSC A;  3ZDT A;  1PMS A;  2J0K A;  2YT1 A;  2D9W A;  3FM8 C;  4NY0 A;  2ELB A;  3A8P A;  4NSW A;  5KCV A;  2D9Y A;  4GN1 A;  1V88 A;  4MY6 A;  5D3W A;  1M7R A;  1UNP A;  1NI2 A;  5C5B A;  4HAU B;  2RSG A;  3ODO A;  2CRF A;  3WYF B;  3OAN A;  3RCP A;  5GOW B;  3HW2 B;  3AU4 A;  1MK9 B;  2GCJ A;  3PEG A;  2N0Y A;  3F5R A;  3WA0 A;  1I2H A;  1NTV A;  3DXD A;  2P8V A;  1BAK A;  1MK7 B;  2KCJ A;  3A98 B;  2W2X D;  1BTK A;  1GG3 A;  1B55 A;  2OQB A;  4HB4 B;  2HTH B;  1V5U A;  2COA A;  4A6F A;  2K00 A;  2Y7B A;  4HDQ A;  4A5K A;  2ADZ A;  2RGN B;  4ZRK A;  2VRW B;  4KHA A;  2D4Q A;  4CYE A;  4BBK A;  2DHI A;  5KQ1 A;  1P5T A;  1Z87 A;  2OTX A;  2ZPY A;  2I1K A;  2YVC A;  1U5F A;  1I7A A;  2Z0P A;  2LUL A;  2ELA A;  2DKQ A;  1UEF A;  4H8S A;  1Y5O A;  1RJ2 A;  1J19 A;  4K2P A;  5CLL B;  3U8Z A;  1MKE A;  4WSF A;  4HB2 B;  3A8Q A;  3G9W A;  1UNR A;  5D3V A;  3HK0 A;  4Z2M B;  3SNH A;  5DHF B;  3SUZ A;  2LYD A;  1FHO A;  2MDX A;  4MT7 A;  4L6E A;  1V61 A;  4MK0 A;  2CY5 A;  2DA0 A;  3QIJ A;  1WG7 A;  3TW1 A;  2EMS A;  4Y94 A;  1QC6 A;  3D8F A;  2DX5 A;  2DFK A;  2ROZ B;  2YS3 A;  5DHA B;  1OQN A;  5HE2 A;  2AEH A;  2RVB B;  3ML4 A;  2FJL A;  4TYZ A;  2R0D A;  2XQN M;  2H7D A;  1LB1 A;  2VKI A;  2EMT A;  4XWX A;  4YON A;  1KZG A;  4HDO A;  4DXA B;  3SV1 A;  3NSU A;  2UZS A;  4GMV A;  2X18 A;  5LON B;  4HHV A;  2L2I A;  5C5B B;  1NTY A;  1MAI A;  1MIX A;  2W2X C;  2YRY A;  3ODX A;  2RNR B;  3M1I B;  2BCJ A;  4HAW B;  1X05 A;  1WJM A;  1ZC3 B;  4K2O A;  5JHG A;  1FAO A;  1V5P A;  1U5D A;  5C16 A;  4EKU A;  1IRS A;  5FI0 A;  1V89 A;  2QKL A;  2YF0 A;  2LKO A;  3ULB A;  2D11 A;  1V5M A;  4D0N B;  1SHC A;  1OY2 A;  3ZVR A;  2NZ8 B;  4P7I A;  1DDV A;  1P6S A;  4C0A A;  4GMX B;  4HAT B;  2DHK A;  4EJN A;  3ULC A;  1M7E A;  1DBH A;  5J3Y A;  2DHJ A;  2D9V A;  3KSY A;  4HAZ B;  2GS0 A;  5DIF B;  1H4R A;  2D9Z A;  3MDB C;  3BIN A;  1X1G A;  1X11 A;  4CHM A;  1FB8 A;  1N3H A;  2DYQ A;  3PVU A;  1FOE A;  3VOQ A;  4TKN A;  3PVW A;  1AQC A;  1XCG A;  5HE0 A;  2P0H A;  3SO6 A;  5KQ4 A;  1RRP B;  2N23 A;  1W1D A;  2E2X A;  4HAV B;  2H7E A;  1OMW A;  1E5W A;  2QKM A;  4F7U P;  1SGH A;  5DI9 B;  1WGU A;  3UZT A;  1GC7 A;  2UZR A;  5D3Y A;  1XD4 A;  3DXE A;  5JP4 A;  1UPR A;  2M38 A;  2VSZ A;  2R09 A;  1TXD A;  2DTC A;  2MWN B;  1U5G A;  1J0W A;  2KUP A;  2HE7 A;  5FI1 A;  4DX9 0;  3KY9 A;  4CHJ A;  1DYN A;  2KGX B;  1X1F A;  2W2W A;  2NMB A;  1DRO A;  1WJ1 A;  2J0M A;  1PLS A;  1XKE A;  4F7G A;  2ROV A; 
#chains in the Genus database with same CATH topology
 5D3X A;  3V5W A;  2LG1 A;  4QJ5 B;  4GPT B;  4DIX A;  5C6R A;  4QJ3 B;  3CIK A;  1U29 A;  4K17 A;  2CAY A;  2KIE A;  1ZM0 A;  4WVF B;  2D2Q A;  3DXC A;  1U27 A;  5D27 A;  2DX1 A;  4EMO A;  2I5C A;  3SYX A;  1XX0 A;  1EAZ A;  3KRX A;  1QQG A;  2EC1 A;  3GYP A;  3P7Z A;  4PNK A;  2J59 M;  3P6A A;  4WJ7 A;  3TFM A;  2K2J A;  4PQ0 A;  2COC A;  1FHW A;  3PVL A;  4HB3 B;  4A6F B;  2LOZ A;  1FGY A;  3U7D A;  1DDM A;  2P0F A;  5DH9 B;  2PZ1 A;  5CLQ B;  1WI1 A;  1ZSQ A;  4GXB A;  3AJ4 A;  3NW8 A;  3TCA A;  5LOP B;  3AU5 A;  3O96 A;  2GJY A;  5HE3 A;  2YT2 A;  2J0J A;  2IYB A;  1FGZ A;  4ZRJ A;  5J3T A;  1ZC4 B;  2P0D A;  1UPQ A;  3QBV B;  4HAX B;  1K5D B;  3ODW A;  1W1H A;  3QWM A;  3N7C A;  1Q67 A;  2DYN A;  3FEH A;  2G35 A;  1AWE A;  3KZ1 A;  2IFS A;  1P3R A;  1NU2 A;  4Z2N A;  4A6H A;  1TJ6 A;  2COF A;  5EFX A;  4KVG B;  1ISN A;  1DDW A;  1X86 A;  2Y8F A;  1LW3 A;  2D10 A;  1EF1 A;  1KZ7 A;  1XR0 B;  3KRW A;  3NWA A;  2YT0 A;  3MPX A;  2Y8G A;  3PZD A;  1KI1 B;  2YS5 A;  4B6H A;  4KHO A;  3CXB B;  4YL8 A;  4CSQ A;  3PG7 A;  4KAX B;  4DBB A;  5JHH A;  2DLW A;  4GZU A;  4HB0 B;  1W1G A;  2CY4 A;  5L81 A;  4A6K A;  1MI1 A;  2RLO A;  1PFJ A;  3HQC A;  1WVH A;  2I5F A;  2LOX A;  5JLJ B;  1EVH A;  3GYO A;  2YS1 A;  5I2M A;  3TO1 A;  1BTN A;  4KHB A;  1BWN A;  2GCL A;  3TVV A;  3D8D A;  2DN6 A;  3IVF A;  1EGX A;  1MPH A;  2AL6 A;  2Z14 A;  1UNQ A;  2DKP A;  2L1C A;  3FSS A;  5C79 A;  2COD A;  1FHX A;  5HE1 A;  4F7H A;  5J3Q A;  4HAY B;  2Q13 A;  2Z0Q A;  1U2B A;  2UVM A;  2YSZ A;  1GC6 A;  2M14 A;  4IAP A;  1K5G B;  2V76 A;  4KHB B;  2MKR A;  3HIE A;  4DX8 A;  1XOD A;  1ZVR A;  2Z0O A;  2K8E A;  1WGQ A;  2MFQ A;  3LJU X;  1U5E A;  4IOY X;  1TQZ A;  3D8E A;  2I1J A;  4K81 A;  2Z13 A;  4ZRI A;  1Y19 B;  2JP2 A;  3BJI A;  4D6W A;  2EJ8 A;  3X23 A;  2KIG A;  2RUK B;  3VIA A;  3F0W A;  1MIZ B;  2FJU B;  2K2U A;  1H10 A;  3T06 A;  3PP2 A;  4IFS A;  2D9X A;  3PSC A;  4GOU A;  3ZDT A;  3HSA A;  1PMS A;  2J0K A;  4HSI A;  2YT1 A;  2D9W A;  3FM8 C;  2RRF A;  4NY0 A;  2ELB A;  3A8P A;  4NSW A;  5KCV A;  2D9Y A;  4GN1 A;  1V88 A;  4MY6 A;  5D3W A;  1M7R A;  1UNP A;  1NI2 A;  5C5B A;  4HAU B;  2RSG A;  3ODO A;  2CRF A;  3WYF B;  3OAN A;  3RCP A;  5GOW B;  3HW2 B;  3AU4 A;  1MK9 B;  2GCJ A;  3PEG A;  2N0Y A;  3F5R A;  3WA0 A;  1I2H A;  1NTV A;  3DXD A;  2P8V A;  1BAK A;  1MK7 B;  2KCJ A;  3A98 B;  5LG4 B;  2W2X D;  1BTK A;  1GG3 A;  1B55 A;  3DCX A;  2OQB A;  4HB4 B;  2HTH B;  1V5U A;  2COA A;  4A6F A;  2K00 A;  2Y7B A;  4HDQ A;  4A5K A;  2ADZ A;  2RGN B;  4ZRK A;  2VRW B;  5IRS A;  4KHA A;  2NBV A;  2D4Q A;  4CYE A;  4BBK A;  2DHI A;  5KQ1 A;  1P5T A;  1Z87 A;  2OTX A;  2ZPY A;  2I1K A;  2GUM A;  2YVC A;  1U5F A;  1I7A A;  4OT1 A;  2Z0P A;  2LUL A;  2ELA A;  3A58 A;  2DKQ A;  1UEF A;  4H8S A;  1Y5O A;  3OHM B;  1RJ2 A;  1J19 A;  4K2P A;  5CLL B;  3U8Z A;  1MKE A;  4WSF A;  4HB2 B;  3A8Q A;  3G9W A;  1UNR A;  2R2Y A;  5D3V A;  3HK0 A;  4Z2M B;  3SNH A;  5DHF B;  3SUZ A;  4OSN A;  2LYD A;  5M4Y B;  1FHO A;  2MDX A;  4MT7 A;  2Z4D A;  2ZKM X;  4L6E A;  1V61 A;  4MK0 A;  2CY5 A;  2DA0 A;  3QIJ A;  3NWD A;  1WG7 A;  3TW1 A;  2EMS A;  4Y94 A;  1QC6 A;  3D8F A;  2DX5 A;  2DFK A;  2ROZ B;  1ZYI A;  2YS3 A;  5DHA B;  1OQN A;  5HE2 A;  4QJ4 B;  2AEH A;  2RVB B;  3ML4 A;  2FJL A;  2K49 A;  4TYZ A;  2R0D A;  2XQN M;  2H7D A;  1LB1 A;  2VKI A;  2EMT A;  4XWX A;  4YON A;  1KZG A;  4HDO A;  4DXA B;  1T77 A;  3SV1 A;  3NSU A;  2UZS A;  4GMV A;  2X18 A;  5LON B;  4HHV A;  2L2I A;  5C5B B;  1NTY A;  4L1R A;  1MAI A;  1MIX A;  2W2X C;  2YRY A;  3ODX A;  2RNR B;  3M1I B;  2BCJ A;  4HAW B;  1X05 A;  1WJM A;  1ZC3 B;  4K2O A;  5JHG A;  1FAO A;  1V5P A;  1U5D A;  5C16 A;  4EKU A;  1IRS A;  5FI0 A;  1V89 A;  2QKL A;  2YF0 A;  2LKO A;  3ULB A;  2D11 A;  1V5M A;  4D0N B;  1SHC A;  1OY2 A;  4QXA B;  3ZVR A;  2NZ8 B;  4P7I A;  1DDV A;  1P6S A;  4C0A A;  4GMX B;  4HAT B;  3U12 A;  2DHK A;  4EJN A;  2KR0 A;  3ULC A;  1M7E A;  1DBH A;  5J3Y A;  2DHJ A;  2D9V A;  3KSY A;  4HAZ B;  2GS0 A;  5DIF B;  1H4R A;  2D9Z A;  3MDB C;  3BIN A;  1X1G A;  1X11 A;  4CHM A;  1FB8 A;  1N3H A;  2DYQ A;  3PVU A;  1FOE A;  3VOQ A;  2Z59 A;  4TKN A;  3PVW A;  1AQC A;  1XCG A;  5HE0 A;  2P0H A;  3SO6 A;  5KQ4 A;  1RRP B;  2N23 A;  1W1D A;  2E2X A;  4HAV B;  2KUQ A;  4GNK B;  2H7E A;  1OMW A;  1E5W A;  2QKM A;  4F7U P;  1SGH A;  5DI9 B;  1WGU A;  3UZT A;  3B77 A;  1GC7 A;  2UZR A;  5D3Y A;  1XD4 A;  3DXE A;  5JP4 A;  1UPR A;  2M38 A;  2VSZ A;  2R09 A;  1TXD A;  2DTC A;  2MWN B;  1U5G A;  1J0W A;  2KUP A;  2HE7 A;  5FI1 A;  4DX9 0;  3KY9 A;  4CHJ A;  1DYN A;  2KGX B;  1X1F A;  2W2W A;  2NMB A;  1DRO A;  3FVC A;  1WJ1 A;  3NWF A;  2J0M A;  5I2S A;  1PLS A;  1XKE A;  4F7G A;  2ROV A; 
#chains in the Genus database with same CATH homology
 5D3X A;  3V5W A;  2LG1 A;  4GPT B;  5C6R A;  3CIK A;  1U29 A;  4K17 A;  2CAY A;  1ZM0 A;  4WVF B;  2D2Q A;  3DXC A;  1U27 A;  5D27 A;  2DX1 A;  4EMO A;  2I5C A;  3SYX A;  1XX0 A;  1EAZ A;  3KRX A;  1QQG A;  2EC1 A;  3GYP A;  3P7Z A;  4PNK A;  2J59 M;  3P6A A;  4WJ7 A;  3TFM A;  2K2J A;  4PQ0 A;  2COC A;  1FHW A;  3PVL A;  4HB3 B;  4A6F B;  2LOZ A;  1FGY A;  3U7D A;  1DDM A;  2P0F A;  5DH9 B;  2PZ1 A;  5CLQ B;  1WI1 A;  1ZSQ A;  4GXB A;  3AJ4 A;  3TCA A;  5LOP B;  3AU5 A;  3O96 A;  2GJY A;  5HE3 A;  2J0J A;  2IYB A;  1FGZ A;  4ZRJ A;  5J3T A;  1ZC4 B;  2P0D A;  1UPQ A;  3QBV B;  4HAX B;  1K5D B;  3ODW A;  1W1H A;  3QWM A;  3N7C A;  1Q67 A;  2DYN A;  3FEH A;  2G35 A;  1AWE A;  3KZ1 A;  2IFS A;  1P3R A;  1NU2 A;  4Z2N A;  4A6H A;  1TJ6 A;  2COF A;  5EFX A;  4KVG B;  1ISN A;  1DDW A;  1X86 A;  2Y8F A;  1LW3 A;  2D10 A;  1EF1 A;  1KZ7 A;  1XR0 B;  3KRW A;  2YT0 A;  3MPX A;  2Y8G A;  3PZD A;  1KI1 B;  2YS5 A;  4B6H A;  4KHO A;  3CXB B;  4YL8 A;  3PG7 A;  4KAX B;  4DBB A;  5JHH A;  2DLW A;  4GZU A;  4HB0 B;  1W1G A;  2CY4 A;  5L81 A;  4A6K A;  2RLO A;  1PFJ A;  3HQC A;  1WVH A;  2I5F A;  2LOX A;  5JLJ B;  1EVH A;  3GYO A;  2YS1 A;  3TO1 A;  1BTN A;  1BWN A;  2GCL A;  3TVV A;  3D8D A;  2DN6 A;  3IVF A;  1EGX A;  1MPH A;  2AL6 A;  1UNQ A;  2DKP A;  2L1C A;  3FSS A;  5C79 A;  2COD A;  1FHX A;  5HE1 A;  4F7H A;  5J3Q A;  4HAY B;  2Q13 A;  2Z0Q A;  1U2B A;  2UVM A;  2YSZ A;  1GC6 A;  2M14 A;  4IAP A;  1K5G B;  2V76 A;  4KHB B;  2MKR A;  4DX8 A;  1XOD A;  1ZVR A;  2Z0O A;  1WGQ A;  2MFQ A;  4IOY X;  1U5E A;  3LJU X;  1TQZ A;  3D8E A;  2I1J A;  4K81 A;  4ZRI A;  1Y19 B;  2JP2 A;  3BJI A;  2EJ8 A;  3X23 A;  2RUK B;  3VIA A;  3F0W A;  1MIZ B;  2K2U A;  1H10 A;  3T06 A;  3PP2 A;  4IFS A;  2D9X A;  3PSC A;  3ZDT A;  1PMS A;  2J0K A;  2YT1 A;  2D9W A;  3FM8 C;  4NY0 A;  2ELB A;  3A8P A;  4NSW A;  5KCV A;  2D9Y A;  4GN1 A;  1V88 A;  4MY6 A;  5D3W A;  1M7R A;  1UNP A;  1NI2 A;  5C5B A;  4HAU B;  2RSG A;  3ODO A;  2CRF A;  3WYF B;  3OAN A;  3RCP A;  5GOW B;  3HW2 B;  3AU4 A;  1MK9 B;  2GCJ A;  3PEG A;  2N0Y A;  3F5R A;  3WA0 A;  1I2H A;  1NTV A;  3DXD A;  2P8V A;  1BAK A;  1MK7 B;  2KCJ A;  3A98 B;  2W2X D;  1BTK A;  1GG3 A;  1B55 A;  2OQB A;  4HB4 B;  2HTH B;  1V5U A;  2COA A;  4A6F A;  2K00 A;  2Y7B A;  4HDQ A;  4A5K A;  2ADZ A;  2RGN B;  4ZRK A;  2VRW B;  4KHA A;  2D4Q A;  4CYE A;  4BBK A;  2DHI A;  5KQ1 A;  1P5T A;  1Z87 A;  2OTX A;  2ZPY A;  2I1K A;  2YVC A;  1U5F A;  1I7A A;  2Z0P A;  2LUL A;  2ELA A;  2DKQ A;  1UEF A;  4H8S A;  1Y5O A;  1RJ2 A;  1J19 A;  4K2P A;  5CLL B;  3U8Z A;  1MKE A;  4WSF A;  4HB2 B;  3A8Q A;  3G9W A;  1UNR A;  5D3V A;  3HK0 A;  4Z2M B;  3SNH A;  5DHF B;  3SUZ A;  2LYD A;  1FHO A;  2MDX A;  4MT7 A;  4L6E A;  1V61 A;  4MK0 A;  2CY5 A;  2DA0 A;  3QIJ A;  1WG7 A;  3TW1 A;  2EMS A;  4Y94 A;  1QC6 A;  3D8F A;  2DX5 A;  2DFK A;  2ROZ B;  2YS3 A;  5DHA B;  1OQN A;  5HE2 A;  2AEH A;  2RVB B;  3ML4 A;  2FJL A;  4TYZ A;  2R0D A;  2XQN M;  2H7D A;  1LB1 A;  2VKI A;  2EMT A;  4XWX A;  4YON A;  1KZG A;  4HDO A;  4DXA B;  3SV1 A;  3NSU A;  2UZS A;  4GMV A;  2X18 A;  5LON B;  4HHV A;  2L2I A;  5C5B B;  1NTY A;  1MAI A;  1MIX A;  2W2X C;  2YRY A;  3ODX A;  2RNR B;  3M1I B;  2BCJ A;  4HAW B;  1X05 A;  1WJM A;  1ZC3 B;  4K2O A;  5JHG A;  1FAO A;  1V5P A;  1U5D A;  5C16 A;  4EKU A;  1IRS A;  5FI0 A;  1V89 A;  2QKL A;  2YF0 A;  2LKO A;  3ULB A;  2D11 A;  1V5M A;  4D0N B;  1SHC A;  1OY2 A;  3ZVR A;  2NZ8 B;  4P7I A;  1DDV A;  1P6S A;  4C0A A;  4GMX B;  4HAT B;  2DHK A;  4EJN A;  3ULC A;  1M7E A;  1DBH A;  5J3Y A;  2DHJ A;  2D9V A;  3KSY A;  4HAZ B;  2GS0 A;  5DIF B;  1H4R A;  2D9Z A;  3MDB C;  3BIN A;  1X1G A;  1X11 A;  4CHM A;  1FB8 A;  1N3H A;  2DYQ A;  3PVU A;  1FOE A;  3VOQ A;  4TKN A;  3PVW A;  1AQC A;  1XCG A;  5HE0 A;  2P0H A;  3SO6 A;  5KQ4 A;  1RRP B;  2N23 A;  1W1D A;  2E2X A;  4HAV B;  2H7E A;  1OMW A;  1E5W A;  2QKM A;  4F7U P;  1SGH A;  5DI9 B;  1WGU A;  3UZT A;  1GC7 A;  2UZR A;  5D3Y A;  1XD4 A;  3DXE A;  5JP4 A;  1UPR A;  2M38 A;  2VSZ A;  2R09 A;  1TXD A;  2DTC A;  2MWN B;  1U5G A;  1J0W A;  2KUP A;  2HE7 A;  5FI1 A;  4DX9 0;  3KY9 A;  4CHJ A;  1DYN A;  2KGX B;  1X1F A;  2W2W A;  2NMB A;  1DRO A;  1WJ1 A;  2J0M A;  1PLS A;  1XKE A;  4F7G A;  2ROV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...